GOS 1384010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092351624788
Annotathon code: GOS_1384010
Sample :
  • GPS :1°23'21n; 91°49'1w
  • Galapagos Islands: Wolf Island - Ecuador
  • Coastal (-1.7m, 21.8°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : gruta1
Annotated on : 2010-07-11 15:27:45
  • a36797 FernandoAlbertoLemosRodrigues
  • a36804 MargaridaIsabelAlvesGuerreiro
  • a37964 LurdesCristinaSardinhaGranadeiro

Synopsis

  • Taxonomy: Candidatus Pelagibacter (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198251
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1092351624788 GOS_1384010 Genomic DNA
TCCTTTTGGACACGCACTAGTGCAATTTAAAATTGTATGACATCTATAAAGTTTTAATTCATCAGCTACTTTTTTTAATCTAGCCTCTTTTTCTTCATCC
CTACTATCTACAATCCATCTATAAGCTTGCAATAATACAGCTGGACCTAAATATTTGTCTCCATTCCACCAATAACTTGGGCAAGATGTTGAGCAACATG
CACACATAATACATTCGTACGCACCATCTAATTTTGCCCGCTCTTTTTTAGATTGGATAATTTCATTAGTTTCAGAATTTGAGTTTGATTTAAGCCAAGG
CTCGATTGATTGATATTGTTTATATAAACCATCCAAATCTCCAATTAAATCTTTTTTAACCTTTAAATGTGGTAATGGATAAATATCGATATTGCCATCA
ATCTCGGCATGTGGGGTTGTACAAGCCAAACCATTTTTACCACCCATGTTCATAGCACAAGAACCACAAACCCCGTGTGCACATGATCTCCTATATGCAA
TTGTAGGATCTATTTCGTTCTTAATTTTATTTAAAACATCTAAAACTTTAGAAGAGCAATTATCCATATCAACTTCATAGGTATCAATTCTAGGATTTTC
TTCTGTTGATGGATCCCATCTATAAATATTTACTTTTTTTAAATTTTTTGAACCAGTTTTATCCTTAAAATATTTACCTTTTTGAACTTGAGAGTTTTCA
GGTAAATTAATCTGAACCATTAATATACTCTTTCTTGAGGTGGAAAATATTGAACTTCATTTGTAAGTGTCGATTTATGAACTTCTCTATAGCTTATTTT
TGTATTTTTTCCATCACACCAAGCAAGTGTATGTTGCATAAATTTTTCATCATCTCTTTTCGGATAATCTTCCCTAGCGTGTGCGCCTCTACTTTCTTTT
CTG

Translation

[184 - 903/903]   indirect strand
>GOS_1384010 Translation [184-903   indirect strand]
MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVLDVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLAC
TTPHAEIDGNIDIYPLPHLKVKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAY
RWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

After all the analisys of our metagenomic sequence we conclude that it is a coding sequence, since it has several ORFs, and have a considerable leght (240aa) which increases the possibility of our ORF being coding.


In protein domains we have obtained E-values very significant, and a possible function for our protein, based on other domains of other proteins, that lead us to conclude that our protein may be an succinate dehydrogenase and fumarate reductase iron sulfur protein, with oxireductase activity in the tricarboxylic acid cicle,because the E-value of this family was the lowest one (_1.9e-66), and the most significant which means that the possibility to found a domain equal to ours is very low.

So on the GO terms: We put on Biologic Process catabolic process molecular function and on molecular function catalytic activity.



(1)The protein doesn't contains any signal peptide, so is not a secretory protein.


(1)B.Jannick, N.Henrik , H.Gunnar and B.Søren, (2004), "Improved prediction of signal peptides: SignalP 3.0,J. Mol. Biol.", 340:783-795 .


In blastp, we have search for homologs, the E-value obtained for the same protein is 6e-130, and produces a maximum score of 468 Bits (the first protein) and we also obtained E-values very significants for all of our proteins in Blastp (are all above of 7e-28) and the most of them are a succinate and dehydrogenase and fumarate reductase.


With the blastp we get the lineage report wich show us the most likely organism wich encodes our protein, in other words the metagenomic sequence wich was given to us may contain succinate dehydrogenase iron-sulfur protein, belonging to C.Pelagibacter sp. since it produces a score of 468 and an E-value of 1.9e-130, being the most significant result.


After the analisys of multiple sequence alignment we have concluded that most of sequences have conserved regions, presenting similarities between them and our polypeptide chain, so they may have the same function but in diferent organisms, that happens because they have diverged from a common ancestor a long time ago.

After the modifications, the codon start (met) has been in the the first position of polinucleotidic chain, and the carboxyl terminal was incomplete (doesn't have a codon wich encodes a stop codon *).


The both tree give us a better perspective about the closest species to our, uses methods of distance. C.Pelagibacter is the most similar specie to our. In the pyML method the root wich separates our protein and the C.Pelagibacter sp. is 0,98, and in BioNJ the same value for the root is 1, it simply means that the probability of that clade being there is maximum. The several Rickettsias that appears are more distant.


The Order was the most embracing taxon that we found so we can conclude tha our ORF is from the Rickettsiales order.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


In the result of the metagenomics sequence choosed, we obtained four ORF's, then the coding. Two on the forward strand, one in reading frame 2, other in reading frame 3, and the other two on reverse strand one in reading frame 1 and the other in reading frame 2.


The one that we have chose is the largest one, when the ORF has got more than 150aa the probability of containing function is bigger, and it contains a start codon (met), but wich is not the first codon in the translation.


Our ORF has lack of stop codon in the end of the sequece and don't has any stop codon in the middle of sequence. The ORF is contained in the reading frame 1, on the reverse strand.


We have run a BLASTx to search for biological function of additional ORF's,using metagenomics sequence, and we have found homologs, with a e-value very significant *discussed on results analysis of BLAST*.

RAW RESULTS

a) Forward strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 383 to base 580.
ATATCGATATTGCCATCAATCTCGGCATGTGGGGTTGTACAAGCCAAACCATTTTTACCA
CCCATGTTCATAGCACAAGAACCACAAACCCCGTGTGCACATGATCTCCTATATGCAATT
GTAGGATCTATTTCGTTCTTAATTTTATTTAAAACATCTAAAACTTTAGAAGAGCAATTA
TCCATATCAACTTCATAG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
ISILPSISACGVVQAKPFLPPMFIAQEPQTPCAHDLLYAIVGSISFLILFKTSKTLEEQL
SISTS*

>ORF number 1 in reading frame 3 on the direct strand extends from base 711 to base 902.
TCTGAACCATTAATATACTCTTTCTTGAGGTGGAAAATATTGAACTTCATTTGTAAGTGT
CGATTTATGAACTTCTCTATAGCTTATTTTTGTATTTTTTCCATCACACCAAGCAAGTGT
ATGTTGCATAAATTTTTCATCATCTCTTTTCGGATAATCTTCCCTAGCGTGTGCGCCTCT
ACTTTCTTTTCT

>Translation of ORF number 1 in reading frame 3 on the direct strand.
SEPLIYSFLRWKILNFICKCRFMNFSIAYFCIFSITPSKCMLHKFFIISFRIIFPSVCAS
TFFS
 
b)Reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 148 to base 903.
AGTTCAATATTTTCCACCTCAAGAAAGAGTATATTAATGGTTCAGATTAATTTACCTGAA
AACTCTCAAGTTCAAAAAGGTAAATATTTTAAGGATAAAACTGGTTCAAAAAATTTAAAA
AAAGTAAATATTTATAGATGGGATCCATCAACAGAAGAAAATCCTAGAATTGATACCTAT
GAAGTTGATATGGATAATTGCTCTTCTAAAGTTTTAGATGTTTTAAATAAAATTAAGAAC
GAAATAGATCCTACAATTGCATATAGGAGATCATGTGCACACGGGGTTTGTGGTTCTTGT
GCTATGAACATGGGTGGTAAAAATGGTTTGGCTTGTACAACCCCACATGCCGAGATTGAT
GGCAATATCGATATTTATCCATTACCACATTTAAAGGTTAAAAAAGATTTAATTGGAGAT
TTGGATGGTTTATATAAACAATATCAATCAATCGAGCCTTGGCTTAAATCAAACTCAAAT
TCTGAAACTAATGAAATTATCCAATCTAAAAAAGAGCGGGCAAAATTAGATGGTGCGTAC
GAATGTATTATGTGTGCATGTTGCTCAACATCTTGCCCAAGTTATTGGTGGAATGGAGAC
AAATATTTAGGTCCAGCTGTATTATTGCAAGCTTATAGATGGATTGTAGATAGTAGGGAT
GAAGAAAAAGAGGCTAGATTAAAAAAAGTAGCTGATGAATTAAAACTTTATAGATGTCAT
ACAATTTTAAATTGCACTAGTGCGTGTCCAAAAGGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SSIFSTSRKSILMVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTY
EVDMDNCSSKVLDVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEID
GNIDIYPLPHLKVKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAY
ECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCH
TILNCTSACPKG

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 184.
AGAAAAGAAAGTAGAGGCGCACACGCTAGGGAAGATTATCCGAAAAGAGATGATGAAAAA
TTTATGCAACATACACTTGCTTGGTGTGATGGAAAAAATACAAAAATAAGCTATAGAGAA
GTTCATAAATCGACACTTACAAATGAAGTTCAATATTTTCCACCTCAAGAAAGAGTATAT
TAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
RKESRGAHAREDYPKRDDEKFMQHTLAWCDGKNTKISYREVHKSTLTNEVQYFPPQERVY
*

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

Gblocks 0.91b


RESULTS ANALYSIS


The multiple alignment allow us identify (when the amino ends is not incomplete) the start codon, where methionine is the start codon. Our ORF doesn't start with a met codon then we look at the multiple alignment, and the first methionines who apeears is aligned with the other ones. So we believe that is the start methionine.


In the raw output we can see diferent and not repeated kind of species aligned to our ORF, indicating the possible organism that contains the protein encoded by our orf, the sequences aligned are almost all the same size, and there exist many conserved aminoacids.


The results are similar to domains, blast and taxonomy,wich present significant results showing a credible E-value(_2e-130) and score (_468) that our ORF encodes a protein, and contain protein domains of a Candidatus Pelagibacter. There is a high rate of conservation between C.P.sp. (candidatus pelagibacter sp.) and GOS_1384010.19 (our ORF) in the multiple alignment. Wich reinforces the ideia showed above.



Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 23
Alignment assumed to be: Protein
New number of positions: 170 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Limnobactersp.M  ----------------------------------MSEKRIVRFEIYRYDPDTGEAPKMQK
BpertussisToham  ----------------------------------MSTKRIVKFEIYRYDPDKDERPYMQK
gproteobacteriu  ------------MAQFKLPANSIM-TKGKVWKAPEGAKNTKKFEIYRFDPDSGKNPRTDT
AlichiiMLHE-1_O  ------------MAEFKLPANSVV-GEGKTWKAESGG-NVRQFKIYRWDPDAGQNPRLDT
XfastidiosaTeme  ------------MAEFTLPKNSKI-GKGTHFPAKSGTKNARTFKVYRWNPDDDANPRTDT
EArkansas_IN     ------------MVQFFLPKNSKVNKNGKVHHARKGAKNVKCFKIYRWSPDDDENPRIDT
WfasciatusPel_I  ------------------------------------------------------------
Wcautella_IN     ------------MVQFSLPKNSKVNKKGKVYPTPTGAKNIRRFQIYRWSADDDKNPRIDT
Rbellii_RML369-  ------------MAELRLPPNSVV-KKGKEHKAKGDVSNLRKIKIYRYDPDLDENPTIDS
RMadridE_IN      ------------MVELRLPSNSVV-KKGREHKAQQKMLKPRKVKVYRYDPDLDENPTIDS
Raprowazekii_IN  ------------MVELRLPSNSVV-KKGREHKAQQKMLKPRKVKVYRYDPDLDENPTIDS
RHartford_IN     ------------MAELRLPPNSVV-KKGKEYKEQEEMFKPRKVKIYRYDPDLDENPTIDS
RfelisURRWXCal2  ------------MAELRLPPNSVV-KKGKEHKEQEEMLKPRKVKIYRYDPDLDENPTIDS
Rendosymbiont_o  ------------MAELRLPPNSVV-KKGREHKENEEMLKPRKIKIYRYDPDLDENPTIDS
Rrickettsii_str  ------------MAELRLPPNSVV-KKGREHKEQEEMLKPRKIKIYRYDPDLDKNPTIDS
RmassiliaeMTU5   ------------MAELRLPPNSVV-KKGREHKEQEEMLKPKKIKIYRYDPDLDENPTIDS
Rsibirica_246_I  ------------MAELRLPPNSVV-KKGREHKEQEEMLKPRKIKIYRYDPDLDKNPTIDS
Rconorii_str._M  ------------MAELRLPPNSVV-KKGREHKEQEEMLKPRKIKIYRYDPDLDKNPTIDS
aproteobacteriu  ------------MVQFNLPKNSKI-KKGNYFKSVSESKNIKKVNVYRWNPDKDANPRVDT
CPelagibacter_u  ------------MVQINLPKNSEV-QKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDT
CPelagibacterub  ------------MVQINLPKNSEV-QKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDT
GOS_1384010.19   SSIFSTSRKSILMVQINLPENSQV-QKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDT
CPelagibactersp  ------------MVQINLPKNSEV-IKGKYYQDKTGSKNIRKVNVYRWDPSTEENPRIDT
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Limnobactersp.M  LEVELEPTDKMLLDALMRIKSDVDESIAYRRSCREGVCGSDAMNINGKNGLACITNLRDL
BpertussisToham  LEVELQPTDKMLLDALVRIKNDVDDSLALRRSCREGVCGSDAMNINGKNGLACTTNLLEL
gproteobacteriu  YEVDLDTCGPMVLDALLKIKNEMDPTLTLRRSCREGICGSCAMNIDGTNTLACTKAIEDV
AlichiiMLHE-1_O  YEVDLDNCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGTNTLACTKAIDEV
XfastidiosaTeme  YEIDLDTCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKAISAC
EArkansas_IN     FFIDLDECGQMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNIDGTNTLACTKAISDI
WfasciatusPel_I  ----------------------IDSTLTFRRSCREGICGSCAMNIDGTNTLACTKSIHDI
Wcautella_IN     FFIDMDNCGPMVLDALIKIKDEIDSTLTFRRSCREGICGSCAMNIDGTNTLACTKSIHDI
Rbellii_RML369-  FEIDLSKTGPMVLDALIKIKNEIDSTVTFRRSCREGICGSCAMNIDGTNTLACIKPIEEI
RMadridE_IN      FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
Raprowazekii_IN  FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
RHartford_IN     FEIDLSKTGPMVLDALIKIKNEIDSTLAFRRSCREGICGSCSMNIDGTNTLACIKPIEDI
RfelisURRWXCal2  FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCSMNIDGTNTLACIKPIEEI
Rendosymbiont_o  FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
Rrickettsii_str  FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
RmassiliaeMTU5   FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
Rsibirica_246_I  FEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
Rconorii_str._M  FEIDLSKTGPMILDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDI
aproteobacteriu  YEVDMDNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGSNTLACTKSAREI
CPelagibacter_u  YEVDMDNCPSKVLDILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEI
CPelagibacterub  YEVDMDNCPSKVLDILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEI
GOS_1384010.19   YEVDMDNCSSKVLDVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEI
CPelagibactersp  YEVDMDNCPSKVLDILNKIKNEIDPTLAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEI
                                       ######################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Limnobactersp.M  K-QPIVLKPLPGLPVVRDLIVDMTQFFKQYHSIKPYLVNETPPPEK-ERLQSPEEREELD
BpertussisToham  K-EPIVLKPLPGLPVIRDLIVDMTHFFNQYHSIRPYLINDTPPPEK-ERLQSPEAREELD
gproteobacteriu  K-GTVKIYPLPHMPVVKDLVPDLTNFYAQLRSVDPFLKTKSQAPTR-ERLQTEADRAQLD
AlichiiMLHE-1_O  R-GDVKIYPLPHMSVVKDLVPDMTHFYAQYASIKPWMRTQTPAPPDQERLQSKEDRAKLD
XfastidiosaTeme  TISEIPIYPLPHMNVIKDLIPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPVDRKKLD
EArkansas_IN     K-SDVNIYPLPHMHVIKDLVPDLSNFYKQYESVTPWIQAEEPNHNK-ERLQTIEDRSKLD
WfasciatusPel_I  K-GEVKIYPLPHMYIVKDLVPDLSQFYEQYKSIKPWLQTDKSALQNKEYFQSPEDRKKLD
Wcautella_IN     K-GEVKIYPLPHMYIVKDLVPDLSQFYEQYKSIKPWLQTDKSALQNKEYFQSPEDRKKLD
Rbellii_RML369-  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPAPSNAERLQSIKDREKLD
RMadridE_IN      S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKNDSPAPSNSERLQSIKDREKLD
Raprowazekii_IN  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKNDSPAPSNSERLQSIKDREKLD
RHartford_IN     S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSHTPSNSERLQSIKDREKLD
RfelisURRWXCal2  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKGREKLD
Rendosymbiont_o  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDREKLD
Rrickettsii_str  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPIPSNSERLQSIKDREKLD
RmassiliaeMTU5   S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDREKLD
Rsibirica_246_I  S-GDIRIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDREKLD
Rconorii_str._M  S-GDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDREKLD
aproteobacteriu  K-GEININPLPHMPVIKDLVPNLKQLYKQYQSVEPWMQSNKSSNGS-EGLQTIEDRSKLD
CPelagibacter_u  E-GDINIYPLPHLKVKKDLIGDLSGLYKQYESIEPWLKTNTKVETT-EILQTKEDRVKLD
CPelagibacterub  E-GDINIYPLPHLKVKKDLIGDLSGLYKQYESIEPWLKTNTKVETT-EILQTKEDRVKLD
GOS_1384010.19   D-GNIDIYPLPHLKVKKDLIGDLDGLYKQYQSIEPWLKSNSNSETN-EIIQSKKERAKLD
CPelagibactersp  D-GDIDIYPLPHLKVKRDLIGDLDGLYKQYQSIEPWLKNNSTKDTT-EIFQSKEERAKLD
                   ############################################ #############


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Limnobactersp.M  GLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFIADSRDQSTGERLDNLEDPYRLF
BpertussisToham  GLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFIADSRDEATGARLDNLEDPYRLF
gproteobacteriu  GLYECILCACCSTSCPSYWWNGDRYLGPAVLMQAYRWIIDSRDEATGERLDALEDPFKLY
AlichiiMLHE-1_O  GLYECILCACCSTSCPSYWWNSDRYLGPAILLQAYRWIVDSRDEATGERLDELEDPFKLY
XfastidiosaTeme  GLYECILCACCSTSCPSYWWNGDRYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLY
EArkansas_IN     GIYDCILCACCSTSCPSYWWNSDKYLGPAALLQAYRWLIDSRDEASDSRLDVLDDAFKLY
WfasciatusPel_I  GLSDCILCACCSTGCPSYWWNGDKFLGPAILLQAYRWIADSRDNKKEERLASLNDPFKLY
Wcautella_IN     GLSDCILCACCSTGCPSYWWNGDKFLGPAILLQAYRWIADSRDNKKEERLASLNDPFKLY
Rbellii_RML369-  GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDHTGERLEALEDPFKLY
RMadridE_IN      GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGARLEALEDPFKLY
Raprowazekii_IN  GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGARLEALEDPFKLY
RHartford_IN     GLYECILCACCSTSCPSYWWNSDKYLGPAILLQAYRWIADSRDDNTCERLEALEDPFKLY
RfelisURRWXCal2  GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDHTGERLEDLEDPSKLY
Rendosymbiont_o  GLYECILCACCSTSCPSYWWNGDKYLGPMILLQAYRWIADSRDDHNGERLEALEDPFKLY
Rrickettsii_str  GVYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDPFKLY
RmassiliaeMTU5   GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDPFKLY
Rsibirica_246_I  GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEDLEDPFKLY
Rconorii_str._M  GLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDPFKLY
aproteobacteriu  GLYECILCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIIDSRDEERQKRLKKVADELKLF
CPelagibacter_u  GAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLY
CPelagibacterub  GAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLY
GOS_1384010.19   GAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLY
CPelagibactersp  GAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIIDSRDEERKARLKKVADELKLY
                 ############################################################


                        250       260       270
                 =========+=========+=========+=====
Limnobactersp.M  RCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV-
BpertussisToham  RCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV-
gproteobacteriu  RCHTIMNCAKTCPKGLNPARAIAEIKKMLMERKY-
AlichiiMLHE-1_O  RCHTIMNCAKTCPKGLNPGKAIAEIKKMLVMRR--
XfastidiosaTeme  RCHTIMNCTRTCPKGLNPAQAIAEIKKLMMLRRA-
EArkansas_IN     RCHTIMNCTKTCPKGLNPAKAIAHIKQMMVRR---
WfasciatusPel_I  RCHTIMNCTKTCPKGLNPAKAIAKVKQLMVEREGI
Wcautella_IN     RCHTIMNCTKTCPKGLNPAKAIAKVKQLMVEREGI
Rbellii_RML369-  RCHTIMNCTKTCPKGLNPAKAISEIKGLIAERHGV
RMadridE_IN      RCHTIMNCTKTCPKGLNPAKAIGRVKNLIAERHGV
Raprowazekii_IN  RCHTIMNCTKTCPKGLNPAKAIGRVKNLIAERHGV
RHartford_IN     RCHTIMNCTKTCPKSLNPAKAIGKIKNLIAERRGV
RfelisURRWXCal2  RCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGV
Rendosymbiont_o  RCHTIMNCTKTCPKGLNPAKVIGKIKSLIAERHGV
Rrickettsii_str  RCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHSV
RmassiliaeMTU5   RCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGV
Rsibirica_246_I  RCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGL
Rconorii_str._M  RCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGL
aproteobacteriu  RCHTIMNCTNACPKGLNPAKAIGSIKKMLVTEKSA
CPelagibacter_u  RCHTIMNCTNACPKGLNPAKAIAELKKMLATS---
CPelagibacterub  RCHTIMNCTNACPKGLNPAKAIAELKKMLATN---
GOS_1384010.19   RCHTILNCTSACPKG--------------------
CPelagibactersp  RCHTILNCTSACPKGLNPAKAIAEIKKMIATANV-
                 ###############                    






Parameters used
Minimum Number Of Sequences For A Conserved Position: 12
Minimum Number Of Sequences For A Flanking Position: 20
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 3 selected block(s)
Flanks: [83  120]  [123  166]  [168  255]  

New number of positions in input.fasta-gb:  170  (61% of the original 275 positions)





Protein Domains

PROTOCOL


InterPro, default parameters at EBI


RESULTS ANALYSIS


After the analysis of proteins domains, we believe that the function of the protein is enzymatic. This ORF seems to have a domain similar to those found in family succinate dehydrogenase and fumarate reductase iron sulfur protein (at interpro: IPR004489). That presents a significant E-value (1.9e-66) and seems to contain another domains, (IPR001041) Ferredoxin, (IPR006058) 2Fe-2S ferredoxin, iron-sulphur binding site and (IPR012285) Fumarate reductase, C-terminal.

Presents a participation in a tricarboxylic acid cycle) and oxidation reduction with a oxidoreductase activity.

Participate in am enzymatic interconversion:succinate + FAD+ _ fumarate + FADH2, the reverse and forward reaction are catalyzed by complex fumarate reductase (anaerobic respiration) and succinate dehydrogenase (aerobic respiration).(1)


(1)Interpro (IPR004489 Succ_DH/fum_Rdtase_Fe-S)


Another domain presented, which may be similar to our protein, is fumarate reductase, with an E-value of 1.4e-37. Contains (IPR017900) 4Fe-4S ferredoxin, iron-sulphur binding, conserved site has got an oxidoreductase activity and iron-sulfur cluster binding, which is an iron sulphur active site and doesn't seems to participates in a specific biological process.Participates in the catalyzes reduction fumarate to succinate. (2)


(2) - Interpro (IPR012285 Fum_reductase_C)


Another possible domain for our ORF is the 2Fe-2S Ferrodoxin, with an e-value of 3.3e-30,contains (IPR000283) NADH:ubiquinone oxidoreductase, 75kDa subunit, conserved site; (IPR006058) 2Fe-2S ferredoxin, iron-sulphur binding site; (IPR018298) Adrenodoxin, iron-sulphur binding site; (IPR019574) NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur binding. Presents her self as electron carrier activity, and iron-sulphur cluster binding, and is envolved in a biological process of oxidation reduction. 2Fe-2S Ferredoxin are a family of proteins that act in very metabolic reactions. Is founded in aminoacids and enzymes. (3)


(3) - Interpro (IPR001041 Ferredoxin)


Some other domains that we obtained do not present any molecular or biological function diferent, or don't present at all. Graphically only one domain is presented, the Family succinate dehydrogenase and fumarate reductase iron sulphur protein, that encompasses the other domains represented above.

RAW RESULTS

GOS_1384010.19	A5EFD87A634FA2C7	252	Gene3D	G3DSA:3.10.20.30	no description	36	140	2.5e-30	T	02-May-2010	IPR012675	Beta-grasp fold, ferredoxin-type	
GOS_1384010.19	A5EFD87A634FA2C7	252	Gene3D	G3DSA:1.10.1060.10	no description	141	252	1.4e-37	T	02-May-2010	IPR012285	Fumarate reductase, C-terminal	Molecular Function: oxidoreductase activity (GO:0016491), Molecular Function: iron-sulfur cluster binding (GO:0051536)
GOS_1384010.19	A5EFD87A634FA2C7	252	HMMTigr	TIGR00384	dhsB: succinate dehydrogenase and fumarate	44	252	1.9e-66	T	02-May-2010	IPR004489	Succinate dehydrogenase/fumarate reductase iron-sulphur protein	Biological Process: tricarboxylic acid cycle (GO:0006099), Molecular Function: oxidoreductase activity (GO:0016491), Biological Process: oxidation reduction (GO:0055114)
GOS_1384010.19	A5EFD87A634FA2C7	252	HMMPanther	PTHR11921	SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN	53	252	6e-103	T	02-May-2010	NULL	NULL	
GOS_1384010.19	A5EFD87A634FA2C7	252	superfamily	SSF46548	alpha-helical ferredoxin	141	252	1.4e-45	T	02-May-2010	IPR009051	Alpha-helical ferredoxin	Molecular Function: oxidoreductase activity (GO:0016491), Molecular Function: iron-sulfur cluster binding (GO:0051536), Biological Process: oxidation reduction (GO:0055114)
GOS_1384010.19	A5EFD87A634FA2C7	252	superfamily	SSF54292	2Fe-2S ferredoxin-like	35	140	3.3e-30	T	02-May-2010	IPR001041	Ferredoxin	Molecular Function: electron carrier activity (GO:0009055), Molecular Function: iron-sulfur cluster binding (GO:0051536)
GOS_1384010.19	A5EFD87A634FA2C7	252	ProfileScan	PS51085	2FE2S_FER_2	40	131	9.197	T	02-May-2010	IPR001041	Ferredoxin	Molecular Function: electron carrier activity (GO:0009055), Molecular Function: iron-sulfur cluster binding (GO:0051536)
GOS_1384010.19	A5EFD87A634FA2C7	252	ProfileScan	PS51379	4FE4S_FER_2	172	202	7.912	T	02-May-2010	IPR017896	4Fe-4S ferredoxin, iron-sulpur binding domain	
GOS_1384010.19	A5EFD87A634FA2C7	252	PatternScan	PS00197	2FE2S_FER_1	92	100	NA	T	02-May-2010	IPR006058	2Fe-2S ferredoxin, iron-sulphur binding site	Molecular Function: electron carrier activity (GO:0009055)
GOS_1384010.19	A5EFD87A634FA2C7	252	PatternScan	PS00198	4FE4S_FER_1	182	193	NA	T	02-May-2010	IPR017900	4Fe-4S ferredoxin, iron-sulphur binding, conserved site	Molecular Function: electron carrier activity (GO:0009055), Molecular Function: iron-sulfur cluster binding (GO:0051536)
GOS_1384010.19	A5EFD87A634FA2C7	252	PatternScan	PS00518	ZF_RING_1	92	101	NA	?	02-May-2010	IPR017907	Zinc finger, RING-type, conserved site	

Phylogeny

PROTOCOL


a)Phylogeny.fr / PhyML method / out group_ b-proteobacteria, g-proteobacteria

b)Phylogeny.fr / BioNJ method / bootstrap _ 100/out group: b-proteobacteria, g-proteobacteria


RESULTS ANALYSIS


In both methods we had to reroot the tree, because there were outgroup sequences in the middle of ingroup sequences. Then we collapse the bootstrap,(having brach support smaller than 70%), because there were root values smaller than 0,7.


In PhyML the closest related to our ORF is CPelagibactersp (Candidatus Pelagibacter sp. HTCC7211) whose root is significant (equal to 0,98). Their sister clade is formed by CPelagibacter_uHTCC1062 and CPelagibacter_uHTCC1002. The root between them, which is significant (equal to 1), may show a possible common ancestor. These 3 homologs organisms are a-proteobacteria. So our ORF belongs to a-proteobacteria taxonomic group. The root that is equal to 0,79 is the common root of all sequences. So it seems to represent the common ancestor. All outgroup sequences are separate from the rest of ingroup sequences. The outgroups are separate in two clades: Limnobactersp.MED105 and BpertussisTohamaI are togheter in the same clade, sharing a root (_1).Both are b-proteobacterias. The other clade has AlichiiMLHE-1,togher with gproteobacterium_HTCC5015 they share a root of 0,72. Their closest sister clade is XfastidiosaTemecula1. These three are g-proteobacterias.


In BioNJ tree the closest related to our ORF is again Candidatus Pelagibacter sp. HTCC7211, and their common root has the value equal to 1. Their closest sister clade is formed by CPelagibacter_uHTCC1062 and CPelagibacter_uHTCC1002. The common root value is equal to 1. Once again we can deduce that our ORF is a a-proteobacteria. The outgroup sequences are separete from the ingroup sequences.

In general both trees, given by these methods, are coherent because they are concordant in main results.

RAW RESULTS

a) PyML
           
                                                                                                        -------0.1-----
 
                           +---------------------EArkansas_IN                       a-proteobacteria
                           |
     +------------------0,82                    +------------aproteobacteriumHIMB114 IN      a-proteobacteria
     |                     |                    |
     |                     |                    |                                    +CPelagibacter_uHTCC1062 IN    a-proteobacteria
     |                     +-----------------0,97                                 +-0,7 
     |                                          |                                 |  +CPelagibacter_uHTCC1002 IN     a-proteobacteria
     |                                          +---------------------------------1
     |                                                                            |
     |                                                                            |             +-----GOS_1384010.19
     |                                                                            +------------0,98
     |                                                                                          +----CPelagibactersp. IN    a-proteobacteria
     |
 +-0,79                                +WfasciatusPel_IN       a-proteobacteria
 |   |--------------------------------0,99
 |   |                                 +Wcautella_IN           a-proteobacteria
 |   |
 |   |            +-Rsibirica_246_IN                           a-proteobacteria
 |   |            |
 |   |            |   +RickettsiabelliiRML369-C_IN             a-protebacteria
 |   |            |  +0,79
 |   |            |  |+Rbellii_RML369-C IN                     a-proteobacteria
 |   |------------+ +0,75
 |   |            | |+---RfelisURRWXCal2 IN                    a-proteobacteria  
 |   |            |-0,79
 |   |            | |
 |   |            | +--Rendosymbiont_of_Ixodes_scapularis IN    a-proteobacteria
 |   |            |
 |   |            |------RHartford_IN                           a-proteobacteria
 |   |            |
 |   |            |-RmassiliaeMTU5_IN                           a-proteobacteria
 |   |            |
 |   |            |  +RMadridE_IN
 |   |            |-0,94
 |   |            |  +Raprowazekii_IN                           a-proteobacteria
 |   |            |
 |   |            |-Rconorii_str._Malish_7_IN                  a-proteobacteria
 |   |            |
 |   |            +--Rrickettsii_str._Iowa_IN                  a-protebacteria
 |   |
 |   |                                                                           +--------Limnobactersp.MED105_OUT    b-protebacteria
 |   |                                                                           |
 |   +---------------------------------------------------------------------------1
 |                                                                               +--------BpertussisTohamaI_OUT       b-proteobacteria
 |
 |   +----------------XfastidiosaTemecula1 OUT                       g-protebacteria
 +-0,79
     |     +---AlichiiMLHE-1 OUT                                     g-proteobacteria
     +----0,72
           +-------------------------gproteobacterium_HTCC5015_OUT   g-proteobacteria



b)bioNJ

                                                                                               -----0.05---
 
              +-------------------------------EArkansas_IN                                                a-proteobacteria
              |
       +------+                +----------------------------aproteobacteriumHIMB114_IN                    a-protebacteria
       |      |                |
       |      |                |                                      +CPelagibacter_ubiqueHTCC1062_IN    a-proteobacteria
       |      +-------------0,94                              +-------1
       |                       |                              |       +CPelagibacterubiqueHTCC1002_IN     a-proteobacteria
       |                       +------------------------------1
       |                                                      |
       |                                                      |               +-------GOS_1384010.19
       |                                                      +---------------1
       |                                                                      +-------CPelagibactersp._IN   a-proteobacteria
       |
       |                     +RMadridE_IN                  a-proteobacteria
       |                  +--0,98
       |                  |  +Raprowazekii_IN              a-proteobacteria         
       |                  |
       |                  |Rconorii_str._Malish_7_IN       a-proteobacteria
     +-+                  |
     | |                  |--Rrickettsii_str._Iowa_IN      a-proteobacteria
     | |                  |
     | |                  |RmassiliaeMTU5_IN               a-proteobacteria
     | |                  |
     | |                  |--------RHartford_IN            a-proteobacteria
     | |                  |
     | |                  |
     | |                  |   +RickettsiabelliiRML369-C_IN    a-proteobacteria
     | |                  | +-0,85
     | |                  |++ +Rbellii_RML369-C_IN            a-proteobacteria
     | |                  |||
  +--+ |   +--------------+++-----RfelisURRWXCal2_IN          a-proteobacteria
  |  | |   |              ||
  |  | |   |              |+---Rendosymbiont_of_Ixodes_scapularis_IN    a-proteobacteria
  |  | |   |              |
  |  | +---+              +--Rsibirica_246_IN                           a-proteobacteria
  |  |     |
  |  |     |                                +WfasciatusPel_IN           a-proteobacteria  
 ++  |     +--------------------------------1
 ||  |                                      +Wcautella_IN               a-proteobacteria
 ||  |
 ||  |                                                                             +------------Limnobactersp.MED105_OUT  b-proteobacteria
 ||  |                                                                             |
 ||  +-----------------------------------------------------------------------------1
 ||                                                                                +-----------BpertussisTohamaI_OUT      b-proteobacteria
 ||
 |+----------------------------gproteobacterium_HTCC5015_OUT   g-proteobacteria
 |
 |+-------------AlichiiMLHE-1_OUT                 g-proteobacteria
 ++
  +---------------------XfastidiosaTemecula1_OUT  g-proteobacteria
  

Taxonomy report

PROTOCOL


BLASTp versus NR, NCBI default parameters apart from " max target sequences_1000"

Blastx versus NR, NCBI dafault parameters apart from " max target sequences _ 1000"


RESULTS ANALYSIS


The first organism that apears is Candidatus Pelagibacter sp. HTCC7211 . It produces the highest score (_468) and presents 2 hits, this reinforces once again the possibility that our ORF has the same protein functions of C.pelagibacter. The multiple Rickettsias that appears (several hits) lead us to the possibility that this organism is also related with our ORF, and may have the same function since they possessed the same enzyme that our ORF encodes.

