GOS 1364010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025538032
Annotathon code: GOS_1364010
Sample :
  • GPS :9°01'3s; 127°46'2w
  • Tropical South Pacific: 400 miles from F. Polynesia - International
  • Open Ocean (-1.7m, 28.3°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : claucar
Annotated on : 2010-07-05 23:55:59
  • CláudiaMariaSouza a37749@ualg.pt
  • CármenCarolinaPrieto a23279@ualg.pt
  • MariaJoãoPrata a36781@ualg.pt

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_1093025538032 GOS_1364010 Genomic DNA
CAGTACCTGGATACGATGTAAAAATTATTAAATCTGATCAGTCTCTAGCTAAACCTAATGAAATGGGTGACATAGTAGTCAAGTTACCTTTGCCTCCAGG
AACTTTTCCAACTCTATGGAATGCTGATCAAAGATATAAAGAAAATTATATGAGTAACTATGAAGGTTATTATCAAACTTATGATGCAGGTCATATCGAT
GATGATGGTTATATTTGGATAATGTCAAGAACTGATGATATTATAAATGTTGCTGGTCATAGATTGTCTACTGGGGCAATTGAAGAAGTTCTGTCTGAAC
ATCAGTCTGTTGCTGAATGCGCGGTTCTTGGAATTGCAGACAAACTTAAAGGACAATTGCCGATTGGTTTAGTCGTTTTAAAAGCAGGGGTAGATAAAAG
TCACGAAGACATTTCTAAAGAATGTATTCAGATGGTAAGAGAAAAAATTGGTCCAGTTGCAGCGTTCAAAGTTGCAATAGTAATTAAAAGACTTCCAAAA
ACTAGATCAGGAAAAATTTTAAGAGGTACAATAAGGAAAATAGCAGATAATGAAGAATACAAAATGCCTCCAACCATTGATGATCCAGCAATATTGGATG
AAATAAAAACTGATCTTATTAATAACAATATTCTAAAATTGTGATTAAAACTTATCTATTTTTAATTGGTGCAATATTTTGTGAAGTTGCAGGCACAATG
TTGTTACCTGTTTCTCAGAACTTTACTAAATTTGTTCCAACATTTTCATTAGCAGTATTTTATTTAACTGCTTTTTATCTTCTTACATTTGTTGTAAATA
AATTACCAATAGCGATTGTCTATGCTACATGGAGTGGACTTGGTATATTCACTATTGCAATACTGGGCTATATTTTTTTTAAACAAACTTTATCTTGGCA

Translation

[3 - 641/900]   direct strand
>GOS_1364010 Translation [3-641   direct strand]
VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEH
QSVAECAVLGIADKLKGQLPIGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKIADNEEYKMPPTIDDPAILDE
IKTDLINNNILKL

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

After analyzing all the results, we can conclude that the protein is probably a coding protein because has a stop codon (TGA), and is constituted by 213 amino acids. We can also conclude, from the results obtained in the InterPro and the subroutine BLASTp that, probably, our protein participates in the catalytic activity. The InterPro shows that our protein have a domain, the AMP-binding whitch is a enzyme and it seems to act on ATP-dependent covalent binding of AMP to their substrate. The subroutine BLASTp shows that this protein have several homologies with a enzyme, Acetyl-coenzyme A synthetase, which has a E-value significant of 1e-57. So our protein, probably, have similar function of the Acetyl-coenzyme A synthetase, and participates in the catalytic activity.

In the program PSORT ( http://psort.nibb.ac.jp/ ) we can see that the protein probably can be found in the bacterial cytoplasmic (0,207%)

According to the results of subroutine BLASTp, InterPro and PSORT was concluded that, possibly, the molecular function of our protein is to participate in a catalytic activity (GO:0003824), in other words is involved in the metabolic process (GO:0008152).

This protein is very conserved (conclued by MSA analysis) and have several homologys with several organisms (conclued by subroutine BLASTp). The subroutine BLASTp and the taxonomy report show that probably our protein is from the phylum Proteobacteria, it has a high homology with several organisms of class gamma-proteobacteria and order enterobacteria (belonging to the phylum Proteobacteria). The trees shows that probably our protein belongs to the class gamma-proteobacteria, but we can really know so we conclues that the taxonomy is probably Bacteria kingdom and Proteobacteria phylum.






ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frame 1,2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frame 1,2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS



The chosen ORF was a foward strand (5' -> 3'), frame 3, for being the largest sequence. The frame 1 of the foward strand, and frame 1 and 2 of the reverse strand dont have ORFs.

The frame 2 in foward strand has an ORF with 91 aa. but the E value is 3e-11, it is less significant then The ORF of reading frame 3 of the same strand.

The reverse strand has an ORF with 76 aa but it has no known homology.

The choose ORF is a coding sequence, with a size of 213aa it has a stop codon which is the last nucleotides of the ORF, TGA, and has no start codon (conclude by MSA).


RAW RESULTS

a) foward strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 626 to base 898.
CAATATTCTAAAATTGTGATTAAAACTTATCTATTTTTAATTGGTGCAATATTTTGTGAA
GTTGCAGGCACAATGTTGTTACCTGTTTCTCAGAACTTTACTAAATTTGTTCCAACATTT
TCATTAGCAGTATTTTATTTAACTGCTTTTTATCTTCTTACATTTGTTGTAAATAAATTA
CCAATAGCGATTGTCTATGCTACATGGAGTGGACTTGGTATATTCACTATTGCAATACTG
GGCTATATTTTTTTTAAACAAACTTTATCTTGG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
QYSKIVIKTYLFLIGAIFCEVAGTMLLPVSQNFTKFVPTFSLAVFYLTAFYLLTFVVNKL
PIAIVYATWSGLGIFTIAILGYIFFKQTLSW