From Lineage Report we define the in and outgroups. Based on FAQ's we follow the example nº2, wich considers as ingorup the a-proteobacteria, and as outgroup the g-proteobacteria and b-proteobacteria. As we don't have a treshold line we choose 15 organisms belonging to a-proteobacteria, 3 g-proteobacteria and 2 b-ptoteobacteria defined below:


In group: a-proteobacteria


ref|ZP_05068692.1|CPelagibactersp. 2e-130 Candidatus Pelagibacter sp. HTCC7211 .

ref|YP_265666.1| CPelagibacter_uHTCC1062 7e-123 Candidatus Pelagibacter ubique HTCC1062. ref|ZP_01264594.1|CPelagibacter_uHTCC1002 7e-123 Candidatus Pelagibacter ubique HTCC1002.

ref|ZP_06055687.1|aproteobacteriumHIMB114 4e-100 alpha proteobacterium HIMB114. ref|YP_538560.1| RickettsiabelliiRML369-C 6e-87 Rickettsia bellii RML369-C . ref|NP_220438.1| RMadridE 5e-85 Rickettsia prowazekii str. Madrid E .

sp|Q9ZEA1.1| Raprowazekii 5e-85 Rickettsia prowazekii

ref|YP_001975350.1|WfasciatusPel 9e-85 Wolbachia endosymbiont of Culex quinquefasciatus Pel

ref|YP_001498933.1|RmassiliaeMTU5 2e-84 Rickettsia massiliae MTU5

ref|YP_507137.1| EArkansas 2e-84 Ehrlichia chaffeensis str. Arkansas

dbj|BAH22200.1| Wcautella 2e-84 Wolbachia endosymbiont of Cadra cautella

ref|YP_001492917.1|RHartford 6e-84 Rickettsia akari str. Hartford

ref|YP_246152.1| RfelisURRWXCal2 7e-84 Rickettsia felis URRWXCal2

Rrickettsii str. Iowa

Rconorii str. Malish 7

Rsibirica 246


Out group: g-proteobacteria


ref|ZP_05062250.1| gamma proteobacterium HTCC5015 2e-86 (g-proteobacteria)

ref|YP_742174.1| Alkalilimnicola ehrlichii MLHE-1 8e-86 (g-proteobacteria)

ref|NP_778584.1| Xylella fastidiosa Temecula1 1e-84 (g-proteobacteria)


b-proteobacteria


|ref|ZP_01914424.1|Limnobacter sp. MED105 4e-64 (b-proteobacteria)

|ref|NP_880996.1| Bordetella pertussis Tohama I 2e-63 (b-proteobacteria)

RAW RESULTS

Lineage Report:

root
. cellular organisms
. . Proteobacteria          [proteobacteria]
. . . Alphaproteobacteria     [a-proteobacteria]
. . . . Rickettsiales           [a-proteobacteria]
. . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter sp. HTCC7211 --------------------------  468  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Candidatus Pel
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 .......................  443  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Candidatus Pel
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 .......................  443  2 hits [a-proteobacteria]      succinate dehydrogenase [Candidatus Pelagibacter ubique HTC
. . . . . . alpha proteobacterium HIMB114 -----------------------------------  368  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [alpha proteoba
. . . . . Rickettsia bellii RML369-C ----------------------------------------  324  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia bel
. . . . . Rickettsia bellii OSU 85-389 ......................................  324  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia bel
. . . . . Orientia tsutsugamushi str. Ikeda .................................  323  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Orientia tsuts
. . . . . Orientia tsutsugamushi str. Boryong ...............................  322  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Orientia tsuts
. . . . . Rickettsia prowazekii str. Madrid E ...............................  318  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia pro
. . . . . Rickettsia prowazekii .............................................  318  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia pro
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ..............  317  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Wolbachia end
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB ..............  317  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Wolbachia end
. . . . . Rickettsia massiliae MTU5 .........................................  316  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia mas
. . . . . Ehrlichia chaffeensis str. Arkansas ...............................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ehrlichia chaf
. . . . . Wolbachia endosymbiont of Cadra cautella ..........................  315  1 hit  [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Wolbachia end
. . . . . Rickettsia akari str. Hartford ....................................  314  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia aka
. . . . . Rickettsia felis URRWXCal2 ........................................  314  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia fel
. . . . . Rickettsia felis ..................................................  314  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia fel
. . . . . Ehrlichia ruminantium str. Welgevonden ............................  314  4 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ehrlichia rumi
. . . . . Ehrlichia ruminantium str. Gardel .................................  314  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ehrlichia rumi
. . . . . Rickettsia peacockii str. Rustic ..................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia pea
. . . . . Rickettsia sibirica 246 ...........................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Rickettsia sib
. . . . . Rickettsia conorii str. Malish 7 ..................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia con
. . . . . Rickettsia conorii ................................................  313  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia con
. . . . . Rickettsia rickettsii str. Iowa ...................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia ric
. . . . . Rickettsia endosymbiont of Ixodes scapularis ......................  313  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia end
. . . . . Rickettsia rickettsii str. 'Sheila Smith' .........................  312  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia ric
. . . . . Rickettsia africae ESF-5 ..........................................  312  2 hits [a-proteobacteria]      Succinate dehydrogenase iron-sulfur protein [Rickettsia afr
. . . . . Rickettsia typhi str. Wilmington ..................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia typ
. . . . . Rickettsia typhi ..................................................  311  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia typ
. . . . . Rickettsia canadensis str. McKiel .................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rickettsia can
. . . . . Ehrlichia canis str. Jake .........................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ehrlichia cani
. . . . . Wolbachia endosymbiont strain TRS of Brugia malayi ................  304  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Wolbachia endo
. . . . . Wolbachia endosymbiont of Drosophila melanogaster .................  302  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Wolbachia endo
. . . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 .  302  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Wolbachia endo
. . . . . Anaplasma phagocytophilum HZ ......................................  301  4 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma phag
. . . . . Anaplasma phagocytophilum (agent of human granulo...) .............  301  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma phag
. . . . . Wolbachia sp. wRi .................................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [Wolbachia sp. wR
. . . . . Anaplasma marginale str. St. Maries ...............................  301  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma marg
. . . . . Anaplasma marginale str. Mississippi ..............................  301  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma marg
. . . . . Anaplasma centrale str. Israel ....................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma marg
. . . . . Anaplasma marginale str. Florida ..................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein (sdhB/frdB) [An
. . . . . Wolbachia endosymbiont of Drosophila ananassae ....................  300  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Wolbachia end
. . . . . Neorickettsia sennetsu str. Miyayama ..............................  295  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Neorickettsia 
. . . . . Neorickettsia risticii str. Illinois ..............................  294  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . . Anaplasma marginale str. Puerto Rico ..............................  285  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma marg
. . . . . Anaplasma marginale str. Virginia .................................  285  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Anaplasma marg
. . . . . Wolbachia endosymbiont of Drosophila simulans .....................  240  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Wolbachia end
. . . . Rhodospirillum rubrum ATCC 11170 ------------------------------------  322  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodospirillum
. . . . Rhodobacter sphaeroides 2.4.1 .......................................  321  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodobacter sp
. . . . Rhodobacter sphaeroides ATCC 17029 ..................................  321  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodobacter sp
. . . . Rhodobacter sphaeroides KD131 .......................................  321  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodobacter sp
. . . . Mesorhizobium loti MAFF303099 .......................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Mesorhizobium 
. . . . Mesorhizobium opportunistum WSM2075 .................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Loktanella vestfoldensis SKA53 ......................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase [Loktanella vestfoldensis SKA53] >g
. . . . Agrobacterium vitis S4 ..............................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur [Agrobacterium vitis S4
. . . . Parvibaculum lavamentivorans DS-1 ...................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Dinoroseobacter shibae DFL 12 .......................................  320  2 hits [a-proteobacteria]      succinate dehydrogenase [Dinoroseobacter shibae DFL 12] >gi
. . . . Beijerinckia indica subsp. indica ATCC 9039 .........................  319  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Agrobacterium tumefaciens str. C58 ..................................  319  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Agrobacterium 
. . . . Roseovarius sp. 217 .................................................  318  2 hits [a-proteobacteria]      succinate dehydrogenase [Roseovarius sp. 217] >gi|85668812|
. . . . Roseobacter sp. SK209-2-6 ...........................................  318  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Roseobacter sp
. . . . Rhodobacter sphaeroides ATCC 17025 ..................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodobacter sp
. . . . Paracoccus denitrificans PD1222 .....................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Paracoccus den
. . . . Paracoccus denitrificans ............................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Paracoccus den
. . . . Sulfitobacter sp. EE-36 .............................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase [Sulfitobacter sp. EE-36] >gi|83953
. . . . Sulfitobacter sp. NAS-14.1 ..........................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase [Sulfitobacter sp. EE-36] >gi|83953
. . . . Oceanibulbus indolifex HEL-45 .......................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Oceanibulbus i
. . . . Roseobacter denitrificans OCh 114 ...................................  317  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Roseobacter de
. . . . Rhizobium sp. NGR234 ................................................  316  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Rhizobium sp. 
. . . . Rhodobacterales bacterium Y4I .......................................  316  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Rhodobacteral
. . . . Roseovarius nubinhibens ISM .........................................  316  2 hits [a-proteobacteria]      succinate dehydrogenase [Roseovarius nubinhibens ISM] >gi|8
. . . . Roseovarius sp. TM1035 ..............................................  316  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Roseovarius sp
. . . . Rhodobacterales bacterium HTCC2083 ..................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Rhodobacteral
. . . . Brucella sp. 83/13 ..................................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella sp. 8
. . . . Brucella melitensis bv. 1 str. 16M ..................................  315  4 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus bv. 1 str. 9-941 ...................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella melitensis biovar Abortus 2308 .............................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella ovis ATCC 25840 ............................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella suis ATCC 23445 ............................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus S19 ................................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella melitensis ATCC 23457 ......................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus str. 2308 A ........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus bv. 3 str. Tulya ...................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus bv. 2 str. 86/8/59 .................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella pinnipedialis M163/99/10 ...................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella pinnipedialis B2/94 ........................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella ceti M644/93/1 .............................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella ceti M13/05/1 ..............................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus bv. 4 str. 292 .....................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella pinnipedialis M292/94/1 ....................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella melitensis bv. 1 str. Rev.1 ................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella neotomae 5K33 ..............................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella melitensis bv. 3 str. Ether ................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella ceti M490/95/1 .............................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella ceti B1/94 .................................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus bv. 9 str. C68 .....................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella melitensis bv. 2 str. 63/9 .................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella microti CCM 4915 ...........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Brucella abortus NCTC 8038 ..........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella melit
. . . . Roseovarius sp. HTCC2601 ............................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [Roseovarius sp. 
. . . . Sinorhizobium meliloti 1021 .........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Sinorhizobium 
. . . . Sinorhizobium medicae WSM419 ........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Sinorhizobium 
. . . . Brucella suis 1330 ..................................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella suis 
. . . . Brucella suis bv. 3 str. 686 ........................................  315  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella suis 
. . . . Brucella abortus bv. 6 str. 870 .....................................  315  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella abort
. . . . Brucella canis ATCC 23365 ...........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella canis
. . . . Brucella suis bv. 4 str. 40 .........................................  315  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella canis
. . . . Roseobacter litoralis Och 149 .......................................  314  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Roseobacter li
. . . . Rhodobacteraceae bacterium KLH11 ....................................  314  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Rhodobacterac
. . . . Hyphomicrobium denitrificans ATCC 51888 .............................  314  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Octadecabacter antarcticus 307 ......................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Brucella suis bv. 5 str. 513 ........................................  313  3 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Brucella suis 
. . . . Roseobacter sp. CCS2 ................................................  313  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Roseobacter s
. . . . Agrobacterium radiobacter K84 .......................................  312  2 hits [a-proteobacteria]      succinate dehydrogenase subunit B [Agrobacterium radiobacte
. . . . Hoeflea phototrophica DFL-43 ........................................  312  2 hits [a-proteobacteria]      succinate dehydrogenase subunit B, iron-sulfur protein [Hoe
. . . . Brucella ceti str. Cudo .............................................  312  2 hits [a-proteobacteria]      aspartate kinase [Brucella ceti str. Cudo] >gi|260169329|re
. . . . Brucella sp. F5/99 ..................................................  312  3 hits [a-proteobacteria]      aspartate kinase [Brucella ceti str. Cudo] >gi|260169329|re
. . . . Ochrobactrum intermedium LMG 3301 ...................................  312  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Candidatus Liberibacter asiaticus str. psy62 ........................  312  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Candidatus Lib
. . . . Thalassiobium sp. R2A62 .............................................  312  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Thalassiobium 
. . . . Ruegeria sp. R11 ....................................................  312  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Ruegeria sp. 
. . . . Rhodobacterales bacterium HTCC2255 ..................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [alpha proteobact
. . . . Caulobacter segnis ATCC 21756 .......................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . alpha proteobacterium BAL199 ........................................  311  2 hits [a-proteobacteria]      Succinate dehydrogenase/fumarate reductase, Fe-S protein su
. . . . Jannaschia sp. CCS1 .................................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Jannaschia sp.
. . . . Citreicella sp. SE45 ................................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Citreicella sp
. . . . Silicibacter lacuscaerulensis ITI-1157 ..............................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Silicibacter l
. . . . Labrenzia aggregata IAM 12614 .......................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Stappia aggreg
. . . . Roseobacter sp. MED193 ..............................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Roseobacter s
. . . . Sagittula stellata E-37 .............................................  311  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [Sagittula stella
. . . . Rhodobacterales bacterium HTCC2150 ..................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodobacterale
. . . . Rhizobium leguminosarum bv. viciae 3841 .............................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium legu
. . . . Rhizobium leguminosarum bv. trifolii WSM1325 ........................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium legu
. . . . Caulobacter sp. K31 .................................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Caulobacter sp
. . . . Rhizobium etli CIAT 894 .............................................  310  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . . Phaeobacter gallaeciensis BS107 .....................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Phaeobacter gallaeciensis 2.10 ......................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Erythrobacter sp. SD-21 .............................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Erythrobacter 
. . . . Rhodomicrobium vannielii ATCC 17100 .................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Ochrobactrum anthropi ATCC 49188 ....................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ochrobactrum a
. . . . Asticcacaulis excentricus CB 48 .....................................  310  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Rhizobium etli CFN 42 ...............................................  309  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . . Caulobacter crescentus CB15 .........................................  309  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Caulobacter cr
. . . . Caulobacter crescentus NA1000 .......................................  309  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Caulobacter cr
. . . . Oceanicola batsensis HTCC2597 .......................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase [Oceanicola batsensis HTCC2597] >gi
. . . . Acidiphilium cryptum JF-5 ...........................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Acidiphilium c
. . . . Rhizobium etli CIAT 652 .............................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase protein, iron-sulfur subunit [Rhizo
. . . . Silicibacter sp. TrichCH4B ..........................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Silicibacter s
. . . . Fulvimarina pelagi HTCC2506 .........................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [Fulvimarina pela
. . . . Ruegeria pomeroyi DSS-3 .............................................  308  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ruegeria pomer
. . . . Labrenzia alexandrii DFL-11 .........................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Chelativorans sp. BNC1 ..............................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Mesorhizobium 
. . . . Ruegeria sp. TM1040 .................................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ruegeria sp. T
. . . . Oceanicola granulosus HTCC2516 ......................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase [Oceanicola granulosus HTCC2516] >g
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 ........................  307  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium legu
. . . . Rhodobacterales bacterium HTCC2654 ..................................  307  2 hits [a-proteobacteria]      succinate dehydrogenase [Rhodobacterales bacterium HTCC2654
. . . . Aurantimonas manganoxydans SI85-9A1 .................................  306  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Aurantimonas m
. . . . Acetobacter pasteurianus IFO 3283-01 ................................  305  2 hits [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-03 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-07 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-22 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-26 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-32 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-01-42C ............................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Acetobacter pasteurianus IFO 3283-12 ................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase Fe-S protein subunit [Acetobacter p
. . . . Methylobacterium extorquens DM4 .....................................  305  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur subunit [Methylobacter
. . . . Hirschia baltica ATCC 49814 .........................................  305  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Methylobacterium extorquens PA1 .....................................  305  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Methylobacterium chloromethanicum CM4 ...............................  305  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Methylobacterium extorquens AM1 .....................................  305  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Methylobacterium extorquens .........................................  305  1 hit  [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Gluconacetobacter diazotrophicus PAl 5 ..............................  304  4 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Gluconacetobac
. . . . Azospirillum sp. B510 ...............................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Azospirillum s
. . . . Magnetospirillum gryphiswaldense MSR-1 ..............................  303  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Magnetospirill
. . . . Methylocella silvestris BL2 .........................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Azorhizobium caulinodans ORS 571 ....................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase/fumarate reductase iron-sulfur prot
. . . . Xanthobacter autotrophicus Py2 ......................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Phenylobacterium zucineum HLK1 ......................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Phenylobacter
. . . . Magnetospirillum magnetotacticum MS-1 ...............................  303  1 hit  [a-proteobacteria]      COG0479: Succinate dehydrogenase/fumarate reductase, Fe-S p
. . . . Methylobacterium populi BJ001 .......................................  303  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Granulibacter bethesdensis CGDNIH1 ..................................  302  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Granulibacter 
. . . . Bartonella bacilliformis KC583 ......................................  302  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella bac
. . . . Erythrobacter sp. NAP1 ..............................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase [Erythrobacter sp. NAP1] >gi|856903
. . . . Roseobacter sp. GAI101 ..............................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Roseobacter s
. . . . Rhodobacter sp. SW2 .................................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Pseudovibrio sp. JE062 ..............................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Pseudovibrio 
. . . . Magnetospirillum magneticum AMB-1 ...................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Magnetospirill
. . . . Bartonella tribocorum CIP 105476 ....................................  301  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella tri
. . . . Bartonella tribocorum ...............................................  301  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella tri
. . . . Sphingopyxis alaskensis RB2256 ......................................  300  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Sphingopyxis a
. . . . Erythrobacter litoralis HTCC2594 ....................................  300  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Erythrobacter 
. . . . Rhodospirillum centenum SW ..........................................  299  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Rhodospirillum
. . . . Hyphomonas neptunium ATCC 15444 .....................................  299  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Hyphomonas nep
. . . . Novosphingobium aromaticivorans DSM 12444 ...........................  299  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Novosphingobiu
. . . . Bartonella quintana str. Toulouse ...................................  299  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella qui
. . . . Sphingomonas wittichii RW1 ..........................................  299  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Sphingomonas w
. . . . Sphingomonas sp. SKA58 ..............................................  298  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Sphingomonas s
. . . . Methylobacterium radiotolerans JCM 2831 .............................  298  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Methylobacterium sp. 4-46 ...........................................  298  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Bartonella birtlesii ................................................  297  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella bir
. . . . Bartonella henselae str. Houston-1 ..................................  297  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bartonella hen
. . . . Methylobacterium nodulans ORS 2060 ..................................  297  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Bartonella grahamii as4aup ..........................................  296  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Bartonella gr
. . . . Oceanicaulis alexandrii HTCC2633 ....................................  296  2 hits [a-proteobacteria]      succinate dehydrogenase [Oceanicaulis alexandrii HTCC2633] 
. . . . Nitrobacter sp. Nb-311A .............................................  296  2 hits [a-proteobacteria]      succinate dehydrogenase [Nitrobacter sp. Nb-311A] >gi|85698
. . . . Octadecabacter antarcticus 238 ......................................  294  2 hits [a-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Octadecabacte
. . . . Bradyrhizobium japonicum USDA 110 ...................................  291  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bradyrhizobium
. . . . Bradyrhizobium japonicum ............................................  291  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bradyrhizobium
. . . . Maricaulis maris MCS10 ..............................................  291  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Maricaulis mar
. . . . Nitrobacter winogradskyi Nb-255 .....................................  290  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Nitrobacter wi
. . . . Bradyrhizobium sp. BTAi1 ............................................  289  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bradyrhizobium
. . . . Nitrobacter hamburgensis X14 ........................................  289  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Nitrobacter ha
. . . . Bradyrhizobium sp. ORS278 ...........................................  288  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bradyrhizobium
. . . . Oligotropha carboxidovorans OM5 .....................................  286  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Oligotropha ca
. . . . Roseobacter sp. AzwK-3b .............................................  286  2 hits [a-proteobacteria]      succinate dehydrogenase catalytic subunit [Roseobacter sp. 
. . . . Rhodopseudomonas palustris BisB18 ...................................  285  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Brevundimonas subvibrioides ATCC 15264 ..............................  285  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Rhodopseudomonas palustris HaA2 .....................................  282  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Rhodopseudomonas palustris BisB5 ....................................  281  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Brevundimonas sp. BAL3 ..............................................  281  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Rhodopseudomonas palustris CGA009 ...................................  280  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Rhodopseudomonas palustris TIE-1 ....................................  280  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Rhodopseudomonas palustris DX-1 .....................................  280  2 hits [a-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . . Rhodopseudomonas palustris BisA53 ...................................  279  2 hits [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhodopseudomon
. . . . Parvularcula bermudensis HTCC2503 ...................................  278  2 hits [a-proteobacteria]      Succinate dehydrogenase iron-sulfur protein [Parvularcula b
. . . . Rhizobium etli GR56 .................................................  274  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . . Rhizobium etli IE4771 ...............................................  272  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . . Rhizobium etli Kim 5 ................................................  253  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . . Rhizobium etli 8C-3 .................................................  250  1 hit  [a-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Rhizobium etli
. . . gamma proteobacterium HTCC5015 ----------------------------------------  322  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur protein [gamma proteoba
. . . Alkalilimnicola ehrlichii MLHE-1 ......................................  320  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Alkalilimnicol
. . . Xylella fastidiosa Temecula1 ..........................................  316  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xylella fastid
. . . Xylella fastidiosa M23 ................................................  316  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xylella fastid
. . . Xylella fastidiosa Dixon ..............................................  316  2 hits [g-proteobacteria]      Succinate dehydrogenase/fumarate reductase iron-sulfur prot
. . . Xylella fastidiosa subsp. sandyi Ann-1 ................................  316  4 hits [g-proteobacteria]      Succinate dehydrogenase/fumarate reductase iron-sulfur prot
. . . Xylella fastidiosa M12 ................................................  316  2 hits [g-proteobacteria]      Succinate dehydrogenase/fumarate reductase iron-sulfur prot
. . . Xylella fastidiosa 9a5c ...............................................  314  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xylella fastid
. . . Stenotrophomonas maltophilia K279a ....................................  314  2 hits [g-proteobacteria]      putative succinate dehydrogenase iron-sulfur protein [Steno
. . . Stenotrophomonas maltophilia R551-3 ...................................  314  2 hits [g-proteobacteria]      putative succinate dehydrogenase iron-sulfur protein [Steno
. . . Stenotrophomonas sp. SKA14 ............................................  314  2 hits [g-proteobacteria]      putative succinate dehydrogenase iron-sulfur protein [Steno
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 .....................  311  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Xanthomonas axonopodis pv. citri str. 306 .............................  311  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ax
. . . Xanthomonas citri .....................................................  311  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ax
. . . Halorhodospira halophila SL1 ..........................................  310  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Halorhodospira
. . . Xanthomonas oryzae pv. oryzae KACC10331 ...............................  310  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas or
. . . Xanthomonas oryzae pv. oryzicola BLS256 ...............................  310  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas or
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 .............................  309  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas or
. . . Xanthomonas oryzae pv. oryzae PXO99A ..................................  309  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas or
. . . Xanthomonas oryzae pv. oryzae .........................................  309  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas or
. . . Xanthomonas albilineans ...............................................  308  2 hits [g-proteobacteria]      putative succinate dehydrogenase catalytic subunit (iron-su
. . . Xanthomonas campestris pv. musacearum NCPPB4381 .......................  308  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 .................  306  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Xanthomonas campestris pv. campestris str. 8004 .......................  306  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Xanthomonas campestris pv. campestris str. B100 .......................  306  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Xanthomonas campestris pv. campestris .................................  306  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Nitrococcus mobilis Nb-231 ............................................  306  2 hits [g-proteobacteria]      succinate dehydrogenase catalytic subunit [Nitrococcus mobi
. . . Xanthomonas campestris pv. vasculorum NCPPB702 ........................  305  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Xanthomonas ca
. . . Methylococcus capsulatus str. Bath ....................................  302  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Methylococcus 
. . . Mariprofundus ferrooxydans PV-1 .......................................  251  2 hits [proteobacteria]        succinate dehydrogenase catalytic subunit [Mariprofundus fe
. . . Limnobacter sp. MED105 ................................................  248  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Limnobacter sp
. . . Bordetella pertussis Tohama I .........................................  246  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella per
. . . Bordetella parapertussis 12822 ........................................  246  1 hit  [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella per
. . . Bordetella bronchiseptica RB50 ........................................  246  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella per
. . . Bordetella parapertussis ..............................................  246  1 hit  [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella per
. . . Bordetella avium 197N .................................................  244  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur protein [Bordetella avi
. . . gamma proteobacterium HTCC2207 ........................................  243  2 hits [g-proteobacteria]      succinate dehydrogenase (B subunit) [marine gamma proteobac
. . . Methylibium petroleiphilum PM1 ........................................  243  2 hits [b-proteobacteria]      succinate dehydrogenase subunit B [Methylibium petroleiphil
. . . Polaromonas naphthalenivorans CJ2 .....................................  242  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Bordetella petrii DSM 12804 ...........................................  242  1 hit  [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella pet
. . . Bordetella petrii .....................................................  242  1 hit  [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Bordetella pet
. . . Polaromonas sp. JS666 .................................................  242  2 hits [b-proteobacteria]      succinate dehydrogenase subunit B [Polaromonas sp. JS666] >
. . . Alcanivorax borkumensis SK2 ...........................................  241  2 hits [g-proteobacteria]      succinate dehydrogenase, iron-sulfur [Alcanivorax borkumens
. . . Burkholderia glumae BGR1 ..............................................  241  4 hits [b-proteobacteria]      Succinate dehydrogenase/fumarate reductase, Fe-S protein su
. . . Alcanivorax sp. DG881 .................................................  241  2 hits [g-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Delftia acidovorans SPH-1 .............................................  241  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Chromohalobacter salexigens DSM 3043 ..................................  241  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Chromohalobact
. . . Cupriavidus metallidurans CH34 ........................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Cupriavidus me
. . . Nitrosomonas sp. AL212 ................................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Shewanella amazonensis SB2B ...........................................  240  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Shewanella ama
. . . Ralstonia eutropha H16 ................................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia eutr
. . . Cupriavidus taiwanensis ...............................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia eutr
. . . Cupriavidus necator ...................................................  240  1 hit  [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia eutr
. . . Ralstonia solanacearum GMI1000 ........................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia sola
. . . Ralstonia solanacearum UW551 ..........................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia sola
. . . Ralstonia solanacearum MolK2 ..........................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia sola
. . . Ralstonia solanacearum IPO1609 ........................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia sola
. . . Ralstonia eutropha JMP134 .............................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Ralstonia eutr
. . . Ralstonia pickettii 12J ...............................................  240  6 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Ralstonia pickettii 12D ...............................................  240  4 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Verminephrobacter eiseniae EF01-2 .....................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Saccharophagus degradans 2-40 .........................................  240  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Saccharophagus
. . . Nitrosospira multiformis ATCC 25196 ...................................  240  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Nitrosospira m
. . . Acidovorax avenae subsp. avenae ATCC 19860 ............................  240  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Acidovorax citrulli AAC00-1 ...........................................  239  2 hits [b-proteobacteria]      succinate dehydrogenase subunit B [Acidovorax avenae subsp.
. . . Herminiimonas arsenicoxydans ..........................................  239  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Herminiimonas 
. . . Nitrosomonas europaea ATCC 19718 ......................................  239  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Nitrosomonas e
. . . gamma proteobacterium NOR51-B .........................................  239  2 hits [g-proteobacteria]      succinate dehydrogenase, iron-sulfur subunit [gamma proteob
. . . gamma proteobacterium NOR5-3 ..........................................  239  2 hits [g-proteobacteria]      succinate dehydrogenase, iron-sulfur subunit [gamma proteob
. . . Congregibacter litoralis KT71 .........................................  238  2 hits [g-proteobacteria]      succinate dehydrogenase, iron-sulfur protein [Congregibacte
. . . Burkholderia phymatum STM815 ..........................................  238  4 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Variovorax paradoxus S110 .............................................  238  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Curvibacter putative symbiont of Hydra magnipapillata .................  238  1 hit  [b-proteobacteria]      PREDICTED: similar to Succinate dehydrogenase [ubiquinone] 
. . . Francisella tularensis subsp. mediasiatica FSC147 .....................  238  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Burkholderia sp. CCGE1003 .............................................  237  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Janthinobacterium sp. Marseille .......................................  237  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Janthinobacter
. . . Burkholderia graminis C4D1M ...........................................  237  4 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Acidovorax delafieldii 2AN ............................................  237  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Herbaspirillum seropedicae ............................................  236  1 hit  [b-proteobacteria]      Succinate dehydrogenase Fe-S protein subunit protein [Herba
. . . Laribacter hongkongensis HLHK9 ........................................  236  2 hits [b-proteobacteria]      SdhB [Laribacter hongkongensis HLHK9] >gi|226716262|gb|ACO7
. . . Rhodoferax fermentans .................................................  236  1 hit  [b-proteobacteria]      fumarate reductase iron-sulpher protein subunit [Rhodoferax
. . . Pseudomonas putida KT2440 .............................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Pseudomonas pu
. . . Pseudomonas putida F1 .................................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Pseudomonas pu
. . . Pseudomonas putida GB-1 ...............................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Pseudomonas pu
. . . Sideroxydans lithotrophicus ES-1 ......................................  236  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Leptothrix cholodnii SP-6 .............................................  236  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Burkholderia sp. H160 .................................................  236  4 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Burkholderia sp. CCGE1002 .............................................  236  2 hits [b-proteobacteria]      succinate dehydrogenase and fumarate reductase iron-sulfur 
. . . Francisella tularensis subsp. tularensis SCHU S4 ......................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella tularensis subsp. tularensis FSC198 .......................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella tularensis subsp. tularensis WY96-3418 ....................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella tularensis subsp. tularensis MA00-2987 ....................  236  3 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella tularensis subsp. tularensis FSC033 .......................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella tularensis subsp. tularensis NE061598 .....................  236  1 hit  [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella novicida U112 .............................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella novicida FTE ..............................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella novicida FTG ..............................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella novicida GA99-3549 ........................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Francisella novicida GA99-3548 ........................................  236  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella tu
. . . Shewanella loihica PV-4 ...............................................  235  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Shewanella loi
. . . Azotobacter vinelandii DJ .............................................  235  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Azotobacter vi
. . . Francisella philomiragia subsp. philomiragia ATCC 25017 ...............  235  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella ph
. . . Francisella philomiragia subsp. philomiragia ATCC 25015 ...............  235  3 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Francisella ph
. . . marine gamma proteobacterium HTCC2080 .................................  234  2 hits [g-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [marine gamma p
. . . Burkholderia cenocepacia AU 1054 ......................................  234  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Burkholderia c
. . . Burkholderia cenocepacia HI2424 .......................................  234  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Burkholderia c
. . . Burkholderia cenocepacia MC0-3 ........................................  234  2 hits [b-proteobacteria]      succinate dehydrogenase iron-sulfur subunit [Burkholderia c
. . Monodelphis domestica ---------------------------------------------------  286  2 hits [marsupials]            PREDICTED: hypothetical protein [Monodelphis domestica]
. . Branchiostoma floridae ..................................................  286  2 hits [lancelets]             hypothetical protein BRAFLDRAFT_273662 [Branchiostoma flori
. . Sus scrofa (wild boar) ..................................................  286  6 hits [even-toed ungulates]   Chain B, Crystal Structure Of Mitochondrial Respiratory Com
. . Osmerus mordax ..........................................................  285  2 hits [bony fishes]           Succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Anoplopoma fimbria ......................................................  285  2 hits [bony fishes]           Succinate dehydrogenase iron-sulfur subunit, mitochondrial 
. . Oncorhynchus mykiss .....................................................  284  3 hits [bony fishes]           Succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Tetraodon nigroviridis ..................................................  284  2 hits [bony fishes]           unnamed protein product [Tetraodon nigroviridis]
. . Oryctolagus cuniculus (domestic rabbit) .................................  283  1 hit  [rabbits & hares]       succinate dehydrogenase complex subunit B [Oryctolagus cuni
. . Ostreococcus lucimarinus CCE9901 ........................................  283  2 hits [green algae]           predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. . Lepus europaeus .........................................................  283  1 hit  [rabbits & hares]       succinate dehydrogenase complex subunit B [Lepus europaeus]
. . Xenopus laevis (common platanna) ........................................  283  4 hits [frogs & toads]         Sdhb-prov protein [Xenopus laevis]
. . Xenopus (Silurana) tropicalis ...........................................  283  3 hits [frogs & toads]         succinate dehydrogenase complex, subunit B, iron sulfur (Ip
. . Bos taurus (cow) ........................................................  283  4 hits [even-toed ungulates]   succinate dehydrogenase complex, subunit B, iron sulfur (Ip
. . Equus caballus (equine) .................................................  282  2 hits [odd-toed ungulates]    succinate dehydrogenase complex, subunit B, iron sulfur (Ip
. . Homo sapiens (man) ......................................................  281 12 hits [primates]              succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Pan troglodytes .........................................................  281  4 hits [primates]              succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Pediculus humanus corporis (human body lice) ............................  281  2 hits [lice]                  succinate dehydrogenase, iron-sulfur subunit [Pediculus hum
. . Balaenoptera physalus (finback whale) ...................................  281  1 hit  [whales & dolphins]     succinate dehydrogenase complex subunit B [Balaenoptera phy
. . Felis catus (cat) .......................................................  281  1 hit  [carnivores]            succinate dehydrogenase complex subunit B [Felis catus]
. . Plasmodium vivax SaI-1 ..................................................  281  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase [Plasmodium 
. . Plasmodium vivax ........................................................  281  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase [Plasmodium 
. . Solanum lycopersicum (tomato) ...........................................  281  1 hit  [eudicots]              mitochondrial succinate dehydrogenase iron sulfur subunit [
. . Lepeophtheirus salmonis .................................................  280  3 hits [crustaceans]           Succinate dehydrogenase iron-sulfur subunit, mitochondrial 
. . Macaca mulatta (rhesus macaque) .........................................  280  2 hits [primates]              PREDICTED: succinate dehydrogenase complex, subunit B, iron
. . Macaca fascicularis (cynomolgus monkey) .................................  280  1 hit  [primates]              PREDICTED: succinate dehydrogenase complex, subunit B, iron
. . Canis lupus familiaris (dogs) ...........................................  280  4 hits [carnivores]            PREDICTED: similar to Succinate dehydrogenase [ubiquinone] 
. . Mus musculus (mouse) ....................................................  280 17 hits [rodents]               succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Populus trichocarpa (black cottonwood) ..................................  280  2 hits [eudicots]              predicted protein [Populus trichocarpa] >gi|222845841|gb|EE
. . Gallus gallus (bantam) ..................................................  280 10 hits [birds]                 succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Hippopotamus amphibius ..................................................  280  1 hit  [even-toed ungulates]   succinate dehydrogenase complex subunit B [Hippopotamus amp
. . Phytophthora infestans T30-4 ............................................  279  1 hit  [oomycetes]             succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Diceros bicornis ........................................................  279  1 hit  [odd-toed ungulates]    succinate dehydrogenase complex subunit B [Diceros bicornis]
. . Mesocricetus auratus (Syrian hamster) ...................................  279  1 hit  [rodents]               succinate dehydrogenase complex subunit B [Mesocricetus aur
. . Ceratotherium simum (square-lipped rhinoceros) ..........................  279  1 hit  [odd-toed ungulates]    succinate dehydrogenase complex subunit B [Ceratotherium si
. . Plasmodium knowlesi strain H ............................................  279  2 hits [apicomplexans]         Iron-sulfur subunit of succinate dehydrogenase [Plasmodium 
. . Strongylocentrotus purpuratus (purple urchin) ...........................  278  2 hits [sea urchins]           PREDICTED: hypothetical protein [Strongylocentrotus purpura
. . Sminthopsis douglasi ....................................................  278  1 hit  [marsupials]            succinate dehydrogenase complex subunit B [Sminthopsis doug
. . Mortierella alpina ......................................................  278  1 hit  [fungi]                 iron-sulfur subunit of succinate dehydrogenase [Mortierella
. . Rattus norvegicus (brown rat) ...........................................  278  7 hits [rodents]               succinate dehydrogenase complex, subunit B, iron sulfur (Ip
. . Reclinomonas americana ..................................................  278  3 hits [eukaryotes]            succinate:ubiquinone oxidoreductase subunit 2 [Reclinomonas
. . Arabidopsis thaliana (thale-cress) ......................................  277 20 hits [eudicots]              SDH2-1; electron carrier/ succinate dehydrogenase [Arabidop
. . Anopheles gambiae str. PEST .............................................  277  2 hits [flies]                 AGAP007309-PA [Anopheles gambiae str. PEST] >gi|157020207|g
. . Danio rerio (zebra fish) ................................................  277  3 hits [bony fishes]           succinate dehydrogenase complex, subunit B, iron sulfur (Ip
. . Cavia porcellus (guinea pig) ............................................  277  1 hit  [rodents]               succinate dehydrogenase complex subunit B [Cavia porcellus]
. . Aotus trivirgatus (owl monkey) ..........................................  277  1 hit  [primates]              succinate dehydrogenase complex subunit B [Aotus trivirgatu
. . Plasmodium yoelii yoelii str. 17XNL .....................................  277  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Plasmodium yoe
. . Plasmodium yoelii yoelii ................................................  277  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Plasmodium yoe
. . Drosophila persimilis ...................................................  277  4 hits [flies]                 GL21331 [Drosophila persimilis] >gi|194115823|gb|EDW37866.1
. . Picea sitchensis ........................................................  276  1 hit  [conifers]              unknown [Picea sitchensis]
. . Physcomitrella patens subsp. patens .....................................  276  2 hits [mosses]                predicted protein [Physcomitrella patens subsp. patens] >gi
. . Salmo salar .............................................................  276  6 hits [bony fishes]           Succinate dehydrogenase iron-sulfur subunit, mitochondrial 
. . Plasmodium berghei str. ANKA ............................................  276  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, [Plasmodium
. . Plasmodium berghei ......................................................  276  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, [Plasmodium
. . Ciona intestinalis ......................................................  275  1 hit  [tunicates]             PREDICTED: similar to Sdhb-prov protein [Ciona intestinalis]
. . Cyanidioschyzon merolae .................................................  275  1 hit  [red algae]             succinate dehydrogenase iron-sulfur protein [Cyanidioschyzo
. . Cyanidioschyzon merolae strain 10D ......................................  275  1 hit  [red algae]             succinate dehydrogenase iron-sulfur protein [Cyanidioschyzo
. . Glossina morsitans morsitans ............................................  275  1 hit  [flies]                 succinate dehydrogenase Fe-s protein subunit [Glossina mors
. . Apis mellifera (bee) ....................................................  275  2 hits [bees]                  PREDICTED: similar to Succinate dehydrogenase B CG3283-PA [
. . Ailuropoda melanoleuca ..................................................  275  1 hit  [carnivores]            hypothetical protein PANDA_013300 [Ailuropoda melanoleuca]
. . Plasmodium falciparum 3D7 ...............................................  275  2 hits [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase [Plasmodium 
. . Plasmodium falciparum ...................................................  275  2 hits [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase [Plasmodium 
. . Aedes aegypti ...........................................................  275  2 hits [flies]                 succinate dehydrogenase [Aedes aegypti] >gi|108873481|gb|EA
. . Tribolium castaneum (rust-red flour beetle) .............................  275  2 hits [beetles]               succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Drosophila melanogaster .................................................  275  8 hits [flies]                 succinate dehydrogenase B [Drosophila melanogaster] >gi|195
. . Drosophila simulans .....................................................  275  4 hits [flies]                 succinate dehydrogenase B [Drosophila melanogaster] >gi|195
. . Drosophila yakuba .......................................................  275  4 hits [flies]                 GE19076 [Drosophila yakuba] >gi|194175481|gb|EDW89092.1| GE
. . Ixodes scapularis (shoulder tick) .......................................  275  3 hits [mites & ticks]         succinate dehydrogenase Ip subunit [Ixodes scapularis]
. . Phaeodactylum tricornutum CCAP 1055/1 ...................................  275  2 hits [diatoms]               succinate dehydrogenase iron sulfur protein [Phaeodactylum 
. . Drosophila grimshawi ....................................................  275  6 hits [flies]                 GH24727 [Drosophila grimshawi] >gi|193893238|gb|EDV92104.1|
. . Drosophila sechellia ....................................................  274  4 hits [flies]                 GM20899 [Drosophila sechellia] >gi|194124620|gb|EDW46663.1|
. . Vitis vinifera (wine grape) .............................................  274  2 hits [eudicots]              PREDICTED: hypothetical protein [Vitis vinifera]
. . Drosophila erecta .......................................................  274  4 hits [flies]                 GG23224 [Drosophila erecta] >gi|190662589|gb|EDV59781.1| GG
. . Lysiphlebus testaceipes .................................................  274  1 hit  [wasps &c.]             succinate dehydrogenase iron sulfur subunit B [Lysiphlebus 
. . Drosophila virilis ......................................................  274  4 hits [flies]                 GJ22180 [Drosophila virilis] >gi|194145284|gb|EDW61680.1| G
. . Caligus clemensi ........................................................  274  1 hit  [crustaceans]           Succinate dehydrogenase iron-sulfur subunit, mitochondrial 
. . Dasypus novemcinctus ....................................................  274  1 hit  [placentals]            succinate dehydrogenase complex subunit B [Dasypus novemcin
. . Plasmodium chabaudi chabaudi ............................................  274  2 hits [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, [Plasmodium
. . Drosophila ananassae ....................................................  274  4 hits [flies]                 GF11072 [Drosophila ananassae] >gi|190622581|gb|EDV38105.1|
. . Debaryomyces hansenii CBS767 ............................................  274  1 hit  [ascomycetes]           hypothetical protein DEHA0G20581g [Debaryomyces hansenii CB
. . Debaryomyces hansenii ...................................................  274  1 hit  [ascomycetes]           hypothetical protein DEHA0G20581g [Debaryomyces hansenii CB
. . Drosophila pseudoobscura pseudoobscura ..................................  273  4 hits [flies]                 GA17170 [Drosophila pseudoobscura pseudoobscura] >gi|195149
. . Hydra magnipapillata ....................................................  273  2 hits [hydrozoans]            PREDICTED: similar to Sdhb-prov protein [Hydra magnipapilla
. . Drosophila mojavensis ...................................................  273  4 hits [flies]                 GI19303 [Drosophila mojavensis] >gi|193910059|gb|EDW08926.1
. . Micromonas sp. RCC299 ...................................................  273  2 hits [green algae]           succinate dehydrogenase [Micromonas sp. RCC299] >gi|2265220
. . Tamandua tetradactyla ...................................................  273  1 hit  [placentals]            succinate dehydrogenase complex subunit B [Tamandua tetrada
. . Vanderwaltozyma polyspora DSM 70294 .....................................  273  4 hits [ascomycetes]           hypothetical protein Kpol_1070p4 [Vanderwaltozyma polyspora
. . Ustilago maydis 521 .....................................................  272  2 hits [basidiomycetes]        succinate dehydrogenase [Ustilago maydis 521] >gi|416903|sp
. . Ustilago maydis .........................................................  272  3 hits [basidiomycetes]        succinate dehydrogenase [Ustilago maydis 521] >gi|416903|sp
. . Candida tropicalis MYA-3404 .............................................  272  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Drosophila willistoni ...................................................  272  4 hits [flies]                 GK22142 [Drosophila willistoni] >gi|194162128|gb|EDW77029.1
. . Ricinus communis ........................................................  271  4 hits [eudicots]              succinate dehydrogenase, putative [Ricinus communis] >gi|22
. . Coprinopsis cinerea okayama7#130 ........................................  271  2 hits [basidiomycetes]        hypothetical protein CC1G_09250 [Coprinopsis cinerea okayam
. . Coprinopsis cinerea .....................................................  271  1 hit  [basidiomycetes]        hypothetical protein CC1G_09250 [Coprinopsis cinerea okayam
. . Uromyces viciae-fabae ...................................................  270  2 hits [basidiomycetes]        RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sul
. . Micromonas pusilla CCMP1545 .............................................  270  1 hit  [green algae]           predicted protein [Micromonas pusilla CCMP1545]
. . Acyrthosiphon pisum .....................................................  270  2 hits [aphids]                Succinate dehydrogenase B [Acyrthosiphon pisum] >gi|2397994
. . Schizosaccharomyces pombe ...............................................  269  3 hits [ascomycetes]           succinate dehydrogenase (ubiquinone) iron-sulfur protein su
. . Nasonia vitripennis .....................................................  269  2 hits [wasps &c.]             succinate dehydrogenase [ubiquinone] iron-sulfur subunit, m
. . Nematostella vectensis ..................................................  269  2 hits [sea anemones]          predicted protein [Nematostella vectensis] >gi|156224111|gb
. . Tadarida brasiliensis ...................................................  269  1 hit  [bats]                  succinate dehydrogenase complex subunit B [Tadarida brasili
. . Candida dubliniensis CD36 ...............................................  269  2 hits [ascomycetes]           succinate dehydrogenase, iron-sulfur protein subunit, mitoc
. . Cyanidium caldarium .....................................................  268  2 hits [red algae]             RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sul
. . Candida albicans SC5314 .................................................  268  4 hits [ascomycetes]           hypothetical protein CaO19.8251 [Candida albicans SC5314] >
. . Candida albicans WO-1 ...................................................  268  1 hit  [ascomycetes]           hypothetical protein CaO19.8251 [Candida albicans SC5314] >
. . Theileria annulata strain Ankara ........................................  268  1 hit  [apicomplexans]         succinate dehydrogenase [ubiquinone] iron-sulfur protein [T
. . Theileria annulata ......................................................  268  1 hit  [apicomplexans]         succinate dehydrogenase [ubiquinone] iron-sulfur protein [T
. . Pichia guilliermondii ATCC 6260 .........................................  267  2 hits [ascomycetes]           hypothetical protein PGUG_03289 [Pichia guilliermondii ATCC
. . Chlamydomonas reinhardtii ...............................................  266  2 hits [green algae]           iron-sulfur subunit of mitochondrial succinate dehydrogenas
. . Triticum aestivum (common wheat) ........................................  266  1 hit  [monocots]              succinate dehydrogenase [Triticum aestivum]
. . Kluyveromyces lactis NRRL Y-1140 ........................................  266  1 hit  [ascomycetes]           unnamed protein product [Kluyveromyces lactis] >gi|49643112
. . Kluyveromyces lactis ....................................................  266  1 hit  [ascomycetes]           unnamed protein product [Kluyveromyces lactis] >gi|49643112
. . Brugia malayi (agent of lymphatic fil...) ...............................  266  2 hits [nematodes]             succinate dehydrogenase [ubiquinone] iron-sulfur protein, m
. . Clavispora lusitaniae ATCC 42720 ........................................  266  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Zea mays (maize) ........................................................  266  5 hits [monocots]              succinate dehydrogenase iron-sulfur protein,mitochondrial p
. . Dendronephthya klunzingeri ..............................................  266  1 hit  [soft corals]           DHSB protein [Dendronephthya klunzingeri]
. . Verticillium albo-atrum VaMs.102 ........................................  266  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur subunit [Verticillium a
. . Cryptococcus neoformans var. neoformans JEC21 ...........................  265  2 hits [basidiomycetes]        succinate dehydrogenase iron-sulfur subunit [Cryptococcus n
. . Cryptococcus neoformans var. neoformans B-3501A .........................  265  2 hits [basidiomycetes]        succinate dehydrogenase iron-sulfur subunit [Cryptococcus n
. . Schistosoma mansoni .....................................................  265  2 hits [flatworms]             succinate dehydrogenase iron-sulfur protein [Schistosoma ma
. . Schistosoma japonicum ...................................................  265  7 hits [flatworms]             succinate dehydrogenase iron-sulfur protein [Schistosoma ja
. . Thalassiosira pseudonana CCMP1335 .......................................  265  2 hits [diatoms]               precursor of hydrogenase [Thalassiosira pseudonana CCMP1335
. . Ashbya gossypii ATCC 10895 ..............................................  265  2 hits [ascomycetes]           ACL065Cp [Ashbya gossypii ATCC 10895] >gi|51701412|sp|Q75CI
. . Eremothecium gossypii ...................................................  265  1 hit  [ascomycetes]           ACL065Cp [Ashbya gossypii ATCC 10895] >gi|51701412|sp|Q75CI
. . Trichoplax adhaerens ....................................................  265  2 hits [placozoans]            expressed hypothetical protein [Trichoplax adhaerens] >gi|1
. . Magnaporthe oryzae 70-15 ................................................  265  2 hits [ascomycetes]           conserved hypothetical protein [Magnaporthe grisea 70-15] >
. . Magnaporthe grisea ......................................................  265  1 hit  [ascomycetes]           conserved hypothetical protein [Magnaporthe grisea 70-15] >
. . Oryza sativa Japonica Group (Japanese rice) .............................  265  8 hits [monocots]              Os08g0120000 [Oryza sativa (japonica cultivar-group)] >gi|5
. . Pholiota nameko .........................................................  265  1 hit  [basidiomycetes]        succinate dehydrogenase iron-sulfur protein subunit [Pholio
. . Caenorhabditis briggsae .................................................  265  3 hits [nematodes]             C. briggsae CBR-SDHB-1 protein [Caenorhabditis briggsae] >g
. . Laccaria bicolor S238N-H82 ..............................................  264  2 hits [basidiomycetes]        predicted protein [Laccaria bicolor S238N-H82] >gi|16464950
. . Botryotinia fuckeliana ..................................................  263  8 hits [ascomycetes]           succinate dehydrogenase iron sulphur protein [Botryotinia f
. . Schizosaccharomyces japonicus yFS275 ....................................  263  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur subunit [Schizosaccharo
. . Candida glabrata CBS 138 ................................................  263  2 hits [ascomycetes]           unnamed protein product [Candida glabrata] >gi|51701395|sp|
. . Candida glabrata ........................................................  263  3 hits [ascomycetes]           unnamed protein product [Candida glabrata] >gi|51701395|sp|
. . Yarrowia lipolytica CLIB122 .............................................  263  1 hit  [ascomycetes]           YALI0D23397p [Yarrowia lipolytica] >gi|49649057|emb|CAG8138
. . Yarrowia lipolytica .....................................................  263  1 hit  [ascomycetes]           YALI0D23397p [Yarrowia lipolytica] >gi|49649057|emb|CAG8138
. . Monosiga brevicollis MX1 ................................................  263  2 hits [choanoflagellates]     hypothetical protein [Monosiga brevicollis MX1] >gi|1637735
. . Lentinula edodes ........................................................  263  2 hits [basidiomycetes]        iron-sulphar subunit protein of succinate dehydrogenase [Le
. . Lodderomyces elongisporus NRRL YB-4239 ..................................  262  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Botryotinia fuckeliana B05.10 ...........................................  262  2 hits [ascomycetes]           succinate dehydrogenase-ubiquinone-iron-sulphur protein [Bo
. . Theileria parva strain Muguga ...........................................  261  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Theileria parv
. . Theileria parva .........................................................  261  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Theileria parv
. . Podospora anserina DSM 980 ..............................................  261  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170943573|
. . Podospora anserina ......................................................  261  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170943573|
. . Pichia stipitis CBS 6054 ................................................  261  2 hits [ascomycetes]           succinate dehydrogenase subunit [Pichia stipitis CBS 6054] 
. . Pichia pastoris GS115 ...................................................  261  2 hits [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Zygosaccharomyces rouxii CBS 732 ........................................  261  1 hit  [ascomycetes]           ZYRO0G07788p [Zygosaccharomyces rouxii] >gi|238941227|emb|C
. . Zygosaccharomyces rouxii ................................................  261  1 hit  [ascomycetes]           ZYRO0G07788p [Zygosaccharomyces rouxii] >gi|238941227|emb|C
. . Saccharomyces cerevisiae EC1118 .........................................  261  1 hit  [ascomycetes]           Sdh2p [Saccharomyces cerevisiae EC1118]
. . Hebeloma cylindrosporum .................................................  261  1 hit  [basidiomycetes]        succinate dehydrogenase iron-sulfur subunit [Hebeloma cylin
. . Caenorhabditis elegans (nematode) .......................................  261  3 hits [nematodes]             Succinate DeHydrogenase complex subunit B family member (sd
. . Neurospora crassa OR74A .................................................  261  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Neurospora crassa .......................................................  261  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Sordaria macrospora .....................................................  261  1 hit  [ascomycetes]           unnamed protein product [Sordaria macrospora]
. . Agaricus bisporus (common mushroom) .....................................  260  1 hit  [basidiomycetes]        succinate dehydrogenase iron-sulfur subunit [Agaricus bispo
. . Saccharomyces cerevisiae (yeast) ........................................  260  6 hits [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Saccharomyces cerevisiae YJM789 .........................................  260  1 hit  [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Saccharomyces cerevisiae RM11-1a ........................................  260  1 hit  [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Saccharomyces cerevisiae AWRI1631 .......................................  260  1 hit  [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Saccharomyces cerevisiae JAY291 .........................................  260  1 hit  [ascomycetes]           Iron-sulfur protein subunit of succinate dehydrogenase (Sdh
. . Coccidioides posadasii C735 delta SOWgp .................................  259  1 hit  [ascomycetes]           Succinate dehydrogenase iron-sulfur protein,mitochondrial p
. . Ascaris suum ............................................................  259  1 hit  [nematodes]             iron-sulfur subunit of succinate dehydrogenase [Ascaris suu
. . Talaromyces stipitatus ATCC 10500 .......................................  258  2 hits [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Coccidioides immitis RS .................................................  258  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Perkinsus marinus ATCC 50983 ............................................  258  2 hits [eukaryotes]            succinate dehydrogenase, putative [Perkinsus marinus ATCC 5
. . Malassezia globosa CBS 7966 .............................................  257  2 hits [basidiomycetes]        hypothetical protein MGL_3104 [Malassezia globosa CBS 7966]
. . Uncinocarpus reesii 1704 ................................................  256  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein [Uncinocarpus r
. . Gillichthys seta ........................................................  256  1 hit  [bony fishes]           succinate dehydrogenase complex subunit B [Gillichthys seta]
. . Gillichthys mirabilis ...................................................  256  1 hit  [bony fishes]           succinate dehydrogenase complex subunit B [Gillichthys mira
. . Penicillium marneffei ATCC 18224 ........................................  255  2 hits [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Sclerotinia sclerotiorum 1980 UF-70 .....................................  255  2 hits [ascomycetes]           hypothetical protein SS1G_04384 [Sclerotinia sclerotiorum 1
. . Lachancea thermotolerans CBS 6340 .......................................  255  1 hit  [ascomycetes]           KLTH0E05742p [Lachancea thermotolerans] >gi|238935113|emb|C
. . Lachancea thermotolerans ................................................  255  1 hit  [ascomycetes]           KLTH0E05742p [Lachancea thermotolerans] >gi|238935113|emb|C
. . Ajellomyces capsulatus NAm1 .............................................  253  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Ajellomyces capsulatus G186AR ...........................................  253  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur protein [Ajellomyces ca
. . Aspergillus clavatus NRRL 1 .............................................  253  2 hits [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Alternaria alternata ....................................................  253  7 hits [ascomycetes]           mitochondrial succinate dehydrogenase iron-sulphur subunit 
. . Ajellomyces capsulatus H143 .............................................  253  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulphur protein [Ajellomyces c
. . Aspergillus nidulans FGSC A4 ............................................  253  3 hits [ascomycetes]           hypothetical protein AN2332.2 [Aspergillus nidulans FGSC A4
. . Neosartorya fischeri NRRL 181 ...........................................  253  2 hits [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Pyrenophora tritici-repentis Pt-1C-BFP ..................................  253  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur subunit, mitochondrial 
. . Phaeosphaeria nodorum SN15 ..............................................  252  2 hits [ascomycetes]           hypothetical protein SNOG_03351 [Phaeosphaeria nodorum SN15
. . Microsporum canis CBS 113480 ............................................  252  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur subunit [Microsporum ca
. . Porphyra purpurea .......................................................  252  3 hits [red algae]             succinate:cytochrome c oxidoreductase subunit 2 [Porphyra p
. . Aspergillus fumigatus Af293 .............................................  252  2 hits [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Aspergillus fumigatus A1163 .............................................  252  1 hit  [ascomycetes]           iron-sulfur protein subunit of succinate dehydrogenase Sdh2
. . Pleurotus ostreatus .....................................................  252  5 hits [basidiomycetes]        iron-sulfur protein subunit [Pleurotus ostreatus] >gi|24469
. . Chondrus crispus (carrageen) ............................................  251  3 hits [red algae]             succinate:cytochrome c oxidoreductase subunit 2 [Chondrus c
. . Penicillium chrysogenum Wisconsin 54-1255 ...............................  250  2 hits [ascomycetes]           Pc21g09900 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. . Tupaia glis (tree shrew) ................................................  250  1 hit  [placentals]            succinate dehydrogenase complex subunit B [Tupaia glis]
. . Ajellomyces dermatitidis SLH14081 .......................................  249  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein [Ajellomyces de
. . Ajellomyces dermatitidis ER-3 ...........................................  249  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur protein [Ajellomyces de
. . Aspergillus oryzae RIB40 ................................................  249  1 hit  [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|2385069
. . Aspergillus flavus NRRL3357 .............................................  249  2 hits [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|2385069
. . Aspergillus oryzae ......................................................  249  5 hits [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|2385069
. . Babesia bovis T2Bo ......................................................  249  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Babesia bovis 
. . Babesia bovis ...........................................................  249  1 hit  [apicomplexans]         succinate dehydrogenase iron-sulfur subunit [Babesia bovis 
. . Dictyostelium discoideum AX4 ............................................  248  2 hits [cellular slime molds]  succinate dehydrogenase [Dictyostelium discoideum AX4] >gi|
. . Dictyostelium discoideum ................................................  248  1 hit  [cellular slime molds]  succinate dehydrogenase [Dictyostelium discoideum AX4] >gi|
. . Toxoplasma gondii ME49 ..................................................  248  2 hits [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, putative [T
. . Toxoplasma gondii GT1 ...................................................  248  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, putative [T
. . Toxoplasma gondii VEG ...................................................  248  1 hit  [apicomplexans]         iron-sulfur subunit of succinate dehydrogenase, putative [T
. . Mycosphaerella graminicola ..............................................  246  2 hits [ascomycetes]           RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sul
. . Paracoccidioides brasiliensis Pb03 ......................................  245  1 hit  [ascomycetes]           succinate dehydrogenase iron-sulfur subunit [Paracoccidioid
. . Aspergillus terreus NIH2624 .............................................  244  2 hits [ascomycetes]           succinate dehydrogenase iron-sulfur protein, mitochondrial 
. . Loxodonta africana (African savannah elephant) ..........................  244  1 hit  [placentals]            succinate dehydrogenase complex subunit B [Loxodonta africa
. . Taeniopygia guttata (zebra finch) .......................................  243  1 hit  [birds]                 PREDICTED: putative succinate dehydrogenase Ip subunit, par
. . Didelphis virginiana (Virginia opossum) .................................  241  1 hit  [marsupials]            succinate dehydrogenase complex subunit B [Didelphis virgin
. . Cryptosporidium muris RN66 ..............................................  239  2 hits [apicomplexans]         succinate dehydrogenase [ubiquinone] iron-sulfur subunit [C
. . Polysphondylium pallidum PN500 ..........................................  236  1 hit  [cellular slime molds]  succinate dehydrogenase [Polysphondylium pallidum PN500]
. synthetic construct -------------------------------------------------------  275  4 hits [other sequences]       succinate dehydrogenase B [Drosophila melanogaster] >gi|195
. Cloning vector pDonrCbx ...................................................  268  1 hit  [other sequences]       succinate dehydrogenase [Ustilago maydis] >gi|164653718|gb|

BLAST

PROTOCOL


Blastp vs NR, default NCBI parameters * "1000 max taget sequences"

Blastx vs NR, default NCBI parameters "1000 max target sequences"


RESULTS ANALYSIS


We have running a BLASTp, which search for protein homologs to our ORF, and a BLASTx seeking biological function to other ORFs. We have obtained a complete hit list, and the best 12 alignments are all presented. We find proteins homologous to our ORF, with a meaning E-value, and high scores.


The alignment produced in blastp presents E-values, all above 10e-28, the list produced is very good. So the probability of false positives is less.


The first protein has got the biggest score (_468 bits) and the lower E-value (_2e-130),is a succinate dehydrogenase iron sulfur protein which is an enzyme, are in Candidatus Pelagibacter being the most significant, and most homolog protein to our.


As our protein is homologous to succinate dehydrogenase iron sulphur protein, we believe that the function is similar. The identity between them is 90%, so this reinforces the possibility of our protein contains the same function . Can be in different organisms but contains homologous function, which is an oxidation reduction activity, and may participate in the tricarboxylic acid cicle. Most of homologies found points for the same protein, which strengs the ideia presented above.


To search for biological function in other ORF's we run a BASTx, and found known homology, that is also very significant, with a good E-value (4e-133) bigger than for the choosen ORF and also a bigger score (_478). This means that the chosen ORF not produces the best alignment, and may exist other homologs proteins, perhaps better than the homologous of our ORF, but with the same protein function.