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 644.
GTACCTGGATACGATGTAAAAATTATTAAATCTGATCAGTCTCTAGCTAAACCTAATGAA
ATGGGTGACATAGTAGTCAAGTTACCTTTGCCTCCAGGAACTTTTCCAACTCTATGGAAT
GCTGATCAAAGATATAAAGAAAATTATATGAGTAACTATGAAGGTTATTATCAAACTTAT
GATGCAGGTCATATCGATGATGATGGTTATATTTGGATAATGTCAAGAACTGATGATATT
ATAAATGTTGCTGGTCATAGATTGTCTACTGGGGCAATTGAAGAAGTTCTGTCTGAACAT
CAGTCTGTTGCTGAATGCGCGGTTCTTGGAATTGCAGACAAACTTAAAGGACAATTGCCG
ATTGGTTTAGTCGTTTTAAAAGCAGGGGTAGATAAAAGTCACGAAGACATTTCTAAAGAA
TGTATTCAGATGGTAAGAGAAAAAATTGGTCCAGTTGCAGCGTTCAAAGTTGCAATAGTA
ATTAAAAGACTTCCAAAAACTAGATCAGGAAAAATTTTAAGAGGTACAATAAGGAAAATA
GCAGATAATGAAGAATACAAAATGCCTCCAACCATTGATGATCCAGCAATATTGGATGAA
ATAAAAACTGATCTTATTAATAACAATATTCTAAAATTGTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY
DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP
IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI
ADNEEYKMPPTIDDPAILDEIKTDLINNNILKL*

------------------------------------------------------------------------------

b) reverse strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 246 to base 473.
ATAAGTTTTAATCACAATTTTAGAATATTGTTATTAATAAGATCAGTTTTTATTTCATCC
AATATTGCTGGATCATCAATGGTTGGAGGCATTTTGTATTCTTCATTATCTGCTATTTTC
CTTATTGTACCTCTTAAAATTTTTCCTGATCTAGTTTTTGGAAGTCTTTTAATTACTATT
GCAACTTTGAACGCTGCAACTGGACCAATTTTTTCTCTTACCATCTGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
ISFNHNFRILLLIRSVFISSNIAGSSMVGGILYSSLSAIFLIVPLKIFPDLVFGSLLITI
ATLNAATGPIFSLTI*

Multiple Alignement

PROTOCOL


ClustalW2, default EMBL-EBI parameters + 'output order input'


RESULTS ANALYSIS


In the MSA, we can observe there is several preserved areas. This is expected bacause the AMP-binding protein is very conserved, although our sequence is smaller then the others and the alignment does not is so good as should be. The MSA also shows that all sequences have approximatly the same number of amino acids. We can also conclude that is not possible to known the start codon.