RAW RESULTS

a)BLASTp com ORF

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05068692.1|  succinate dehydrogenase iron-sulfur protei...   468    2e-130
ref|YP_265666.1|  succinate dehydrogenase iron-sulfur subunit ...   443    7e-123
ref|ZP_01264594.1|  succinate dehydrogenase [Candidatus Pelagi...   443    7e-123
ref|ZP_06055687.1|  succinate dehydrogenase iron-sulfur subuni...   368    4e-100
ref|YP_538560.1|  succinate dehydrogenase iron-sulfur subunit ...   324    6e-87 
ref|YP_001938646.1|  succinate dehydrogenase iron-sulfur subun...   323    1e-86 
ref|ZP_05062250.1|  succinate dehydrogenase iron-sulfur protei...   322    2e-86 
ref|YP_001249012.1|  succinate dehydrogenase iron-sulfur subun...   322    3e-86 
ref|YP_426293.1|  succinate dehydrogenase iron-sulfur subunit ...   322    3e-86 
ref|YP_354063.1|  succinate dehydrogenase iron-sulfur subunit ...   321    4e-86 
ref|NP_105173.1|  succinate dehydrogenase iron-sulfur subunit ...   320    6e-86 
ref|ZP_05812399.1|  succinate dehydrogenase and fumarate reduc...   320    7e-86 
ref|ZP_01003249.1|  succinate dehydrogenase [Loktanella vestfo...   320    7e-86 
ref|YP_002551002.1|  succinate dehydrogenase iron-sulfur [Agro...   320    8e-86 
ref|YP_001412713.1|  succinate dehydrogenase and fumarate redu...   320    8e-86 
ref|YP_742174.1|  succinate dehydrogenase iron-sulfur subunit ...   320    8e-86 
ref|YP_001534195.1|  succinate dehydrogenase [Dinoroseobacter ...   320    1e-85 
ref|YP_001833808.1|  succinate dehydrogenase and fumarate redu...   319    1e-85 
ref|NP_355579.1|  succinate dehydrogenase iron-sulfur subunit ...   319    2e-85 
ref|ZP_01037846.1|  succinate dehydrogenase [Roseovarius sp. 2...   318    4e-85 
ref|ZP_01756189.1|  succinate dehydrogenase iron-sulfur subuni...   318    4e-85 
ref|NP_220438.1|  succinate dehydrogenase iron-sulfur subunit ...   318    5e-85 
ref|YP_001166307.1|  succinate dehydrogenase iron-sulfur subun...   317    6e-85 
ref|YP_914380.1|  succinate dehydrogenase iron-sulfur subunit ...   317    7e-85 
ref|ZP_00956311.1|  succinate dehydrogenase [Sulfitobacter sp....   317    9e-85 
ref|YP_001975350.1|  succinate dehydrogenase, iron-sulfur prot...   317    9e-85 
ref|ZP_02151623.1|  succinate dehydrogenase iron-sulfur subuni...   317    1e-84 
ref|YP_681943.1|  succinate dehydrogenase iron-sulfur subunit ...   317    1e-84 
ref|NP_778584.1|  succinate dehydrogenase iron-sulfur subunit ...   316    1e-84 
ref|ZP_00651885.1|  Succinate dehydrogenase/fumarate reductase...   316    1e-84 
ref|YP_002827622.1|  succinate dehydrogenase iron-sulfur prote...   316    1e-84 
ref|ZP_05078230.1|  succinate dehydrogenase, iron-sulfur prote...   316    2e-84 
ref|YP_001498933.1|  succinate dehydrogenase iron-sulfur subun...   316    2e-84 
ref|ZP_00959156.1|  succinate dehydrogenase [Roseovarius nubin...   316    2e-84 
ref|ZP_01878341.1|  succinate dehydrogenase iron-sulfur subuni...   316    2e-84 
ref|YP_507137.1|  succinate dehydrogenase iron-sulfur subunit ...   315    2e-84 
dbj|BAH22200.1|  succinate dehydrogenase, iron-sulfur protein ...   315    2e-84 
ref|ZP_05074885.1|  succinate dehydrogenase, iron-sulfur prote...   315    2e-84 
ref|ZP_05179779.1|  succinate dehydrogenase iron-sulfur subuni...   315    3e-84 
ref|YP_003576908.1|  succinate dehydrogenase, iron-sulfur subu...   315    3e-84 
ref|NP_539080.1|  succinate dehydrogenase iron-sulfur subunit ...   315    3e-84 
ref|ZP_01444049.1|  succinate dehydrogenase catalytic subunit ...   315    3e-84 
ref|NP_387175.1|  succinate dehydrogenase iron-sulfur subunit ...   315    4e-84 
ref|NP_698879.1|  succinate dehydrogenase iron-sulfur subunit ...   315    4e-84 
ref|ZP_05153300.1|  succinate dehydrogenase iron-sulfur subuni...   315    4e-84 
ref|YP_001593705.1|  succinate dehydrogenase iron-sulfur subun...   315    4e-84 
ref|NP_298363.1|  succinate dehydrogenase iron-sulfur subunit ...   314    4e-84 
ref|ZP_02141587.1|  succinate dehydrogenase iron-sulfur subuni...   314    5e-84 
ref|YP_001971624.1|  putative succinate dehydrogenase iron-sul...   314    5e-84 
ref|YP_001492917.1|  succinate dehydrogenase iron-sulfur subun...   314    6e-84 
ref|ZP_05124579.1|  succinate dehydrogenase, iron-sulfur prote...   314    6e-84 
ref|ZP_05376667.1|  succinate dehydrogenase and fumarate reduc...   314    7e-84 
ref|YP_246152.1|  succinate dehydrogenase iron-sulfur subunit ...   314    7e-84 
ref|YP_197591.1|  succinate dehydrogenase iron-sulfur subunit ...   314    7e-84 
ref|ZP_00681580.1|  Succinate dehydrogenase/fumarate reductase...   314    7e-84 
ref|ZP_05053465.1|  succinate dehydrogenase and fumarate reduc...   313    8e-84 
ref|ZP_05162373.1|  succinate dehydrogenase iron-sulfur subuni...   313    8e-84 
ref|ZP_06791815.1|  succinate dehydrogenase iron-sulfur protei...   313    9e-84 
ref|YP_002916363.1|  succinate dehydrogenase iron-sulfur subun...   313    1e-83 
ref|ZP_01750590.1|  succinate dehydrogenase, iron-sulfur prote...   313    1e-83 
ref|ZP_00142453.1|  succinate dehydrogenase iron-sulfur protei...   313    1e-83 
ref|NP_359706.1|  succinate dehydrogenase iron-sulfur subunit ...   313    1e-83 
ref|YP_001649419.1|  succinate dehydrogenase iron-sulfur subun...   313    2e-83 
ref|ZP_04698698.1|  succinate dehydrogenase iron-sulfur subuni...   313    2e-83 
ref|YP_001494184.1|  succinate dehydrogenase iron-sulfur subun...   312    2e-83 
ref|YP_002546003.1|  succinate dehydrogenase subunit B [Agroba...   312    2e-83 
ref|ZP_02168492.1|  succinate dehydrogenase subunit B, iron-su...   312    2e-83 
ref|ZP_03786136.1|  aspartate kinase [Brucella ceti str. Cudo]...   312    2e-83 
ref|ZP_04681361.1|  succinate dehydrogenase and fumarate reduc...   312    2e-83 
ref|YP_002844781.1|  Succinate dehydrogenase iron-sulfur prote...   312    3e-83 
ref|YP_003065457.1|  succinate dehydrogenase iron-sulfur subun...   312    3e-83 
ref|ZP_05342805.1|  succinate dehydrogenase iron-sulfur subuni...   312    3e-83 
ref|ZP_05088244.1|  succinate dehydrogenase, iron-sulfur prote...   312    3e-83 
ref|ZP_01446908.1|  succinate dehydrogenase catalytic subunit ...   311    3e-83 
ref|ZP_06122130.1|  succinate dehydrogenase and fumarate reduc...   311    3e-83 
ref|ZP_02190356.1|  Succinate dehydrogenase/fumarate reductase...   311    3e-83 
ref|YP_508746.1|  succinate dehydrogenase iron-sulfur subunit ...   311    3e-83 
ref|YP_180543.1|  succinate dehydrogenase iron-sulfur subunit ...   311    3e-83 
ref|ZP_05779806.1|  succinate dehydrogenase iron-sulfur subuni...   311    4e-83 
ref|ZP_05785489.1|  succinate dehydrogenase iron-sulfur subuni...   311    4e-83 
ref|YP_067054.1|  succinate dehydrogenase iron-sulfur subunit ...   311    5e-83 
ref|ZP_01547939.1|  succinate dehydrogenase iron-sulfur subuni...   311    5e-83 
ref|ZP_01057543.1|  succinate dehydrogenase, iron-sulfur prote...   311    5e-83 
ref|ZP_01746135.1|  succinate dehydrogenase catalytic subunit ...   311    5e-83 
ref|YP_363976.1|  succinate dehydrogenase iron-sulfur subunit ...   311    5e-83 
ref|YP_001491780.1|  succinate dehydrogenase iron-sulfur subun...   311    5e-83 
ref|NP_642399.1|  succinate dehydrogenase iron-sulfur subunit ...   311    6e-83 
ref|ZP_01740892.1|  succinate dehydrogenase iron-sulfur subuni...   310    6e-83 
ref|YP_770013.1|  succinate dehydrogenase iron-sulfur subunit ...   310    6e-83 
ref|YP_001686455.1|  succinate dehydrogenase iron-sulfur subun...   310    8e-83 
ref|ZP_03527675.1|  succinate dehydrogenase iron-sulfur subuni...   310    8e-83 
ref|ZP_02146357.1|  succinate dehydrogenase and fumarate reduc...   310    9e-83 
ref|YP_001001640.1|  succinate dehydrogenase iron-sulfur subun...   310    1e-82 
ref|ZP_01862980.1|  succinate dehydrogenase iron-sulfur subuni...   310    1e-82 
ref|ZP_06349613.1|  succinate dehydrogenase and fumarate reduc...   310    1e-82 
ref|YP_001369504.1|  succinate dehydrogenase iron-sulfur subun...   310    1e-82 
ref|YP_200946.1|  succinate dehydrogenase iron-sulfur subunit ...   310    1e-82 
ref|ZP_04771933.1|  succinate dehydrogenase and fumarate reduc...   310    1e-82 
ref|YP_471367.1|  succinate dehydrogenase iron-sulfur subunit ...   309    2e-82 
ref|YP_451214.1|  succinate dehydrogenase iron-sulfur subunit ...   309    2e-82 
ref|NP_422320.1|  succinate dehydrogenase iron-sulfur subunit ...   309    2e-82 
ref|ZP_06730342.1|  succinate dehydrogenase catalytic subunit ...   309    2e-82 
ref|ZP_00998440.1|  succinate dehydrogenase [Oceanicola batsen...   308    3e-82 
ref|YP_003376304.1|  putative succinate dehydrogenase catalyti...   308    3e-82 
ref|YP_001235003.1|  succinate dehydrogenase iron-sulfur subun...   308    3e-82 
ref|YP_001980285.1|  succinate dehydrogenase protein, iron-sul...   308    3e-82 
ref|ZP_05738936.1|  succinate dehydrogenase iron-sulfur subuni...   308    4e-82 
ref|ZP_01439837.1|  succinate dehydrogenase catalytic subunit ...   308    4e-82 
ref|YP_165624.1|  succinate dehydrogenase iron-sulfur subunit ...   308    5e-82 
ref|ZP_06490099.1|  succinate dehydrogenase iron-sulfur subuni...   308    5e-82 
ref|ZP_05112898.1|  succinate dehydrogenase and fumarate reduc...   307    5e-82 
ref|YP_675780.1|  succinate dehydrogenase iron-sulfur subunit ...   307    6e-82 
ref|YP_611764.1|  succinate dehydrogenase iron-sulfur subunit ...   307    6e-82 
ref|YP_303317.1|  succinate dehydrogenase iron-sulfur subunit ...   307    7e-82 
ref|ZP_01155535.1|  succinate dehydrogenase [Oceanicola granul...   307    8e-82 
ref|YP_002283177.1|  succinate dehydrogenase iron-sulfur subun...   307    8e-82 
ref|ZP_01012118.1|  succinate dehydrogenase [Rhodobacterales b...   307    9e-82 
ref|NP_637490.1|  succinate dehydrogenase iron-sulfur subunit ...   306    1e-81 
ref|ZP_01127589.1|  succinate dehydrogenase catalytic subunit ...   306    1e-81 
ref|ZP_01229060.1|  succinate dehydrogenase iron-sulfur protei...   306    2e-81 
ref|YP_003186571.1|  succinate dehydrogenase Fe-S protein subu...   305    2e-81 
ref|ZP_06487467.1|  succinate dehydrogenase iron-sulfur subuni...   305    2e-81 
ref|YP_003070040.1|  succinate dehydrogenase, iron-sulfur subu...   305    2e-81 
ref|YP_003058704.1|  succinate dehydrogenase and fumarate redu...   305    3e-81 
ref|YP_001641053.1|  succinate dehydrogenase and fumarate redu...   305    4e-81 
ref|YP_001601659.1|  succinate dehydrogenase iron-sulfur subun...   304    6e-81 
ref|YP_198430.1|  succinate dehydrogenase iron-sulfur subunit ...   304    7e-81 
ref|YP_003447358.1|  succinate dehydrogenase iron-sulfur prote...   303    9e-81 
emb|CAM75704.1|  succinate dehydrogenase iron-sulfur protein [...   303    9e-81 
ref|YP_002363813.1|  succinate dehydrogenase and fumarate redu...   303    1e-80 
ref|YP_001526662.1|  succinate dehydrogenase/fumarate reductas...   303    1e-80 
ref|YP_001416865.1|  succinate dehydrogenase and fumarate redu...   303    1e-80 
ref|YP_002129056.1|  succinate dehydrogenase, iron-sulfur prot...   303    2e-80 
ref|ZP_00054195.1|  COG0479: Succinate dehydrogenase/fumarate ...   303    2e-80 
ref|YP_001926923.1|  succinate dehydrogenase and fumarate redu...   303    2e-80 
ref|NP_966485.1|  succinate dehydrogenase iron-sulfur subunit ...   302    2e-80 
ref|YP_745898.1|  succinate dehydrogenase iron-sulfur subunit ...   302    2e-80 
ref|YP_113997.1|  succinate dehydrogenase iron-sulfur subunit ...   302    2e-80 
ref|YP_988429.1|  succinate dehydrogenase iron-sulfur subunit ...   302    2e-80 
ref|ZP_01039842.1|  succinate dehydrogenase [Erythrobacter sp....   301    3e-80 
ref|ZP_05099351.1|  succinate dehydrogenase, iron-sulfur prote...   301    3e-80 
ref|ZP_05844572.1|  succinate dehydrogenase and fumarate reduc...   301    4e-80 
ref|ZP_05084065.1|  succinate dehydrogenase, iron-sulfur prote...   301    4e-80 
ref|YP_003545883.1|  succinate dehydrogenase iron-sulfur prote...   301    4e-80 
ref|YP_423316.1|  succinate dehydrogenase iron-sulfur subunit ...   301    5e-80 
ref|YP_504783.1|  succinate dehydrogenase iron-sulfur subunit ...   301    6e-80 
ref|YP_001610501.1|  succinate dehydrogenase iron-sulfur subun...   301    6e-80 
ref|YP_002727289.1|  succinate dehydrogenase catalytic subunit...   301    6e-80 
ref|YP_153560.1|  succinate dehydrogenase iron-sulfur subunit ...   301    6e-80 
ref|YP_002563270.1|  succinate dehydrogenase iron-sulfur prote...   301    6e-80 
ref|ZP_00374638.1|  succinate dehydrogenase, iron-sulfur prote...   300    7e-80 
ref|YP_617276.1|  succinate dehydrogenase iron-sulfur subunit ...   300    7e-80 
ref|YP_458248.1|  succinate dehydrogenase iron-sulfur subunit ...   300    1e-79 
ref|YP_002300096.1|  succinate dehydrogenase iron-sulfur prote...   299    1e-79 
ref|YP_761920.1|  succinate dehydrogenase iron-sulfur subunit ...   299    2e-79 
ref|YP_497593.1|  succinate dehydrogenase iron-sulfur subunit ...   299    2e-79 
ref|YP_032796.1|  succinate dehydrogenase iron-sulfur subunit ...   299    2e-79 
ref|YP_001261807.1|  succinate dehydrogenase iron-sulfur subun...   299    2e-79 
ref|ZP_01303493.1|  succinate dehydrogenase iron-sulfur protei...   298    3e-79 
ref|YP_001753154.1|  succinate dehydrogenase and fumarate redu...   298    5e-79 
ref|YP_001772753.1|  succinate dehydrogenase and fumarate redu...   298    5e-79 
emb|CBG76060.1|  succinate dehydrogenase iron-sulfur subunit [...   297    6e-79 
ref|YP_034273.1|  succinate dehydrogenase iron-sulfur subunit ...   297    8e-79 
ref|YP_002502284.1|  succinate dehydrogenase and fumarate redu...   297    9e-79 
ref|YP_002972720.1|  succinate dehydrogenase, iron-sulfur prot...   296    9e-79 
ref|ZP_00957174.1|  succinate dehydrogenase [Oceanicaulis alex...   296    1e-78 
ref|ZP_01045468.1|  succinate dehydrogenase [Nitrobacter sp. N...   296    1e-78 
ref|YP_506417.1|  succinate dehydrogenase iron-sulfur subunit ...   295    5e-78 
ref|YP_003081729.1|  succinate dehydrogenase and fumarate redu...   294    6e-78 
ref|ZP_05063368.1|  succinate dehydrogenase, iron-sulfur prote...   294    6e-78 
ref|NP_767155.1|  succinate dehydrogenase iron-sulfur subunit ...   291    4e-77 
ref|YP_758063.1|  succinate dehydrogenase iron-sulfur subunit ...   291    5e-77 
ref|YP_319406.1|  succinate dehydrogenase iron-sulfur subunit ...   290    1e-76 
ref|YP_001236433.1|  succinate dehydrogenase iron-sulfur subun...   289    2e-76 
ref|YP_578807.1|  succinate dehydrogenase iron-sulfur subunit ...   289    2e-76 
ref|YP_001202448.1|  succinate dehydrogenase iron-sulfur subun...   288    3e-76 
ref|YP_002287304.1|  succinate dehydrogenase iron-sulfur subun...   286    1e-75 
ref|ZP_01901675.1|  succinate dehydrogenase catalytic subunit ...   286    1e-75 
ref|XP_001376844.1|  PREDICTED: hypothetical protein [Monodelp...   286    1e-75 
ref|XP_002590428.1|  hypothetical protein BRAFLDRAFT_273662 [B...   286    1e-75 
pdb|1ZOY|B  Chain B, Crystal Structure Of Mitochondrial Respir...   286    2e-75 
ref|NP_001098423.1|  succinate dehydrogenase complex subunit B...   286    2e-75 
ref|YP_529966.1|  succinate dehydrogenase iron-sulfur subunit ...   285    2e-75 
gb|ACO09839.1|  Succinate dehydrogenase iron-sulfur protein, m...   285    2e-75 
gb|ACQ58465.1|  Succinate dehydrogenase iron-sulfur subunit, m...   285    3e-75 
ref|ZP_06170419.1|  succinate dehydrogenase and fumarate reduc...   285    3e-75 
ref|ZP_05277788.1|  succinate dehydrogenase iron-sulfur subuni...   285    4e-75 
ref|ZP_05278757.1|  succinate dehydrogenase iron-sulfur subuni...   285    4e-75 
gb|ACO07425.1|  Succinate dehydrogenase iron-sulfur protein, m...   284    5e-75 
emb|CAG01723.1|  unnamed protein product [Tetraodon nigroviridis]   284    8e-75 
gb|ABD77138.1|  succinate dehydrogenase complex subunit B [Ory...   283    9e-75 
ref|XP_001421210.1|  predicted protein [Ostreococcus lucimarin...   283    1e-74 
gb|ABD77137.1|  succinate dehydrogenase complex subunit B [Lep...   283    1e-74 
gb|ABD77151.1|  succinate dehydrogenase complex subunit B [Sus...   283    1e-74 
gb|AAH43859.1|  Sdhb-prov protein [Xenopus laevis]                  283    1e-74 
ref|NP_001120000.1|  succinate dehydrogenase complex, subunit ...   283    2e-74 
ref|NP_001080247.1|  succinate dehydrogenase complex, subunit ...   283    2e-74 
ref|NP_001035573.1|  succinate dehydrogenase complex, subunit ...   283    2e-74 
ref|YP_003552156.1|  succinate dehydrogenase and fumarate redu...   282    2e-74 
ref|NP_001157295.1|  succinate dehydrogenase complex, subunit ...   282    2e-74 
ref|YP_483946.1|  succinate dehydrogenase iron-sulfur subunit ...   282    3e-74 
ref|NP_002991.2|  succinate dehydrogenase [ubiquinone] iron-su...   281    3e-74 
ref|XP_002433069.1|  succinate dehydrogenase, iron-sulfur subu...   281    3e-74 
gb|ABD77149.1|  succinate dehydrogenase complex subunit B [Bal...   281    3e-74 
ref|YP_567617.1|  succinate dehydrogenase iron-sulfur subunit ...   281    4e-74 
gb|ABD77144.1|  succinate dehydrogenase complex subunit B [Fel...   281    5e-74 
ref|XP_001617230.1|  iron-sulfur subunit of succinate dehydrog...   281    6e-74 
gb|ACZ71182.1|  mitochondrial succinate dehydrogenase iron sul...   281    6e-74 
ref|ZP_05032204.1|  succinate dehydrogenase and fumarate reduc...   281    6e-74 
ref|NP_945569.1|  succinate dehydrogenase iron-sulfur subunit ...   280    7e-74 
ref|ZP_06361469.1|  succinate dehydrogenase and fumarate reduc...   280    9e-74 
gb|ACO09927.1|  Succinate dehydrogenase iron-sulfur protein, m...   280    9e-74 
gb|ACO12876.1|  Succinate dehydrogenase iron-sulfur subunit, m...   280    9e-74 
ref|XP_001088349.1|  PREDICTED: succinate dehydrogenase comple...   280    9e-74 
ref|XP_535392.1|  PREDICTED: similar to Succinate dehydrogenas...   280    9e-74 
ref|NP_075863.2|  succinate dehydrogenase [ubiquinone] iron-su...   280    1e-73 
ref|XP_002298583.1|  predicted protein [Populus trichocarpa] >...   280    1e-73 
dbj|BAB22534.1|  unnamed protein product [Mus musculus]             280    1e-73 
gb|AAA81167.1|  succinate dehydrogenase iron-protein subunit [...   280    1e-73 
gb|EDL13335.1|  succinate dehydrogenase complex, subunit B, ir...   280    1e-73 
gb|ABD77140.1|  succinate dehydrogenase complex subunit B [Hom...   280    1e-73 
ref|NP_001074344.1|  succinate dehydrogenase [ubiquinone] iron...   280    1e-73 
gb|ABD77145.1|  succinate dehydrogenase complex subunit B [Equ...   280    1e-73 
gb|ABD77150.1|  succinate dehydrogenase complex subunit B [Hip...   280    1e-73 
pdb|1YQ3|B  Chain B, Avian Respiratory Complex Ii With Oxaloac...   280    1e-73 
gb|EEY57141.1|  succinate dehydrogenase iron-sulfur protein, m...   279    2e-73 
ref|YP_779453.1|  succinate dehydrogenase iron-sulfur subunit ...   279    2e-73 
gb|ABD77147.1|  succinate dehydrogenase complex subunit B [Dic...   279    2e-73 
ref|XP_001155328.1|  PREDICTED: succinate dehydrogenase comple...   279    2e-73 
gb|ABD77135.1|  succinate dehydrogenase complex subunit B [Mes...   279    2e-73 
gb|ABD77146.1|  succinate dehydrogenase complex subunit B [Cer...   279    2e-73 
ref|XP_002262205.1|  Iron-sulfur subunit of succinate dehydrog...   279    2e-73 
ref|XP_002723906.1|  PREDICTED: succinate dehydrogenase comple...   279    3e-73 
gb|ABD77143.1|  succinate dehydrogenase complex subunit B [Can...   278    3e-73 
ref|XP_794003.1|  PREDICTED: hypothetical protein [Strongyloce...   278    3e-73 
ref|ZP_01016827.1|  Succinate dehydrogenase iron-sulfur protei...   278    4e-73 
gb|ABD77129.1|  succinate dehydrogenase complex subunit B [Smi...   278    4e-73 
dbj|BAH72989.1|  iron-sulfur subunit of succinate dehydrogenas...   278    4e-73 
gb|AAA35708.1|  succinate-ubiquinone oxidoreductase Ip subunit...   278    4e-73 
emb|CAG06850.1|  unnamed protein product [Tetraodon nigroviridis]   278    4e-73 
ref|NP_001094009.1|  succinate dehydrogenase [ubiquinone] iron...   278    4e-73 
ref|NP_044798.1|  succinate:ubiquinone oxidoreductase subunit ...   278    5e-73 
gb|ABD77133.1|  succinate dehydrogenase complex subunit B [Mus...   278    5e-73 
ref|NP_189374.1|  SDH2-1; electron carrier/ succinate dehydrog...   277    6e-73 
emb|CAC19855.1|  mitochondrial succinate dehydrogenase iron-su...   277    6e-73 
ref|XP_308512.4|  AGAP007309-PA [Anopheles gambiae str. PEST] ...   277    7e-73 
ref|NP_001092210.1|  succinate dehydrogenase complex, subunit ...   277    7e-73 
ref|XP_864701.1|  PREDICTED: similar to Succinate dehydrogenas...   277    7e-73 
gb|ABD77136.1|  succinate dehydrogenase complex subunit B [Cav...   277    8e-73 
gb|ABD77141.1|  succinate dehydrogenase complex subunit B [Aot...   277    8e-73 
dbj|BAE41403.1|  unnamed protein product [Mus musculus]             277    8e-73 
gb|ACO12841.1|  Succinate dehydrogenase iron-sulfur subunit, m...   277    8e-73 
ref|XP_725298.1|  succinate dehydrogenase iron-sulfur subunit ...   277    9e-73 
ref|XP_002028083.1|  GL21331 [Drosophila persimilis] >gb|EDW37...   277    1e-72 
gb|ABR17434.1|  unknown [Picea sitchensis]                          276    1e-72 
gb|EDL13333.1|  succinate dehydrogenase complex, subunit B, ir...   276    1e-72 
ref|XP_001784121.1|  predicted protein [Physcomitrella patens ...   276    2e-72 
gb|ACI67402.1|  Succinate dehydrogenase iron-sulfur subunit, m...   276    2e-72 
ref|NP_001135166.1|  succinate dehydrogenase complex, subunit ...   276    2e-72 
ref|XP_678430.1|  iron-sulfur subunit of succinate dehydrogena...   276    2e-72 
ref|XP_002127020.1|  PREDICTED: similar to Sdhb-prov protein [...   275    2e-72 
ref|NP_059350.1|  succinate dehydrogenase iron-sulfur protein ...   275    2e-72 
ref|NP_198881.1|  SDH2-2; electron carrier/ succinate dehydrog...   275    3e-72 
gb|ADD20137.1|  succinate dehydrogenase Fe-s protein subunit [...   275    3e-72 
gb|AAM65047.1|  succinate dehydrogenase iron-protein subunit-l...   275    3e-72 
ref|XP_623566.1|  PREDICTED: similar to Succinate dehydrogenas...   275    3e-72 
gb|EFB22313.1|  hypothetical protein PANDA_013300 [Ailuropoda ...   275    4e-72 
ref|XP_001350535.1|  iron-sulfur subunit of succinate dehydrog...   275    4e-72 
ref|XP_850262.1|  PREDICTED: similar to Succinate dehydrogenas...   275    4e-72 
ref|XP_001660815.1|  succinate dehydrogenase [Aedes aegypti] >...   275    4e-72 
ref|NP_001164360.1|  succinate dehydrogenase [ubiquinone] iron...   275    4e-72 
gb|ACO08243.1|  Succinate dehydrogenase iron-sulfur protein, m...   275    4e-72 
ref|NP_477101.1|  succinate dehydrogenase B [Drosophila melano...   275    4e-72 
ref|XP_002089380.1|  GE19076 [Drosophila yakuba] >gb|EDW89092....   275    4e-72 
gb|ACI66514.1|  Succinate dehydrogenase iron-sulfur subunit, m...   275    5e-72 
gb|AAY66829.1|  succinate dehydrogenase Ip subunit [Ixodes sca...   275    5e-72 
ref|XP_002184001.1|  succinate dehydrogenase iron sulfur prote...   275    5e-72 
ref|XP_001992397.1|  GH24727 [Drosophila grimshawi] >gb|EDV921...   275    5e-72 
ref|XP_002032650.1|  GM20899 [Drosophila sechellia] >gb|EDW466...   274    5e-72 
ref|XP_002268523.1|  PREDICTED: hypothetical protein [Vitis vi...   274    5e-72 
ref|XP_001970722.1|  GG23224 [Drosophila erecta] >gb|EDV59781....   274    5e-72 
emb|CAC19856.1|  mitochondrial succinate dehydrogenase iron-su...   274    5e-72 
ref|ZP_03524843.1|  succinate dehydrogenase iron-sulfur subuni...   274    6e-72 
gb|AAY63983.1|  succinate dehydrogenase iron sulfur subunit B ...   274    6e-72 
ref|XP_002050487.1|  GJ22180 [Drosophila virilis] >gb|EDW61680...   274    7e-72 
gb|ACO15487.1|  Succinate dehydrogenase iron-sulfur subunit, m...   274    7e-72 
gb|ABD77131.1|  succinate dehydrogenase complex subunit B [Das...   274    7e-72 
ref|XP_743495.1|  iron-sulfur subunit of succinate dehydrogena...   274    7e-72 
ref|XP_001961283.1|  GF11072 [Drosophila ananassae] >gb|EDV381...   274    8e-72 
ref|XP_462382.1|  DEHA2G19382p [Debaryomyces hansenii CBS767] ...   274    8e-72 
gb|EDL80953.1|  succinate dehydrogenase complex, subunit B, ir...   273    9e-72 
gb|ACQ58642.1|  Succinate dehydrogenase iron-sulfur subunit, m...   273    9e-72 
ref|XP_001360158.1|  GA17170 [Drosophila pseudoobscura pseudoo...   273    1e-71 
ref|XP_001987146.1|  GH21756 [Drosophila grimshawi] >gb|EDW020...   273    1e-71 
ref|XP_002165357.1|  PREDICTED: similar to Sdhb-prov protein [...   273    1e-71 
gb|ABD77134.1|  succinate dehydrogenase complex subunit B [Rat...   273    1e-71 
ref|XP_002004991.1|  GI19303 [Drosophila mojavensis] >gb|EDW08...   273    1e-71 
ref|XP_002506801.1|  succinate dehydrogenase [Micromonas sp. R...   273    2e-71 
gb|ABD77132.1|  succinate dehydrogenase complex subunit B [Tam...   273    2e-71 
ref|XP_001643981.1|  hypothetical protein Kpol_1070p4 [Vanderw...   273    2e-71 
ref|XP_001355118.1|  GA20284 [Drosophila pseudoobscura pseudoo...   273    2e-71 
ref|ZP_03514998.1|  succinate dehydrogenase iron-sulfur subuni...   272    2e-71 
ref|XP_001988000.1|  GH10931 [Drosophila grimshawi] >gb|EDW028...   272    2e-71 
ref|XP_756991.1|  succinate dehydrogenase [Ustilago maydis 521...   272    3e-71 
ref|XP_002545754.1|  succinate dehydrogenase iron-sulfur prote...   272    3e-71 
ref|XP_002066043.1|  GK22142 [Drosophila willistoni] >gb|EDW77...   272    3e-71 
gb|AAM63946.1|  succinate dehydrogenase iron-protein subunit, ...   271    3e-71 
ref|XP_002526944.1|  succinate dehydrogenase, putative [Ricinu...   271    4e-71 
ref|XP_001838873.1|  hypothetical protein CC1G_09250 [Coprinop...   271    4e-71 
sp|Q70KF8.1|DHSB_UROFA  RecName: Full=Succinate dehydrogenase ...   270    7e-71 
gb|ABD77148.1|  succinate dehydrogenase complex subunit B [Bos...   270    8e-71 
gb|EEH54721.1|  predicted protein [Micromonas pusilla CCMP1545]     270    8e-71 
ref|NP_001155908.1|  Succinate dehydrogenase B [Acyrthosiphon ...   270    1e-70 
ref|NP_593530.1|  succinate dehydrogenase (ubiquinone) iron-su...   269    2e-70 
ref|NP_001165802.1|  succinate dehydrogenase [ubiquinone] iron...   269    2e-70 
ref|XP_001637002.1|  predicted protein [Nematostella vectensis...   269    2e-70 
gb|ABD77139.1|  succinate dehydrogenase complex subunit B [Tad...   269    2e-70 
ref|XP_002071510.1|  GK25101 [Drosophila willistoni] >gb|EDW82...   269    2e-70 
ref|XP_002422055.1|  succinate dehydrogenase, iron-sulfur prot...   269    2e-70 
sp|P48933.1|DHSB_CYACA  RecName: Full=Succinate dehydrogenase ...   268    3e-70 
ref|XP_712003.1|  hypothetical protein CaO19.8251 [Candida alb...   268    3e-70 
ref|XP_954510.1|  succinate dehydrogenase [ubiquinone] iron-su...   268    3e-70 
emb|CAA44612.1|  succinate dehydrogenase [Ustilago maydis] >gb...   268    4e-70 
gb|EDK39191.2|  hypothetical protein PGUG_03289 [Pichia guilli...   267    1e-69 
ref|XP_001483908.1|  hypothetical protein PGUG_03289 [Pichia g...   266    1e-69 
ref|XP_001696290.1|  iron-sulfur subunit of mitochondrial succ...   266    1e-69 
emb|CAD62367.1|  succinate dehydrogenase [Triticum aestivum]        266    1e-69 
gb|AAL90301.1|  RE03249p [Drosophila melanogaster]                  266    1e-69 
ref|XP_453977.1|  unnamed protein product [Kluyveromyces lacti...   266    1e-69 
ref|XP_001894995.1|  succinate dehydrogenase [ubiquinone] iron...   266    2e-69 
ref|XP_002616764.1|  succinate dehydrogenase iron-sulfur prote...   266    2e-69 
gb|ABD77128.1|  succinate dehydrogenase complex subunit B [Mon...   266    2e-69 
gb|ACG35757.1|  succinate dehydrogenase iron-sulfur protein,mi...   266    2e-69 
emb|CAC80855.1|  DHSB protein [Dendronephthya klunzingeri]          266    2e-69 
ref|NP_001136531.1|  hypothetical protein LOC100216648 [Zea ma...   266    2e-69 
gb|EEY18786.1|  succinate dehydrogenase iron-sulfur subunit [V...   266    2e-69 
emb|CAB42659.1|  iron sulfur subunit of succinate dehydrogenas...   265    2e-69 
ref|XP_572035.1|  succinate dehydrogenase iron-sulfur subunit ...   265    2e-69 
ref|NP_573340.1|  CG7349 [Drosophila melanogaster] >gb|AAF4890...   265    3e-69 
ref|XP_002579984.1|  succinate dehydrogenase iron-sulfur prote...   265    3e-69 
gb|AAV91323.1|  succinate dehydrogenase iron-sulfur protein [S...   265    3e-69 
ref|XP_002288459.1|  precursor of hydrogenase [Thalassiosira p...   265    3e-69 
ref|XP_001966870.1|  GF19050 [Drosophila ananassae] >gb|EDV339...   265    3e-69 
ref|NP_983339.1|  ACL065Cp [Ashbya gossypii ATCC 10895] >sp|Q7...   265    4e-69 
ref|XP_002113318.1|  expressed hypothetical protein [Trichopla...   265    4e-69 
ref|XP_369077.1|  conserved hypothetical protein [Magnaporthe ...   265    4e-69 
ref|NP_001060876.1|  Os08g0120000 [Oryza sativa (japonica cult...   265    5e-69 
dbj|BAH30231.1|  succinate dehydrogenase iron-sulfur protein s...   265    5e-69 
ref|XP_002629663.1|  C. briggsae CBR-SDHB-1 protein [Caenorhab...   265    5e-69 
ref|XP_002039348.1|  GM22932 [Drosophila sechellia] >gb|EDW560...   264    7e-69 
ref|XP_001876249.1|  predicted protein [Laccaria bicolor S238N...   264    8e-69 
gb|AAW52509.1|  succinate dehydrogenase iron sulphur protein [...   263    9e-69 
ref|XP_002107353.1|  GD17417 [Drosophila simulans] >gb|EDX1833...   263    1e-68 
ref|XP_002171552.1|  succinate dehydrogenase iron-sulfur subun...   263    1e-68 
ref|XP_445316.1|  unnamed protein product [Candida glabrata] >...   263    1e-68 
ref|XP_503189.1|  YALI0D23397p [Yarrowia lipolytica] >emb|CAG8...   263    1e-68 
gb|EAW94829.1|  succinate dehydrogenase complex, subunit B, ir...   263    1e-68 
ref|XP_001747850.1|  hypothetical protein [Monosiga brevicolli...   263    1e-68 
ref|XP_002010092.1|  GI14882 [Drosophila mojavensis] >gb|EDW07...   263    1e-68 
dbj|BAD06473.1|  iron-sulphar subunit protein of succinate deh...   263    1e-68 
sp|A8WPF0.2|DHSB_CAEBR  RecName: Full=Succinate dehydrogenase ...   263    2e-68 
dbj|BAD06472.1|  iron-sulphar subunit protein of succinate deh...   262    2e-68 
ref|XP_002058954.1|  GJ15311 [Drosophila virilis] >gb|EDW58023...   262    2e-68 
ref|XP_001525346.1|  succinate dehydrogenase iron-sulfur prote...   262    3e-68 
ref|XP_001977726.1|  GG19200 [Drosophila erecta] >gb|EDV46653....   262    3e-68 
ref|XP_001548350.1|  succinate dehydrogenase-ubiquinone-iron-s...   262    3e-68 
ref|XP_765737.1|  succinate dehydrogenase iron-sulfur subunit ...   261    4e-68 
ref|XP_001908552.1|  unnamed protein product [Podospora anseri...   261    4e-68 
ref|XP_001386475.1|  succinate dehydrogenase subunit [Pichia s...   261    4e-68 
ref|XP_002493357.1|  Iron-sulfur protein subunit of succinate ...   261    4e-68 
ref|XP_002498333.1|  ZYRO0G07788p [Zygosaccharomyces rouxii] >...   261    4e-68 
ref|XP_002403788.1|  succinate dehydrogenase, putative [Ixodes...   261    4e-68 
emb|CAY81199.1|  Sdh2p [Saccharomyces cerevisiae EC1118]            261    5e-68 
emb|CAT00089.1|  succinate dehydrogenase iron-sulfur subunit [...   261    6e-68 
ref|NP_495992.1|  Succinate DeHydrogenase complex subunit B fa...   261    7e-68 
ref|XP_965152.1|  succinate dehydrogenase iron-sulfur protein,...   261    7e-68 
emb|CBI52051.1|  unnamed protein product [Sordaria macrospora]      261    7e-68 
ref|XP_001642818.1|  hypothetical protein Kpol_388p3 [Vanderwa...   260    8e-68 
dbj|BAA23717.1|  iron-sulfur subunit of mitochondrial succinat...   260    8e-68 
emb|CAA75895.1|  succinate dehydrogenase iron-sulfur subunit [...   260    8e-68 
ref|NP_013059.1|  Iron-sulfur protein subunit of succinate deh...   260    1e-67 
gb|EER27088.1|  Succinate dehydrogenase iron-sulfur protein,mi...   259    1e-67 
dbj|BAA23716.1|  iron-sulfur subunit of succinate dehydrogenas...   259    2e-67 
gb|ACT83442.1|  SdhB [Botryotinia fuckeliana]                       259    3e-67 
ref|XP_002482757.1|  iron-sulfur protein subunit of succinate ...   258    3e-67 
ref|XP_002101683.1|  GE17763 [Drosophila yakuba] >gb|EDX02791....   258    4e-67 
gb|ACT83443.1|  SdhB [Botryotinia fuckeliana]                       258    4e-67 
ref|XP_001241858.1|  succinate dehydrogenase iron-sulfur prote...   258    5e-67 
gb|ACT83445.1|  SdhB [Botryotinia fuckeliana]                       258    5e-67 
ref|XP_002779883.1|  succinate dehydrogenase, putative [Perkin...   258    5e-67 
gb|ACT83444.1|  SdhB [Botryotinia fuckeliana]                       258    5e-67 
gb|ACT83446.1|  SdhB [Botryotinia fuckeliana]                       257    8e-67 
gb|ACT83447.1|  SdhB [Botryotinia fuckeliana]                       257    9e-67 
ref|XP_001729560.1|  hypothetical protein MGL_3104 [Malassezia...   257    1e-66 
ref|XP_002765391.1|  iron-sulfur subunit of succinate dehydrog...   256    1e-66 
ref|XP_002545027.1|  succinate dehydrogenase iron-sulfur prote...   256    1e-66 
gb|ACO57605.1|  succinate dehydrogenase complex subunit B [Gil...   256    1e-66 
gb|ACO57604.1|  succinate dehydrogenase complex subunit B [Gil...   256    2e-66 
ref|XP_002148462.1|  iron-sulfur protein subunit of succinate ...   255    2e-66 
ref|XP_001594577.1|  hypothetical protein SS1G_04384 [Scleroti...   255    2e-66 
ref|XP_002733638.1|  PREDICTED: succinate dehydrogenase B-like...   255    3e-66 
ref|XP_445854.1|  unnamed protein product [Candida glabrata] >...   255    3e-66 
ref|XP_002553731.1|  KLTH0E05742p [Lachancea thermotolerans] >...   255    4e-66 
ref|XP_001541166.1|  succinate dehydrogenase iron-sulfur prote...   253    1e-65 
gb|EEH06399.1|  succinate dehydrogenase iron-sulfur protein [A...   253    1e-65 
ref|XP_001274336.1|  iron-sulfur protein subunit of succinate ...   253    1e-65 
gb|ABW39788.1|  mitochondrial succinate dehydrogenase iron-sul...   253    1e-65 
gb|EER36874.1|  succinate dehydrogenase iron-sulphur protein [...   253    1e-65 
ref|XP_659936.1|  hypothetical protein AN2332.2 [Aspergillus n...   253    1e-65 
ref|XP_001259651.1|  iron-sulfur protein subunit of succinate ...   253    1e-65 
ref|XP_001933259.1|  succinate dehydrogenase iron-sulfur subun...   253    2e-65 
ref|ZP_03499775.1|  succinate dehydrogenase iron-sulfur subuni...   253    2e-65 
ref|XP_001793919.1|  hypothetical protein SNOG_03351 [Phaeosph...   252    2e-65 
gb|EEQ32692.1|  succinate dehydrogenase iron-sulfur subunit [M...   252    3e-65 
ref|NP_049294.1|  succinate:cytochrome c oxidoreductase subuni...   252    3e-65 
ref|XP_753605.1|  iron-sulfur protein subunit of succinate deh...   252    3e-65 
dbj|BAA22505.1|  iron-sulfur protein subunit [Pleurotus ostrea...   252    3e-65 
sp|P80477.1|DHSB_PORPU  RecName: Full=Succinate dehydrogenase ...   251    5e-65 
ref|NP_062488.1|  succinate:cytochrome c oxidoreductase subuni...   251    5e-65 
ref|ZP_01451021.1|  succinate dehydrogenase catalytic subunit ...   251    6e-65 
gb|ABW39789.1|  mitochondrial succinate dehydrogenase iron-sul...   251    6e-65 
ref|NP_001161244.1|  Succinate dehydrogenase [ubiquinone] iron...   251    8e-65 
ref|ZP_03511641.1|  succinate dehydrogenase iron-sulfur subuni...   250    8e-65 
gb|EFE30253.1|  hypothetical protein ARB_02933 [Arthroderma be...   250    9e-65 
gb|ABW39793.1|  mitochondrial succinate dehydrogenase iron-sul...   250    9e-65 
ref|XP_001088018.1|  PREDICTED: succinate dehydrogenase comple...   250    1e-64 
ref|XP_002568026.1|  Pc21g09900 [Penicillium chrysogenum Wisco...   250    1e-64 
gb|ABD77142.1|  succinate dehydrogenase complex subunit B [Tup...   250    1e-64 
ref|XP_002626245.1|  succinate dehydrogenase iron-sulfur prote...   249    1e-64 
ref|XP_513112.2|  PREDICTED: similar to Succinate dehydrogenas...   249    1e-64 
ref|XP_001827486.1|  hypothetical protein [Aspergillus oryzae ...   249    1e-64 
ref|XP_001610457.1|  succinate dehydrogenase iron-sulfur subun...   249    2e-64 
ref|XP_646559.1|  succinate dehydrogenase [Dictyostelium disco...   248    3e-64 
ref|ZP_01914424.1|  succinate dehydrogenase iron-sulfur subuni...   248    4e-64 
ref|XP_002370847.1|  iron-sulfur subunit of succinate dehydrog...   248    5e-64 
gb|EDL80956.1|  succinate dehydrogenase complex, subunit B, ir...   248    6e-64 
dbj|BAG80571.1|  succinate dehydrogenase iron-sulfur subunit [...   247    8e-64 
sp|O42772.1|DHSB_MYCGR  RecName: Full=Succinate dehydrogenase ...   246    1e-63 
dbj|BAG80574.1|  succinate dehydrogenase iron-sulfur subunit [...   246    1e-63 
ref|NP_880996.1|  succinate dehydrogenase iron-sulfur subunit ...   246    2e-63 
dbj|BAG80573.1|  succinate dehydrogenase iron-sulfur subunit [...   246    2e-63 
gb|EEH16466.1|  succinate dehydrogenase iron-sulfur subunit [P...   245    3e-63 
gb|EDL13334.1|  succinate dehydrogenase complex, subunit B, ir...   245    3e-63 
ref|YP_785707.1|  succinate dehydrogenase iron-sulfur protein ...   244    5e-63 
ref|XP_001216213.1|  succinate dehydrogenase iron-sulfur prote...   244    5e-63 
gb|ABD77130.1|  succinate dehydrogenase complex subunit B [Lox...   244    8e-63 
ref|ZP_01223999.1|  succinate dehydrogenase (B subunit) [marin...   243    1e-62 
ref|YP_001021358.1|  succinate dehydrogenase subunit B [Methyl...   243    1e-62 
ref|XP_002189250.1|  PREDICTED: putative succinate dehydrogena...   243    1e-62 
ref|ZP_06686503.1|  succinate dehydrogenase iron-sulfur subuni...   243    1e-62 
ref|YP_983255.1|  succinate dehydrogenase and fumarate reducta...   242    3e-62 
ref|YP_001630431.1|  succinate dehydrogenase iron-sulfur subun...   242    3e-62 
ref|YP_550406.1|  succinate dehydrogenase subunit B [Polaromon...   242    3e-62 
ref|YP_693217.1|  succinate dehydrogenase, iron-sulfur [Alcani...   241    4e-62 
ref|YP_002908367.1|  Succinate dehydrogenase/fumarate reductas...   241    4e-62 
gb|ABD77127.1|  succinate dehydrogenase complex subunit B [Did...   241    4e-62 
ref|ZP_05043355.1|  succinate dehydrogenase and fumarate reduc...   241    4e-62 
ref|YP_001563447.1|  succinate dehydrogenase and fumarate redu...   241    5e-62 
ref|YP_573270.1|  succinate dehydrogenase iron-sulfur subunit ...   241    6e-62 
ref|YP_584629.1|  succinate dehydrogenase iron-sulfur subunit ...   240    8e-62 
ref|ZP_05315855.1|  succinate dehydrogenase and fumarate reduc...   240    8e-62 
ref|YP_927303.1|  succinate dehydrogenase iron-sulfur subunit ...   240    9e-62 
ref|NP_680465.2|  SDH2-3; electron carrier/ succinate dehydrog...   240    1e-61 
ref|YP_727079.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|NP_520114.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|YP_296528.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|ZP_00372228.1|  succinate dehydrogenase, iron-sulfur prote...   240    1e-61 
ref|YP_001892881.1|  succinate dehydrogenase and fumarate redu...   240    1e-61 
ref|YP_999072.1|  succinate dehydrogenase and fumarate reducta...   240    1e-61 
ref|YP_527579.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|YP_411555.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|ZP_06211027.1|  succinate dehydrogenase and fumarate reduc...   240    1e-61 
ref|YP_970553.1|  succinate dehydrogenase subunit B [Acidovora...   239    1e-61 
ref|YP_001100056.1|  succinate dehydrogenase iron-sulfur subun...   239    1e-61 
ref|NP_842366.1|  succinate dehydrogenase iron-sulfur subunit ...   239    1e-61 
ref|XP_002141075.1|  succinate dehydrogenase [ubiquinone] iron...   239    2e-61 
ref|ZP_04958194.1|  succinate dehydrogenase, iron-sulfur subun...   239    2e-61 
ref|ZP_05126261.1|  succinate dehydrogenase, iron-sulfur subun...   239    2e-61 
ref|ZP_01101179.1|  succinate dehydrogenase, iron-sulfur prote...   238    3e-61 
ref|YP_001861710.1|  succinate dehydrogenase and fumarate redu...   238    4e-61 
ref|YP_002943344.1|  succinate dehydrogenase and fumarate redu...   238    6e-61 
ref|XP_002163025.1|  PREDICTED: similar to Succinate dehydroge...   238    6e-61 
ref|YP_001891015.1|  succinate dehydrogenase iron-sulfur subun...   238    7e-61 
ref|YP_001900075.1|  succinate dehydrogenase and fumarate redu...   237    7e-61 
ref|ZP_06469908.1|  succinate dehydrogenase and fumarate reduc...   237    9e-61 
ref|YP_001353199.1|  succinate dehydrogenase iron-sulfur subun...   237    9e-61 
ref|ZP_02882192.1|  succinate dehydrogenase and fumarate reduc...   237    9e-61 
ref|XP_001122922.1|  PREDICTED: similar to Succinate dehydroge...   237    9e-61 
ref|ZP_04763573.1|  succinate dehydrogenase and fumarate reduc...   237    1e-60 
emb|CAM32703.1|  Succinate dehydrogenase Fe-S protein subunit ...   236    1e-60 
ref|XP_002264752.1|  PREDICTED: hypothetical protein [Vitis vi...   236    2e-60 
ref|YP_002796409.1|  SdhB [Laribacter hongkongensis HLHK9] >gb...   236    2e-60 
dbj|BAA31216.1|  fumarate reductase iron-sulpher protein subun...   236    2e-60 
gb|EFA84800.1|  succinate dehydrogenase [Polysphondylium palli...   236    2e-60 
ref|XP_002534311.1|  succinate dehydrogenase, putative [Ricinu...   236    2e-60 
ref|NP_746307.1|  succinate dehydrogenase iron-sulfur subunit ...   236    2e-60 
ref|YP_003524454.1|  succinate dehydrogenase and fumarate redu...   236    2e-60 
ref|YP_001791733.1|  succinate dehydrogenase and fumarate redu...   236    2e-60 
ref|ZP_03271142.1|  succinate dehydrogenase and fumarate reduc...   236    2e-60 
ref|YP_002908476.1|  Succinate dehydrogenase and fumarate redu...   236    2e-60 
ref|YP_169150.1|  succinate dehydrogenase iron-sulfur subunit ...   236    2e-60 
ref|YP_899248.1|  succinate dehydrogenase iron-sulfur subunit ...   236    3e-60 
ref|YP_001093780.1|  succinate dehydrogenase iron-sulfur subun...   235    3e-60 
ref|ZP_03266729.1|  succinate dehydrogenase and fumarate reduc...   235    3e-60 
ref|YP_002800119.1|  succinate dehydrogenase iron-sulfur subun...   235    4e-60 
gb|AAX77761.1|  unknown protein [synthetic construct]               235    4e-60 
ref|YP_001677696.1|  succinate dehydrogenase iron-sulfur subun...   235    4e-60 
ref|ZP_01625259.1|  succinate dehydrogenase iron-sulfur subuni...   234    4e-60 
ref|YP_621202.1|  succinate dehydrogenase iron-sulfur subunit ...   234    5e-60 
ref|ZP_03542044.1|  succinate dehydrogenase and fumarate reduc...   234    5e-60 
ref|YP_001981990.1|  succinate dehydrogenase iron-sulfur subun...   234    5e-60 
ref|YP_747091.1|  succinate dehydrogenase iron-sulfur subunit ...   234    5e-60 
ref|NP_900738.1|  succinate dehydrogenase iron-sulfur subunit ...   234    6e-60 
ref|YP_001341648.1|  succinate dehydrogenase iron-sulfur subun...   234    6e-60 
ref|ZP_03697617.1|  succinate dehydrogenase and fumarate reduc...   234    6e-60 
gb|ACF79054.1|  unknown [Zea mays]                                  234    7e-60 
ref|ZP_04985894.1|  succinate dehydrogenase iron-sulfur protei...   234    8e-60 
ref|YP_001750365.1|  succinate dehydrogenase iron-sulfur subun...   234    9e-60 
ref|YP_609160.1|  succinate dehydrogenase iron-sulfur subunit ...   234    9e-60 
ref|ZP_01305541.1|  succinate dehydrogenase, iron-sulfur prote...   233    1e-59 
ref|ZP_01042323.1|  succinate dehydrogenase [Idiomarina baltic...   233    1e-59 
ref|YP_003146722.1|  succinate dehydrogenase and fumarate redu...   233    1e-59 
gb|EEU43008.1|  predicted protein [Nectria haematococca mpVI 7...   233    1e-59 
ref|ZP_01075067.1|  Succinate dehydrogenase/fumarate reductase...   233    1e-59 
ref|YP_435868.1|  succinate dehydrogenase iron-sulfur subunit ...   233    1e-59 
ref|YP_003073952.1|  succinate dehydrogenase / fumarate reduct...   233    1e-59 
ref|YP_314943.1|  succinate dehydrogenase subunit B [Thiobacil...   233    2e-59 
ref|YP_514410.1|  succinate dehydrogenase iron-sulfur subunit ...   233    2e-59 
ref|YP_001760215.1|  succinate dehydrogenase and fumarate redu...   233    2e-59 
ref|XP_002462291.1|  hypothetical protein SORBIDRAFT_02g023310...   233    2e-59 
ref|YP_003519469.1|  SdhB [Pantoea ananatis LMG 20103] >gb|ADD...   233    2e-59 
ref|ZP_01114264.1|  succinate dehydrogenase, iron-sulfur prote...   233    2e-59 
ref|ZP_03455873.1|  succinate dehydrogenase and fumarate reduc...   232    3e-59 
ref|YP_106517.1|  succinate dehydrogenase iron-sulfur subunit ...   232    3e-59 
ref|ZP_01892760.1|  succinate dehydrogenase iron-sulfur subuni...   232    3e-59 
ref|ZP_02417039.1|  succinate dehydrogenase iron-sulfur subuni...   232    3e-59 
ref|ZP_04889099.1|  succinate dehydrogenase and fumarate reduc...   231    4e-59 
ref|YP_003332775.1|  succinate dehydrogenase and fumarate redu...   231    4e-59 
ref|YP_001674706.1|  succinate dehydrogenase iron-sulfur subun...   231    4e-59 
ref|ZP_01768559.1|  succinate dehydrogenase and fumarate reduc...   231    4e-59 
ref|YP_112265.1|  succinate dehydrogenase iron-sulfur subunit ...   231    4e-59 
ref|ZP_02376333.1|  succinate dehydrogenase iron-sulfur subuni...   231    4e-59 
ref|ZP_05876599.1|  succinate dehydrogenase iron-sulfur protei...   231    5e-59 
ref|XP_385786.1|  hypothetical protein FG05610.1 [Gibberella z...   231    5e-59 
emb|CBA73768.1|  succinate dehydrogenase iron-sulfur protein [...   231    5e-59 
ref|YP_002126172.1|  succinate dehydrogenase catalytic subunit...   231    5e-59 
ref|YP_001077078.1|  succinate dehydrogenase iron-sulfur subun...   231    5e-59 
ref|YP_001349044.1|  succinate dehydrogenase iron-sulfur subun...   231    6e-59 
ref|YP_286062.1|  succinate dehydrogenase iron-sulfur subunit ...   231    6e-59 
ref|ZP_03577970.1|  succinate dehydrogenase iron-sulfur subuni...   231    6e-59 
ref|YP_737759.1|  succinate dehydrogenase iron-sulfur subunit ...   231    6e-59 
ref|ZP_05068351.1|  succinate dehydrogenase iron-sulfur protei...   231    6e-59 
ref|YP_002871455.1|  succinate dehydrogenase iron-sulfur prote...   231    7e-59 
ref|ZP_01706465.1|  succinate dehydrogenase and fumarate reduc...   231    7e-59 
ref|YP_258843.1|  succinate dehydrogenase iron-sulfur subunit ...   231    7e-59 
ref|ZP_02476785.1|  succinate dehydrogenase iron-sulfur subuni...   231    7e-59 
ref|ZP_05731904.1|  succinate dehydrogenase and fumarate reduc...   231    8e-59 
ref|YP_963129.1|  succinate dehydrogenase iron-sulfur subunit ...   231    8e-59 
ref|ZP_05082141.1|  SdhB succinate dehydrogenase (iron-sulfur ...   231    8e-59 
ref|ZP_05969169.1|  succinate dehydrogenase, iron-sulfur prote...   231    8e-59 
gb|AAT50386.1|  PA1584 [synthetic construct]                        230    9e-59 
ref|ZP_01449549.1|  succinate dehydrogenase catalytic subunit ...   230    9e-59 
ref|NP_250275.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|ZP_01814755.1|  succinate dehydrogenase iron-sulfur subuni...   230    1e-58 
ref|ZP_02369744.1|  succinate dehydrogenase, iron-sulfur prote...   230    1e-58 
ref|YP_001908229.1|  succinate dehydrogenase iron-sulfur subun...   230    1e-58 
ref|ZP_01869370.1|  succinate dehydrogenase iron-sulfur subuni...   230    1e-58 
ref|YP_372904.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|YP_002649435.1|  Succinate dehydrogenase, iron sulfur prot...   230    1e-58 
ref|YP_263409.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|ZP_04617352.1|  Succinate dehydrogenase iron-sulfur protei...   230    1e-58 
ref|XP_974251.1|  PREDICTED: similar to succinate dehydrogenas...   230    1e-58 
ref|YP_001183790.1|  succinate dehydrogenase iron-sulfur subun...   230    1e-58 
ref|YP_438562.1|  succinate dehydrogenase, iron-sulfur protein...   230    1e-58 
ref|NP_717536.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|YP_001501645.1|  succinate dehydrogenase iron-sulfur subun...   230    1e-58 
ref|ZP_05498372.1|  succinate dehydrogenase and fumarate reduc...   229    2e-58 
ref|YP_003005216.1|  succinate dehydrogenase and fumarate redu...   229    2e-58 
ref|YP_347345.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|YP_001050878.1|  succinate dehydrogenase and fumarate redu...   229    2e-58 
ref|YP_751028.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|YP_002986770.1|  succinate dehydrogenase and fumarate redu...   229    2e-58 
ref|XP_572036.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|ZP_02159770.1|  succinate dehydrogenase catalytic subunit ...   229    2e-58 
ref|YP_579378.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|ZP_05618842.1|  succinate dehydrogenase iron-sulfur subuni...   229    2e-58 
ref|YP_775203.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|YP_733767.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|ZP_05971151.1|  succinate dehydrogenase, iron-sulfur prote...   229    2e-58 
ref|YP_624285.1|  succinate dehydrogenase iron-sulfur subunit ...   229    3e-58 
ref|YP_001116844.1|  succinate dehydrogenase iron-sulfur subun...   229    3e-58 
ref|YP_523058.1|  succinate dehydrogenase and fumarate reducta...   229    3e-58 
ref|YP_001810513.1|  succinate dehydrogenase and fumarate redu...   229    3e-58 
ref|YP_001585460.1|  succinate dehydrogenase iron-sulfur subun...   229    3e-58 
ref|YP_003530525.1|  succinate dehydrogenase, iron sulfur prot...   229    3e-58 
gb|AAO39688.1|  succinate dehydrogenase iron-sulfur protein [E...   228    3e-58 
gb|EAZ08849.1|  hypothetical protein OsI_31111 [Oryza sativa I...   228    3e-58 
ref|YP_001155543.1|  succinate dehydrogenase and fumarate redu...   228    3e-58 
emb|CBK85659.1|  succinate dehydrogenase subunit B [Enterobact...   228    3e-58 
ref|YP_001187992.1|  succinate dehydrogenase iron-sulfur subun...   228    3e-58 
ref|YP_001584615.1|  succinate dehydrogenase iron-sulfur subun...   228    3e-58 
ref|YP_001172390.1|  succinate dehydrogenase iron-sulfur subun...   228    4e-58 
ref|ZP_03571737.1|  succinate dehydrogenase iron-sulfur subuni...   228    4e-58 
ref|NP_001063018.1|  Os09g0370300 [Oryza sativa (japonica cult...   228    4e-58 
ref|YP_001477498.1|  succinate dehydrogenase iron-sulfur subun...   228    4e-58 
ref|YP_001797849.1|  succinate dehydrogenase and fumarate redu...   228    4e-58 
ref|ZP_02359344.1|  succinate dehydrogenase iron-sulfur subuni...   228    4e-58 
ref|YP_933056.1|  succinate dehydrogenase iron-sulfur subunit ...   228    4e-58 
ref|ZP_06054024.1|  succinate dehydrogenase iron-sulfur protei...   228    4e-58 
ref|YP_438862.1|  succinate dehydrogenase iron-sulfur subunit ...   228    5e-58 
ref|YP_106305.1|  succinate dehydrogenase iron-sulfur subunit ...   228    5e-58 
ref|ZP_04831435.1|  succinate dehydrogenase and fumarate reduc...   228    5e-58 
ref|YP_049466.1|  succinate dehydrogenase iron-sulfur subunit ...   228    6e-58 
ref|ZP_06641508.1|  succinate dehydrogenase [Serratia odorifer...   228    7e-58 
ref|NP_415252.1|  succinate dehydrogenase, FeS subunit [Escher...   228    7e-58 
ref|YP_003557485.1|  succinate dehydrogenase, iron-sulfur prot...   227    7e-58 
ref|YP_204205.1|  succinate dehydrogenase iron-sulfur subunit ...   227    7e-58 
ref|ZP_06155773.1|  succinate dehydrogenase iron-sulfur protei...   227    8e-58 
ref|YP_402339.1|  succinate dehydrogenase iron-sulfur subunit ...   227    8e-58 
ref|YP_003260450.1|  succinate dehydrogenase and fumarate redu...   227    8e-58 
ref|YP_002262352.1|  succinate dehydrogenase iron-sulfur subun...   227    8e-58 
ref|YP_002417833.1|  succinate dehydrogenase iron-sulfur subun...   227    9e-58 
ref|YP_563189.1|  succinate dehydrogenase iron-sulfur subunit ...   227    9e-58 
ref|ZP_03828418.1|  succinate dehydrogenase iron-sulfur subuni...   227    9e-58 
ref|ZP_01065971.1|  succinate dehydrogenase [Vibrio sp. MED222...   227    1e-57 
ref|YP_001279169.1|  succinate dehydrogenase iron-sulfur subun...   227    1e-57 
ref|NP_670367.1|  succinate dehydrogenase iron-sulfur subunit ...   227    1e-57 
ref|ZP_00992235.1|  succinate dehydrogenase [Vibrio splendidus...   227    1e-57 
ref|ZP_06192040.1|  succinate dehydrogenase iron-sulfur subuni...   227    1e-57 
ref|YP_661373.1|  succinate dehydrogenase and fumarate reducta...   227    1e-57 
ref|YP_552453.1|  succinate dehydrogenase iron-sulfur subunit ...   227    1e-57 
ref|ZP_04561169.1|  succinate dehydrogenase iron-sulfur subuni...   226    1e-57 
ref|ZP_04629825.1|  Succinate dehydrogenase iron-sulfur protei...   226    1e-57 
ref|ZP_06124570.1|  succinate dehydrogenase, iron-sulfur prote...   226    1e-57 
ref|YP_002924625.1|  succinate dehydrogenase, Fe-S protein [Ca...   226    1e-57 
ref|YP_001585729.1|  succinate dehydrogenase and fumarate redu...   226    1e-57 
ref|YP_003016819.1|  succinate dehydrogenase and fumarate redu...   226    1e-57 
ref|ZP_02959668.1|  hypothetical protein PROSTU_01554 [Provide...   226    1e-57 
ref|ZP_06353731.1|  succinate dehydrogenase, iron-sulfur prote...   226    1e-57 
ref|YP_001890516.1|  succinate dehydrogenase and fumarate redu...   226    2e-57 
ref|ZP_01617015.1|  Succinate dehydrogenase/fumarate reductase...   226    2e-57 
ref|ZP_06457356.1|  succinate dehydrogenase iron-sulfur subuni...   226    2e-57 
ref|YP_274203.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|YP_235089.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|YP_003364345.1|  succinate dehydrogenase iron-sulfur prote...   226    2e-57 
ref|NP_792019.1|  succinate dehydrogenase, iron-sulfur protein...   226    2e-57 
ref|ZP_03831568.1|  succinate dehydrogenase iron-sulfur subuni...   226    2e-57 
ref|YP_002150337.1|  succinate dehydrogenase iron-sulfur prote...   226    2e-57 
ref|ZP_04637505.1|  Succinate dehydrogenase iron-sulfur protei...   226    2e-57 
ref|NP_286440.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|YP_001453988.1|  succinate dehydrogenase iron-sulfur subun...   226    2e-57 
ref|YP_094574.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|ZP_01614801.1|  succinate dehydrogenase iron-sulfur subuni...   226    2e-57 
ref|YP_454555.1|  succinate dehydrogenase iron-sulfur subunit ...   226    3e-57 
ref|YP_160850.1|  succinate dehydrogenase iron-sulfur subunit ...   226    3e-57 
ref|YP_002312262.1|  succinate dehydrogenase iron-sulfur subun...   225    3e-57 
ref|YP_151223.1|  succinate dehydrogenase iron-sulfur subunit ...   225    3e-57 
ref|YP_122934.1|  succinate dehydrogenase iron-sulfur subunit ...   225    3e-57 
ref|YP_125941.1|  succinate dehydrogenase iron-sulfur subunit ...   225    3e-57 
ref|ZP_03346202.1|  succinate dehydrogenase iron-sulfur subuni...   225    4e-57 
ref|ZP_04619155.1|  Succinate dehydrogenase iron-sulfur protei...   225    4e-57 
ref|ZP_03320574.1|  hypothetical protein PROVALCAL_03540 [Prov...   225    4e-57 
ref|YP_856457.1|  succinate dehydrogenase iron-sulfur protein ...   225    4e-57 
ref|ZP_04634255.1|  Succinate dehydrogenase iron-sulfur protei...   225    4e-57 
ref|YP_001474550.1|  succinate dehydrogenase iron-sulfur subun...   225    4e-57 
ref|NP_455291.1|  succinate dehydrogenase iron-sulfur subunit ...   225    4e-57 
ref|YP_003227850.1|  succinate dehydrogenase, FeS subunit [Esc...   225    4e-57 
ref|ZP_05885435.1|  succinate dehydrogenase iron-sulfur protei...   225    4e-57 
ref|YP_001438699.1|  succinate dehydrogenase iron-sulfur subun...   225    4e-57 
ref|YP_003461104.1|  succinate dehydrogenase and fumarate redu...   224    5e-57 
ref|NP_797225.1|  succinate dehydrogenase iron-sulfur subunit ...   224    5e-57 
ref|ZP_06478027.1|  succinate dehydrogenase iron-sulfur subuni...   224    5e-57 
ref|YP_003466989.1|  succinate dehydrogenase, Fe-S protein [Xe...   224    5e-57 
ref|YP_003037136.1|  succinate dehydrogenase and fumarate redu...   224    5e-57 
ref|YP_001142155.1|  succinate dehydrogenase, iron-sulfur prot...   224    5e-57 
ref|YP_987013.1|  succinate dehydrogenase subunit B [Acidovora...   224    5e-57 
ref|YP_001007133.1|  succinate dehydrogenase iron-sulfur subun...   224    5e-57 
ref|NP_459720.1|  succinate dehydrogenase iron-sulfur subunit ...   224    5e-57 
ref|ZP_04655502.1|  succinate dehydrogenase iron-sulfur subuni...   224    5e-57 
ref|YP_003041805.1|  succinate dehydrogenase iron-sulfur prote...   224    5e-57 
ref|ZP_06752965.1|  succinate dehydrogenase iron-sulfur subuni...   224    5e-57 
ref|ZP_04626186.1|  Succinate dehydrogenase iron-sulfur protei...   224    6e-57 
ref|ZP_03165065.1|  succinate dehydrogenase iron-sulfur subuni...   224    6e-57 
ref|ZP_04613598.1|  Succinate dehydrogenase iron-sulfur protei...   224    6e-57 
ref|ZP_02346598.2|  succinate dehydrogenase, iron-sulfur subun...   224    6e-57 
ref|YP_001571227.1|  succinate dehydrogenase iron-sulfur subun...   224    6e-57 
ref|YP_268943.1|  succinate dehydrogenase iron-sulfur subunit ...   224    6e-57 
ref|ZP_06186651.1|  succinate dehydrogenase iron-sulfur subuni...   224    7e-57 
ref|YP_001175957.1|  succinate dehydrogenase iron-sulfur subun...   224    7e-57 
ref|YP_003526276.1|  succinate dehydrogenase and fumarate redu...   224    8e-57 
ref|YP_958431.1|  succinate dehydrogenase iron-sulfur subunit ...   224    9e-57 
ref|NP_928727.1|  succinate dehydrogenase iron-sulfur subunit ...   224    9e-57 
ref|ZP_05111360.1|  succinate dehydrogenase iron-sulfur subuni...   224    9e-57 
ref|YP_002353820.1|  succinate dehydrogenase and fumarate redu...   224    9e-57 
ref|YP_159617.1|  succinate dehydrogenase iron-sulfur subunit ...   224    9e-57 
ref|YP_002889526.1|  succinate dehydrogenase and fumarate redu...   224    1e-56 
ref|YP_003167603.1|  succinate dehydrogenase and fumarate redu...   224    1e-56 
gb|AAV36011.1|  mitochondrial succinate dehydrogenase beta sub...   224    1e-56 
ref|ZP_03806467.1|  hypothetical protein PROPEN_04872 [Proteus...   223    1e-56 
ref|ZP_03822023.1|  succinate dehydrogenase iron-sulfur subuni...   223    1e-56 
ref|ZP_06728544.1|  succinate dehydrogenase iron-sulfur subuni...   223    1e-56 
ref|ZP_01262352.1|  succinate dehydrogenase catalytic subunit ...   223    1e-56 
ref|ZP_01134827.1|  succinate dehydrogenase catalytic subunit ...   223    1e-56 
ref|NP_933824.1|  succinate dehydrogenase iron-sulfur subunit ...   223    1e-56 
ref|YP_002239651.1|  succinate dehydrogenase, iron-sulfur subu...   223    1e-56 
ref|NP_231720.1|  succinate dehydrogenase iron-sulfur subunit ...   223    1e-56 
ref|ZP_06048566.1|  succinate dehydrogenase iron-sulfur protei...   223    1e-56 
ref|YP_340164.1|  succinate dehydrogenase iron-sulfur subunit ...   223    1e-56 
ref|ZP_05716179.1|  succinate dehydrogenase catalytic subunit ...   223    2e-56 
ref|ZP_06069086.1|  succinate dehydrogenase iron-sulfur subuni...   223    2e-56 
ref|NP_066507.1|  succinate:cytochrome c oxidoreductase subuni...   223    2e-56 
ref|YP_003048197.1|  succinate dehydrogenase and fumarate redu...   223    2e-56 
ref|YP_001334404.1|  succinate dehydrogenase iron-sulfur subun...   222    2e-56 
ref|ZP_05881274.1|  succinate dehydrogenase iron-sulfur protei...   222    3e-56 
ref|ZP_06065212.1|  succinate dehydrogenase/fumarate reductase...   222    3e-56 
ref|YP_003209694.1|  Succinate dehydrogenase iron-sulfur subun...   222    3e-56 
ref|ZP_06033935.1|  succinate dehydrogenase iron-sulfur protei...   222    3e-56 
ref|ZP_06062753.1|  succinate dehydrogenase iron-sulfur subuni...   222    3e-56 
ref|YP_001444558.1|  succinate dehydrogenase iron-sulfur subun...   222    4e-56 
ref|ZP_06175080.1|  succinate dehydrogenase catalytic subunit ...   222    4e-56 
ref|ZP_01552152.1|  succinate dehydrogenase catalytic subunit ...   221    4e-56 
ref|ZP_01988018.1|  succinate dehydrogenase iron-sulfur protei...   221    4e-56 
ref|YP_001706359.1|  succinate dehydrogenase iron-sulfur subun...   221    5e-56 
ref|ZP_06715727.1|  succinate dehydrogenase, iron-sulfur prote...   221    6e-56 
ref|ZP_05823226.1|  succinate dehydrogenase/fumarate reductase...   221    6e-56 
ref|ZP_01739269.1|  succinate dehydrogenase iron-sulfur subuni...   221    7e-56 
ref|XP_624306.2|  PREDICTED: similar to Succinate dehydrogenas...   221    7e-56 
ref|ZP_06059059.1|  succinate dehydrogenase/fumarate reductase...   221    7e-56 
ref|NP_871423.1|  succinate dehydrogenase iron-sulfur subunit ...   221    8e-56 
ref|ZP_04418286.1|  succinate dehydrogenase iron-sulfur protei...   221    8e-56 
ref|ZP_06226639.1|  succinate dehydrogenase and fumarate reduc...   221    8e-56 
ref|ZP_06298054.1|  succinate dehydrogenase and fumarate reduc...   221    8e-56 
ref|ZP_05360099.1|  succinate dehydrogenase iron-sulfur subuni...   220    9e-56 
gb|ABR16401.1|  unknown [Picea sitchensis]                          220    9e-56 
ref|ZP_05944836.1|  succinate dehydrogenase iron-sulfur protei...   220    1e-55 
ref|YP_047427.1|  succinate dehydrogenase iron-sulfur subunit ...   220    1e-55 
ref|YP_003296631.1|  succinate dehydrogenase iron-sulfur subun...   219    2e-55 
ref|ZP_01900521.1|  succinate dehydrogenase [Moritella sp. PE3...   219    2e-55 
ref|NP_759169.1|  succinate dehydrogenase iron-sulfur subunit ...   219    2e-55 
ref|YP_002513552.1|  succinate dehydrogenase and fumarate redu...   219    2e-55 
ref|ZP_03713182.1|  hypothetical protein EIKCOROL_00857 [Eiken...   219    2e-55 
ref|ZP_05317153.1|  succinate dehydrogenase iron-sulfur subuni...   219    2e-55 
ref|ZP_05121137.1|  succinate dehydrogenase iron-sulfur subuni...   219    3e-55 
ref|ZP_02196429.1|  succinate dehydrogenase iron-sulfur subuni...   219    3e-55 
ref|YP_002934265.1|  succinate dehydrogenase iron-sulfur subun...   219    3e-55 
ref|ZP_01219608.1|  succinate dehydrogenase [Photobacterium pr...   219    3e-55 
ref|ZP_03718320.1|  hypothetical protein NEIFLAOT_00120 [Neiss...   218    3e-55 
ref|YP_208028.1|  succinate dehydrogenase iron-sulfur subunit ...   218    3e-55 
ref|YP_344453.1|  succinate dehydrogenase/fumarate reductase i...   218    3e-55 
ref|ZP_06393786.1|  succinate dehydrogenase iron-sulfur subuni...   218    4e-55 
ref|YP_129260.1|  succinate dehydrogenase iron-sulfur subunit ...   218    4e-55 
ref|XP_001451516.1|  hypothetical protein [Paramecium tetraure...   218    4e-55 
ref|YP_002001504.1|  succinate dehydrogenase iron-sulfur subun...   218    5e-55 
gb|EDL13331.1|  succinate dehydrogenase complex, subunit B, ir...   218    5e-55 
ref|ZP_04758496.1|  succinate dehydrogenase iron-sulfur subuni...   218    5e-55 
ref|ZP_06693197.1|  conserved hypothetical protein [Acinetobac...   218    6e-55 
ref|XP_001433045.1|  hypothetical protein [Paramecium tetraure...   218    6e-55 
ref|XP_001429245.1|  hypothetical protein [Paramecium tetraure...   218    6e-55 
ref|YP_974998.1|  succinate dehydrogenase iron-sulfur subunit ...   218    6e-55 
ref|YP_001115006.1|  succinate dehydrogenase iron-sulfur subun...   218    7e-55 
ref|NP_273989.1|  succinate dehydrogenase iron-sulfur subunit ...   217    9e-55 
ref|ZP_06736101.1|  hypothetical protein NEIELOOT_02958 [Neiss...   217    9e-55 
ref|ZP_06569693.1|  succinate dehydrogenase iron-sulfur subuni...   217    1e-54 
ref|YP_003264217.1|  succinate dehydrogenase and fumarate redu...   217    1e-54 
ref|ZP_05794484.1|  succinate dehydrogenase iron-sulfur subuni...   216    1e-54 
ref|ZP_01168172.1|  Succinate dehydrogenase/fumarate reductase...   216    2e-54 
ref|ZP_01364935.1|  hypothetical protein PaerPA_01002047 [Pseu...   216    2e-54 
ref|XP_001506093.1|  PREDICTED: similar to succinate dehydroge...   216    2e-54 
ref|ZP_01160042.1|  succinate dehydrogenase [Photobacterium sp...   216    2e-54 
ref|ZP_02062643.1|  succinate dehydrogenase iron-sulfur subuni...   215    4e-54 
ref|XP_002579985.1|  succinate dehydrogenase iron-sulfur prote...   215    5e-54 
ref|ZP_01235861.1|  succinate dehydrogenase catalytic subunit ...   214    5e-54 
gb|EDL80952.1|  succinate dehydrogenase complex, subunit B, ir...   214    7e-54 
ref|ZP_05093784.1|  succinate dehydrogenase and fumarate reduc...   214    1e-53 
ref|ZP_01215176.1|  succinate dehydrogenase [Psychromonas sp. ...   213    2e-53 
ref|ZP_04919691.1|  succinate dehydrogenase, iron-sulfur prote...   213    2e-53 
ref|NP_878622.1|  succinate dehydrogenase iron-sulfur subunit ...   213    2e-53 
ref|YP_003443617.1|  succinate dehydrogenase and fumarate redu...   212    3e-53 
gb|ACN33958.1|  unknown [Zea mays]                                  211    5e-53 
emb|CAB42658.1|  iron sulfur subunit of succinate dehydrogenas...   211    5e-53 
emb|CAD62368.1|  chimeric SDH2-RPS14 protein [Triticum aestivum]    211    6e-53 
dbj|BAA82748.1|  mitochondrial ribosomal protein S14 [Oryza sa...   211    8e-53 
ref|XP_001024894.2|  succinate dehydrogenase and fumarate redu...   211    9e-53 
gb|EAZ05419.1|  hypothetical protein OsI_27631 [Oryza sativa I...   210    9e-53 
ref|ZP_01737259.1|  succinate dehydrogenase iron-sulfur subuni...   209    2e-52 
ref|ZP_01736792.1|  succinate dehydrogenase iron-sulfur subuni...   209    2e-52 
emb|CAA13166.1|  z62f [Vibrio cholerae]                             207    8e-52 
ref|YP_392292.1|  succinate dehydrogenase and fumarate reducta...   206    2e-51 
gb|EEY66687.1|  succinate dehydrogenase iron-sulfur protein [P...   205    3e-51 
ref|YP_001085729.1|  succinate dehydrogenase iron-sulfur subun...   205    4e-51 
ref|ZP_06186276.1|  succinate dehydrogenase iron-sulfur subuni...   204    6e-51 
gb|EAZ44499.1|  hypothetical protein OsJ_29116 [Oryza sativa J...   203    1e-50 
ref|YP_277840.1|  succinate dehydrogenase iron-sulfur subunit ...   202    3e-50 
gb|AAV36007.1|  hydrogenosomal succinate dehydrogenase beta su...   200    1e-49 
ref|XP_001451992.1|  hypothetical protein [Paramecium tetraure...   199    3e-49 
ref|YP_943593.1|  succinate dehydrogenase catalytic subunit [P...   197    7e-49 
gb|AAA88331.1|  ORF2 [Neisseria gonorrhoeae]                        195    3e-48 
gb|AAB24366.1|  succinate-ubiquinone oxidoreductase complex II...   195    4e-48 
ref|YP_155891.1|  succinate dehydrogenase iron-sulfur subunit ...   195    4e-48 
ref|XP_002778710.1|  iron-sulfur subunit of succinate dehydrog...   191    5e-47 
ref|ZP_06806584.1|  succinate dehydrogenase [Brevibacterium mc...   189    2e-46 
ref|YP_003379238.1|  succinate dehydrogenase and fumarate redu...   189    3e-46 
ref|YP_001597241.1|  succinate dehydrogenase iron-sulfur subun...   188    5e-46 
ref|NP_820385.1|  succinate dehydrogenase iron-sulfur subunit ...   188    5e-46 
ref|YP_003111545.1|  succinate dehydrogenase and fumarate redu...   187    8e-46 
ref|YP_001824202.1|  succinate dehydrogenase iron-sulfur subun...   187    8e-46 
ref|YP_947028.1|  succinate dehydrogenase iron-sulfur subunit ...   187    8e-46 
ref|YP_001363682.1|  succinate dehydrogenase and fumarate redu...   187    8e-46 
sp|P51053.1|DHSB_COXBU  RecName: Full=Succinate dehydrogenase ...   187    8e-46 
ref|YP_003200700.1|  succinate dehydrogenase and fumarate redu...   187    1e-45 
ref|YP_003322523.1|  succinate dehydrogenase and fumarate redu...   187    1e-45 
ref|ZP_04036501.1|  succinate dehydrogenase subunit B [Meiothe...   187    1e-45 
ref|YP_003363294.1|  succinate dehydrogenase/fumarate reductas...   186    2e-45 
ref|YP_830622.1|  succinate dehydrogenase iron-sulfur subunit ...   186    2e-45 
ref|ZP_04695676.1|  succinate dehydrogenase iron-sulfur subuni...   186    2e-45 
ref|ZP_03496517.1|  succinate dehydrogenase and fumarate reduc...   186    2e-45 
ref|ZP_01131108.1|  succinate dehydrogenase [marine actinobact...   186    2e-45 
ref|ZP_05000543.1|  succinate dehydrogenase iron-sulfur subuni...   186    2e-45 
ref|ZP_00374696.1|  succinate dehydrogenase, iron-sulfur prote...   186    2e-45 
ref|YP_479791.1|  succinate dehydrogenase iron-sulfur subunit ...   186    3e-45 
ref|YP_005058.1|  succinate dehydrogenase iron-sulfur subunit ...   185    3e-45 
ref|ZP_05802955.1|  succinate dehydrogenase and fumarate reduc...   185    4e-45 
ref|YP_003155531.1|  succinate dehydrogenase subunit B [Brachy...   185    5e-45 
emb|CBI17705.1|  unnamed protein product [Vitis vinifera]           185    5e-45 
ref|YP_003319254.1|  succinate dehydrogenase and fumarate redu...   185    5e-45 
ref|YP_144719.1|  succinate dehydrogenase iron-sulfur subunit ...   184    6e-45 
ref|YP_711442.1|  succinate dehydrogenase iron-sulfur subunit ...   184    7e-45 
ref|YP_001855646.1|  succinate dehydrogenase iron-sulfur prote...   184    8e-45 
ref|YP_002487281.1|  succinate dehydrogenase and fumarate redu...   184    9e-45 
ref|YP_003104112.1|  succinate dehydrogenase and fumarate redu...   184    1e-44 
ref|YP_061547.1|  succinate dehydrogenase iron-sulfur subunit ...   184    1e-44 
ref|ZP_06270008.1|  succinate dehydrogenase and fumarate reduc...   184    1e-44 
gb|EDL80955.1|  succinate dehydrogenase complex, subunit B, ir...   183    1e-44 
ref|ZP_05915713.1|  succinate dehydrogenase iron-sulfur subuni...   183    1e-44 
ref|ZP_04993463.1|  succinate dehydrogenase iron-sulfur subuni...   183    1e-44 
ref|ZP_05009427.1|  succinate dehydrogenase iron-sulfur subuni...   183    1e-44 
ref|YP_001996170.1|  succinate dehydrogenase and fumarate redu...   183    1e-44 
ref|YP_003325576.1|  succinate dehydrogenase and fumarate redu...   183    2e-44 
ref|ZP_05368435.1|  succinate dehydrogenase iron-sulfur subuni...   182    2e-44 
ref|ZP_04364946.1|  succinate dehydrogenase subunit B [Cellulo...   182    3e-44 
ref|ZP_04702374.1|  succinate dehydrogenase iron-sulfur subuni...   182    3e-44 
ref|YP_003108954.1|  succinate dehydrogenase and fumarate redu...   182    3e-44 
ref|ZP_06709603.1|  succinate dehydrogenase, iron-sulfur subun...   182    3e-44 
ref|YP_002785919.1|  putative Succinate dehydrogenase, iron-su...   182    4e-44 
ref|ZP_06502346.1|  succinate dehydrogenase iron-sulfur subuni...   182    4e-44 
ref|YP_002956577.1|  succinate dehydrogenase subunit B [Microc...   182    4e-44 
pir||C32394  succinate dehydrogenase (ubiquinone) (EC 1.3.5.1)...   181    5e-44 
ref|ZP_05476980.1|  succinate dehydrogenase iron-sulfur subuni...   181    6e-44 
ref|ZP_05508527.1|  succinate dehydrogenase iron-sulfur subuni...   181    6e-44 
ref|YP_002521580.1|  succinate dehydrogenase iron-sulfur prote...   181    6e-44 
ref|ZP_05008916.1|  succinate dehydrogenase iron-sulfur subuni...   181    7e-44 
ref|YP_003289505.1|  succinate dehydrogenase and fumarate redu...   181    7e-44 
ref|ZP_03363735.1|  succinate dehydrogenase iron-sulfur subuni...   181    8e-44 
ref|YP_002248613.1|  succinate dehydrogenase iron-sulfur prote...   181    9e-44 
ref|ZP_05533784.1|  succinate dehydrogenase iron-sulfur subuni...   180    1e-43 
ref|YP_003132436.1|  succinate dehydrogenase subunit B [Saccha...   180    1e-43 
ref|ZP_05539229.1|  succinate dehydrogenase iron-sulfur subuni...   179    2e-43 
ref|YP_117155.1|  succinate dehydrogenase iron-sulfur subunit ...   179    2e-43 
ref|YP_002765489.1|  succinate dehydrogenase iron-sulfur prote...   179    2e-43 
ref|ZP_04686291.1|  succinate dehydrogenase iron-sulfur subuni...   179    2e-43 
ref|YP_003504718.1|  succinate dehydrogenase and fumarate redu...   179    2e-43 
ref|YP_001108677.1|  succinate dehydrogenase iron-sulfur subun...   179    2e-43 
ref|YP_706180.1|  succinate dehydrogenase iron-sulfur subunit ...   179    3e-43 
ref|ZP_05517003.1|  succinate dehydrogenase iron-sulfur subuni...   179    4e-43 
ref|NP_629010.1|  succinate dehydrogenase iron-sulfur subunit ...   178    5e-43 
emb|CAD36476.1|  succinate dehydrogenase [Rhodococcus ruber]        177    7e-43 
ref|YP_001221710.1|  succinate dehydrogenase iron-sulfur subun...   177    9e-43 
ref|NP_294675.1|  succinate dehydrogenase iron-sulfur subunit ...   177    1e-42 
ref|ZP_00544973.1|  Succinate dehydrogenase (ubiquinone) [Ehrl...   177    1e-42 
ref|ZP_05018190.1|  succinate dehydrogenase iron-sulfur subuni...   177    1e-42 
ref|YP_001623470.1|  succinate dehydrogenase iron-sulfur subun...   177    1e-42 
ref|YP_001960098.1|  succinate dehydrogenase and fumarate redu...   177    1e-42 
ref|YP_003315321.1|  succinate dehydrogenase subunit B [Sangui...   177    1e-42 
ref|YP_002882960.1|  succinate dehydrogenase and fumarate redu...   176    2e-42 
ref|ZP_04027449.1|  succinate dehydrogenase subunit B [Tsukamu...   176    2e-42 
ref|YP_604357.1|  succinate dehydrogenase iron-sulfur subunit ...   176    2e-42 
ref|YP_001711502.1|  succinate dehydrogenase iron-sulfur subun...   176    2e-42 
ref|YP_002015456.1|  succinate dehydrogenase and fumarate redu...   176    2e-42 
ref|NP_824575.1|  succinate dehydrogenase iron-sulfur subunit ...   175    4e-42 
ref|YP_003160783.1|  succinate dehydrogenase and fumarate redu...   174    5e-42 
ref|YP_003489172.1|  putative succinate dehydrogenase iron-sul...   174    8e-42 
ref|YP_001136103.1|  succinate dehydrogenase iron-sulfur subun...   172    2e-41 
ref|YP_003272926.1|  succinate dehydrogenase and fumarate redu...   172    3e-41 
ref|YP_952421.1|  succinate dehydrogenase iron-sulfur subunit ...   172    4e-41 
gb|AAC72370.1|  succinate dehydrogenase Ip subunit [Bos taurus]     171    7e-41 
ref|YP_638395.1|  succinate dehydrogenase iron-sulfur subunit ...   171    7e-41 
ref|YP_001069546.1|  succinate dehydrogenase iron-sulfur subun...   171    7e-41 
ref|YP_001704404.1|  succinate dehydrogenase iron-sulfur subun...   171    9e-41 
ref|ZP_06473678.1|  succinate dehydrogenase and fumarate reduc...   171    9e-41 
ref|YP_444629.1|  succinate dehydrogenase iron-sulfur subunit ...   171    9e-41 
ref|YP_886045.1|  succinate dehydrogenase iron-sulfur subunit ...   169    2e-40 
ref|YP_003495921.1|  succinate dehydrogenase iron-sulfur prote...   169    2e-40 
ref|YP_002777259.1|  succinate dehydrogenase iron-sulfur prote...   169    3e-40 
ref|YP_076469.1|  succinate dehydrogenase iron-sulfur protein ...   169    3e-40 
ref|YP_846221.1|  succinate dehydrogenase and fumarate reducta...   169    3e-40 
gb|AAC72371.1|  succinate dehydrogenase Ip subunit [Mus musculus]   169    3e-40 
ref|ZP_03426725.1|  succinate dehydrogenase iron-sulfur subuni...   168    6e-40 
ref|NP_217836.1|  succinate dehydrogenase iron-sulfur subunit ...   168    6e-40 
ref|YP_001849513.1|  succinate dehydrogenase (iron-sulphur pro...   168    6e-40 
ref|NP_856993.1|  succinate dehydrogenase iron-sulfur subunit ...   168    6e-40 
ref|YP_905387.1|  succinate dehydrogenase iron-sulfur subunit ...   167    9e-40 
ref|ZP_02004479.1|  Succinate dehydrogenase/fumarate reductase...   166    2e-39 
ref|YP_002646429.1|  succinate dehydrogenase iron-sulphur prot...   166    2e-39 
ref|ZP_05225244.1|  succinate dehydrogenase iron-sulfur subuni...   164    6e-39 
gb|ADD79481.1|  succinate dehydrogenase iron-sulfur protein [C...   164    7e-39 
ref|ZP_04747772.1|  succinate dehydrogenase iron-sulfur subuni...   164    8e-39 
emb|CBI60026.1|  unnamed protein product [Sordaria macrospora]      164    9e-39 
ref|NP_301555.1|  succinate dehydrogenase iron-sulfur subunit ...   163    2e-38 
ref|NP_962378.1|  succinate dehydrogenase iron-sulfur subunit ...   163    2e-38 
ref|YP_883438.1|  succinate dehydrogenase iron-sulfur subunit ...   162    2e-38 
emb|CAJ71023.1|  similar to succinate dehydrogenase/fumarate r...   161    5e-38 
gb|ACV53598.1|  succinate dehydrogenase iron-sulfur protein [A...   160    1e-37 
ref|ZP_02533464.1|  succinate dehydrogenase iron-sulfur subuni...   157    1e-36 
emb|CAA53461.1|  succinate dehydrogenase subunit-B [Haemonchus...   155    5e-36 
ref|YP_002566637.1|  succinate dehydrogenase and fumarate redu...   154    8e-36 
emb|CAL57483.1|  Succinate dehydrogenase, Fe-S protein subunit...   153    1e-35 
ref|ZP_01737280.1|  succinate dehydrogenase iron-sulfur subuni...   153    2e-35 
ref|XP_001868013.1|  succinate dehydrogenase [Culex quinquefas...   153    2e-35 
emb|CAA68981.1|  SDH subunit B-homologue; iron-sulphur protein...   152    2e-35 
emb|CAE51196.1|  putative succinate dehydrogenase beta subunit...   152    2e-35 
ref|YP_330862.1|  succinate dehydrogenase, subunit B (iron-sul...   151    7e-35 
ref|YP_001546550.1|  succinate dehydrogenase and fumarate redu...   150    1e-34 
ref|YP_001737600.1|  succinate dehydrogenase and fumarate redu...   150    2e-34 
ref|YP_003177898.1|  succinate dehydrogenase and fumarate redu...   149    3e-34 
ref|ZP_06536443.1|  succinate dehydrogenase iron-sulfur subuni...   148    5e-34 
ref|YP_658694.1|  succinate dehydrogenase, subunit B (iron-sul...   148    6e-34 
ref|ZP_03350501.1|  succinate dehydrogenase iron-sulfur subuni...   147    8e-34 
dbj|BAC78391.1|  succinate dehydrogenase iron-sulfur protein s...   146    2e-33 
ref|YP_003481241.1|  succinate dehydrogenase and fumarate redu...   146    2e-33 
gb|EDL13332.1|  succinate dehydrogenase complex, subunit B, ir...   146    2e-33 
ref|ZP_03376563.1|  succinate dehydrogenase iron-sulfur subuni...   145    3e-33 
ref|YP_003402502.1|  succinate dehydrogenase and fumarate redu...   144    7e-33 
ref|ZP_03999754.1|  succinate dehydrogenase subunit B [Halogeo...   144    7e-33 
ref|YP_135761.1|  succinate dehydrogenase iron-sulfur protein ...   144    9e-33 
ref|YP_003536821.1|  succinate dehydrogenase subunit B (iron-s...   143    2e-32 
ref|YP_001652551.1|  fumarate reductase iron-sulfur subunit [A...   143    2e-32 
ref|YP_001356160.1|  succinate dehydrogenase/fumarate reductas...   142    5e-32 
ref|ZP_00135022.2|  COG0479: Succinate dehydrogenase/fumarate ...   141    6e-32 
gb|EDL80951.1|  succinate dehydrogenase complex, subunit B, ir...   141    6e-32 
ref|YP_003435673.1|  succinate dehydrogenase and fumarate redu...   141    6e-32 
gb|ACE98099.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   141    7e-32 
gb|ACE98095.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE980...   141    7e-32 
gb|ACE98127.1|  2Fe-2S ferredoxin [Populus tremula]                 141    8e-32 
ref|YP_003131727.1|  succinate dehydrogenase and fumarate redu...   141    8e-32 
ref|NP_280172.1|  hypothetical protein VNG1308G [Halobacterium...   140    1e-31 
ref|YP_002730151.1|  fumarate reductase, iron-sulfur subunit [...   140    1e-31 
ref|ZP_04752430.1|  fumarate reductase iron-sulfur subunit [Ac...   140    1e-31 
gb|EDL80957.1|  succinate dehydrogenase complex, subunit B, ir...   140    1e-31 
gb|ACE98101.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   140    1e-31 
gb|ACE98097.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   140    1e-31 
ref|ZP_03787633.1|  succinate dehydrogenase catalytic subunit ...   140    2e-31 
dbj|BAH57150.1|  AT3G27380 [Arabidopsis thaliana]                   139    2e-31 
ref|ZP_05990406.1|  fumarate reductase iron-sulfur protein [Ma...   139    3e-31 
ref|NP_760197.1|  fumarate reductase iron-sulfur subunit [Vibr...   138    6e-31 
gb|ABF83897.1|  succinate dehydrogenase [Mangifera indica]          138    7e-31 
ref|YP_001012374.1|  succinate dehydrogenase iron-sulfur subun...   137    8e-31 
emb|CAA53463.1|  succinate dehydrogenase subunit-B [Haemonchus...   137    8e-31 
ref|ZP_04978698.1|  succinate dehydrogenase [Mannheimia haemol...   137    1e-30 
ref|ZP_02551232.1|  succinate dehydrogenase iron-sulfur subuni...   137    1e-30 
ref|YP_360202.1|  succinate dehydrogenase iron-sulfur subunit ...   137    1e-30 
ref|ZP_02028480.1|  hypothetical protein BIFADO_00913 [Bifidob...   136    2e-30 
ref|YP_002728121.1|  fumarate reductase, iron-sulfur subunit [...   135    3e-30 
ref|YP_001541171.1|  succinate dehydrogenase iron-sulfur subun...   135    4e-30 
ref|NP_872658.1|  fumarate reductase iron-sulfur subunit [Haem...   135    5e-30 
ref|ZP_05880966.1|  succinate dehydrogenase iron-sulfur protei...   135    5e-30 
ref|ZP_06156318.1|  succinate dehydrogenase iron-sulfur protei...   134    9e-30 
ref|XP_001220613.1|  succinate dehydrogenase, ubiquinone, iron...   134    1e-29 
emb|CBI40994.1|  unnamed protein product [Vitis vinifera]           134    1e-29 
ref|ZP_01813517.1|  succinate dehydrogenase iron-sulfur subuni...   133    1e-29 
ref|XP_001401064.1|  hypothetical protein An14g04400 [Aspergil...   133    2e-29 
ref|ZP_01987599.1|  fumarate reductase iron-sulfur protein [Vi...   133    2e-29 
ref|ZP_04416810.1|  succinate dehydrogenase iron-sulfur protei...   133    2e-29 
ref|YP_719490.1|  fumarate reductase iron-sulfur subunit [Haem...   132    3e-29 
ref|ZP_05715509.1|  Fumarate reductase iron-sulfur subunit [Vi...   132    3e-29 
ref|YP_001930574.1|  succinate dehydrogenase and fumarate redu...   132    3e-29 
ref|ZP_06050849.1|  succinate dehydrogenase iron-sulfur protei...   132    3e-29 
ref|NP_069516.1|  succinate dehydrogenase iron-sulfur subunit ...   132    3e-29 
ref|ZP_06305918.1|  Succinate dehydrogenase/fumarate reductase...   132    3e-29 
ref|ZP_06034407.1|  succinate dehydrogenase iron-sulfur protei...   132    3e-29 
ref|ZP_01870462.1|  fumarate reductase iron-sulfur subunit [Vi...   132    4e-29 
ref|ZP_06176846.1|  Fumarate reductase iron-sulfur subunit [Vi...   132    4e-29 
ref|ZP_05888478.1|  succinate dehydrogenase iron-sulfur protei...   132    4e-29 
ref|YP_002607451.1|  succinate dehydrogenase/fumarate reductas...   132    4e-29 
ref|ZP_06306671.1|  Succinate dehydrogenase/fumarate reductase...   132    4e-29 
ref|ZP_03627142.1|  succinate dehydrogenase and fumarate reduc...   132    4e-29 
ref|YP_909455.1|  iron sulfur protein associated with succinat...   132    5e-29 
ref|YP_001581595.1|  succinate dehydrogenase and fumarate redu...   132    5e-29 
ref|NP_232285.1|  fumarate reductase iron-sulfur subunit [Vibr...   132    5e-29 
ref|ZP_02196613.1|  fumarate reductase iron-sulfur subunit [Vi...   131    5e-29 
gb|AAU38260.1|  FrdB protein [Mannheimia succiniciproducens MB...   131    6e-29 
ref|ZP_01065534.1|  succinate dehydrogenase [Vibrio sp. MED222...   131    6e-29 
ref|YP_002264125.1|  fumarate reductase iron-sulfur subunit [A...   131    6e-29 
ref|ZP_05946709.1|  succinate dehydrogenase iron-sulfur protei...   131    6e-29 
ref|ZP_05120327.1|  fumarate reductase iron-sulfur subunit [Vi...   131    6e-29 
ref|ZP_00989983.1|  succinate dehydrogenase [Vibrio splendidus...   131    6e-29 
ref|ZP_03728739.1|  succinate dehydrogenase and fumarate reduc...   131    7e-29 
ref|YP_205718.1|  fumarate reductase iron-sulfur subunit [Vibr...   131    7e-29 
ref|ZP_05720563.1|  Fumarate reductase iron-sulfur subunit [Vi...   131    9e-29 
ref|ZP_01262329.1|  succinate dehydrogenase [Vibrio alginolyti...   131    9e-29 
ref|NP_799220.1|  fumarate reductase iron-sulfur subunit [Vibr...   131    9e-29 