RAW RESULTS

CLUSTAL 2.0.12 multiple sequence alignment


Translation           ------------------------------------------------------------
inP.aerug             -----------------------------MTYLQQHARSIAEPAA---FWAEQA-RSLAW 27
inM.aquae             -------MTDKQVYPVSPEVAERALVNK-SQYEEMYRQSVEDPNT---FWGEHG-KRIDW 48
inA.ehrli             -------MSDTKVYPVPDYIREKAHITK-DTYEEMYRRSLDDPEG---FWGEQAEKFLDW 49
inV.vulnifi           -------MSEAHIYPVKENIKAHTHADN-DTYLAMYQQSVTDPEG---FWSEHG-KIVDW 48
inS.frigidima         -------MTPQSLYKVPSDIAENALVNN-DQYKKMYQESIINPEG---FWREHG-KRIDW 48
inX.axono             ---------MADVYPVDPAFAADARVTR-EQYAALYRESIQHPEQ---FWGKAA-QRLEW 46
inS.loihica           -------MSTQSLYKVPSEIAANAHIND-EKYKKMYQESVVNPEG---FWREHG-QRIDW 48
inA.hydro             -------MSESKVYPVKAHISNGALLDK-AGYEAMYRASVQDPDA---FWGEQG-KILDW 48
inP.ingraha           -------MSEEHIYPVTDNLAKNSLLTN-EEYLTQYQASISDPSA---FWGEKG-KILDW 48
inX.campest           ---------MADVYPVDPAFAADARITR-EQYATLYRESIEHPEQ---FWGKAA-QRLDW 46
inP.profund           -------MSEVHVYPVNQEIAATAHVND-EQYREMYQQSVINPEG---FWREHG-QIVDW 48
inM.sp.MWyl           --------MKSLYSATSNEAAKNANVSQ-AEFEKRYQESIENPDE---FWGREG-KRIDW 47
inS.degrad            -------MSTPHLYPVPEALAANAHINN-EKYHTDYARSINEPDV---FWAEKAREFLTW 49
inS.amazonen          -------MSTQSLYSVPADIAANALVNN-EQYQKMYQESVANPEG---FWGEHA-KRIDW 48
inV.choler            -------MSEAHIYPVKQNIKAHTHADN-DTYLAMYQQSIKDPEG---FWSEHG-KIVDW 48
inP.putida            -------MSAAPLYPVRPEVAATTLTDE-ATYKAMYQQSVINPDG---FWREQA-QRIDW 48
inP.articus           --------MTQKSFPITPEFLAAANVTA-EQYVEQYQQSIASPEATDAFWAKQA-ELIDW 50
inV.parahae           -------MSEAHVYPVKENIKTHTHADN-DTYLAMYQQSVTDPEG---FWNEHG-KIVDW 48
inS.oneiden           -------MSSQSLYKVSGNIAANALVNN-DQYKTMYQESIVNPEG---FWREHG-KRIDW 48
inS.baltica           -------MSSQSLYKVSGNIAANALVNN-DKYKTMYQESIVNPEG---FWREHG-KRIDW 48
outT.denitrif         MAAIESVLTETRVFPPAEAFVTQANVAGMEAYQALCRRAEADYEG---FWAELARQHIDW 57
outN.europaea         MATIESILHENRIFPPASEFVRNANLSGREAYETLRQEAEHDYTG---FWAKLAQQYIAW 57
outN.eutropha         MATIESILRENRIFPPANEFVRHANITGMKTYEALRQEAERDYAG---FWAKLAKQYITW 57
outM.flagellatus      MSSIESVLTETRVFAPHETFRQAATVSGLPGYQALCDAAEQDYTG---FWANLARQEISW 57
outL.hongkong         MSTIESVLKETRSFPPSEAFRQQATVSGMQAYNDLCEKANADYEG---FWADLARELLSW 57
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             YQAPANILES---LPDGTHRWFADGRLNSAYLALDRQIEEGRGEQTALIYDSPVTGTQDR 84
inM.aquae             IKPFTKVKNSTYDYNNLSIKWFEDGVLNASANCLDRHLEQRGDQTAIIFEGD-DPSVSRN 107
inA.ehrli             FSKWDKVYHSDLKNG--EIRFFEGGKLNVAHNCLDRHLEQRGDQTAIIWEGD-DPNNSEH 106
inV.vulnifi           IKPFTKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAERGDDVAIIWEGD-NPADDKT 107
inS.frigidima         IKPYTKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLEEHGDKLAIIWEGD-DANEQRK 107
inX.axono             FKQPTQIKDVSYALDDFHIRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDAASYP 106
inS.loihica           MKPFTKVKKTSFDDHNLSINWFYDGTLNASVNCLDRHLADNADKLAIIWEGD-DAADQRT 107
inA.hydro             MKPYTRVKNTSYDPGHVSIKWYEDGLLNVSANCLDRHLAQRGDKVAIIWEGD-NPAEDRK 107
inP.ingraha           IKPYTKVKNSSFDSGHVSIKWFEDGKLNVSANCIDRHLATKGDQVAILWEGD-TADKDEK 107
inX.campest           FKQPTQIKDVSFALDDFHVRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDSPSYP 106
inP.profund           IKPFTKVKHTSFDTGHVSVKWFEDGTLNVSANCIDRHLATRGDQPAIIWEGD-DPTDDAT 107
inM.sp.MWyl           FKPYTKVKNTSFKRGEVSIKWFEDGELNVAYNCIDRHLAKSANKVAYYCEGDKESDEKVA 107
inS.degrad            DKPWQSVRSFDFHKG--EATWFEGGKLNVTVNCIDRHLPTKANDVAIIWEGD-DPSVDAS 106
inS.amazonen          IKPFTQVKDTSYDDQNLYIKWFHDGTLNASANCLDRHLASKGDDVAIIWEGD-DASEQRK 107
inV.choler            IKPFTKVKHTSFDPGHIDIRWFEDGTLNVSANCIDRHLATRGDQVAIIWEGD-DPTQDKT 107
inP.putida            IKPFTKVKQTSFDDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGD-DPSEHRN 107
inP.articus           IKKPTKISDVSYDLEDFRIKWFEDGELNISVNCLDRHVKNNPYKPAIIWEGD-HPSLHKI 109
inV.parahae           IKPFTKVKSTSFDTGHVDIRWFEDGTLNVSANCIDRHLAEHGDDVAIIWEGD-DPADDKT 107
inS.oneiden           IKPYTKIKKTTFDDHNLSINWFYDGTLNASANCLDRHLAAHSDRVAIIWEGD-NANEQRK 107
inS.baltica           IKPYTKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGD-NASEQRK 107
outT.denitrif         KTPFTRTLD---ESDAPFYRWFDDGELNVSYNCLDRHLATRGDKTALIFEAD--DGSVRT 112
outN.europaea         HKPFTRVLN---DANPPFYKWFDDGELNISWNCLDRHLATQADKTAIIFESD--AGEVNH 112
outN.eutropha         HKPFTRILD---DTNPPFYKWFDDGELNISWNCLDRHLTTQANKTAIIFESD--EGEVIR 112
outM.flagellatus      QTPFTEVLD---ESNAPFYRWFADGKLNASYNCIDRHLEKRANKIALIFEAD--NGDVAN 112
outL.hongkong         KKPFTQVFD---GSQAPFFKWFADGQLNVSYNCLDRHLEHNANKTAIIYETD--DGQVTP 112
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             YSYLRLRDEVARLAGALRALGVGKGDRVIIYMPMVPQAAMAMLACARLGAVHSVVFGGFA 144
inM.aquae             VTYRELYEETCKFANVLKDQGVKKGDVVTIYMPMIVETAVAMLACARIGAIHSVVFGGFS 167
inA.ehrli             ITYKDLHERVCRLANAMKARGVKKGDRVCIYLPMIPEAAVAMLACARIGAIHSIVFGGFS 166
inV.vulnifi           LTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTIVFGGFS 167
inS.frigidima         LTYAELHTQVCKFANALRSQGVNKGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS 167
inX.axono             VTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFA 166
inS.loihica           LTYGELHTEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVVMLACARIGAIHSVVFGGFS 167
inA.hydro             LTYRELHTEVCKFANVLKAQGVHRGDVVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFS 167
inP.ingraha           ITYKQLHQRVCQFANVLKSQGVRKGDVVCLYMPMTPEAAVAMLACTRIGAVHSIVFGGFS 167
inX.campest           VTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFA 166
inP.profund           FTYNELHEQVCKFSNALKSQGVRKGDVVCLYMPMVAEAAIAMLACTRIGAVHTIVFGGFS 167
inM.sp.MWyl           ITYQTLHDEVGRLANLLKRQGVKKGDRVAIYMPMIPQAVYAMLACARIGAIHSVIFGGFS 167
inS.degrad            ITYQQLHDAVCKFANVLKARGVAKGDRVCIYMPMIPEAAYAMLACARIGAVHSIVFGGFS 166
inS.amazonen          VTYRELHAEVCQFANALKAEGVKRGDVVTIYMPMVVEATVAMLACARIGAVHSVVFGGFS 167
inV.choler            LTYKQLHQEVCRFANALKEQGVRKGDVVCIYMPMVPEAAVAMLACTRIGAVHTIVFGGFS 167
inP.putida            ITYRELHEQVCKFANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFS 167
inP.articus           ISFKELHEAVCRLGNAMRKLGVKKGDRVTLYMPMIPEAVVAMLACTRIGAVHSVVFGGFS 169
inV.parahae           LTFNELHKEVCKFSNALKDQGVRKGDVVCLYMPMVPEAAIAMLACTRIGAVHTVVFGGFS 167
inS.oneiden           ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS 167
inS.baltica           ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS 167
outT.denitrif         VTYKELHARVCQFANGLKSLGVGKGDRVIVYMPMSIEAVVAMQACARIGAIHSVVFGGFS 172
outN.europaea         CSYRELHRQVCHFANGLKSLGIRQGDRVVIYMPMRIEAVVAMQACARIGAIHSVVFGGFS 172
outN.eutropha         CSYRELHQRVCRFANGLKALGIRQGDRIVIYMPMRIEAVVAMQACARIGVIHSVVFGGFS 172
outM.flagellatus      ITYRELHQRVCRFANALKKQGVGLGDRVIIYLPMSIEAIVAMQACARIGAIHSVVFGGFS 172
outL.hongkong         ISYRSLYEQVCQFANGLKSLGVGKGDRVVIYMPMVPQAIVAMQACARIGAIHSVVFGGFS 172
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             PYELALRIDDATPKLVLTASCGLEFDRVIEYKPLVDKALELAIHQPAHVMVWQRPQAP-- 202