ALIGNMENTS
>ref|ZP_05068692.1| succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
sp. HTCC7211]
 gb|EDZ59691.1| succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
sp. HTCC7211]
Length=259

 Score =  468 bits (1205),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 217/240 (90%), Positives = 234/240 (97%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MVQINLP+NS+V KGKY++DKTGSKN++KVN+YRWDPSTEENPRIDTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVIKGKYYQDKTGSKNIRKVNVYRWDPSTEENPRIDTYEVDMDNCPSKVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D+LNKIKNEIDPT+AYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDG+IDIYPLPHLK
Sbjct  61   DILNKIKNEIDPTLAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGDIDIYPLPHLK  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            VK+DLIGDLDGLYKQYQSIEPWLK+NS  +T EI QSK+ERAKLDGAYECIMCACCSTSC
Sbjct  121  VKRDLIGDLDGLYKQYQSIEPWLKNNSTKDTTEIFQSKEERAKLDGAYECIMCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGDKYLGPAVLLQAYRWI+DSRDEE++ARLKKVADELKLYRCHTILNCTSACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIIDSRDEERKARLKKVADELKLYRCHTILNCTSACPKG  240


>ref|YP_265666.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Pelagibacter 
ubique HTCC1062]
 gb|AAZ21063.1| Succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
ubique HTCC1062]
Length=257

 Score =  443 bits (1140),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 228/240 (95%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MVQINLP+NS+VQKG Y++DKTGSKN++KVN+YRWDPS  ENPR+DTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDTYEVDMDNCPSKVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D+LNKIKNEIDP++AYRRSCAHGVCGSCAMNM GKNGLACT PH+EI+G+I+IYPLPHLK
Sbjct  61   DILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEIEGDINIYPLPHLK  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            VKKDLIGDL GLYKQY+SIEPWLK+N+  ET EI+Q+K++R KLDGAYECIMCACCSTSC
Sbjct  121  VKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKEDRVKLDGAYECIMCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGDKYLGPAVLLQAYRWIVDSRD+EK+ RLKKVADELKLYRCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLYRCHTIMNCTNACPKG  240


>ref|ZP_01264594.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
 gb|EAS85081.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
Length=257

 Score =  443 bits (1140),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 228/240 (95%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MVQINLP+NS+VQKG Y++DKTGSKN++KVN+YRWDPS  ENPR+DTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDTYEVDMDNCPSKVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D+LNKIKNEIDP++AYRRSCAHGVCGSCAMNM GKNGLACT PH+EI+G+I+IYPLPHLK
Sbjct  61   DILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEIEGDINIYPLPHLK  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            VKKDLIGDL GLYKQY+SIEPWLK+N+  ET EI+Q+K++R KLDGAYECIMCACCSTSC
Sbjct  121  VKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKEDRVKLDGAYECIMCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGDKYLGPAVLLQAYRWIVDSRD+EK+ RLKKVADELKLYRCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLYRCHTIMNCTNACPKG  240


>ref|ZP_06055687.1| succinate dehydrogenase iron-sulfur subunit [alpha proteobacterium 
HIMB114]
 gb|EEY75456.1| succinate dehydrogenase iron-sulfur subunit [alpha proteobacterium 
HIMB114]
Length=260

 Score =  368 bits (944),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 201/240 (83%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MVQ NLP+NS+++KG YFK  + SKN+KKVN+YRW+P  + NPR+DTYEVDMDNC   VL
Sbjct  1    MVQFNLPKNSKIKKGNYFKSVSESKNIKKVNVYRWNPDKDANPRVDTYEVDMDNCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNEID T+ +RRSC  G+CGSCAMN+ G N LACT    EI G I+I PLPH+ 
Sbjct  61   DALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGSNTLACTKSAREIKGEININPLPHMP  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            V KDL+ +L  LYKQYQS+EPW++SN +S  +E +Q+ ++R+KLDG YECI+CACCSTSC
Sbjct  121  VIKDLVPNLKQLYKQYQSVEPWMQSNKSSNGSEGLQTIEDRSKLDGLYECILCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGDKYLGPAVLLQAYRWI+DSRDEE++ RLKKVADELKL+RCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIIDSRDEERQKRLKKVADELKLFRCHTIMNCTNACPKG  240


>ref|YP_538560.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
RML369-C]
 ref|YP_001496880.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
OSU 85-389]
 sp|Q1RGP3.1|DHSB_RICBR RecName: Full=Succinate dehydrogenase iron-sulfur subunit
 gb|ABE05471.1| Succinate dehydrogenase iron-sulfur protein [Rickettsia bellii 
RML369-C]
 gb|ABV79843.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
OSU 85-389]
Length=261

 Score =  324 bits (830),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/241 (61%), Positives = 181/241 (75%), Gaps = 1/241 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            M ++ LP NS V+KGK  K K    NL+K+ IYR+DP  +ENP ID++E+D+      VL
Sbjct  1    MAELRLPPNSVVKKGKEHKAKGDVSNLRKIKIYRYDPDLDENPTIDSFEIDLSKTGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNEID T+ +RRSC  G+CGSCAMN+ G N LAC  P  EI G+I IYPLPH+K
Sbjct  61   DALIKIKNEIDSTVTFRRSCREGICGSCAMNIDGTNTLACIKPIEEISGDIKIYPLPHMK  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETN-EIIQSKKERAKLDGAYECIMCACCSTS  191
            V KDL+ D+   Y QY+SIEPWLK++S + +N E +QS K+R KLDG YECI+CACCSTS
Sbjct  121  VVKDLVPDMSHFYAQYESIEPWLKTDSPAPSNAERLQSIKDREKLDGLYECILCACCSTS  180

Query  192  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  251
            CPSYWWNGDKYLGPA+LLQAYRWI DSRD+    RL+ + D  KLYRCHTI+NCT  CPK
Sbjct  181  CPSYWWNGDKYLGPAILLQAYRWIADSRDDHTGERLEALEDPFKLYRCHTIMNCTKTCPK  240

Query  252  G  252
            G
Sbjct  241  G  241


>ref|YP_001938646.1| succinate dehydrogenase iron-sulfur subunit [Orientia tsutsugamushi 
str. Ikeda]
 dbj|BAG41412.1| succinate dehydrogenase iron-sulfur protein [Orientia tsutsugamushi 
str. Ikeda]
Length=261

 Score =  323 bits (827),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/241 (59%), Positives = 182/241 (75%), Gaps = 1/241 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MV+  LP NS+V+ GK +  K   K +K+V++YR+ P T +NPRID +E+DM+NC   VL
Sbjct  1    MVEFRLPPNSKVKVGKRYAAKDSVKKVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNEIDPT+ +RRSC  G+CGSC+MN+ G NGLAC     +I G++ IYPLPH+ 
Sbjct  61   DALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMS  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNS-NSETNEIIQSKKERAKLDGAYECIMCACCSTS  191
            V KDL+ D+   Y QYQSIEPWLK+ + +  + E +Q+ ++R KLDG YECI+CACCST+
Sbjct  121  VIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTA  180

Query  192  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  251
            CPSYWWN DKYLGPAVLLQAYRWI+DSRDE    RL ++ D  KLYRCHTI+NCT  CPK
Sbjct  181  CPSYWWNADKYLGPAVLLQAYRWIIDSRDEHTSERLDQLEDSFKLYRCHTIMNCTKTCPK  240

Query  252  G  252
            G
Sbjct  241  G  241


>ref|ZP_05062250.1| succinate dehydrogenase iron-sulfur protein [gamma proteobacterium 
HTCC5015]
 gb|EDY85922.1| succinate dehydrogenase iron-sulfur protein [gamma proteobacterium 
HTCC5015]
Length=259

 Score =  322 bits (826),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 177/240 (73%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            M Q  LP NS + KGK +K   G+KN KK  IYR+DP + +NPR DTYEVD+D C   VL
Sbjct  1    MAQFKLPANSIMTKGKVWKAPEGAKNTKKFEIYRFDPDSGKNPRTDTYEVDLDTCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNE+DPT+  RRSC  G+CGSCAMN+ G N LACT    ++ G + IYPLPH+ 
Sbjct  61   DALLKIKNEMDPTLTLRRSCREGICGSCAMNIDGTNTLACTKAIEDVKGTVKIYPLPHMP  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            V KDL+ DL   Y Q +S++P+LK+ S + T E +Q++ +RA+LDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQLRSVDPFLKTKSQAPTRERLQTEADRAQLDGLYECILCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGD+YLGPAVL+QAYRWI+DSRDE    RL  + D  KLYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPAVLMQAYRWIIDSRDEATGERLDALEDPFKLYRCHTIMNCAKTCPKG  240


>ref|YP_001249012.1| succinate dehydrogenase iron-sulfur subunit [Orientia tsutsugamushi 
str. Boryong]
 emb|CAM80794.1| Succinate dehydrogenase iron-sulfur protein [Orientia tsutsugamushi 
Boryong]
Length=263

 Score =  322 bits (825),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/241 (59%), Positives = 182/241 (75%), Gaps = 1/241 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MV+  LP NS+V+ GK +  K   K +K+V++YR+ P T +NPRID +E+DM+NC   VL
Sbjct  3    MVEFRLPPNSKVKVGKRYVAKDSVKRVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVL  62