inM.aquae             PEALAARIVNGKSRFVITADEGLRGGRAIPLKKNVDSALKHEDDAKVDKVIVVSRTGNDQ 227
inA.ehrli             PDALKDRIQNADCETVITADEGVRGGRNVALKSNADKALES--CPDVKNVFVVKRTGG-D 223
inV.vulnifi           PEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVFKRTGG-N 226
inS.frigidima         PDSIAARVIDGKSKVLITADEGIRGGRKIPLKRSIDEAISNPDVTCVEKVIVFKRTGG-D 226
inX.axono             ANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGG-A 225
inS.loihica           PDSIASRVIDGKSKVVITADEGVRGGRTIPLKANIDEALSHPDVTCVEKVIVLERTGN-P 226
inA.hydro             PEALAGRIIDSGSSIVITADEGLRGGRPVPLKKNVDEALTNPETK-VNNVIVLKRTGG-N 225
inP.ingraha           PDAIAGRIVDSSAKIVITADEGRRGGRVVPLKANVDEALTKDGTDCVKSVIVFKNTGG-E 226
inX.campest           ANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGG-A 225
inP.profund           PEALAGRIVDSNAKLVITADEGVRAGRAVPLKKNVDDALANKNVTSIEKVIVLKRTGG-N 226
inM.sp.MWyl           AHAIADRLNDCEVKLVITADEGRRAGNTIPLKHNVDMALDNNACPTVENVIVYRYTEK-D 226
inS.degrad            PEALKDRIVDSDCKVLITADEGLRGGRAVALKANADKAVAH--CPQVHSVIVVKRTGA-D 223
inS.amazonen          PDSIASRVIDGKSKLLITADEGVRGGRKIPLKGNIDEALNRPDVTTVETVIVLKRTGG-A 226
inV.choler            PEALAGRIIDSNAKLVITADEGVRGGRAVPLKKNVDEALCNPEVKNISKVMVLKRTGG-N 226
inP.putida            PEALAGRIIDCKSKVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGG-D 226
inP.articus           TQSLGNRIIDSQSKLVITADEGIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTGN-S 228
inV.parahae           PEALSGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVLKRTGG-N 226
inS.oneiden           PDSIASRVIDGKSKIVITSDEGMRGGRAIPLKRNIDDALKHPDVTSVEKVIVLKRTGG-K 226
inS.baltica           PDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNIDDALKNPDVTTVEKVIVLKRTGG-K 226
outT.denitrif         AKSLFERIEDAQAKLIVTADESLRGGKAVPLKRAADEALAMGDTSCVERVVVYRRSGG-E 231
outN.europaea         AKSVYERIIDAGASAVITADEQIRGGRYHPLKATVDEALAMGDTATVHSVIVFRHTGT-G 231
outN.eutropha         AKSVYERIIDAGASAVITADEQTRGGKRHALKATVDEALAMGDTTSVHSVIVFRHTGT-D 231
outM.flagellatus      AKSLHERIVDVGAKLVITADAGIRGGKQVALKASVDEALELGGCESVEKVIVYQRTGV-D 231
outL.hongkong         AGALRDRIQDAAAKVVITANESVRGGKLVPLKATVDEALAMDGCDSIEKVVVLQRTYT-P 231
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             ARLHPGRDLDWQDCLAAAEP-ADPLPVASGDPLYIMYTSGTTGKPKGIVRDNGGHAVAVR 261
inM.aquae             VPWTEGRDLRYEDLMKNASAECQPEPMNAEDPLFMLYTSGSTGAPKGVLHTTGGYMVYAS 287
inA.ehrli             IDWKEGRDIWYHEAVADVSADCPAEELDAEDPLFILYTSGSTGKPKGVQHCSAGYLLGAA 283
inV.vulnifi           IDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT 286
inS.frigidima         IDWVEGRDVWWHSLMEVASEFCQPAEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAS 286
inX.axono             VEMQAPRDRWFHDVVDGQPAACEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFAS 285
inS.loihica           VNWVEGRDIKWASLMETASEHCVAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAS 286
inA.hydro             IAWHNHRDIWWHDAVATVSADCPPEAMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT 285
inP.ingraha           VNWVVGRDLDWESVCADESSECEPEAMNAEDPLFILYTSGSTGTPKGVLHTTGGYLVYAA 286
inX.campest           VDMQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFAS 285
inP.profund           VEWHSERDVWWHEATAVASSHCEPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT 286
inM.sp.MWyl           VPWFEGRDLDWAVEVENESTECPAERMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAS 286
inS.degrad            VAWNTERDIWLHEAQQSVDTVCEPESMDSEDPLFILYTSGSTGKPKGVLHTTGGYLLQAA 283
inS.amazonen          VNWVEGRDKWWHQVTDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAS 286
inV.choler            VAWHEHRDIWWHEATAKASDNCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT 286
inP.putida            IAWHQHRDIWYEDLMKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAA 286
inP.articus           VPMSGRRDIWYHSLVDGESQYCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYAL 288
inV.parahae           VDWHGHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAA 286
inS.oneiden           IDWVEGRDVWWHSLVETASEHCAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAS 286
inS.baltica           VDWVEGRDVWWHSLMETASEYCQPEEMDAEAPLFLLYTSGSTGNPKGVLHTTGGYMVYAS 286
outT.denitrif         VNWS-ARDLWWHELTQTQAETCEPVWVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLGAL 290
outN.europaea         ITWQPERDHWWHDLIAGQPDECEPAWINAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAV 291
outN.eutropha         IPWQPERDRWWHNLTASQSDECEPIWVNAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAI 291
outM.flagellatus      IAWNPHRDAWWHEVEAAENDNCEPVWVDAEHPLFILYTSGSTGTPKGVQHSTGGYLLGAI 291
outL.hongkong         CSMG-ARDITWDALTAGQPLECEPEWMSAEDPLFILYTSGSTGKPKGIQHSSAGYLLGAA 290
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             YAVRTIYGMQA-GDVWWGISDVGWVVGHSLIVYGPLMCGCTTVFYEGKPVRTPDAGAYWR 320
inM.aquae             MTHQYVFDYHD-GDVYWCTADFGWVTGHSYILYGPLANGAITLLFEGVPN-YPDSSRMGQ 345
inA.ehrli             MTHKYVFDYQE-GEVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPT-YPSAARCWE 341
inV.vulnifi           MTFKYVFDYQP-GETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPN-YPNTSRMSE 344
inS.frigidima         MTHEYVFDYKA-DEVYWCTADVGWITGHSYMVYGPFANAATVLIHEGVPN-HPTPARLGE 344
inX.axono             YTHEVVFDLRE-DDIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPN-YPNVSRFWE 343
inS.loihica           MTHEYVFDYKE-GEIYWCTADVGWITGHSYMVYGPLANGATILIHEGIPN-YPTPARLGE 344
inA.hydro             LTFKYIFDYHE-EDIYWCTADVGWVTGHSYLVYGPLANGATTIMFEGVPN-YPATNRMSQ 343
inP.ingraha           MTFKYVFDYQE-GDIYWCTADVGWITGHTYSVYGPLANGATSLIFEGVPN-YPTPARMSE 344
inX.campest           YTHEVVFDLRE-DDIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPN-YPNVSRFWE 343
inP.profund           MTFKYVFDYQE-GDVYWCTADVGWITGHSYLVYGPLANGATTVLFEGVPN-YPSTSRMSE 344
inM.sp.MWyl           LTHELVFDLKP-DDVYWCAADVGWITGHSYMVYGPLANGTTSILFEGVPT-YPDSGRIGR 344
inS.degrad            MTHKYVFDYQP-GEVYWCTADVGWVTGHTYIVYGPLTNGATTLMFEGVPT-YPTAARCWE 341
inS.amazonen          MTHEYVFDYKP-GEVYWCTADVGWITGHSYMVYGPLANGATILIHEGIPN-FPSPARLGE 344
inV.choler            MTFKYVFDYQP-NEVFWCTADVGWITGHSYLVYGPLANGAKTILFEGVPN-YPTTARMSE 344
inP.putida            LTHERVFDYRP-GEVYWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPN-YPDITRVSK 344
inP.articus           STFRDVFDVKD-DDVYWCTADVGWVTGHTYATYAPLANGTTTVMFEGVPE-YPTWARIGH 346
inV.parahae           MTFKYVFDYQP-GETFWCTADVGWITGHTYLIYGPLANGAKTILFEGVPN-YPNTSRMSE 344
inS.oneiden           MTHEYVFDYKP-GEIYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPN-HPSPARLGE 344
inS.baltica           MTHEYVFDYKA-GEVYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPN-HPSPARLGE 344
outT.denitrif         LSMLWVFDAKADNDVYWCTADVGWITGHTYVAYGPLALGMTEVIFEGIPT-YPHAGRFWE 349
outN.europaea         TSMQWVFDYHA-DDVFWCTADVGWVTGHSYVAYGPLAIGATQVIFEGTPT-HPHAGRFWE 349
outN.eutropha         VSMQWVFDYHS-EDIFWCTADVGWVTGHSYVTYGPLAIGATQVIFEGTPT-YPHAGRFWE 349
outM.flagellatus      MSMKWVFDHKA-TDIFWCTADVGWITGHSYVAYGPLALGSTQVVFEGVPT-YPDAGRFWQ 349
outL.hongkong         NSFRWAFDYKP-NDIYWCTADVGWITGHSYICYGPLAMGATQVVFEGIPT-YPDAGRFWR 348
                                                                                  

Translation           ------------------------------------------------------------
inP.aerug             VIEEHRVNSLFCAPTAIRAIRKEDPHGERVKRYDLGSLRHLFLAGEKLDSSTQHWLEEHT 380
inM.aquae             VVDKHKVNILYTAPTAIRALMAQGES--CMDGTTRGSLKLLGSVGEPINPEAWEWYHRVI 403
inA.ehrli             VVDKHNVSIFYTAPTAIRALMGQGNE--HVTKTSRKSLRILGTVGEPINPEAWEWYYNVV 399
inV.vulnifi           VVDKHQVNILYTAPTAIRALMAKGNE--AIEGTDRSSLRIMGSVGEPINPEAWEWYYKTI 402
inS.frigidima         MIDRHKVNILYTAPTLIRALMAEGKE--QFSSYKGDSLRIMGSVGEPINPEAWRWYHEVI 402
inX.axono             VIDKHQVTIFYTAPTAIRALMRDGAD--PVKKTSRKSLRLLGSVGEPINPEAWRWYYEVV 401
inS.loihica           MIDRHKVNILYTAPTLIRALMAEGKE--QFDGFDGSSLRIMGSVGEPINPEAWRWYHEVI 402
inA.hydro             VVDKHQVSILYTAPTAIRALMAKGNE--AVADTSRSSLRIMGSVGEPINPEAWEWYYRTI 401
inP.ingraha           VVDKHKVSILYTAPTAIRALMAKGDQ--AIEGTHRSSLRILGSVGEPINPEAWEWYYNKI 402
inX.campest           VIDKHQVTIFYTAPTAIRALMREGEA--PVKKTSRSSLRLLGSVGEPINPEAWRWYYEVV 401
inP.profund           VVDKHNVSILYTAPTAIRALMAKGTE--AIKGTSRSSLRIMGSVGEPINPEAWEWYHHTI 402
inM.sp.MWyl           VVDKFDVTILYTAPTAIRALMAKGDE--ATRSSKRDSLRVLGSVGEPINPEAWSWYYSEI 402
inS.degrad            VCDKHNVNIFYTAPTAIRALMGQGDE--FVASTQRKSLRILGTVGEPINPEAWEWYYNVV 399
inS.amazonen          IVDRHQVNILYTAPTLIRALMAEGKQ--HFDNFDGKSLRIMGSVGEPINPEAWRWYHEVI 402
inV.choler            VVDKHKVNILYTAPTAIRALMAKGDE--AIKGTSRDSLRIMGSVGEPINPEAWEWYYRTI 402
inP.putida            IVDKHKVNILYTAPTAIRAMMAEGQA--AVEGADGSSLRLLGSVGEPINPEAWNWYYKTV 402
inP.articus           IIDKHQITVLYTAPTAIRAMMKEGDT--FVRESDRSSLRLLGTVGEPINPEAWDWYYHIV 404
inV.parahae           VVDKHQVNILYTAPTAIRALMAKGNE--AVAGTSRSSLRIMGSVGEPINPEAWEWYYKTI 402
inS.oneiden           MIDRHKVNILYTAPTLIRALMAEGKQ--HFDKYNGSSLRIMGSVGEPINPEAWRWYHEVI 402
inS.baltica           MIDRHKVSILYTAPTLIRALMAEGKQ--HFDKFDGSSLRIMGSVGEPINPEAWRWYHEVI 402
outT.denitrif         TIAKHKVTTFYTAPTAIRSLIKLGSE--LPAQYDLSSLRLLGTVGEPINPEAWMWYHEVI 407
outN.europaea         IIQKHRITTFYTAPTAIRSLIKLGSD--LPAKYDLSSLRLLGSVGEPINPEAWMWYYTVV 407
outN.eutropha         IIQKHRVTTFYTAPTAIRSLIKLGPD--LPEKYDLSSLRLLGSVGEPINPEAWMWYYTVI 407
outM.flagellatus      MIERHKVSIFYTAPTAIRSLIKLGGD--LPHKYDLSSLRLLGTVGEPINPEAWMWYYKVV 407
outL.hongkong         MIEQHKVNIFYTAPTAIRSLIKLGAD--LPKQFDLSSLRVLGTVGEPINPEAWMWYYEVV 406
                                                                                  