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNEIDPT+ +RRSC  G+CGSC+MN+ G NGLAC     +I G++ IYPLPH+ 
Sbjct  63   DALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMS  122

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNS-NSETNEIIQSKKERAKLDGAYECIMCACCSTS  191
            V KDL+ D+   Y QYQSIEPWLK+ + +  + E +Q+ ++R KLDG YECI+CACCST+
Sbjct  123  VIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTA  182

Query  192  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  251
            CPSYWWN DKYLGPAVLLQAYRWI+DSRDE    RL ++ D  KLYRCHTI+NCT  CPK
Sbjct  183  CPSYWWNADKYLGPAVLLQAYRWIIDSRDEYASERLDQLEDSFKLYRCHTIMNCTKTCPK  242

Query  252  G  252
            G
Sbjct  243  G  243


>ref|YP_426293.1| succinate dehydrogenase iron-sulfur subunit [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC22006.1| succinate dehydrogenase subunit B [Rhodospirillum rubrum ATCC 
11170]
Length=260

 Score =  322 bits (824),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/241 (58%), Positives = 181/241 (75%), Gaps = 1/241 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MV+  LP NS+V++GK F    G+K LK+  IYRWDP    NPR+DT+++D+D+C   VL
Sbjct  1    MVEFALPPNSRVKEGKTFPAPDGAKRLKRFKIYRWDPEEGGNPRLDTFQIDLDDCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D LNKIKNEIDPT+ YRRSC  G+CGSC+MN+   N LAC  P AE++G+++IYPLPHL 
Sbjct  61   DALNKIKNEIDPTLTYRRSCREGICGSCSMNIDSNNSLACLKPIAEVEGDVEIYPLPHLP  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNS-NSETNEIIQSKKERAKLDGAYECIMCACCSTS  191
            V KDL+ DL  +Y QY +IEPWLK++S      E +QS +ERA+LDG +ECI+C CC TS
Sbjct  121  VVKDLVPDLTHIYAQYNAIEPWLKTDSPPPPAKERLQSPEERARLDGLWECILCFCCQTS  180

Query  192  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  251
            CPSYWWN ++YLGPA+LLQA RW+ DSRDE    RL  + D  +L+RCHTI+NCT+ CPK
Sbjct  181  CPSYWWNSERYLGPAILLQAARWVFDSRDEATGERLDMLDDPFRLFRCHTIMNCTATCPK  240

Query  252  G  252
            G
Sbjct  241  G  241


>ref|YP_354063.1| succinate dehydrogenase iron-sulfur subunit [Rhodobacter sphaeroides 
2.4.1]
 ref|YP_001044513.1| succinate dehydrogenase iron-sulfur subunit [Rhodobacter sphaeroides 
ATCC 17029]
 ref|YP_002526732.1| Succinate dehydrogenase subunit B [Rhodobacter sphaeroides KD131]
 gb|ABA80162.1| succinate dehydrogenase subunit B [Rhodobacter sphaeroides 2.4.1]
 gb|ABN77741.1| succinate dehydrogenase subunit B [Rhodobacter sphaeroides ATCC 
17029]
 gb|ACM02231.1| Succinate dehydrogenase subunit B [Rhodobacter sphaeroides KD131]
Length=259

 Score =  321 bits (823),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 175/240 (72%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MVQ+ LP+NS+V+ GK +     +KN++K  IYRWDP T ENPR+DTY +DMD C   VL
Sbjct  1    MVQLTLPKNSKVRTGKTWPKPADAKNVRKFMIYRWDPDTGENPRVDTYFLDMDKCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L KIKNE+DPT+ +RRSC  G+CGSCAMN+ G N LAC     EI G++ IYPLPH+ 
Sbjct  61   DALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEIKGDVKIYPLPHMP  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            V KDLI DL   Y Q+ SI PWL++ +     E  QS ++RAKLDG YEC+MCACCSTSC
Sbjct  121  VIKDLIPDLSLFYAQHASIMPWLETKTVEPAKEWRQSVEDRAKLDGLYECVMCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGD+YLGPA LL AYRWIVDSRDE    RL  + D  KLYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPAALLHAYRWIVDSRDEATPERLDMLEDPFKLYRCHTIMNCAKTCPKG  240


>ref|NP_105173.1| succinate dehydrogenase iron-sulfur subunit [Mesorhizobium loti 
MAFF303099]
 dbj|BAB50959.1| succinate dehydrogenase iron-sulfur protein subunit [Mesorhizobium 
loti MAFF303099]
Length=259

 Score =  320 bits (821),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 178/240 (74%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MV++ LP+NS++Q+GK +    G+ NL++  IYRW P  +ENPRIDTY VDMD+C   VL
Sbjct  1    MVELTLPKNSKIQQGKTWPKPEGATNLREYRIYRWSPDDDENPRIDTYFVDMDDCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L  IKN+IDPT+  RRSC  G+CGSCAMN+ G N LACT    +I G + +YPLPH++
Sbjct  61   DALLWIKNKIDPTLTLRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKVYPLPHMQ  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            V KDL+ DL   Y Q+ SIEPWLK+ S     E +QS ++R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQHASIEPWLKTVSPQPAKEWLQSHEDREKLDGLYECILCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGD+YLGPA LLQAYRW++DSRDE K  RL  + D  +LYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPATLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG  240


>ref|ZP_05812399.1| succinate dehydrogenase and fumarate reductase iron-sulfur protein 
[Mesorhizobium opportunistum WSM2075]
 gb|EEW31292.1| succinate dehydrogenase and fumarate reductase iron-sulfur protein 
[Mesorhizobium opportunistum WSM2075]
Length=259

 Score =  320 bits (821),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 178/240 (74%), Gaps = 0/240 (0%)

Query  13   MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  72
            MV++ LP+NS++Q+GK +    G+ NL++  IYRW P  +ENPRIDTY VDMD+C   VL
Sbjct  1    MVELTLPKNSKIQQGKTWPKPEGATNLREYRIYRWSPDDDENPRIDTYFVDMDDCGPMVL  60

Query  73   DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  132
            D L  IKN+IDPT+A RRSC  G+CGSCAMN+ G N LACT    +I G + +YPLPH++
Sbjct  61   DALLWIKNKIDPTLALRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKVYPLPHMQ  120

Query  133  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  192
            V KDL+ DL   Y Q+ SIEPWLK+ S     E +QS ++R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQHASIEPWLKTVSPEPAKEWLQSHEDREKLDGLYECILCACCSTSC  180

Query  193  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  252
            PSYWWNGD+YLGPA LLQAYRW++DSRDE    RL  + D  +LYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPATLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQTCPKG  240