Translation           ----------------------------------------VPGYDVKIIKSDQSLAKP-- 18
inP.aerug             GR---PVHDHWWQTETGWPVTAPCIGIAGHDLRAGSTNRAVPGYHVQVLDDEGRPLGA-- 435
inM.aquae             GNSKCPIVDTWWQTETGGILISPLPG--AVDLKPGSATLPFFGVQPALVDNEGNILEG-- 459
inA.ehrli             GDGRCPIVDTWWQTETGSILIAPLPG--ATDLKPGSATLPFFGVEPALVDPEGKELEG-- 455
inV.vulnifi           GNEKSPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPALVDNMGNVIEDQ- 459
inS.frigidima         GHENCPIVDTWWQTETGGILISPLPG--ATDTKPGSATRPFFGVQPALVDNMGDIVEG-- 458
inX.axono             GDSRCPIVDTWWQTETGGILISPLAG--AVDLKPGSATLPFFGVQPALVDAEGKILEG-- 457
inS.loihica           GHENCPIVDTWWQTETGGILISPLPG--ATDTKPGSATRPFFGVQPALVDNMGNIIDG-- 458
inA.hydro             GEERCPIVDTWWQTETGGILISPLPG--VTDLKPGSATRPFFGVQPALVDNMGEPLEG-- 457
inP.ingraha           GDERCPIVDTWWQTETGGILISPLPG--ATDLKPGSATRPFFGVQPAIVDSEGVVLEG-- 458
inX.campest           GDSRCPIVDTWWQTETGGILISPLAG--AVDLKPGSATLPFFGVQPALVDAEGKILEG-- 457
inP.profund           GDSRCPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPAIVDNMGNILEG-- 458
inM.sp.MWyl           GNSSCPIVDTWWQTETGGMMMTPRIV--QGDVKPGSCTGPLYGVQPALVDAQGVLQEEQG 460
inS.degrad            GDRRCPIMDTWWQTETGGHMLTPLPG--AIDLKPGSATLPFFGVEPVLLDGEGNIIEG-- 455
inS.amazonen          GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNEGNILEG-- 458
inV.choler            GNEKSPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPALVDNMGEIVEG-- 458
inP.putida            GKERCPIVDTWWQTETGGILISPLPG--ATGLKPGSATRPFFGVVPALVDNLGNLIDG-- 458
inP.articus           GGGKCPVVDTWWQTETGGIMLAPIPG--TVAMKPGAVMNPLYGIIPEVIDTDGVALEG-- 460
inV.parahae           GNENSPIVDTWWQTETGGILIAPLPG--ATDLKPGSATRPFFGVQPALVDNMGNILEDT- 459
inS.oneiden           GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNMGNILEG-- 458
inS.baltica           GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNMGNILEG-- 458
outT.denitrif         GGGRCPIVDTWWQTETGAHMIAPLPG--AVPTKPGSCTLPLPGIMAAVTDEHGGPVAK-- 463
outN.europaea         GQSRCPVVDTWWQTETGCHMIAPAPG--AISTKPGSCTLPLPGIDAAVVDETGHPVEQ-- 463
outN.eutropha         GQSRCPVVDTWWQTETGSHMIAPIPG--AIPAKPGSCTLPLPGIDAAVVDETGLPAEQ-- 463
outM.flagellatus      GKERCPIADTWWQTETGAHMIAPLPG--AIDLKPGSCTRPLPGIIMDIVEEDGTHIEG-- 463
outL.hongkong         GGGRCPIVDTWWQTETGSAMIAPMPG--AVATKPGSCTLPLPGIMADIVDESGAQVEP-- 462
                                                              . *    : .          