b)BLASTx com a sequência metagenómica


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05068692.1|  succinate dehydrogenase iron-sulfur protei...   478    4e-133
ref|ZP_01264594.1|  succinate dehydrogenase [Candidatus Pelagi...   453    1e-125
ref|YP_265666.1|  succinate dehydrogenase iron-sulfur subunit ...   453    1e-125
ref|ZP_06055687.1|  succinate dehydrogenase iron-sulfur subuni...   374    1e-101
ref|YP_538560.1|  succinate dehydrogenase iron-sulfur subunit ...   327    9e-88 
ref|YP_001938646.1|  succinate dehydrogenase iron-sulfur subun...   325    4e-87 
ref|NP_105173.1|  succinate dehydrogenase iron-sulfur subunit ...   325    4e-87 
ref|YP_002551002.1|  succinate dehydrogenase iron-sulfur [Agro...   325    6e-87 
ref|ZP_05812399.1|  succinate dehydrogenase and fumarate reduc...   324    7e-87 
ref|YP_001249012.1|  succinate dehydrogenase iron-sulfur subun...   324    1e-86 
ref|NP_355579.1|  succinate dehydrogenase iron-sulfur subunit ...   323    2e-86 
ref|ZP_05062250.1|  succinate dehydrogenase iron-sulfur protei...   322    3e-86 
ref|YP_742174.1|  succinate dehydrogenase iron-sulfur subunit ...   322    3e-86 
ref|YP_001412713.1|  succinate dehydrogenase and fumarate redu...   322    4e-86 
ref|NP_220438.1|  succinate dehydrogenase iron-sulfur subunit ...   322    5e-86 
ref|YP_426293.1|  succinate dehydrogenase iron-sulfur subunit ...   321    6e-86 
ref|ZP_01003249.1|  succinate dehydrogenase [Loktanella vestfo...   321    6e-86 
ref|YP_354063.1|  succinate dehydrogenase iron-sulfur subunit ...   321    6e-86 
ref|YP_001975350.1|  succinate dehydrogenase, iron-sulfur prot...   321    8e-86 
ref|YP_001833808.1|  succinate dehydrogenase and fumarate redu...   320    1e-85 
ref|YP_001498933.1|  succinate dehydrogenase iron-sulfur subun...   320    1e-85 
ref|YP_001534195.1|  succinate dehydrogenase [Dinoroseobacter ...   320    1e-85 
ref|YP_002827622.1|  succinate dehydrogenase iron-sulfur prote...   320    1e-85 
ref|YP_507137.1|  succinate dehydrogenase iron-sulfur subunit ...   320    1e-85 
dbj|BAH22200.1|  succinate dehydrogenase, iron-sulfur protein ...   319    2e-85 
ref|ZP_01037846.1|  succinate dehydrogenase [Roseovarius sp. 2...   319    2e-85 
ref|ZP_05179779.1|  succinate dehydrogenase iron-sulfur subuni...   319    3e-85 
ref|ZP_05153300.1|  succinate dehydrogenase iron-sulfur subuni...   318    4e-85 
ref|YP_246152.1|  succinate dehydrogenase iron-sulfur subunit ...   318    4e-85 
ref|YP_197591.1|  succinate dehydrogenase iron-sulfur subunit ...   318    4e-85 
ref|NP_539080.1|  succinate dehydrogenase iron-sulfur subunit ...   318    4e-85 
ref|YP_003065457.1|  succinate dehydrogenase iron-sulfur subun...   318    5e-85 
ref|ZP_01756189.1|  succinate dehydrogenase iron-sulfur subuni...   318    5e-85 
ref|NP_387175.1|  succinate dehydrogenase iron-sulfur subunit ...   318    5e-85 
ref|YP_001492917.1|  succinate dehydrogenase iron-sulfur subun...   318    5e-85 
ref|YP_002916363.1|  succinate dehydrogenase iron-sulfur subun...   318    7e-85 
ref|ZP_05074885.1|  succinate dehydrogenase, iron-sulfur prote...   318    7e-85 
ref|YP_001593705.1|  succinate dehydrogenase iron-sulfur subun...   318    7e-85 
ref|YP_001971624.1|  putative succinate dehydrogenase iron-sul...   318    7e-85 
ref|NP_698879.1|  succinate dehydrogenase iron-sulfur subunit ...   318    7e-85 
ref|ZP_04698698.1|  succinate dehydrogenase iron-sulfur subuni...   317    9e-85 
ref|ZP_02151623.1|  succinate dehydrogenase iron-sulfur subuni...   317    9e-85 
ref|YP_681943.1|  succinate dehydrogenase iron-sulfur subunit ...   317    9e-85 
ref|NP_359706.1|  succinate dehydrogenase iron-sulfur subunit ...   317    9e-85 
ref|YP_001166307.1|  succinate dehydrogenase iron-sulfur subun...   317    9e-85 
ref|ZP_00142453.1|  succinate dehydrogenase iron-sulfur protei...   317    9e-85 
ref|ZP_06791815.1|  succinate dehydrogenase iron-sulfur protei...   317    1e-84 
ref|ZP_05162373.1|  succinate dehydrogenase iron-sulfur subuni...   317    1e-84 
ref|YP_001649419.1|  succinate dehydrogenase iron-sulfur subun...   317    1e-84 
ref|ZP_00956311.1|  succinate dehydrogenase [Sulfitobacter sp....   317    1e-84 
ref|YP_001494184.1|  succinate dehydrogenase iron-sulfur subun...   317    1e-84 
ref|ZP_05376667.1|  succinate dehydrogenase and fumarate reduc...   317    2e-84 
ref|YP_002844781.1|  Succinate dehydrogenase iron-sulfur prote...   317    2e-84 
ref|NP_778584.1|  succinate dehydrogenase iron-sulfur subunit ...   317    2e-84 
ref|YP_180543.1|  succinate dehydrogenase iron-sulfur subunit ...   317    2e-84 
ref|ZP_00651885.1|  Succinate dehydrogenase/fumarate reductase...   317    2e-84 
ref|YP_914380.1|  succinate dehydrogenase iron-sulfur subunit ...   317    2e-84 
ref|ZP_04681361.1|  succinate dehydrogenase and fumarate reduc...   316    2e-84 
ref|YP_002546003.1|  succinate dehydrogenase subunit B [Agroba...   316    2e-84 
ref|ZP_05078230.1|  succinate dehydrogenase, iron-sulfur prote...   316    2e-84 
ref|ZP_01878341.1|  succinate dehydrogenase iron-sulfur subuni...   316    2e-84 
ref|ZP_00959156.1|  succinate dehydrogenase [Roseovarius nubin...   316    2e-84 
ref|ZP_03786136.1|  aspartate kinase [Brucella ceti str. Cudo]...   316    3e-84 
ref|ZP_01444049.1|  succinate dehydrogenase catalytic subunit ...   316    3e-84 
ref|ZP_02141587.1|  succinate dehydrogenase iron-sulfur subuni...   315    3e-84 
ref|ZP_05053465.1|  succinate dehydrogenase and fumarate reduc...   315    6e-84 
ref|YP_001491780.1|  succinate dehydrogenase iron-sulfur subun...   315    6e-84 
ref|YP_067054.1|  succinate dehydrogenase iron-sulfur subunit ...   315    6e-84 
ref|NP_298363.1|  succinate dehydrogenase iron-sulfur subunit ...   315    6e-84 
ref|ZP_01750590.1|  succinate dehydrogenase, iron-sulfur prote...   314    8e-84 
ref|ZP_00681580.1|  Succinate dehydrogenase/fumarate reductase...   314    8e-84 
ref|ZP_05124579.1|  succinate dehydrogenase, iron-sulfur prote...   314    1e-83 
ref|ZP_02168492.1|  succinate dehydrogenase subunit B, iron-su...   314    1e-83 
ref|YP_003576908.1|  succinate dehydrogenase, iron-sulfur subu...   313    1e-83 
ref|ZP_03527675.1|  succinate dehydrogenase iron-sulfur subuni...   313    1e-83 
ref|YP_001369504.1|  succinate dehydrogenase iron-sulfur subun...   313    1e-83 
ref|YP_770013.1|  succinate dehydrogenase iron-sulfur subunit ...   313    1e-83 
ref|YP_508746.1|  succinate dehydrogenase iron-sulfur subunit ...   313    1e-83 
ref|YP_363976.1|  succinate dehydrogenase iron-sulfur subunit ...   313    1e-83 
ref|NP_642399.1|  succinate dehydrogenase iron-sulfur subunit ...   313    2e-83 
ref|ZP_05342805.1|  succinate dehydrogenase iron-sulfur subuni...   313    2e-83 
ref|ZP_01547939.1|  succinate dehydrogenase iron-sulfur subuni...   313    2e-83 
ref|ZP_01446908.1|  succinate dehydrogenase catalytic subunit ...   312    3e-83 
ref|ZP_01439837.1|  succinate dehydrogenase catalytic subunit ...   312    3e-83 
ref|YP_303317.1|  succinate dehydrogenase iron-sulfur subunit ...   312    3e-83 
ref|ZP_01057543.1|  succinate dehydrogenase, iron-sulfur prote...   312    3e-83 
ref|ZP_05088244.1|  succinate dehydrogenase, iron-sulfur prote...   312    4e-83 
ref|ZP_04771933.1|  succinate dehydrogenase and fumarate reduc...   311    5e-83 
ref|YP_471367.1|  succinate dehydrogenase iron-sulfur subunit ...   311    5e-83 
ref|YP_200946.1|  succinate dehydrogenase iron-sulfur subunit ...   311    5e-83 
ref|ZP_01746135.1|  succinate dehydrogenase catalytic subunit ...   311    6e-83 
ref|YP_451214.1|  succinate dehydrogenase iron-sulfur subunit ...   311    6e-83 
ref|ZP_06730342.1|  succinate dehydrogenase catalytic subunit ...   311    8e-83 
ref|ZP_05779806.1|  succinate dehydrogenase iron-sulfur subuni...   311    8e-83 
ref|ZP_05785489.1|  succinate dehydrogenase iron-sulfur subuni...   311    8e-83 
ref|ZP_02190356.1|  Succinate dehydrogenase/fumarate reductase...   311    8e-83 
ref|ZP_01740892.1|  succinate dehydrogenase iron-sulfur subuni...   311    8e-83 
ref|ZP_06490099.1|  succinate dehydrogenase iron-sulfur subuni...   310    1e-82 
ref|YP_003376304.1|  putative succinate dehydrogenase catalyti...   310    1e-82 
ref|YP_001980285.1|  succinate dehydrogenase protein, iron-sul...   310    1e-82 
ref|ZP_02146357.1|  succinate dehydrogenase and fumarate reduc...   310    1e-82 
ref|ZP_06122130.1|  succinate dehydrogenase and fumarate reduc...   310    1e-82 
ref|YP_001686455.1|  succinate dehydrogenase iron-sulfur subun...   310    1e-82 
ref|YP_001001640.1|  succinate dehydrogenase iron-sulfur subun...   309    2e-82 
ref|YP_675780.1|  succinate dehydrogenase iron-sulfur subunit ...   309    2e-82 
ref|ZP_06349613.1|  succinate dehydrogenase and fumarate reduc...   309    3e-82 
ref|ZP_05112898.1|  succinate dehydrogenase and fumarate reduc...   309    3e-82 
ref|YP_002283177.1|  succinate dehydrogenase iron-sulfur subun...   309    3e-82 
ref|NP_637490.1|  succinate dehydrogenase iron-sulfur subunit ...   309    3e-82 
ref|YP_001235003.1|  succinate dehydrogenase iron-sulfur subun...   309    3e-82 
ref|ZP_05738936.1|  succinate dehydrogenase iron-sulfur subuni...   308    4e-82 
ref|ZP_01229060.1|  succinate dehydrogenase iron-sulfur protei...   308    4e-82 
ref|YP_165624.1|  succinate dehydrogenase iron-sulfur subunit ...   308    7e-82 
ref|NP_422320.1|  succinate dehydrogenase iron-sulfur subunit ...   308    7e-82 
ref|YP_611764.1|  succinate dehydrogenase iron-sulfur subunit ...   308    7e-82 
ref|ZP_06487467.1|  succinate dehydrogenase iron-sulfur subuni...   307    9e-82 
ref|ZP_01862980.1|  succinate dehydrogenase iron-sulfur subuni...   307    9e-82 
ref|YP_198430.1|  succinate dehydrogenase iron-sulfur subunit ...   307    9e-82 
ref|ZP_00998440.1|  succinate dehydrogenase [Oceanicola batsen...   307    9e-82 
ref|ZP_01127589.1|  succinate dehydrogenase catalytic subunit ...   307    1e-81 
ref|ZP_01155535.1|  succinate dehydrogenase [Oceanicola granul...   306    2e-81 
ref|YP_504783.1|  succinate dehydrogenase iron-sulfur subunit ...   306    2e-81 
ref|ZP_01012118.1|  succinate dehydrogenase [Rhodobacterales b...   306    2e-81 
ref|YP_002563270.1|  succinate dehydrogenase iron-sulfur prote...   306    3e-81 
ref|YP_153560.1|  succinate dehydrogenase iron-sulfur subunit ...   306    3e-81 
ref|YP_003186571.1|  succinate dehydrogenase Fe-S protein subu...   305    4e-81 
ref|NP_966485.1|  succinate dehydrogenase iron-sulfur subunit ...   305    4e-81 
ref|YP_003070040.1|  succinate dehydrogenase, iron-sulfur subu...   305    5e-81 
ref|YP_003447358.1|  succinate dehydrogenase iron-sulfur prote...   305    6e-81 
ref|ZP_05084065.1|  succinate dehydrogenase, iron-sulfur prote...   305    6e-81 
ref|YP_001526662.1|  succinate dehydrogenase/fumarate reductas...   305    6e-81 
ref|YP_002363813.1|  succinate dehydrogenase and fumarate redu...   304    1e-80 
ref|YP_001601659.1|  succinate dehydrogenase iron-sulfur subun...   304    1e-80 
ref|YP_001641053.1|  succinate dehydrogenase and fumarate redu...   304    1e-80 
ref|YP_002727289.1|  succinate dehydrogenase catalytic subunit...   303    1e-80 
ref|ZP_05099351.1|  succinate dehydrogenase, iron-sulfur prote...   303    1e-80 
ref|YP_001416865.1|  succinate dehydrogenase and fumarate redu...   303    1e-80 
ref|ZP_00374638.1|  succinate dehydrogenase, iron-sulfur prote...   303    1e-80 
ref|YP_003545883.1|  succinate dehydrogenase iron-sulfur prote...   302    3e-80 
ref|YP_003058704.1|  succinate dehydrogenase and fumarate redu...   302    3e-80 
ref|YP_001926923.1|  succinate dehydrogenase and fumarate redu...   302    3e-80 
ref|YP_745898.1|  succinate dehydrogenase iron-sulfur subunit ...   302    3e-80 
ref|YP_001610501.1|  succinate dehydrogenase iron-sulfur subun...   302    3e-80 
ref|YP_988429.1|  succinate dehydrogenase iron-sulfur subunit ...   302    4e-80 
ref|ZP_00054195.1|  COG0479: Succinate dehydrogenase/fumarate ...   302    4e-80 
emb|CAM75704.1|  succinate dehydrogenase iron-sulfur protein [...   301    5e-80 
ref|YP_002129056.1|  succinate dehydrogenase, iron-sulfur prot...   301    7e-80 
ref|ZP_01039842.1|  succinate dehydrogenase [Erythrobacter sp....   300    1e-79 
ref|YP_001261807.1|  succinate dehydrogenase iron-sulfur subun...   300    1e-79 
ref|YP_113997.1|  succinate dehydrogenase iron-sulfur subunit ...   300    1e-79 
ref|YP_032796.1|  succinate dehydrogenase iron-sulfur subunit ...   300    1e-79 
ref|ZP_05844572.1|  succinate dehydrogenase and fumarate reduc...   300    2e-79 
ref|YP_423316.1|  succinate dehydrogenase iron-sulfur subunit ...   300    2e-79 
ref|YP_034273.1|  succinate dehydrogenase iron-sulfur subunit ...   299    3e-79 
ref|YP_002972720.1|  succinate dehydrogenase, iron-sulfur prot...   299    3e-79 
ref|ZP_01303493.1|  succinate dehydrogenase iron-sulfur protei...   299    3e-79 
ref|YP_617276.1|  succinate dehydrogenase iron-sulfur subunit ...   299    3e-79 
emb|CBG76060.1|  succinate dehydrogenase iron-sulfur subunit [...   298    4e-79 
ref|ZP_00957174.1|  succinate dehydrogenase [Oceanicaulis alex...   298    4e-79 
ref|YP_497593.1|  succinate dehydrogenase iron-sulfur subunit ...   298    7e-79 
ref|YP_001772753.1|  succinate dehydrogenase and fumarate redu...   297    1e-78 
ref|YP_761920.1|  succinate dehydrogenase iron-sulfur subunit ...   297    1e-78 
ref|YP_002300096.1|  succinate dehydrogenase iron-sulfur prote...   296    2e-78 
ref|YP_001753154.1|  succinate dehydrogenase and fumarate redu...   296    2e-78 
ref|YP_002502284.1|  succinate dehydrogenase and fumarate redu...   296    2e-78 
ref|YP_458248.1|  succinate dehydrogenase iron-sulfur subunit ...   296    3e-78 
ref|ZP_05063368.1|  succinate dehydrogenase, iron-sulfur prote...   295    4e-78 
ref|YP_003081729.1|  succinate dehydrogenase and fumarate redu...   295    5e-78 
ref|YP_506417.1|  succinate dehydrogenase iron-sulfur subunit ...   295    5e-78 
ref|ZP_01045468.1|  succinate dehydrogenase [Nitrobacter sp. N...   294    8e-78 
ref|NP_767155.1|  succinate dehydrogenase iron-sulfur subunit ...   293    2e-77 
ref|YP_001236433.1|  succinate dehydrogenase iron-sulfur subun...   291    7e-77 
ref|YP_758063.1|  succinate dehydrogenase iron-sulfur subunit ...   291    9e-77 
ref|ZP_05278757.1|  succinate dehydrogenase iron-sulfur subuni...   290    2e-76 
ref|ZP_05277788.1|  succinate dehydrogenase iron-sulfur subuni...   290    2e-76 
ref|NP_001098423.1|  succinate dehydrogenase complex subunit B...   290    2e-76 
pdb|1ZOY|B  Chain B, Crystal Structure Of Mitochondrial Respir...   290    2e-76 
ref|YP_001202448.1|  succinate dehydrogenase iron-sulfur subun...   290    2e-76 
ref|YP_578807.1|  succinate dehydrogenase iron-sulfur subunit ...   288    4e-76 
gb|ACO09839.1|  Succinate dehydrogenase iron-sulfur protein, m...   288    6e-76 
ref|XP_308512.4|  AGAP007309-PA [Anopheles gambiae str. PEST] ...   288    6e-76 
ref|XP_001376844.1|  PREDICTED: hypothetical protein [Monodelp...   288    6e-76 
gb|ABD77151.1|  succinate dehydrogenase complex subunit B [Sus...   288    6e-76 
gb|ACQ58465.1|  Succinate dehydrogenase iron-sulfur subunit, m...   288    8e-76 
ref|ZP_01901675.1|  succinate dehydrogenase catalytic subunit ...   288    8e-76 
gb|ABD77138.1|  succinate dehydrogenase complex subunit B [Ory...   288    8e-76 
ref|YP_319406.1|  succinate dehydrogenase iron-sulfur subunit ...   288    8e-76 
gb|ACO07425.1|  Succinate dehydrogenase iron-sulfur protein, m...   287    1e-75 
gb|ABD77149.1|  succinate dehydrogenase complex subunit B [Bal...   287    1e-75 
gb|ABD77137.1|  succinate dehydrogenase complex subunit B [Lep...   287    1e-75 
ref|NP_001120000.1|  succinate dehydrogenase complex, subunit ...   286    2e-75 
ref|NP_001035573.1|  succinate dehydrogenase complex, subunit ...   286    2e-75 
ref|XP_002590428.1|  hypothetical protein BRAFLDRAFT_273662 [B...   286    2e-75 
ref|YP_002287304.1|  succinate dehydrogenase iron-sulfur subun...   286    2e-75 
ref|XP_001660815.1|  succinate dehydrogenase [Aedes aegypti] >...   286    2e-75 
ref|XP_001421210.1|  predicted protein [Ostreococcus lucimarin...   286    3e-75 
gb|ABD77144.1|  succinate dehydrogenase complex subunit B [Fel...   286    3e-75 
ref|YP_529966.1|  succinate dehydrogenase iron-sulfur subunit ...   286    3e-75 
ref|NP_001157295.1|  succinate dehydrogenase complex, subunit ...   285    4e-75 
gb|ABD77145.1|  succinate dehydrogenase complex subunit B [Equ...   285    4e-75 
gb|AAH43859.1|  Sdhb-prov protein [Xenopus laevis]                  285    4e-75 
ref|NP_001080247.1|  succinate dehydrogenase complex, subunit ...   285    4e-75 
emb|CAG01723.1|  unnamed protein product [Tetraodon nigroviridis]   285    4e-75 
ref|ZP_06170419.1|  succinate dehydrogenase and fumarate reduc...   285    5e-75 
ref|XP_002433069.1|  succinate dehydrogenase, iron-sulfur subu...   285    5e-75 
gb|ABD77150.1|  succinate dehydrogenase complex subunit B [Hip...   285    5e-75 
ref|YP_003552156.1|  succinate dehydrogenase and fumarate redu...   284    8e-75 
gb|ABD77146.1|  succinate dehydrogenase complex subunit B [Cer...   284    8e-75 
gb|ABD77135.1|  succinate dehydrogenase complex subunit B [Mes...   284    8e-75 
gb|ABD77147.1|  succinate dehydrogenase complex subunit B [Dic...   284    8e-75 
gb|ABD77143.1|  succinate dehydrogenase complex subunit B [Can...   284    1e-74 
ref|XP_535392.1|  PREDICTED: similar to Succinate dehydrogenas...   284    1e-74 
gb|ACZ71182.1|  mitochondrial succinate dehydrogenase iron sul...   283    1e-74 
ref|XP_001617230.1|  iron-sulfur subunit of succinate dehydrog...   283    1e-74 
gb|ABD77140.1|  succinate dehydrogenase complex subunit B [Hom...   283    1e-74 
ref|XP_001088349.1|  PREDICTED: succinate dehydrogenase comple...   283    1e-74 
ref|NP_002991.2|  succinate dehydrogenase [ubiquinone] iron-su...   283    1e-74 
gb|EEY57141.1|  succinate dehydrogenase iron-sulfur protein, m...   283    2e-74 
gb|ACO12876.1|  Succinate dehydrogenase iron-sulfur subunit, m...   283    2e-74 
ref|XP_002298583.1|  predicted protein [Populus trichocarpa] >...   283    2e-74 
gb|EDL13335.1|  succinate dehydrogenase complex, subunit B, ir...   283    2e-74 
gb|ABD77133.1|  succinate dehydrogenase complex subunit B [Mus...   283    2e-74 
gb|ABD77129.1|  succinate dehydrogenase complex subunit B [Smi...   283    2e-74 
dbj|BAB22534.1|  unnamed protein product [Mus musculus]             283    2e-74 
ref|NP_001074344.1|  succinate dehydrogenase [ubiquinone] iron...   283    2e-74 
pdb|1YQ3|B  Chain B, Avian Respiratory Complex Ii With Oxaloac...   283    2e-74 
ref|NP_075863.2|  succinate dehydrogenase [ubiquinone] iron-su...   283    2e-74 
gb|ABD77141.1|  succinate dehydrogenase complex subunit B [Aot...   283    2e-74 
ref|YP_483946.1|  succinate dehydrogenase iron-sulfur subunit ...   283    2e-74 
gb|ACO09927.1|  Succinate dehydrogenase iron-sulfur protein, m...   282    3e-74 
emb|CAG06850.1|  unnamed protein product [Tetraodon nigroviridis]   282    3e-74 
ref|NP_044798.1|  succinate:ubiquinone oxidoreductase subunit ...   282    3e-74 
gb|ABD77136.1|  succinate dehydrogenase complex subunit B [Cav...   282    4e-74 
gb|AAA81167.1|  succinate dehydrogenase iron-protein subunit [...   282    4e-74 
ref|NP_945569.1|  succinate dehydrogenase iron-sulfur subunit ...   282    4e-74 
gb|AAA35708.1|  succinate-ubiquinone oxidoreductase Ip subunit...   282    4e-74 
ref|YP_567617.1|  succinate dehydrogenase iron-sulfur subunit ...   282    4e-74 
ref|ZP_06361469.1|  succinate dehydrogenase and fumarate reduc...   281    5e-74 
ref|ZP_05032204.1|  succinate dehydrogenase and fumarate reduc...   281    5e-74 
ref|XP_002262205.1|  Iron-sulfur subunit of succinate dehydrog...   281    5e-74 
emb|CAC19855.1|  mitochondrial succinate dehydrogenase iron-su...   281    5e-74 
ref|XP_864701.1|  PREDICTED: similar to Succinate dehydrogenas...   281    5e-74 
ref|NP_189374.1|  SDH2-1; electron carrier/ succinate dehydrog...   281    5e-74 
ref|XP_001155328.1|  PREDICTED: succinate dehydrogenase comple...   281    7e-74 
gb|EFB22313.1|  hypothetical protein PANDA_013300 [Ailuropoda ...   281    9e-74 
ref|XP_001784121.1|  predicted protein [Physcomitrella patens ...   281    9e-74 
gb|EDL13333.1|  succinate dehydrogenase complex, subunit B, ir...   281    9e-74 
ref|XP_623566.1|  PREDICTED: similar to Succinate dehydrogenas...   281    9e-74 
ref|XP_002723906.1|  PREDICTED: succinate dehydrogenase comple...   280    1e-73 
gb|ACO12841.1|  Succinate dehydrogenase iron-sulfur subunit, m...   280    1e-73 
ref|NP_001092210.1|  succinate dehydrogenase complex, subunit ...   280    1e-73 
ref|NP_001094009.1|  succinate dehydrogenase [ubiquinone] iron...   280    2e-73 
dbj|BAE41403.1|  unnamed protein product [Mus musculus]             280    2e-73 
ref|XP_725298.1|  succinate dehydrogenase iron-sulfur subunit ...   280    2e-73 
gb|ABR17434.1|  unknown [Picea sitchensis]                          280    2e-73 
ref|XP_002028083.1|  GL21331 [Drosophila persimilis] >gb|EDW37...   280    2e-73 
ref|NP_001164360.1|  succinate dehydrogenase [ubiquinone] iron...   280    2e-73 
gb|AAM65047.1|  succinate dehydrogenase iron-protein subunit-l...   280    2e-73 
ref|NP_198881.1|  SDH2-2; electron carrier/ succinate dehydrog...   280    2e-73 
ref|ZP_01016827.1|  Succinate dehydrogenase iron-sulfur protei...   279    3e-73 
ref|YP_779453.1|  succinate dehydrogenase iron-sulfur subunit ...   279    3e-73 
ref|XP_002526944.1|  succinate dehydrogenase, putative [Ricinu...   279    4e-73 
gb|AAY66829.1|  succinate dehydrogenase Ip subunit [Ixodes sca...   279    4e-73 
ref|XP_850262.1|  PREDICTED: similar to Succinate dehydrogenas...   279    4e-73 
ref|XP_794003.1|  PREDICTED: hypothetical protein [Strongyloce...   279    4e-73 
ref|XP_001350535.1|  iron-sulfur subunit of succinate dehydrog...   277    4e-73 
gb|ACI67402.1|  Succinate dehydrogenase iron-sulfur subunit, m...   278    5e-73 
ref|NP_001135166.1|  succinate dehydrogenase complex, subunit ...   278    5e-73 
gb|AAY63983.1|  succinate dehydrogenase iron sulfur subunit B ...   278    5e-73 
emb|CAC19856.1|  mitochondrial succinate dehydrogenase iron-su...   278    5e-73 
ref|XP_678430.1|  iron-sulfur subunit of succinate dehydrogena...   278    5e-73 
ref|XP_002184001.1|  succinate dehydrogenase iron sulfur prote...   278    6e-73 
ref|XP_002268523.1|  PREDICTED: hypothetical protein [Vitis vi...   278    6e-73 
gb|ACQ58642.1|  Succinate dehydrogenase iron-sulfur subunit, m...   278    8e-73 
gb|ACO08243.1|  Succinate dehydrogenase iron-sulfur protein, m...   278    8e-73 
gb|EDL80953.1|  succinate dehydrogenase complex, subunit B, ir...   278    8e-73 
gb|ABD77134.1|  succinate dehydrogenase complex subunit B [Rat...   278    8e-73 
gb|ABD77131.1|  succinate dehydrogenase complex subunit B [Das...   278    8e-73 
gb|ACO15487.1|  Succinate dehydrogenase iron-sulfur subunit, m...   277    1e-72 
ref|XP_002165357.1|  PREDICTED: similar to Sdhb-prov protein [...   277    1e-72 
ref|ZP_03524843.1|  succinate dehydrogenase iron-sulfur subuni...   277    1e-72 
gb|ACI66514.1|  Succinate dehydrogenase iron-sulfur subunit, m...   277    1e-72 
ref|XP_001992397.1|  GH24727 [Drosophila grimshawi] >gb|EDV921...   277    1e-72 
ref|XP_743495.1|  iron-sulfur subunit of succinate dehydrogena...   277    1e-72 
ref|XP_001355118.1|  GA20284 [Drosophila pseudoobscura pseudoo...   277    1e-72 
ref|XP_002089380.1|  GE19076 [Drosophila yakuba] >gb|EDW89092....   276    2e-72 
ref|XP_002032650.1|  GM20899 [Drosophila sechellia] >gb|EDW466...   276    2e-72 
ref|XP_001970722.1|  GG23224 [Drosophila erecta] >gb|EDV59781....   276    2e-72 
ref|NP_477101.1|  succinate dehydrogenase B [Drosophila melano...   276    2e-72 
ref|ZP_03514998.1|  succinate dehydrogenase iron-sulfur subuni...   276    2e-72 
ref|XP_001961283.1|  GF11072 [Drosophila ananassae] >gb|EDV381...   276    2e-72 
gb|ABD77132.1|  succinate dehydrogenase complex subunit B [Tam...   276    2e-72 
gb|ABD77148.1|  succinate dehydrogenase complex subunit B [Bos...   276    2e-72 
ref|XP_001360158.1|  GA17170 [Drosophila pseudoobscura pseudoo...   276    3e-72 
ref|XP_001643981.1|  hypothetical protein Kpol_1070p4 [Vanderw...   275    4e-72 
gb|ABD77139.1|  succinate dehydrogenase complex subunit B [Tad...   275    4e-72 
ref|NP_059350.1|  succinate dehydrogenase iron-sulfur protein ...   275    4e-72 
dbj|BAH72989.1|  iron-sulfur subunit of succinate dehydrogenas...   275    5e-72 
ref|XP_002050487.1|  GJ22180 [Drosophila virilis] >gb|EDW61680...   275    5e-72 
ref|XP_001988000.1|  GH10931 [Drosophila grimshawi] >gb|EDW028...   275    5e-72 
gb|ADD20137.1|  succinate dehydrogenase Fe-s protein subunit [...   275    7e-72 
ref|XP_002127020.1|  PREDICTED: similar to Sdhb-prov protein [...   275    7e-72 
ref|XP_002004991.1|  GI19303 [Drosophila mojavensis] >gb|EDW08...   275    7e-72 
gb|AAM63946.1|  succinate dehydrogenase iron-protein subunit, ...   275    7e-72 
ref|XP_001987146.1|  GH21756 [Drosophila grimshawi] >gb|EDW020...   274    9e-72 
ref|XP_001838873.1|  hypothetical protein CC1G_09250 [Coprinop...   274    1e-71 
ref|NP_001165802.1|  succinate dehydrogenase [ubiquinone] iron...   273    1e-71 
ref|XP_002066043.1|  GK22142 [Drosophila willistoni] >gb|EDW77...   273    1e-71 
sp|Q70KF8.1|DHSB_UROFA  RecName: Full=Succinate dehydrogenase ...   273    2e-71 
ref|NP_593530.1|  succinate dehydrogenase (ubiquinone) iron-su...   273    2e-71 
ref|XP_002071510.1|  GK25101 [Drosophila willistoni] >gb|EDW82...   273    3e-71 
ref|XP_954510.1|  succinate dehydrogenase [ubiquinone] iron-su...   273    3e-71 
ref|XP_462382.1|  DEHA2G19382p [Debaryomyces hansenii CBS767] ...   272    3e-71 
ref|XP_002545754.1|  succinate dehydrogenase iron-sulfur prote...   272    4e-71 
sp|P48933.1|DHSB_CYACA  RecName: Full=Succinate dehydrogenase ...   271    6e-71 
ref|NP_001155908.1|  Succinate dehydrogenase B [Acyrthosiphon ...   271    7e-71 
ref|XP_002506801.1|  succinate dehydrogenase [Micromonas sp. R...   271    7e-71 
ref|XP_756991.1|  succinate dehydrogenase [Ustilago maydis 521...   271    7e-71 
ref|XP_002288459.1|  precursor of hydrogenase [Thalassiosira p...   271    1e-70 
gb|ABD77128.1|  succinate dehydrogenase complex subunit B [Mon...   271    1e-70 
gb|EEH54721.1|  predicted protein [Micromonas pusilla CCMP1545]     270    1e-70 
ref|NP_001060876.1|  Os08g0120000 [Oryza sativa (japonica cult...   270    1e-70 
ref|XP_001894995.1|  succinate dehydrogenase [ubiquinone] iron...   270    2e-70 
emb|CAC80855.1|  DHSB protein [Dendronephthya klunzingeri]          270    2e-70 
ref|XP_002579984.1|  succinate dehydrogenase iron-sulfur prote...   270    2e-70 
ref|XP_002422055.1|  succinate dehydrogenase, iron-sulfur prot...   270    2e-70 
ref|XP_002113318.1|  expressed hypothetical protein [Trichopla...   270    2e-70 
ref|XP_001696290.1|  iron-sulfur subunit of mitochondrial succ...   269    3e-70 
ref|XP_001637002.1|  predicted protein [Nematostella vectensis...   269    3e-70 
emb|CAD62367.1|  succinate dehydrogenase [Triticum aestivum]        269    3e-70 
ref|XP_712003.1|  hypothetical protein CaO19.8251 [Candida alb...   269    3e-70 
ref|NP_001136531.1|  hypothetical protein LOC100216648 [Zea ma...   268    5e-70 
ref|XP_001966870.1|  GF19050 [Drosophila ananassae] >gb|EDV339...   268    5e-70 
gb|AAV91323.1|  succinate dehydrogenase iron-sulfur protein [S...   268    5e-70 
emb|CAB42659.1|  iron sulfur subunit of succinate dehydrogenas...   268    5e-70 
ref|XP_002403788.1|  succinate dehydrogenase, putative [Ixodes...   268    6e-70 
gb|ACG35757.1|  succinate dehydrogenase iron-sulfur protein,mi...   268    6e-70 
gb|EDK39191.2|  hypothetical protein PGUG_03289 [Pichia guilli...   268    6e-70 
ref|XP_001483908.1|  hypothetical protein PGUG_03289 [Pichia g...   268    6e-70 
ref|XP_002616764.1|  succinate dehydrogenase iron-sulfur prote...   268    8e-70 
ref|XP_002010092.1|  GI14882 [Drosophila mojavensis] >gb|EDW07...   268    8e-70 
ref|XP_572035.1|  succinate dehydrogenase iron-sulfur subunit ...   268    8e-70 
dbj|BAH30231.1|  succinate dehydrogenase iron-sulfur protein s...   267    1e-69 
ref|NP_983339.1|  ACL065Cp [Ashbya gossypii ATCC 10895] >sp|Q7...   267    1e-69 
emb|CAA44612.1|  succinate dehydrogenase [Ustilago maydis] >gb...   267    1e-69 
gb|AAL90301.1|  RE03249p [Drosophila melanogaster]                  267    1e-69 
gb|EAW94829.1|  succinate dehydrogenase complex, subunit B, ir...   266    2e-69 
ref|XP_453977.1|  unnamed protein product [Kluyveromyces lacti...   266    2e-69 
ref|NP_573340.1|  CG7349 [Drosophila melanogaster] >gb|AAF4890...   266    2e-69 
gb|EEY18786.1|  succinate dehydrogenase iron-sulfur subunit [V...   265    4e-69 
ref|XP_002171552.1|  succinate dehydrogenase iron-sulfur subun...   265    4e-69 
ref|XP_765737.1|  succinate dehydrogenase iron-sulfur subunit ...   265    4e-69 
ref|XP_369077.1|  conserved hypothetical protein [Magnaporthe ...   265    5e-69 
ref|XP_002107353.1|  GD17417 [Drosophila simulans] >gb|EDX1833...   265    7e-69 
ref|XP_002058954.1|  GJ15311 [Drosophila virilis] >gb|EDW58023...   265    7e-69 
ref|XP_002039348.1|  GM22932 [Drosophila sechellia] >gb|EDW560...   265    7e-69 
ref|XP_001642818.1|  hypothetical protein Kpol_388p3 [Vanderwa...   265    7e-69 
emb|CAA75895.1|  succinate dehydrogenase iron-sulfur subunit [...   265    7e-69 
ref|XP_001876249.1|  predicted protein [Laccaria bicolor S238N...   264    9e-69 
ref|XP_445316.1|  unnamed protein product [Candida glabrata] >...   264    9e-69 
ref|XP_002498333.1|  ZYRO0G07788p [Zygosaccharomyces rouxii] >...   264    1e-68 
ref|XP_503189.1|  YALI0D23397p [Yarrowia lipolytica] >emb|CAG8...   264    1e-68 
dbj|BAD06473.1|  iron-sulphar subunit protein of succinate deh...   264    1e-68 
dbj|BAD06472.1|  iron-sulphar subunit protein of succinate deh...   264    1e-68 
ref|XP_001977726.1|  GG19200 [Drosophila erecta] >gb|EDV46653....   263    2e-68 
emb|CAY81199.1|  Sdh2p [Saccharomyces cerevisiae EC1118]            263    2e-68 
ref|XP_002493357.1|  Iron-sulfur protein subunit of succinate ...   263    2e-68 
ref|XP_001525346.1|  succinate dehydrogenase iron-sulfur prote...   263    3e-68 
ref|XP_001747850.1|  hypothetical protein [Monosiga brevicolli...   262    3e-68 
ref|XP_001386475.1|  succinate dehydrogenase subunit [Pichia s...   262    3e-68 
gb|AAW52509.1|  succinate dehydrogenase iron sulphur protein [...   262    3e-68 
ref|NP_013059.1|  Iron-sulfur protein subunit of succinate deh...   262    3e-68 
ref|XP_965152.1|  succinate dehydrogenase iron-sulfur protein,...   262    3e-68 
sp|A8WPF0.2|DHSB_CAEBR  RecName: Full=Succinate dehydrogenase ...   262    4e-68 
emb|CAT00089.1|  succinate dehydrogenase iron-sulfur subunit [...   262    4e-68 
ref|XP_002629663.1|  C. briggsae CBR-SDHB-1 protein [Caenorhab...   262    4e-68 
emb|CBI52051.1|  unnamed protein product [Sordaria macrospora]      261    8e-68 
ref|XP_002779883.1|  succinate dehydrogenase, putative [Perkin...   260    1e-67 
ref|XP_001908552.1|  unnamed protein product [Podospora anseri...   260    1e-67 
ref|XP_001548350.1|  succinate dehydrogenase-ubiquinone-iron-s...   260    1e-67 
gb|EER27088.1|  Succinate dehydrogenase iron-sulfur protein,mi...   260    2e-67 
dbj|BAA23716.1|  iron-sulfur subunit of succinate dehydrogenas...   259    2e-67 
dbj|BAA23717.1|  iron-sulfur subunit of mitochondrial succinat...   259    3e-67 
ref|NP_495992.1|  Succinate DeHydrogenase complex subunit B fa...   259    3e-67 
ref|XP_002765391.1|  iron-sulfur subunit of succinate dehydrog...   259    4e-67 
ref|XP_002101683.1|  GE17763 [Drosophila yakuba] >gb|EDX02791....   259    4e-67 
ref|XP_002553731.1|  KLTH0E05742p [Lachancea thermotolerans] >...   258    5e-67 
gb|ACO57605.1|  succinate dehydrogenase complex subunit B [Gil...   258    5e-67 
gb|ACO57604.1|  succinate dehydrogenase complex subunit B [Gil...   258    5e-67 
ref|XP_001241858.1|  succinate dehydrogenase iron-sulfur prote...   258    5e-67 
gb|ACT83442.1|  SdhB [Botryotinia fuckeliana]                       258    6e-67 
ref|XP_002733638.1|  PREDICTED: succinate dehydrogenase B-like...   258    8e-67 
ref|XP_445854.1|  unnamed protein product [Candida glabrata] >...   258    8e-67 
gb|ACT83444.1|  SdhB [Botryotinia fuckeliana]                       257    1e-66 
gb|ACT83443.1|  SdhB [Botryotinia fuckeliana]                       257    1e-66 
gb|ACT83445.1|  SdhB [Botryotinia fuckeliana]                       257    1e-66 
ref|XP_002482757.1|  iron-sulfur protein subunit of succinate ...   257    1e-66 
gb|ACT83447.1|  SdhB [Botryotinia fuckeliana]                       256    2e-66 
ref|XP_002545027.1|  succinate dehydrogenase iron-sulfur prote...   256    2e-66 
gb|ACT83446.1|  SdhB [Botryotinia fuckeliana]                       256    2e-66 
ref|ZP_03499775.1|  succinate dehydrogenase iron-sulfur subuni...   255    4e-66 
ref|NP_049294.1|  succinate:cytochrome c oxidoreductase subuni...   255    4e-66 
sp|P80477.1|DHSB_PORPU  RecName: Full=Succinate dehydrogenase ...   255    4e-66 
ref|XP_002148462.1|  iron-sulfur protein subunit of succinate ...   255    5e-66 
ref|XP_001594577.1|  hypothetical protein SS1G_04384 [Scleroti...   255    5e-66 
gb|ABD77142.1|  succinate dehydrogenase complex subunit B [Tup...   255    5e-66 
ref|XP_001729560.1|  hypothetical protein MGL_3104 [Malassezia...   254    7e-66 
ref|XP_659936.1|  hypothetical protein AN2332.2 [Aspergillus n...   254    7e-66 
ref|XP_001259651.1|  iron-sulfur protein subunit of succinate ...   254    9e-66 
ref|XP_001274336.1|  iron-sulfur protein subunit of succinate ...   253    2e-65 
ref|XP_753605.1|  iron-sulfur protein subunit of succinate deh...   253    2e-65 
gb|EER36874.1|  succinate dehydrogenase iron-sulphur protein [...   253    2e-65 
gb|EEH06399.1|  succinate dehydrogenase iron-sulfur protein [A...   253    2e-65 
ref|XP_001541166.1|  succinate dehydrogenase iron-sulfur prote...   253    2e-65 
ref|ZP_03511641.1|  succinate dehydrogenase iron-sulfur subuni...   253    3e-65 
dbj|BAA22505.1|  iron-sulfur protein subunit [Pleurotus ostrea...   253    3e-65 
ref|XP_001088018.1|  PREDICTED: succinate dehydrogenase comple...   252    4e-65 
ref|XP_513112.2|  PREDICTED: similar to Succinate dehydrogenas...   252    5e-65 
gb|EEQ32692.1|  succinate dehydrogenase iron-sulfur subunit [M...   251    6e-65 
ref|XP_001933259.1|  succinate dehydrogenase iron-sulfur subun...   251    8e-65 
gb|ABW39788.1|  mitochondrial succinate dehydrogenase iron-sul...   251    8e-65 
ref|XP_001793919.1|  hypothetical protein SNOG_03351 [Phaeosph...   251    1e-64 
ref|NP_062488.1|  succinate:cytochrome c oxidoreductase subuni...   251    1e-64 
ref|XP_001610457.1|  succinate dehydrogenase iron-sulfur subun...   250    1e-64 
gb|EDL80956.1|  succinate dehydrogenase complex, subunit B, ir...   250    1e-64 
ref|XP_646559.1|  succinate dehydrogenase [Dictyostelium disco...   250    1e-64 
ref|XP_002626245.1|  succinate dehydrogenase iron-sulfur prote...   250    2e-64 
ref|XP_002568026.1|  Pc21g09900 [Penicillium chrysogenum Wisco...   249    2e-64 
ref|XP_001827486.1|  hypothetical protein [Aspergillus oryzae ...   249    2e-64 
ref|NP_001161244.1|  Succinate dehydrogenase [ubiquinone] iron...   249    4e-64 
gb|ABW39789.1|  mitochondrial succinate dehydrogenase iron-sul...   249    4e-64 
ref|ZP_01451021.1|  succinate dehydrogenase catalytic subunit ...   249    4e-64 
gb|EFE30253.1|  hypothetical protein ARB_02933 [Arthroderma be...   248    5e-64 
gb|ABW39793.1|  mitochondrial succinate dehydrogenase iron-sul...   248    7e-64 
gb|EDL13334.1|  succinate dehydrogenase complex, subunit B, ir...   248    9e-64 
gb|ABD77130.1|  succinate dehydrogenase complex subunit B [Lox...   248    9e-64 
dbj|BAG80571.1|  succinate dehydrogenase iron-sulfur subunit [...   247    1e-63 
dbj|BAG80574.1|  succinate dehydrogenase iron-sulfur subunit [...   247    1e-63 
gb|ABD77127.1|  succinate dehydrogenase complex subunit B [Did...   246    3e-63 
ref|ZP_01914424.1|  succinate dehydrogenase iron-sulfur subuni...   246    3e-63 
ref|XP_002370847.1|  iron-sulfur subunit of succinate dehydrog...   245    4e-63 
dbj|BAG80573.1|  succinate dehydrogenase iron-sulfur subunit [...   245    4e-63 
sp|O42772.1|DHSB_MYCGR  RecName: Full=Succinate dehydrogenase ...   245    4e-63 
ref|XP_001216213.1|  succinate dehydrogenase iron-sulfur prote...   244    7e-63 
gb|EEH16466.1|  succinate dehydrogenase iron-sulfur subunit [P...   244    1e-62 
ref|ZP_00372228.1|  succinate dehydrogenase, iron-sulfur prote...   244    1e-62 
ref|NP_880996.1|  succinate dehydrogenase iron-sulfur subunit ...   244    1e-62 
ref|NP_680465.2|  SDH2-3; electron carrier/ succinate dehydrog...   243    3e-62 
ref|YP_785707.1|  succinate dehydrogenase iron-sulfur protein ...   242    4e-62 
ref|XP_002189250.1|  PREDICTED: putative succinate dehydrogena...   242    5e-62 
ref|ZP_06226639.1|  succinate dehydrogenase and fumarate reduc...   241    6e-62 
ref|XP_002141075.1|  succinate dehydrogenase [ubiquinone] iron...   241    6e-62 
ref|ZP_06686503.1|  succinate dehydrogenase iron-sulfur subuni...   241    1e-61 
ref|XP_002534311.1|  succinate dehydrogenase, putative [Ricinu...   241    1e-61 
ref|YP_001630431.1|  succinate dehydrogenase iron-sulfur subun...   240    1e-61 
ref|YP_527579.1|  succinate dehydrogenase iron-sulfur subunit ...   240    1e-61 
ref|YP_001021358.1|  succinate dehydrogenase subunit B [Methyl...   240    2e-61 
gb|EFA84800.1|  succinate dehydrogenase [Polysphondylium palli...   239    2e-61 
ref|XP_001122922.1|  PREDICTED: similar to Succinate dehydroge...   239    2e-61 
ref|ZP_05043355.1|  succinate dehydrogenase and fumarate reduc...   239    3e-61 
gb|ACF79054.1|  unknown [Zea mays]                                  239    3e-61 
ref|YP_693217.1|  succinate dehydrogenase, iron-sulfur [Alcani...   239    3e-61 
ref|XP_002264752.1|  PREDICTED: hypothetical protein [Vitis vi...   239    4e-61 
ref|ZP_01223999.1|  succinate dehydrogenase (B subunit) [marin...   238    5e-61 
ref|YP_927303.1|  succinate dehydrogenase iron-sulfur subunit ...   238    5e-61 
ref|YP_002908367.1|  Succinate dehydrogenase/fumarate reductas...   238    7e-61 
ref|YP_550406.1|  succinate dehydrogenase subunit B [Polaromon...   238    9e-61 
ref|YP_296528.1|  succinate dehydrogenase iron-sulfur subunit ...   238    9e-61 
ref|YP_727079.1|  succinate dehydrogenase iron-sulfur subunit ...   238    9e-61 
ref|YP_983255.1|  succinate dehydrogenase and fumarate reducta...   238    9e-61 
ref|YP_584629.1|  succinate dehydrogenase iron-sulfur subunit ...   238    9e-61 
ref|YP_001892881.1|  succinate dehydrogenase and fumarate redu...   237    2e-60 
ref|YP_001563447.1|  succinate dehydrogenase and fumarate redu...   237    2e-60 
ref|ZP_04958194.1|  succinate dehydrogenase, iron-sulfur subun...   236    2e-60 
ref|YP_001891015.1|  succinate dehydrogenase iron-sulfur subun...   236    2e-60 
ref|YP_001100056.1|  succinate dehydrogenase iron-sulfur subun...   236    2e-60 
ref|YP_411555.1|  succinate dehydrogenase iron-sulfur subunit ...   236    2e-60 
ref|NP_842366.1|  succinate dehydrogenase iron-sulfur subunit ...   236    2e-60 
ref|NP_520114.1|  succinate dehydrogenase iron-sulfur subunit ...   236    2e-60 
ref|ZP_05315855.1|  succinate dehydrogenase and fumarate reduc...   236    3e-60 
ref|YP_999072.1|  succinate dehydrogenase and fumarate reducta...   236    3e-60 
ref|YP_573270.1|  succinate dehydrogenase iron-sulfur subunit ...   236    3e-60 
gb|EAZ08849.1|  hypothetical protein OsI_31111 [Oryza sativa I...   235    4e-60 
ref|NP_001063018.1|  Os09g0370300 [Oryza sativa (japonica cult...   235    4e-60 
ref|YP_002796409.1|  SdhB [Laribacter hongkongensis HLHK9] >gb...   235    6e-60 
emb|CAM32703.1|  Succinate dehydrogenase Fe-S protein subunit ...   235    6e-60 
ref|ZP_06211027.1|  succinate dehydrogenase and fumarate reduc...   234    8e-60 
ref|YP_970553.1|  succinate dehydrogenase subunit B [Acidovora...   234    8e-60 
gb|EEU43008.1|  predicted protein [Nectria haematococca mpVI 7...   234    1e-59 
ref|YP_001900075.1|  succinate dehydrogenase and fumarate redu...   234    1e-59 
ref|YP_899248.1|  succinate dehydrogenase iron-sulfur subunit ...   234    1e-59 
ref|YP_001861710.1|  succinate dehydrogenase and fumarate redu...   234    1e-59 
gb|AAX77761.1|  unknown protein [synthetic construct]               234    1e-59 
ref|YP_169150.1|  succinate dehydrogenase iron-sulfur subunit ...   234    1e-59 
ref|YP_003524454.1|  succinate dehydrogenase and fumarate redu...   234    1e-59 
ref|YP_002943344.1|  succinate dehydrogenase and fumarate redu...   234    1e-59 
ref|ZP_05126261.1|  succinate dehydrogenase, iron-sulfur subun...   234    1e-59 
ref|ZP_01101179.1|  succinate dehydrogenase, iron-sulfur prote...   234    1e-59 
ref|ZP_06469908.1|  succinate dehydrogenase and fumarate reduc...   233    2e-59 
ref|ZP_04763573.1|  succinate dehydrogenase and fumarate reduc...   233    2e-59 
ref|YP_001791733.1|  succinate dehydrogenase and fumarate redu...   233    2e-59 
ref|ZP_02882192.1|  succinate dehydrogenase and fumarate reduc...   233    2e-59 
ref|YP_001677696.1|  succinate dehydrogenase iron-sulfur subun...   233    2e-59 
ref|XP_002163025.1|  PREDICTED: similar to Succinate dehydroge...   233    2e-59 
ref|YP_001981990.1|  succinate dehydrogenase iron-sulfur subun...   233    2e-59 
ref|YP_001353199.1|  succinate dehydrogenase iron-sulfur subun...   233    2e-59 
ref|YP_552453.1|  succinate dehydrogenase iron-sulfur subunit ...   233    2e-59 
ref|YP_001093780.1|  succinate dehydrogenase iron-sulfur subun...   233    2e-59 
ref|YP_621202.1|  succinate dehydrogenase iron-sulfur subunit ...   233    2e-59 
ref|ZP_03697617.1|  succinate dehydrogenase and fumarate reduc...   233    3e-59 
ref|NP_746307.1|  succinate dehydrogenase iron-sulfur subunit ...   233    3e-59 
ref|YP_002800119.1|  succinate dehydrogenase iron-sulfur subun...   232    4e-59 
ref|ZP_03266729.1|  succinate dehydrogenase and fumarate reduc...   232    4e-59 
ref|ZP_03271142.1|  succinate dehydrogenase and fumarate reduc...   232    4e-59 
ref|ZP_04985894.1|  succinate dehydrogenase iron-sulfur protei...   232    4e-59 
ref|YP_001890516.1|  succinate dehydrogenase and fumarate redu...   232    4e-59 
ref|YP_987013.1|  succinate dehydrogenase subunit B [Acidovora...   232    4e-59 
ref|NP_900738.1|  succinate dehydrogenase iron-sulfur subunit ...   232    4e-59 
ref|YP_003073952.1|  succinate dehydrogenase / fumarate reduct...   232    5e-59 
ref|ZP_05068351.1|  succinate dehydrogenase iron-sulfur protei...   232    5e-59 
dbj|BAA31216.1|  fumarate reductase iron-sulpher protein subun...   232    5e-59 
ref|YP_002908476.1|  Succinate dehydrogenase and fumarate redu...   231    6e-59 
ref|YP_001341648.1|  succinate dehydrogenase iron-sulfur subun...   231    6e-59 
ref|ZP_01042323.1|  succinate dehydrogenase [Idiomarina baltic...   231    6e-59 
ref|YP_003146722.1|  succinate dehydrogenase and fumarate redu...   231    8e-59 
ref|XP_572036.1|  succinate dehydrogenase iron-sulfur subunit ...   231    8e-59 
ref|YP_514410.1|  succinate dehydrogenase iron-sulfur subunit ...   231    8e-59 
ref|XP_385786.1|  hypothetical protein FG05610.1 [Gibberella z...   231    8e-59 
ref|XP_002462291.1|  hypothetical protein SORBIDRAFT_02g023310...   231    1e-58 
ref|YP_001750365.1|  succinate dehydrogenase iron-sulfur subun...   231    1e-58 
ref|ZP_01625259.1|  succinate dehydrogenase iron-sulfur subuni...   231    1e-58 
ref|YP_001760215.1|  succinate dehydrogenase and fumarate redu...   231    1e-58 
ref|YP_314943.1|  succinate dehydrogenase subunit B [Thiobacil...   231    1e-58 
ref|ZP_01075067.1|  Succinate dehydrogenase/fumarate reductase...   231    1e-58 
ref|ZP_01706465.1|  succinate dehydrogenase and fumarate reduc...   230    1e-58 
ref|ZP_01305541.1|  succinate dehydrogenase, iron-sulfur prote...   230    1e-58 
ref|YP_286062.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|YP_963129.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|YP_747091.1|  succinate dehydrogenase iron-sulfur subunit ...   230    1e-58 
ref|ZP_01892760.1|  succinate dehydrogenase iron-sulfur subuni...   230    2e-58 
ref|YP_609160.1|  succinate dehydrogenase iron-sulfur subunit ...   230    2e-58 
ref|ZP_01114264.1|  succinate dehydrogenase, iron-sulfur prote...   230    2e-58 
ref|YP_003519469.1|  SdhB [Pantoea ananatis LMG 20103] >gb|ADD...   229    2e-58 
ref|XP_974251.1|  PREDICTED: similar to succinate dehydrogenas...   229    2e-58 
ref|YP_737759.1|  succinate dehydrogenase iron-sulfur subunit ...   229    2e-58 
ref|YP_001183790.1|  succinate dehydrogenase iron-sulfur subun...   229    2e-58 
ref|ZP_05876599.1|  succinate dehydrogenase iron-sulfur protei...   229    3e-58 
ref|ZP_03542044.1|  succinate dehydrogenase and fumarate reduc...   229    3e-58 
emb|CBA73768.1|  succinate dehydrogenase iron-sulfur protein [...   229    4e-58 
ref|YP_001674706.1|  succinate dehydrogenase iron-sulfur subun...   229    4e-58 
ref|YP_435868.1|  succinate dehydrogenase iron-sulfur subunit ...   229    4e-58 
ref|ZP_05731904.1|  succinate dehydrogenase and fumarate reduc...   228    5e-58 
ref|ZP_05969169.1|  succinate dehydrogenase, iron-sulfur prote...   228    5e-58 
ref|NP_717536.1|  succinate dehydrogenase iron-sulfur subunit ...   228    5e-58 
ref|YP_001050878.1|  succinate dehydrogenase and fumarate redu...   228    5e-58 
ref|YP_003332775.1|  succinate dehydrogenase and fumarate redu...   228    7e-58 
ref|ZP_05498372.1|  succinate dehydrogenase and fumarate reduc...   228    7e-58 
ref|YP_002649435.1|  Succinate dehydrogenase, iron sulfur prot...   228    7e-58 
ref|YP_001908229.1|  succinate dehydrogenase iron-sulfur subun...   228    7e-58 
ref|ZP_01869370.1|  succinate dehydrogenase iron-sulfur subuni...   228    7e-58 
ref|ZP_01814755.1|  succinate dehydrogenase iron-sulfur subuni...   228    7e-58 
ref|YP_751028.1|  succinate dehydrogenase iron-sulfur subunit ...   228    7e-58 
ref|ZP_02376333.1|  succinate dehydrogenase iron-sulfur subuni...   228    9e-58 
ref|ZP_02159770.1|  succinate dehydrogenase catalytic subunit ...   228    9e-58 
ref|YP_733767.1|  succinate dehydrogenase iron-sulfur subunit ...   228    9e-58 
ref|ZP_05082141.1|  SdhB succinate dehydrogenase (iron-sulfur ...   227    1e-57 
ref|YP_933056.1|  succinate dehydrogenase iron-sulfur subunit ...   227    1e-57 
ref|YP_001501645.1|  succinate dehydrogenase iron-sulfur subun...   227    1e-57 
ref|ZP_04617352.1|  Succinate dehydrogenase iron-sulfur protei...   227    2e-57 
ref|ZP_03455873.1|  succinate dehydrogenase and fumarate reduc...   227    2e-57 
ref|ZP_02417039.1|  succinate dehydrogenase iron-sulfur subuni...   227    2e-57 
ref|YP_372904.1|  succinate dehydrogenase iron-sulfur subunit ...   227    2e-57 
ref|YP_002126172.1|  succinate dehydrogenase catalytic subunit...   227    2e-57 
ref|ZP_04889099.1|  succinate dehydrogenase and fumarate reduc...   227    2e-57 
ref|YP_001115006.1|  succinate dehydrogenase iron-sulfur subun...   227    2e-57 
ref|YP_003530525.1|  succinate dehydrogenase, iron sulfur prot...   226    2e-57 
ref|YP_003005216.1|  succinate dehydrogenase and fumarate redu...   226    2e-57 
ref|ZP_05971151.1|  succinate dehydrogenase, iron-sulfur prote...   226    2e-57 
ref|ZP_02369744.1|  succinate dehydrogenase, iron-sulfur prote...   226    2e-57 
ref|YP_001349044.1|  succinate dehydrogenase iron-sulfur subun...   226    2e-57 
ref|ZP_01449549.1|  succinate dehydrogenase catalytic subunit ...   226    2e-57 
ref|YP_438562.1|  succinate dehydrogenase, iron-sulfur protein...   226    2e-57 
ref|YP_258843.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|YP_106517.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|YP_112265.1|  succinate dehydrogenase iron-sulfur subunit ...   226    2e-57 
ref|ZP_06054024.1|  succinate dehydrogenase iron-sulfur protei...   226    3e-57 
ref|YP_002871455.1|  succinate dehydrogenase iron-sulfur prote...   226    3e-57 
ref|ZP_03828418.1|  succinate dehydrogenase iron-sulfur subuni...   226    3e-57 
ref|ZP_03577970.1|  succinate dehydrogenase iron-sulfur subuni...   226    3e-57 
ref|ZP_01768559.1|  succinate dehydrogenase and fumarate reduc...   226    3e-57 
ref|YP_001077078.1|  succinate dehydrogenase iron-sulfur subun...   226    3e-57 
ref|YP_001585460.1|  succinate dehydrogenase iron-sulfur subun...   226    3e-57 
ref|YP_563189.1|  succinate dehydrogenase iron-sulfur subunit ...   226    3e-57 
gb|AAO39688.1|  succinate dehydrogenase iron-sulfur protein [E...   226    3e-57 
ref|YP_263409.1|  succinate dehydrogenase iron-sulfur subunit ...   226    3e-57 
ref|YP_049466.1|  succinate dehydrogenase iron-sulfur subunit ...   226    3e-57 
ref|ZP_02476785.1|  succinate dehydrogenase iron-sulfur subuni...   226    3e-57 
emb|CBK85659.1|  succinate dehydrogenase subunit B [Enterobact...   226    4e-57 
ref|YP_003260450.1|  succinate dehydrogenase and fumarate redu...   226    4e-57 
ref|YP_003016819.1|  succinate dehydrogenase and fumarate redu...   226    4e-57 
ref|ZP_03571737.1|  succinate dehydrogenase iron-sulfur subuni...   226    4e-57 
gb|AAT50386.1|  PA1584 [synthetic construct]                        226    4e-57 
ref|YP_775203.1|  succinate dehydrogenase iron-sulfur subunit ...   226    4e-57 
ref|YP_003557485.1|  succinate dehydrogenase, iron-sulfur prot...   225    5e-57 
ref|YP_002986770.1|  succinate dehydrogenase and fumarate redu...   225    5e-57 
ref|YP_003461104.1|  succinate dehydrogenase and fumarate redu...   225    5e-57 
ref|ZP_02359344.1|  succinate dehydrogenase iron-sulfur subuni...   225    5e-57 
ref|YP_001810513.1|  succinate dehydrogenase and fumarate redu...   225    5e-57 
ref|YP_001477498.1|  succinate dehydrogenase iron-sulfur subun...   225    5e-57 
gb|AAV36011.1|  mitochondrial succinate dehydrogenase beta sub...   225    5e-57 
ref|NP_250275.1|  succinate dehydrogenase iron-sulfur subunit ...   225    5e-57 
ref|YP_160850.1|  succinate dehydrogenase iron-sulfur subunit ...   225    5e-57 
ref|YP_579378.1|  succinate dehydrogenase iron-sulfur subunit ...   225    5e-57 
ref|YP_624285.1|  succinate dehydrogenase iron-sulfur subunit ...   225    5e-57 
ref|YP_001116844.1|  succinate dehydrogenase iron-sulfur subun...   225    5e-57 
ref|ZP_06641508.1|  succinate dehydrogenase [Serratia odorifer...   225    6e-57 
ref|ZP_06192040.1|  succinate dehydrogenase iron-sulfur subuni...   225    6e-57 
ref|ZP_05618842.1|  succinate dehydrogenase iron-sulfur subuni...   225    6e-57 
ref|ZP_03831568.1|  succinate dehydrogenase iron-sulfur subuni...   225    6e-57 
ref|YP_002417833.1|  succinate dehydrogenase iron-sulfur subun...   225    6e-57 
ref|YP_002262352.1|  succinate dehydrogenase iron-sulfur subun...   225    6e-57 
ref|YP_001584615.1|  succinate dehydrogenase iron-sulfur subun...   225    6e-57 
ref|YP_001155543.1|  succinate dehydrogenase and fumarate redu...   225    6e-57 
ref|YP_204205.1|  succinate dehydrogenase iron-sulfur subunit ...   225    6e-57 
ref|YP_438862.1|  succinate dehydrogenase iron-sulfur subunit ...   225    6e-57 
ref|ZP_01065971.1|  succinate dehydrogenase [Vibrio sp. MED222...   225    6e-57 
ref|YP_106305.1|  succinate dehydrogenase iron-sulfur subunit ...   225    6e-57 
ref|ZP_06155773.1|  succinate dehydrogenase iron-sulfur protei...   224    8e-57 
ref|YP_001797849.1|  succinate dehydrogenase and fumarate redu...   224    8e-57 
ref|YP_001172390.1|  succinate dehydrogenase iron-sulfur subun...   224    8e-57 
ref|YP_001279169.1|  succinate dehydrogenase iron-sulfur subun...   224    8e-57 
ref|YP_523058.1|  succinate dehydrogenase and fumarate reducta...   224    8e-57 
ref|YP_347345.1|  succinate dehydrogenase iron-sulfur subunit ...   224    8e-57 
ref|ZP_00992235.1|  succinate dehydrogenase [Vibrio splendidus...   224    8e-57 
ref|ZP_04831435.1|  succinate dehydrogenase and fumarate reduc...   224    1e-56 
ref|ZP_02959668.1|  hypothetical protein PROSTU_01554 [Provide...   224    1e-56 
ref|YP_402339.1|  succinate dehydrogenase iron-sulfur subunit ...   224    1e-56 
ref|NP_415252.1|  succinate dehydrogenase, FeS subunit [Escher...   224    1e-56 
ref|ZP_04561169.1|  succinate dehydrogenase iron-sulfur subuni...   224    1e-56 
ref|YP_002150337.1|  succinate dehydrogenase iron-sulfur prote...   224    1e-56 
ref|NP_670367.1|  succinate dehydrogenase iron-sulfur subunit ...   224    1e-56 
ref|YP_002312262.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|YP_001474550.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|ZP_01617015.1|  Succinate dehydrogenase/fumarate reductase...   223    2e-56 
ref|YP_001175957.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|YP_001585729.1|  succinate dehydrogenase and fumarate redu...   223    2e-56 
ref|YP_856457.1|  succinate dehydrogenase iron-sulfur protein ...   223    2e-56 
ref|ZP_04629825.1|  Succinate dehydrogenase iron-sulfur protei...   223    2e-56 
ref|ZP_06353731.1|  succinate dehydrogenase, iron-sulfur prote...   223    2e-56 
ref|ZP_06124570.1|  succinate dehydrogenase, iron-sulfur prote...   223    2e-56 
ref|YP_002889526.1|  succinate dehydrogenase and fumarate redu...   223    2e-56 
ref|YP_001453988.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|YP_001438699.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|YP_001142155.1|  succinate dehydrogenase, iron-sulfur prot...   223    2e-56 
ref|YP_001187992.1|  succinate dehydrogenase iron-sulfur subun...   223    2e-56 
ref|YP_661373.1|  succinate dehydrogenase and fumarate reducta...   223    2e-56 
ref|YP_003364345.1|  succinate dehydrogenase iron-sulfur prote...   223    3e-56 
ref|ZP_05885435.1|  succinate dehydrogenase iron-sulfur protei...   223    3e-56 
ref|ZP_03320574.1|  hypothetical protein PROVALCAL_03540 [Prov...   223    3e-56 
ref|NP_286440.1|  succinate dehydrogenase iron-sulfur subunit ...   223    3e-56 
ref|ZP_06752965.1|  succinate dehydrogenase iron-sulfur subuni...   222    4e-56 
ref|YP_003526276.1|  succinate dehydrogenase and fumarate redu...   222    4e-56 
ref|YP_003048197.1|  succinate dehydrogenase and fumarate redu...   222    4e-56 
ref|YP_002924625.1|  succinate dehydrogenase, Fe-S protein [Ca...   222    4e-56 
gb|ABR16401.1|  unknown [Picea sitchensis]                          222    4e-56 
ref|ZP_01552152.1|  succinate dehydrogenase catalytic subunit ...   222    4e-56 
ref|XP_624306.2|  PREDICTED: similar to Succinate dehydrogenas...   222    4e-56 
ref|YP_151223.1|  succinate dehydrogenase iron-sulfur subunit ...   222    4e-56 
ref|ZP_04637505.1|  Succinate dehydrogenase iron-sulfur protei...   222    4e-56 
ref|YP_003227850.1|  succinate dehydrogenase, FeS subunit [Esc...   222    5e-56 
ref|YP_003167603.1|  succinate dehydrogenase and fumarate redu...   222    5e-56 
ref|ZP_04619155.1|  Succinate dehydrogenase iron-sulfur protei...   222    5e-56 
ref|ZP_03346202.1|  succinate dehydrogenase iron-sulfur subuni...   222    5e-56 
ref|YP_454555.1|  succinate dehydrogenase iron-sulfur subunit ...   222    5e-56 
ref|NP_455291.1|  succinate dehydrogenase iron-sulfur subunit ...   222    5e-56 
ref|ZP_04634255.1|  Succinate dehydrogenase iron-sulfur protei...   222    5e-56 
ref|ZP_06728544.1|  succinate dehydrogenase iron-sulfur subuni...   221    7e-56 
ref|ZP_04613598.1|  Succinate dehydrogenase iron-sulfur protei...   221    7e-56 
ref|ZP_04626186.1|  Succinate dehydrogenase iron-sulfur protei...   221    7e-56 
ref|ZP_03822023.1|  succinate dehydrogenase iron-sulfur subuni...   221    7e-56 
ref|ZP_03806467.1|  hypothetical protein PROPEN_04872 [Proteus...   221    7e-56 
ref|ZP_02346598.2|  succinate dehydrogenase, iron-sulfur subun...   221    7e-56 
ref|ZP_03165065.1|  succinate dehydrogenase iron-sulfur subuni...   221    7e-56 
ref|YP_001571227.1|  succinate dehydrogenase iron-sulfur subun...   221    7e-56 
gb|EDL13331.1|  succinate dehydrogenase complex, subunit B, ir...   221    7e-56 
ref|YP_001007133.1|  succinate dehydrogenase iron-sulfur subun...   221    7e-56 
ref|NP_459720.1|  succinate dehydrogenase iron-sulfur subunit ...   221    7e-56 
ref|ZP_04655502.1|  succinate dehydrogenase iron-sulfur subuni...   221    7e-56 
ref|NP_797225.1|  succinate dehydrogenase iron-sulfur subunit ...   221    7e-56 
ref|YP_003466989.1|  succinate dehydrogenase, Fe-S protein [Xe...   221    9e-56 
ref|ZP_06069086.1|  succinate dehydrogenase iron-sulfur subuni...   221    9e-56 
ref|YP_003209694.1|  Succinate dehydrogenase iron-sulfur subun...   221    9e-56 
ref|YP_003037136.1|  succinate dehydrogenase and fumarate redu...   221    9e-56 
ref|YP_958431.1|  succinate dehydrogenase iron-sulfur subunit ...   221    9e-56 
ref|ZP_06457356.1|  succinate dehydrogenase iron-sulfur subuni...   221    1e-55 
ref|ZP_06048566.1|  succinate dehydrogenase iron-sulfur protei...   221    1e-55 
ref|YP_003041805.1|  succinate dehydrogenase iron-sulfur prote...   221    1e-55 
ref|ZP_01614801.1|  succinate dehydrogenase iron-sulfur subuni...   221    1e-55 
ref|NP_792019.1|  succinate dehydrogenase, iron-sulfur protein...   221    1e-55 
ref|YP_274203.1|  succinate dehydrogenase iron-sulfur subunit ...   221    1e-55 
ref|YP_268943.1|  succinate dehydrogenase iron-sulfur subunit ...   221    1e-55 
ref|YP_235089.1|  succinate dehydrogenase iron-sulfur subunit ...   221    1e-55 
ref|NP_231720.1|  succinate dehydrogenase iron-sulfur subunit ...   221    1e-55 
ref|NP_928727.1|  succinate dehydrogenase iron-sulfur subunit ...   220    1e-55 
ref|ZP_01262352.1|  succinate dehydrogenase catalytic subunit ...   220    1e-55 
ref|ZP_06065212.1|  succinate dehydrogenase/fumarate reductase...   220    2e-55 
ref|ZP_05716179.1|  succinate dehydrogenase catalytic subunit ...   220    2e-55 
ref|YP_002239651.1|  succinate dehydrogenase, iron-sulfur subu...   220    2e-55 
gb|AAV36007.1|  hydrogenosomal succinate dehydrogenase beta su...   220    2e-55 
ref|ZP_01168172.1|  Succinate dehydrogenase/fumarate reductase...   220    2e-55 
ref|ZP_06478027.1|  succinate dehydrogenase iron-sulfur subuni...   219    3e-55 
ref|ZP_05881274.1|  succinate dehydrogenase iron-sulfur protei...   219    3e-55 
ref|YP_002353820.1|  succinate dehydrogenase and fumarate redu...   219    3e-55 
ref|YP_094574.1|  succinate dehydrogenase iron-sulfur subunit ...   219    3e-55 
ref|NP_933824.1|  succinate dehydrogenase iron-sulfur subunit ...   219    3e-55 
ref|ZP_06062753.1|  succinate dehydrogenase iron-sulfur subuni...   219    3e-55 
ref|YP_001334404.1|  succinate dehydrogenase iron-sulfur subun...   219    3e-55 
ref|NP_066507.1|  succinate:cytochrome c oxidoreductase subuni...   219    3e-55 
ref|YP_159617.1|  succinate dehydrogenase iron-sulfur subunit ...   219    3e-55 
ref|YP_122934.1|  succinate dehydrogenase iron-sulfur subunit ...   219    3e-55 
ref|YP_125941.1|  succinate dehydrogenase iron-sulfur subunit ...   219    3e-55 
ref|ZP_06175080.1|  succinate dehydrogenase catalytic subunit ...   219    4e-55 
ref|ZP_06033935.1|  succinate dehydrogenase iron-sulfur protei...   219    4e-55 
ref|XP_002579985.1|  succinate dehydrogenase iron-sulfur prote...   219    4e-55 
ref|YP_001444558.1|  succinate dehydrogenase iron-sulfur subun...   219    4e-55 
ref|XP_001506093.1|  PREDICTED: similar to succinate dehydroge...   219    4e-55 
ref|ZP_01988018.1|  succinate dehydrogenase iron-sulfur protei...   219    4e-55 
ref|YP_943593.1|  succinate dehydrogenase catalytic subunit [P...   219    4e-55 
ref|ZP_04418286.1|  succinate dehydrogenase iron-sulfur protei...   218    6e-55 
ref|ZP_03713182.1|  hypothetical protein EIKCOROL_00857 [Eiken...   218    6e-55 
ref|XP_001451516.1|  hypothetical protein [Paramecium tetraure...   218    6e-55 
ref|XP_001433045.1|  hypothetical protein [Paramecium tetraure...   218    6e-55 
ref|XP_001429245.1|  hypothetical protein [Paramecium tetraure...   218    6e-55 
ref|YP_340164.1|  succinate dehydrogenase iron-sulfur subunit ...   218    6e-55 
ref|YP_047427.1|  succinate dehydrogenase iron-sulfur subunit ...   218    6e-55 
ref|NP_871423.1|  succinate dehydrogenase iron-sulfur subunit ...   218    6e-55 
ref|ZP_01134827.1|  succinate dehydrogenase catalytic subunit ...   218    6e-55 
ref|ZP_06186651.1|  succinate dehydrogenase iron-sulfur subuni...   218    7e-55 
ref|ZP_06059059.1|  succinate dehydrogenase/fumarate reductase...   218    7e-55 
ref|YP_001706359.1|  succinate dehydrogenase iron-sulfur subun...   218    7e-55 
ref|YP_155891.1|  succinate dehydrogenase iron-sulfur subunit ...   218    7e-55 
ref|ZP_05823226.1|  succinate dehydrogenase/fumarate reductase...   218    1e-54 
ref|ZP_05111360.1|  succinate dehydrogenase iron-sulfur subuni...   218    1e-54 
ref|ZP_01739269.1|  succinate dehydrogenase iron-sulfur subuni...   218    1e-54 
ref|ZP_06715727.1|  succinate dehydrogenase, iron-sulfur prote...   217    1e-54 
ref|ZP_05944836.1|  succinate dehydrogenase iron-sulfur protei...   217    1e-54 
ref|ZP_05317153.1|  succinate dehydrogenase iron-sulfur subuni...   217    1e-54 
ref|ZP_03718320.1|  hypothetical protein NEIFLAOT_00120 [Neiss...   217    1e-54 
ref|ZP_05360099.1|  succinate dehydrogenase iron-sulfur subuni...   217    2e-54 
ref|YP_002001504.1|  succinate dehydrogenase iron-sulfur subun...   217    2e-54 
ref|YP_344453.1|  succinate dehydrogenase/fumarate reductase i...   217    2e-54 
ref|YP_208028.1|  succinate dehydrogenase iron-sulfur subunit ...   217    2e-54 
ref|ZP_06393786.1|  succinate dehydrogenase iron-sulfur subuni...   216    2e-54 
ref|YP_003264217.1|  succinate dehydrogenase and fumarate redu...   216    2e-54 
ref|ZP_04758496.1|  succinate dehydrogenase iron-sulfur subuni...   216    2e-54 
gb|EDL80952.1|  succinate dehydrogenase complex, subunit B, ir...   216    2e-54 
ref|ZP_02196429.1|  succinate dehydrogenase iron-sulfur subuni...   216    3e-54 
ref|YP_974998.1|  succinate dehydrogenase iron-sulfur subunit ...   216    3e-54 
ref|ZP_01219608.1|  succinate dehydrogenase [Photobacterium pr...   216    3e-54 
ref|NP_759169.1|  succinate dehydrogenase iron-sulfur subunit ...   216    3e-54 
ref|NP_273989.1|  succinate dehydrogenase iron-sulfur subunit ...   216    3e-54 
ref|ZP_06693197.1|  conserved hypothetical protein [Acinetobac...   216    4e-54 
ref|ZP_06736101.1|  hypothetical protein NEIELOOT_02958 [Neiss...   216    4e-54 
ref|ZP_06298054.1|  succinate dehydrogenase and fumarate reduc...   216    4e-54 
ref|ZP_05121137.1|  succinate dehydrogenase iron-sulfur subuni...   216    4e-54 
ref|YP_129260.1|  succinate dehydrogenase iron-sulfur subunit ...   216    4e-54 
ref|ZP_06569693.1|  succinate dehydrogenase iron-sulfur subuni...   215    5e-54 
ref|ZP_05794484.1|  succinate dehydrogenase iron-sulfur subuni...   215    5e-54 
ref|ZP_01900521.1|  succinate dehydrogenase [Moritella sp. PE3...   215    5e-54 
ref|YP_002513552.1|  succinate dehydrogenase and fumarate redu...   215    6e-54 
ref|ZP_02062643.1|  succinate dehydrogenase iron-sulfur subuni...   214    8e-54 
ref|YP_003296631.1|  succinate dehydrogenase iron-sulfur subun...   214    1e-53 
gb|EAZ05419.1|  hypothetical protein OsI_27631 [Oryza sativa I...   214    1e-53 
dbj|BAA82748.1|  mitochondrial ribosomal protein S14 [Oryza sa...   214    1e-53 
ref|ZP_01160042.1|  succinate dehydrogenase [Photobacterium sp...   213    2e-53 
ref|YP_002934265.1|  succinate dehydrogenase iron-sulfur subun...   213    2e-53 
gb|ACN33958.1|  unknown [Zea mays]                                  212    4e-53 
ref|YP_001597241.1|  succinate dehydrogenase iron-sulfur subun...   212    4e-53 
ref|ZP_01235861.1|  succinate dehydrogenase catalytic subunit ...   212    4e-53 
emb|CAB42658.1|  iron sulfur subunit of succinate dehydrogenas...   212    4e-53 
sp|P51053.1|DHSB_COXBU  RecName: Full=Succinate dehydrogenase ...   212    4e-53 
ref|NP_820385.1|  succinate dehydrogenase iron-sulfur subunit ...   212    4e-53 
ref|ZP_01364935.1|  hypothetical protein PaerPA_01002047 [Pseu...   212    4e-53 
emb|CAD62368.1|  chimeric SDH2-RPS14 protein [Triticum aestivum]    211    7e-53 
ref|XP_001024894.2|  succinate dehydrogenase and fumarate redu...   211    9e-53 
gb|EAZ44499.1|  hypothetical protein OsJ_29116 [Oryza sativa J...   211    9e-53 
ref|ZP_05093784.1|  succinate dehydrogenase and fumarate reduc...   211    1e-52 
ref|ZP_04919691.1|  succinate dehydrogenase, iron-sulfur prote...   210    2e-52 
ref|YP_003443617.1|  succinate dehydrogenase and fumarate redu...   209    3e-52 
emb|CAD36476.1|  succinate dehydrogenase [Rhodococcus ruber]        171    7e-52 
ref|NP_878622.1|  succinate dehydrogenase iron-sulfur subunit ...   208    8e-52 
ref|ZP_01215176.1|  succinate dehydrogenase [Psychromonas sp. ...   207    1e-51 
ref|ZP_01737259.1|  succinate dehydrogenase iron-sulfur subuni...   207    2e-51 
ref|ZP_01736792.1|  succinate dehydrogenase iron-sulfur subuni...   207    2e-51 
gb|EEY66687.1|  succinate dehydrogenase iron-sulfur protein [P...   206    4e-51 
emb|CAA13166.1|  z62f [Vibrio cholerae]                             206    4e-51 
ref|YP_003504718.1|  succinate dehydrogenase and fumarate redu...   204    8e-51 
ref|YP_392292.1|  succinate dehydrogenase and fumarate reducta...   202    3e-50 
ref|YP_001085729.1|  succinate dehydrogenase iron-sulfur subun...   202    4e-50 
ref|XP_001451992.1|  hypothetical protein [Paramecium tetraure...   202    5e-50 
ref|ZP_06186276.1|  succinate dehydrogenase iron-sulfur subuni...   201    9e-50 
ref|YP_277840.1|  succinate dehydrogenase iron-sulfur subunit ...   197    1e-48 
gb|AAB24366.1|  succinate-ubiquinone oxidoreductase complex II...   197    1e-48 
ref|XP_002778710.1|  iron-sulfur subunit of succinate dehydrog...   194    9e-48 
ref|YP_003495921.1|  succinate dehydrogenase iron-sulfur prote...   193    2e-47 
gb|AAA88331.1|  ORF2 [Neisseria gonorrhoeae]                        191    1e-46 
emb|CBI17705.1|  unnamed protein product [Vitis vinifera]           188    6e-46 
ref|ZP_00374696.1|  succinate dehydrogenase, iron-sulfur prote...   187    1e-45 
gb|EDL80955.1|  succinate dehydrogenase complex, subunit B, ir...   187    2e-45 
gb|ADD79481.1|  succinate dehydrogenase iron-sulfur protein [C...   186    3e-45 
ref|ZP_06806584.1|  succinate dehydrogenase [Brevibacterium mc...   185    7e-45 
ref|YP_003200700.1|  succinate dehydrogenase and fumarate redu...   185    7e-45 
ref|YP_001996170.1|  succinate dehydrogenase and fumarate redu...   184    9e-45 
pir||C32394  succinate dehydrogenase (ubiquinone) (EC 1.3.5.1)...   184    1e-44 
ref|YP_003379238.1|  succinate dehydrogenase and fumarate redu...   183    2e-44 
ref|ZP_03496517.1|  succinate dehydrogenase and fumarate reduc...   183    2e-44 
ref|ZP_04036501.1|  succinate dehydrogenase subunit B [Meiothe...   182    3e-44 
ref|YP_005058.1|  succinate dehydrogenase iron-sulfur subunit ...   182    3e-44 
ref|YP_003111545.1|  succinate dehydrogenase and fumarate redu...   182    5e-44 
ref|YP_003322523.1|  succinate dehydrogenase and fumarate redu...   182    5e-44 
ref|YP_001824202.1|  succinate dehydrogenase iron-sulfur subun...   182    5e-44 
ref|YP_947028.1|  succinate dehydrogenase iron-sulfur subunit ...   182    5e-44 
ref|YP_479791.1|  succinate dehydrogenase iron-sulfur subunit ...   182    5e-44 
ref|YP_003319254.1|  succinate dehydrogenase and fumarate redu...   182    6e-44 
ref|YP_001363682.1|  succinate dehydrogenase and fumarate redu...   182    6e-44 
ref|ZP_05000543.1|  succinate dehydrogenase iron-sulfur subuni...   181    8e-44 
ref|YP_144719.1|  succinate dehydrogenase iron-sulfur subunit ...   181    8e-44 
ref|ZP_01131108.1|  succinate dehydrogenase [marine actinobact...   181    8e-44 
ref|ZP_04695676.1|  succinate dehydrogenase iron-sulfur subuni...   181    1e-43 
ref|YP_830622.1|  succinate dehydrogenase iron-sulfur subunit ...   181    1e-43 
ref|YP_003363294.1|  succinate dehydrogenase/fumarate reductas...   181    1e-43 
ref|ZP_05802955.1|  succinate dehydrogenase and fumarate reduc...   181    1e-43 
ref|YP_002785919.1|  putative Succinate dehydrogenase, iron-su...   180    2e-43 
ref|YP_002487281.1|  succinate dehydrogenase and fumarate redu...   180    2e-43 
ref|YP_003289505.1|  succinate dehydrogenase and fumarate redu...   179    3e-43 
ref|YP_001855646.1|  succinate dehydrogenase iron-sulfur prote...   179    3e-43 
ref|YP_711442.1|  succinate dehydrogenase iron-sulfur subunit ...   179    3e-43 
ref|ZP_06270008.1|  succinate dehydrogenase and fumarate reduc...   179    4e-43 
ref|ZP_03363735.1|  succinate dehydrogenase iron-sulfur subuni...   179    4e-43 
ref|YP_061547.1|  succinate dehydrogenase iron-sulfur subunit ...   179    5e-43 
ref|ZP_05009427.1|  succinate dehydrogenase iron-sulfur subuni...   178    6e-43 
ref|ZP_05915713.1|  succinate dehydrogenase iron-sulfur subuni...   178    6e-43 
ref|ZP_00544973.1|  Succinate dehydrogenase (ubiquinone) [Ehrl...   178    6e-43 
ref|YP_003155531.1|  succinate dehydrogenase subunit B [Brachy...   178    8e-43 
ref|YP_003104112.1|  succinate dehydrogenase and fumarate redu...   178    8e-43 
ref|ZP_05508527.1|  succinate dehydrogenase iron-sulfur subuni...   177    1e-42 
ref|ZP_05368435.1|  succinate dehydrogenase iron-sulfur subuni...   177    1e-42 
ref|ZP_04702374.1|  succinate dehydrogenase iron-sulfur subuni...   177    1e-42 
ref|ZP_04993463.1|  succinate dehydrogenase iron-sulfur subuni...   177    1e-42 
ref|YP_001960098.1|  succinate dehydrogenase and fumarate redu...   177    1e-42 
ref|ZP_06709603.1|  succinate dehydrogenase, iron-sulfur subun...   177    2e-42 
ref|ZP_06502346.1|  succinate dehydrogenase iron-sulfur subuni...   177    2e-42 
ref|YP_002956577.1|  succinate dehydrogenase subunit B [Microc...   177    2e-42 
ref|YP_003325576.1|  succinate dehydrogenase and fumarate redu...   176    2e-42 
ref|YP_003108954.1|  succinate dehydrogenase and fumarate redu...   176    2e-42 
ref|ZP_05008916.1|  succinate dehydrogenase iron-sulfur subuni...   176    2e-42 
ref|ZP_05476980.1|  succinate dehydrogenase iron-sulfur subuni...   176    4e-42 
ref|YP_002521580.1|  succinate dehydrogenase iron-sulfur prote...   176    4e-42 
ref|YP_003132436.1|  succinate dehydrogenase subunit B [Saccha...   175    6e-42 
ref|ZP_04364946.1|  succinate dehydrogenase subunit B [Cellulo...   175    6e-42 
ref|YP_002248613.1|  succinate dehydrogenase iron-sulfur prote...   175    6e-42 
ref|ZP_05533784.1|  succinate dehydrogenase iron-sulfur subuni...   175    7e-42 
ref|ZP_04686291.1|  succinate dehydrogenase iron-sulfur subuni...   175    7e-42 
ref|YP_604357.1|  succinate dehydrogenase iron-sulfur subunit ...   175    7e-42 
ref|ZP_05539229.1|  succinate dehydrogenase iron-sulfur subuni...   174    9e-42 
ref|YP_001108677.1|  succinate dehydrogenase iron-sulfur subun...   174    9e-42 
ref|YP_002015456.1|  succinate dehydrogenase and fumarate redu...   174    1e-41 
ref|YP_002765489.1|  succinate dehydrogenase iron-sulfur prote...   174    2e-41 
ref|NP_294675.1|  succinate dehydrogenase iron-sulfur subunit ...   174    2e-41 
gb|AAC72370.1|  succinate dehydrogenase Ip subunit [Bos taurus]     173    2e-41 
ref|ZP_05517003.1|  succinate dehydrogenase iron-sulfur subuni...   173    3e-41 
ref|YP_001623470.1|  succinate dehydrogenase iron-sulfur subun...   173    3e-41 
ref|YP_706180.1|  succinate dehydrogenase iron-sulfur subunit ...   173    3e-41 
ref|YP_117155.1|  succinate dehydrogenase iron-sulfur subunit ...   173    3e-41 
ref|NP_629010.1|  succinate dehydrogenase iron-sulfur subunit ...   172    4e-41 
ref|ZP_05018190.1|  succinate dehydrogenase iron-sulfur subuni...   171    8e-41 
ref|YP_001221710.1|  succinate dehydrogenase iron-sulfur subun...   171    1e-40 
ref|YP_444629.1|  succinate dehydrogenase iron-sulfur subunit ...   171    1e-40 
ref|YP_002882960.1|  succinate dehydrogenase and fumarate redu...   171    1e-40 
ref|YP_003315321.1|  succinate dehydrogenase subunit B [Sangui...   170    2e-40 
ref|ZP_04027449.1|  succinate dehydrogenase subunit B [Tsukamu...   170    2e-40 
ref|YP_001711502.1|  succinate dehydrogenase iron-sulfur subun...   170    2e-40 
ref|NP_824575.1|  succinate dehydrogenase iron-sulfur subunit ...   170    2e-40 
gb|AAC72371.1|  succinate dehydrogenase Ip subunit [Mus musculus]   170    2e-40 
ref|ZP_02004479.1|  Succinate dehydrogenase/fumarate reductase...   169    3e-40 
ref|YP_003160783.1|  succinate dehydrogenase and fumarate redu...   169    5e-40 
ref|YP_001136103.1|  succinate dehydrogenase iron-sulfur subun...   169    5e-40 
ref|YP_003489172.1|  putative succinate dehydrogenase iron-sul...   168    7e-40 
ref|YP_952421.1|  succinate dehydrogenase iron-sulfur subunit ...   168    7e-40 
ref|YP_001069546.1|  succinate dehydrogenase iron-sulfur subun...   167    1e-39 
ref|YP_638395.1|  succinate dehydrogenase iron-sulfur subunit ...   167    1e-39 
ref|YP_076469.1|  succinate dehydrogenase iron-sulfur protein ...   167    1e-39 
ref|YP_886045.1|  succinate dehydrogenase iron-sulfur subunit ...   166    3e-39 
ref|ZP_06473678.1|  succinate dehydrogenase and fumarate reduc...   166    4e-39 
ref|YP_003272926.1|  succinate dehydrogenase and fumarate redu...   166    4e-39 
ref|YP_846221.1|  succinate dehydrogenase and fumarate reducta...   166    4e-39 
ref|YP_001704404.1|  succinate dehydrogenase iron-sulfur subun...   165    6e-39 
ref|YP_905387.1|  succinate dehydrogenase iron-sulfur subunit ...   164    1e-38 
ref|ZP_03426725.1|  succinate dehydrogenase iron-sulfur subuni...   164    2e-38 
ref|YP_001849513.1|  succinate dehydrogenase (iron-sulphur pro...   164    2e-38 
ref|NP_856993.1|  succinate dehydrogenase iron-sulfur subunit ...   164    2e-38 
ref|NP_217836.1|  succinate dehydrogenase iron-sulfur subunit ...   164    2e-38 
ref|YP_002777259.1|  succinate dehydrogenase iron-sulfur prote...   163    2e-38 
gb|ACV53598.1|  succinate dehydrogenase iron-sulfur protein [A...   162    5e-38 
ref|YP_002646429.1|  succinate dehydrogenase iron-sulphur prot...   162    5e-38 
emb|CAA53463.1|  succinate dehydrogenase subunit-B [Haemonchus...   162    5e-38 
emb|CBI60026.1|  unnamed protein product [Sordaria macrospora]      161    8e-38 
ref|ZP_05225244.1|  succinate dehydrogenase iron-sulfur subuni...   160    1e-37 
ref|ZP_04747772.1|  succinate dehydrogenase iron-sulfur subuni...   160    2e-37 
ref|YP_883438.1|  succinate dehydrogenase iron-sulfur subunit ...   159    4e-37 
ref|NP_962378.1|  succinate dehydrogenase iron-sulfur subunit ...   159    4e-37 
ref|NP_301555.1|  succinate dehydrogenase iron-sulfur subunit ...   159    4e-37 
emb|CAJ71023.1|  similar to succinate dehydrogenase/fumarate r...   157    2e-36 
ref|XP_001868013.1|  succinate dehydrogenase [Culex quinquefas...   156    3e-36 
ref|ZP_02533464.1|  succinate dehydrogenase iron-sulfur subuni...   154    1e-35 
emb|CAA53461.1|  succinate dehydrogenase subunit-B [Haemonchus...   153    3e-35 
ref|ZP_01737280.1|  succinate dehydrogenase iron-sulfur subuni...   152    4e-35 
emb|CAA53460.1|  succinate dehydrogenase subunit-B [Haemonchus...   152    4e-35 
ref|YP_003131727.1|  succinate dehydrogenase and fumarate redu...   151    1e-34 
emb|CAL57483.1|  Succinate dehydrogenase, Fe-S protein subunit...   150    2e-34 
emb|CAA53464.1|  succinate dehydrogenase subunit-B [Haemonchus...   150    2e-34 
emb|CAE51196.1|  putative succinate dehydrogenase beta subunit...   149    3e-34 
ref|YP_001737600.1|  succinate dehydrogenase and fumarate redu...   149    4e-34 
ref|YP_002566637.1|  succinate dehydrogenase and fumarate redu...   149    4e-34 
emb|CAA68981.1|  SDH subunit B-homologue; iron-sulphur protein...   149    6e-34 
dbj|BAC78391.1|  succinate dehydrogenase iron-sulfur protein s...   148    7e-34 
ref|YP_330862.1|  succinate dehydrogenase, subunit B (iron-sul...   147    1e-33 
ref|ZP_03350501.1|  succinate dehydrogenase iron-sulfur subuni...   147    2e-33 
ref|ZP_03376563.1|  succinate dehydrogenase iron-sulfur subuni...   146    3e-33 
ref|ZP_06536443.1|  succinate dehydrogenase iron-sulfur subuni...   146    4e-33 
gb|EDL13332.1|  succinate dehydrogenase complex, subunit B, ir...   145    5e-33 
ref|YP_658694.1|  succinate dehydrogenase, subunit B (iron-sul...   145    5e-33 
dbj|BAH57150.1|  AT3G27380 [Arabidopsis thaliana]                   144    1e-32 
gb|EDL80957.1|  succinate dehydrogenase complex, subunit B, ir...   144    1e-32 
ref|YP_003177898.1|  succinate dehydrogenase and fumarate redu...   144    2e-32 
ref|YP_001356160.1|  succinate dehydrogenase/fumarate reductas...   144    2e-32 
ref|YP_001546550.1|  succinate dehydrogenase and fumarate redu...   143    3e-32 
ref|YP_002730151.1|  fumarate reductase, iron-sulfur subunit [...   142    4e-32 
gb|ACE98127.1|  2Fe-2S ferredoxin [Populus tremula]                 142    5e-32 
gb|ACE98099.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   142    5e-32 
gb|ACE98095.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE980...   142    5e-32 
ref|YP_001652551.1|  fumarate reductase iron-sulfur subunit [A...   142    5e-32 
ref|YP_003435673.1|  succinate dehydrogenase and fumarate redu...   141    9e-32 
ref|YP_003402502.1|  succinate dehydrogenase and fumarate redu...   141    1e-31 
ref|YP_003481241.1|  succinate dehydrogenase and fumarate redu...   141    1e-31 
gb|ACE98101.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   141    1e-31 
gb|ACE98097.1|  2Fe-2S ferredoxin [Populus tremula] >gb|ACE981...   141    1e-31 
emb|CBI40994.1|  unnamed protein product [Vitis vinifera]           140    2e-31 
ref|ZP_03999754.1|  succinate dehydrogenase subunit B [Halogeo...   140    2e-31 
gb|EDL80951.1|  succinate dehydrogenase complex, subunit B, ir...   140    2e-31 
ref|ZP_00135022.2|  COG0479: Succinate dehydrogenase/fumarate ...   140    2e-31 
ref|YP_003536821.1|  succinate dehydrogenase subunit B (iron-s...   140    3e-31 
emb|CAA53456.1|  succinate dehydrogenase subunit b [Haemonchus...   140    3e-31 
ref|ZP_03787633.1|  succinate dehydrogenase catalytic subunit ...   139    4e-31 
ref|YP_135761.1|  succinate dehydrogenase iron-sulfur protein ...   139    4e-31 
ref|XP_001401064.1|  hypothetical protein An14g04400 [Aspergil...   139    6e-31 
ref|ZP_04752430.1|  fumarate reductase iron-sulfur subunit [Ac...   138    7e-31 
ref|ZP_05990406.1|  fumarate reductase iron-sulfur protein [Ma...   138    1e-30 
gb|ABF83897.1|  succinate dehydrogenase [Mangifera indica]          137    1e-30 
ref|NP_280172.1|  hypothetical protein VNG1308G [Halobacterium...   137    1e-30 
ref|NP_760197.1|  fumarate reductase iron-sulfur subunit [Vibr...   137    1e-30 
ref|YP_001541171.1|  succinate dehydrogenase iron-sulfur subun...   137    2e-30 
ref|YP_002728121.1|  fumarate reductase, iron-sulfur subunit [...   136    3e-30 
ref|ZP_04978698.1|  succinate dehydrogenase [Mannheimia haemol...   136    4e-30 
ref|YP_360202.1|  succinate dehydrogenase iron-sulfur subunit ...   136    4e-30 
ref|YP_002607451.1|  succinate dehydrogenase/fumarate reductas...   135    6e-30 
ref|ZP_05880966.1|  succinate dehydrogenase iron-sulfur protei...   134    1e-29 
ref|YP_001930574.1|  succinate dehydrogenase and fumarate redu...   134    1e-29 
ref|ZP_01987599.1|  fumarate reductase iron-sulfur protein [Vi...   134    1e-29 
ref|ZP_06156318.1|  succinate dehydrogenase iron-sulfur protei...   134    2e-29 
ref|ZP_01813517.1|  succinate dehydrogenase iron-sulfur subuni...   134    2e-29 
ref|YP_205718.1|  fumarate reductase iron-sulfur subunit [Vibr...   134    2e-29 
ref|NP_872658.1|  fumarate reductase iron-sulfur subunit [Haem...   134    2e-29 
ref|ZP_06176846.1|  Fumarate reductase iron-sulfur subunit [Vi...   133    2e-29 
ref|ZP_02551232.1|  succinate dehydrogenase iron-sulfur subuni...   133    2e-29 
ref|ZP_06050849.1|  succinate dehydrogenase iron-sulfur protei...   133    3e-29 
ref|YP_002264125.1|  fumarate reductase iron-sulfur subunit [A...   133    3e-29 
ref|YP_001012374.1|  succinate dehydrogenase iron-sulfur subun...   133    3e-29 
ref|ZP_06034407.1|  succinate dehydrogenase iron-sulfur protei...   132    4e-29 
ref|ZP_05888478.1|  succinate dehydrogenase iron-sulfur protei...   132    4e-29 
ref|ZP_05715509.1|  Fumarate reductase iron-sulfur subunit [Vi...   132    4e-29 
ref|ZP_04416810.1|  succinate dehydrogenase iron-sulfur protei...   132    4e-29 
ref|ZP_02196613.1|  fumarate reductase iron-sulfur subunit [Vi...   132    4e-29 
gb|ABB29717.1|  succinate dehydrogenase iron-sulfur protein [M...   132    4e-29 
ref|ZP_04584202.1|  succinate dehydrogenase [ubiquinone] iron-...   132    5e-29 
ref|ZP_05120327.1|  fumarate reductase iron-sulfur subunit [Vi...   132    5e-29 
ref|ZP_01870462.1|  fumarate reductase iron-sulfur subunit [Vi...   132    5e-29 
ref|NP_069516.1|  succinate dehydrogenase iron-sulfur subunit ...   132    5e-29 
ref|NP_799220.1|  fumarate reductase iron-sulfur subunit [Vibr...   132    5e-29 
ref|ZP_01262329.1|  succinate dehydrogenase [Vibrio alginolyti...   132    5e-29 
ref|ZP_05946709.1|  succinate dehydrogenase iron-sulfur protei...   132    7e-29 
ref|ZP_01065534.1|  succinate dehydrogenase [Vibrio sp. MED222...   132    7e-29 
ref|ZP_00989983.1|  succinate dehydrogenase [Vibrio splendidus...   132    7e-29 
ref|YP_719490.1|  fumarate reductase iron-sulfur subunit [Haem...   132    7e-29 
ref|NP_232285.1|  fumarate reductase iron-sulfur subunit [Vibr...   131    9e-29 
ref|ZP_05879789.1|  succinate dehydrogenase iron-sulfur protei...   131    1e-28 
ref|ZP_05720563.1|  Fumarate reductase iron-sulfur subunit [Vi...   130    2e-28 
ref|YP_002893671.1|  succinate dehydrogenase and fumarate redu...   130    2e-28 
ref|ZP_05068947.1|  succinate dehydrogenase, flavoprotein subu...   130    2e-28 
ref|ZP_02028480.1|  hypothetical protein BIFADO_00913 [Bifidob...   130    2e-28 