Translation           -NEMGDIVVKLPLPPGTFPTLWNADQRYKENYM-SNYEG--YYQTYDAGHIDDDGYIWIM 74
inP.aerug             -NRQGAIVIALPLPPGCAQTLWGDHPRYLQAYL-GNYPG--YYHTGDGGYLDEDGFVYIM 491
inM.aquae             -KTEGNLVILDSWP-GQMRTIYGDHERFVQTYF-STYKG--MYFTGDGARRDEDGYYWIT 514
inA.ehrli             -AASGNLVIKRAWP-SMMRTVYGDHKRFMETYL-AAYPG--MYFTGDGARRDEDGYYWIT 510
inV.vulnifi           -AAEGNLVILDSWP-GQMRTVYGDHERFEQTYF-STFKG--MYFTGDGARRDEDGYYWIT 514
inS.frigidima         -TGEGNLVILDSWP-GQMRTVYGDHDRFALTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
inX.axono             -ATEGNLVLLDSWP-GQMRSVYGDHQRFIDTYF-RTYPG--SYFTGDGCRRDADGYYWIT 512
inS.loihica           -AAEGNLVILDSWP-GQMRTVYGDHDRFALTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
inA.hydro             -ATEGNLVITDSWP-GQMRTVFGDHERFEQTYF-STFPG--RYFTGDGARRDEDGYYWIT 512
inP.ingraha           -EAAGNLVMLDSWP-GQMRTLYNNHDRFEQTYF-STFKG--MYFTGDGARRDSDGYYWIT 513
inX.campest           -ATEGNLVLLDSWP-GQMRTVYGDHQRFIDTYF-RTYPG--SYFTGDGCRRDADGYYWIT 512
inP.profund           -VAEGNLVMVDSWP-GQMRTLWGDHERFEQTYF-STFQG--MYFTGDGARRDEDGYYWIT 513
inM.sp.MWyl           VLVEGGLVITDSWP-GQARTVYGDHERFEQTYF-STFDG--MYFTGDGASRDADGHYWIT 516
inS.degrad            -EGEGSLAIKSSWP-GQIRTVYGDHDRLIQTYF-STYPG--YYFTGDGARRDADGYYWIT 510
inS.amazonen          -ATEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
inV.choler            -ATEGNLVLLDSWP-GQMRTVYGDHDRFEQTYF-STFKG--MYFTGDGARRDEDGYYWIT 513
inP.putida            -AAEGNLVILDSWP-GQSRSLYGDHDRFVDTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
inP.articus           -AAEGNLVINGSWP-GQMRTIYKDHARFLETYF-TEYPG--YYFTGDGVQRDEDGHYWIT 515
inV.parahae           -VAEGNLVILDSWP-GQMRTVYGDHERFEQTYF-STFKG--MYFTSDGARRDEDGYYWIT 514
inS.oneiden           -ATEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
inS.baltica           -ENEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT 513
outT.denitrif         -GQGGYLVIKRPFP-SQLRTLWGDPERFKKTYFPEEMGGK-TYLAGDSAHRDDDGYFWIM 520
outN.europaea         -GKGGFLVIKRPFP-SMLRTLWNDPERFRKTYFPTDIAGGRYYLAGDSAHRDQDGYFWIM 521
outN.eutropha         -GKGGFLVIKRPFP-SMLRTLWNDPERFRNTYFPADIAGGHYYLAGDSAHRDQDGYFWIM 521
outM.flagellatus      -TGGGLLVVKKPWP-SMIRNIWGNPERFRKAYFPEELNG--LYLAGDSAHRDEDGYFWIM 519
outL.hongkong         -GRGGFLVIKKPFP-SLVRTIWNDPDRFKKTYFPEEFNGQ-YYLAGDSANRDESGYFWIM 519
                          * :.:  . * .   .::    *    *:     *   * : *.   * .*. :* 

Translation           SRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGVD--K 132
inP.aerug             GRTDDVINVSGHRLSTGEMEERVAQHQAVAECAVIGVRDELKGHVPLGLVVLKDDAG--I 549
inM.aquae             GRVDDVLNVSGHRLGTAEVESALVAHDKVAEAAVVGYPHDIKGQGIYVYVTLVQGE---E 571
inA.ehrli             GRVDDVINVSGHRMGTAEVESALVLHDAVAEAAVVGYPHDIKGQGIYAYVTLMAGV---E 567
inV.vulnifi           GRVDDVLNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGE---Y 571
inS.frigidima         GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGI---E 570
inX.axono             GRVDDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGQ---T 569
inS.loihica           GRVDDVINVSGHRLGTAEVESALVAHEHVAEAAVVGYPHDIKGQGIYAYVTLTKGT---Q 570
inA.hydro             GRVDDVLNVSGHRMGTAEIESALVSHPKIAEAAVVGVPHEIKGQGIYAYVTLIAGE---E 569
inP.ingraha           GRVDDVLNVSGHRMGTAEIESALVSHPKIAEAAVVGVPHEIKGQGIYAYVTLNEGE---Y 570
inX.campest           GRVDDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGE---T 569
inP.profund           GRVDDVLNISGHRMGTAEIESALVAFDKIAEAAIVGVPHDIKGQAIYAYITLNDGE---I 570
inM.sp.MWyl           GRMDDVLNVSGHRLGTAEIESALVAHPSVAEAAIVGFPHDIKGQGIYVYVSAIAGV---I 573
inS.degrad            GRVDDVLNVSGHRMGTAEVESALVLHPKVAEAAVVGYPHDVKGQGIYAYVTLMTGV---E 567
inS.amazonen          GRVDDVINVSGHRLGTAEVESALVAHDLVAEAAVVGYPHDIKGQGIYAYVTLTKGT---E 570
inV.choler            GRVDDVLNVSGHRMGTAEIESALVAFNKIAEAAVVGVPHDIKGQAIYAYITLNDGV---Y 570
inP.putida            GRVDDVLNVSGHRMGTAEIESAMVAHSKVAEAAVVGVPHDIKGQGIYVYVTLNAGI---E 570
inP.articus           GRVDDVLNVSGHRLGTAEIESAIVAHPATAEAAVVGMPHDIRGIGICAFVILKSSE---T 572
inV.parahae           GRVDDVLNVSGHRMGTAEIESALVAHHKIAEAAIVGIPHDIKGQAIYAYITLNDGE---F 571
inS.oneiden           GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGT---E 570
inS.baltica           GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGT---E 570
outT.denitrif         GRIDDVLNVSGHRLGTMEIESALVSNPRVAEAAVVGRPHEVKGEAVVAYVVLKGARAVGD 580
outN.europaea         GRVDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEIKGEVVVAFVTLREKLPDDQ 581
outN.eutropha         GRIDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEIRGEVIVAFVVLRGKLPDDQ 581
outM.flagellatus      GRIDDVLNVSGHRLGTMEIESALVANPLVAEAAIVGKPHDIKGESIVAYVVLKGERPEGE 579
outL.hongkong         GRIDDVLNVSGHRLGTMEIESALVANPLVAEAAVVGKPHDVKGEAVVAFVVLKGIRPEGD 579
                      .* **::*::***:.*  :*. :      **.*::*  ..::*      :          