ALIGNMENTS
>ref|ZP_05068692.1| succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
sp. HTCC7211]
 gb|EDZ59691.1| succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
sp. HTCC7211]
Length=259

 Score =  478 bits (1230),  Expect = 4e-133
 Identities = 217/240 (90%), Positives = 234/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MVQINLP+NS+V KGKY++DKTGSKN++KVN+YRWDPSTEENPRIDTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVIKGKYYQDKTGSKNIRKVNVYRWDPSTEENPRIDTYEVDMDNCPSKVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D+LNKIKNEIDPT+AYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDG+IDIYPLPHLK
Sbjct  61   DILNKIKNEIDPTLAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGDIDIYPLPHLK  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            VK+DLIGDLDGLYKQYQSIEPWLK+NS  +T EI QSK+ERAKLDGAYECIMCACCSTSC
Sbjct  121  VKRDLIGDLDGLYKQYQSIEPWLKNNSTKDTTEIFQSKEERAKLDGAYECIMCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGDKYLGPAVLLQAYRWI+DSRDEE++ARLKKVADELKLYRCHTILNCTSACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIIDSRDEERKARLKKVADELKLYRCHTILNCTSACPKG  240


>ref|ZP_01264594.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
 gb|EAS85081.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
Length=257

 Score =  453 bits (1166),  Expect = 1e-125
 Identities = 202/240 (84%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MVQINLP+NS+VQKG Y++DKTGSKN++KVN+YRWDPS  ENPR+DTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDTYEVDMDNCPSKVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D+LNKIKNEIDP++AYRRSCAHGVCGSCAMNM GKNGLACT PH+EI+G+I+IYPLPHLK
Sbjct  61   DILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEIEGDINIYPLPHLK  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            VKKDLIGDL GLYKQY+SIEPWLK+N+  ET EI+Q+K++R KLDGAYECIMCACCSTSC
Sbjct  121  VKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKEDRVKLDGAYECIMCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGDKYLGPAVLLQAYRWIVDSRD+EK+ RLKKVADELKLYRCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLYRCHTIMNCTNACPKG  240


>ref|YP_265666.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Pelagibacter 
ubique HTCC1062]
 gb|AAZ21063.1| Succinate dehydrogenase iron-sulfur protein [Candidatus Pelagibacter 
ubique HTCC1062]
Length=257

 Score =  453 bits (1166),  Expect = 1e-125
 Identities = 202/240 (84%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MVQINLP+NS+VQKG Y++DKTGSKN++KVN+YRWDPS  ENPR+DTYEVDMDNC SKVL
Sbjct  1    MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDTYEVDMDNCPSKVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D+LNKIKNEIDP++AYRRSCAHGVCGSCAMNM GKNGLACT PH+EI+G+I+IYPLPHLK
Sbjct  61   DILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEIEGDINIYPLPHLK  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            VKKDLIGDL GLYKQY+SIEPWLK+N+  ET EI+Q+K++R KLDGAYECIMCACCSTSC
Sbjct  121  VKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKEDRVKLDGAYECIMCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGDKYLGPAVLLQAYRWIVDSRD+EK+ RLKKVADELKLYRCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLYRCHTIMNCTNACPKG  240


>ref|ZP_06055687.1| succinate dehydrogenase iron-sulfur subunit [alpha proteobacterium 
HIMB114]
 gb|EEY75456.1| succinate dehydrogenase iron-sulfur subunit [alpha proteobacterium 
HIMB114]
Length=260

 Score =  374 bits (959),  Expect = 1e-101
 Identities = 166/240 (69%), Positives = 201/240 (83%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MVQ NLP+NS+++KG YFK  + SKN+KKVN+YRW+P  + NPR+DTYEVDMDNC   VL
Sbjct  1    MVQFNLPKNSKIKKGNYFKSVSESKNIKKVNVYRWNPDKDANPRVDTYEVDMDNCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L KIKNEID T+ +RRSC  G+CGSCAMN+ G N LACT    EI G I+I PLPH+ 
Sbjct  61   DALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGSNTLACTKSAREIKGEININPLPHMP  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ +L  LYKQYQS+EPW++SN +S  +E +Q+ ++R+KLDG YECI+CACCSTSC
Sbjct  121  VIKDLVPNLKQLYKQYQSVEPWMQSNKSSNGSEGLQTIEDRSKLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGDKYLGPAVLLQAYRWI+DSRDEE++ RLKKVADELKL+RCHTI+NCT+ACPKG
Sbjct  181  PSYWWNGDKYLGPAVLLQAYRWIIDSRDEERQKRLKKVADELKLFRCHTIMNCTNACPKG  240


>ref|YP_538560.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
RML369-C]
 ref|YP_001496880.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
OSU 85-389]
 sp|Q1RGP3.1|DHSB_RICBR RecName: Full=Succinate dehydrogenase iron-sulfur subunit
 gb|ABE05471.1| Succinate dehydrogenase iron-sulfur protein [Rickettsia bellii 
RML369-C]
 gb|ABV79843.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia bellii 
OSU 85-389]
Length=261

 Score =  327 bits (839),  Expect = 9e-88
 Identities = 149/241 (61%), Positives = 181/241 (75%), Gaps = 1/241 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            M ++ LP NS V+KGK  K K    NL+K+ IYR+DP  +ENP ID++E+D+      VL
Sbjct  1    MAELRLPPNSVVKKGKEHKAKGDVSNLRKIKIYRYDPDLDENPTIDSFEIDLSKTGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L KIKNEID T+ +RRSC  G+CGSCAMN+ G N LAC  P  EI G+I IYPLPH+K
Sbjct  61   DALIKIKNEIDSTVTFRRSCREGICGSCAMNIDGTNTLACIKPIEEISGDIKIYPLPHMK  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETN-EIIQSKKERAKLDGAYECIMCACCSTS  184
            V KDL+ D+   Y QY+SIEPWLK++S + +N E +QS K+R KLDG YECI+CACCSTS
Sbjct  121  VVKDLVPDMSHFYAQYESIEPWLKTDSPAPSNAERLQSIKDREKLDGLYECILCACCSTS  180

Query  183  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  4
            CPSYWWNGDKYLGPA+LLQAYRWI DSRD+    RL+ + D  KLYRCHTI+NCT  CPK
Sbjct  181  CPSYWWNGDKYLGPAILLQAYRWIADSRDDHTGERLEALEDPFKLYRCHTIMNCTKTCPK  240

Query  3    G  1
            G
Sbjct  241  G  241


>ref|YP_001938646.1| succinate dehydrogenase iron-sulfur subunit [Orientia tsutsugamushi 
str. Ikeda]
 dbj|BAG41412.1| succinate dehydrogenase iron-sulfur protein [Orientia tsutsugamushi 
str. Ikeda]
Length=261

 Score =  325 bits (833),  Expect = 4e-87
 Identities = 145/241 (60%), Positives = 182/241 (75%), Gaps = 1/241 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV+  LP NS+V+ GK +  K   K +K+V++YR+ P T +NPRID +E+DM+NC   VL
Sbjct  1    MVEFRLPPNSKVKVGKRYAAKDSVKKVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L KIKNEIDPT+ +RRSC  G+CGSC+MN+ G NGLAC     +I G++ IYPLPH+ 
Sbjct  61   DALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMS  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETN-EIIQSKKERAKLDGAYECIMCACCSTS  184
            V KDL+ D+   Y QYQSIEPWLK+ +   T+ E +Q+ ++R KLDG YECI+CACCST+
Sbjct  121  VIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTA  180

Query  183  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  4
            CPSYWWN DKYLGPAVLLQAYRWI+DSRDE    RL ++ D  KLYRCHTI+NCT  CPK
Sbjct  181  CPSYWWNADKYLGPAVLLQAYRWIIDSRDEHTSERLDQLEDSFKLYRCHTIMNCTKTCPK  240

Query  3    G  1
            G
Sbjct  241  G  241


>ref|NP_105173.1| succinate dehydrogenase iron-sulfur subunit [Mesorhizobium loti 
MAFF303099]
 dbj|BAB50959.1| succinate dehydrogenase iron-sulfur protein subunit [Mesorhizobium 
loti MAFF303099]
Length=259

 Score =  325 bits (833),  Expect = 4e-87
 Identities = 144/240 (60%), Positives = 178/240 (74%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV++ LP+NS++Q+GK +    G+ NL++  IYRW P  +ENPRIDTY VDMD+C   VL
Sbjct  1    MVELTLPKNSKIQQGKTWPKPEGATNLREYRIYRWSPDDDENPRIDTYFVDMDDCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L  IKN+IDPT+  RRSC  G+CGSCAMN+ G N LACT    +I G + +YPLPH++
Sbjct  61   DALLWIKNKIDPTLTLRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKVYPLPHMQ  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ DL   Y Q+ SIEPWLK+ S     E +QS ++R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQHASIEPWLKTVSPQPAKEWLQSHEDREKLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGD+YLGPA LLQAYRW++DSRDE K  RL  + D  +LYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPATLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG  240


>ref|YP_002551002.1| succinate dehydrogenase iron-sulfur [Agrobacterium vitis S4]
 gb|ACM37990.1| succinate dehydrogenase iron-sulfur [Agrobacterium vitis S4]
Length=259

 Score =  325 bits (832),  Expect = 6e-87
 Identities = 143/240 (59%), Positives = 179/240 (74%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV++ LP+NSQ++ GK +   +G+KNL++  IYRW P  ++NP +DTY VDMD+C   VL
Sbjct  1    MVELTLPKNSQIKPGKVWPKPSGAKNLREYQIYRWSPDDDKNPSLDTYYVDMDDCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L  IKN+IDPT+ +RRSC  G+CGSCAMN+ G N LACT    E+ G + +YPLPH+ 
Sbjct  61   DGLLYIKNKIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKGTDEVKGTVKVYPLPHMP  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ DL   Y Q++SIEPWLK+ S +   E  QS  +R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQHRSIEPWLKTVSPTPVKEWKQSHDDRQKLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGD+YLGPAVLLQAYRW++DSRDE K  RL  + D  +LYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQVCPKG  240


>ref|ZP_05812399.1| succinate dehydrogenase and fumarate reductase iron-sulfur protein 
[Mesorhizobium opportunistum WSM2075]
 gb|EEW31292.1| succinate dehydrogenase and fumarate reductase iron-sulfur protein 
[Mesorhizobium opportunistum WSM2075]
Length=259

 Score =  324 bits (831),  Expect = 7e-87
 Identities = 144/240 (60%), Positives = 178/240 (74%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV++ LP+NS++Q+GK +    G+ NL++  IYRW P  +ENPRIDTY VDMD+C   VL
Sbjct  1    MVELTLPKNSKIQQGKTWPKPEGATNLREYRIYRWSPDDDENPRIDTYFVDMDDCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L  IKN+IDPT+A RRSC  G+CGSCAMN+ G N LACT    +I G + +YPLPH++
Sbjct  61   DALLWIKNKIDPTLALRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKVYPLPHMQ  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ DL   Y Q+ SIEPWLK+ S     E +QS ++R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQHASIEPWLKTVSPEPAKEWLQSHEDREKLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGD+YLGPA LLQAYRW++DSRDE    RL  + D  +LYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPATLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQTCPKG  240


>ref|YP_001249012.1| succinate dehydrogenase iron-sulfur subunit [Orientia tsutsugamushi 
str. Boryong]
 emb|CAM80794.1| Succinate dehydrogenase iron-sulfur protein [Orientia tsutsugamushi 
Boryong]
Length=263

 Score =  324 bits (830),  Expect = 1e-86
 Identities = 145/241 (60%), Positives = 182/241 (75%), Gaps = 1/241 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV+  LP NS+V+ GK +  K   K +K+V++YR+ P T +NPRID +E+DM+NC   VL
Sbjct  3    MVEFRLPPNSKVKVGKRYVAKDSVKRVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVL  62

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L KIKNEIDPT+ +RRSC  G+CGSC+MN+ G NGLAC     +I G++ IYPLPH+ 
Sbjct  63   DALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMS  122

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETN-EIIQSKKERAKLDGAYECIMCACCSTS  184
            V KDL+ D+   Y QYQSIEPWLK+ +   T+ E +Q+ ++R KLDG YECI+CACCST+
Sbjct  123  VIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTA  182

Query  183  CPSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPK  4
            CPSYWWN DKYLGPAVLLQAYRWI+DSRDE    RL ++ D  KLYRCHTI+NCT  CPK
Sbjct  183  CPSYWWNADKYLGPAVLLQAYRWIIDSRDEYASERLDQLEDSFKLYRCHTIMNCTKTCPK  242

Query  3    G  1
            G
Sbjct  243  G  243


>ref|NP_355579.1| succinate dehydrogenase iron-sulfur subunit [Agrobacterium tumefaciens 
str. C58]
 gb|AAK88364.1| succinate dehydrogenase iron-sulfur [Agrobacterium tumefaciens 
str. C58]
Length=259

 Score =  323 bits (828),  Expect = 2e-86
 Identities = 143/240 (59%), Positives = 178/240 (74%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            MV++ LP+NSQ+ +GK +    G+KN+++  IYRW+P   +NPRIDTY +D+D+C   VL
Sbjct  1    MVELALPKNSQISEGKVWPKPDGAKNVREYRIYRWNPDDGQNPRIDTYYIDVDDCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L  IKN IDPT+  RRSC  G+CGSCAMN+ G N LACT    EI G + +YPLPH+ 
Sbjct  61   DALLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMEEIKGTVKVYPLPHMP  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ DL   Y Q++SIEPWLK+ S +   E  QS ++R KLDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLSNFYAQHRSIEPWLKTVSPTPAKEWKQSHEDRLKLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGD+YLGPAVLLQAYRW++DSRDE    RL  + D  +LYRCHTI+NC  ACPKG
Sbjct  181  PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQACPKG  240


>ref|ZP_05062250.1| succinate dehydrogenase iron-sulfur protein [gamma proteobacterium 
HTCC5015]
 gb|EDY85922.1| succinate dehydrogenase iron-sulfur protein [gamma proteobacterium 
HTCC5015]
Length=259

 Score =  322 bits (826),  Expect = 3e-86
 Identities = 144/240 (60%), Positives = 177/240 (73%), Gaps = 0/240 (0%)
 Frame = -1

Query  720  MVQINLPENSQVQKGKYFKDKTGSKNLKKVNIYRWDPSTEENPRIDTYEVDMDNCSSKVL  541
            M Q  LP NS + KGK +K   G+KN KK  IYR+DP + +NPR DTYEVD+D C   VL
Sbjct  1    MAQFKLPANSIMTKGKVWKAPEGAKNTKKFEIYRFDPDSGKNPRTDTYEVDLDTCGPMVL  60

Query  540  DVLNKIKNEIDPTIAYRRSCAHGVCGSCAMNMGGKNGLACTTPHAEIDGNIDIYPLPHLK  361
            D L KIKNE+DPT+  RRSC  G+CGSCAMN+ G N LACT    ++ G + IYPLPH+ 
Sbjct  61   DALLKIKNEMDPTLTLRRSCREGICGSCAMNIDGTNTLACTKAIEDVKGTVKIYPLPHMP  120

Query  360  VKKDLIGDLDGLYKQYQSIEPWLKSNSNSETNEIIQSKKERAKLDGAYECIMCACCSTSC  181
            V KDL+ DL   Y Q +S++P+LK+ S + T E +Q++ +RA+LDG YECI+CACCSTSC
Sbjct  121  VVKDLVPDLTNFYAQLRSVDPFLKTKSQAPTRERLQTEADRAQLDGLYECILCACCSTSC  180

Query  180  PSYWWNGDKYLGPAVLLQAYRWIVDSRDEEKEARLKKVADELKLYRCHTILNCTSACPKG  1
            PSYWWNGD+YLGPAVL+QAYRWI+DSRDE    RL  + D  KLYRCHTI+NC   CPKG
Sbjct  181  PSYWWNGDRYLGPAVLMQAYRWIIDSRDEATGERLDALEDPFKLYRCHTIMNCAKTCPKG  240