Translation           SHEDISKECIQMVREKIGPVAAFKVAIVIK-RLPKTRSGKILRGTIRKIADNEEYKMP-- 189
inP.aerug             AAEQLQRELVALVREQIGALACFQRVVVVK-RLPKTRSGKILRAVLRKIADGEDYAAP-- 606
inM.aquae             PSDELKKELVQWVRKEIGPIASPDVIQWAP-GLPKTRSGKIMRRILRKIAANEHDQLGDT 630
inA.ehrli             PSDELKKELVKLVSNEIGPIAKPDVIQWAP-GLPKTRSGKIMRRILRKVAANELDSLGDT 626
inV.vulnifi           PTAELHKEVKDWVRKEIGPIATPDVLHWTD-ALPKTRSGKIMRRILRKIATGDTSNLGDT 630
inS.frigidima         PTEELRQELRQWVRKEIGALATPDLIQWAS-GLPKTRSGKIMRRFLRKIAANEVTNLGDS 629
inX.axono             PSEDLHKELVSWVRKEIGPIASPDHLQWAP-GLPKTRSGKIMRRILRKIAENAPDQLGDT 628
inS.loihica           ESEELRQELRQWVRKEIGALATPDLIQWAG-GLPKTRSGKIMRRFLRKIAANEVTNLGDA 629
inA.hydro             PSRELHKEVKEWVRKEIGAIATPDVIHWAE-GLPKTRSGKIMRRILRKIATGETDSLGDI 628
inP.ingraha           PSPELYAEVKQWVRKEIGAIATPDILHWAE-GLPKTRSGKIMRRILRKIATGESDSLGDI 629
inX.campest           PSEELHKELVSWVRKEIGPIASPDHLQWAP-GLPKTRSGKIMRRILRKIAENAPDQLGDT 628
inP.profund           PSAELHKEVKDWVRKEIGPIATPDFLHWTD-ALPKTRSGKIMRRILRKIATGDTGSLGDT 629
inM.sp.MWyl           PDEELTKSLKLFVRQEIGPIATPDLIQWTSKGLPKTRSGKIMRRILRKIAANEHDQLGDT 633
inS.degrad            PDDGLRKELVAMCTQEIGPIAKPDLIQWAP-GLPKTRSGKIMRRILRKVAANELDTLGDT 626
inS.amazonen          ATEELRQELRQWVRKEIGALATPDLIQWAS-GLPKTRSGKIMRRFLRKIAANEITNLGDA 629
inV.choler            PSAELHKEVKDWVRKEIGAIATPDVLHWTD-ALPKTRSGKIMRRILRKIATGDTSNLGDT 629
inP.putida            ASEQLRLELKNWVRKEIGPIASPDVIQWAP-GLPKTRSGKIMRRILRKIATGEYDALGDI 629
inP.articus           ATESLKAELNRHVRTEIGPIANLDAIYMVN-VLPKTRSGKIMRRILRSLAAGQYVGLGDL 631
inV.parahae           PSAELHKEVKDWVRKEIGPIATPDVLHWTD-SLPKTRSGKIMRRILRKIATGDTSNLGDT 630
inS.oneiden           ESEELRQELRQWVRKEIGALATPDLIQWAT-GLPKTRSGKIMRRFLRKIAANEVTNLGDA 629
inS.baltica           ETEELRQELRQWVRKEIGALATPDLIQWAT-GLPKTRSGKIMRRFLRKIAANEVTNLGDA 629
outT.denitrif         EAKDIARELRDWVGKEIGPIAKPDEIRFGE-NLPKTRSGKIMRRLLRAIAKGE-EITQDV 638
outN.europaea         RAAEIAATLREWVASEIGAIARPEEIRFGE-NLPKTRSGKIMRRLLRALARGE-TITQDV 639
outN.eutropha         QAAEIAETLREWVSSEIGAIARPEEIRFGE-NLPKTRSGKLMRRLLRSLARGE-TITQDI 639
outM.flagellatus      AAKTIAGQLREWVGKEIGPIAKPDEIRFGE-NLPKTRSGKIMRRLLRSLAKGE-EITSDI 637
outL.hongkong         EAKKVAAELKSWVAHEIGKIAQPDDIRFGE-NLPKTRSGKIMRRLLRSIAKGE-EITQDT 637
                          :          :** :*  .        ********::*  :* :* .        

Translation           PTIDDPAILDEIKTDLINNNILKL 213
inP.aerug             STIDDPTILGEIEAALRVRKAG-- 628
inM.aquae             STLADPGVVDELISSR--AFK--- 649
inA.ehrli             STLADPTVVDNLIEDR--PNK--- 645
inV.vulnifi           STLADPSVVDKLIAEKAELV---- 650
inS.frigidima         STLADPAVIDTLIESR--LNKTE- 650
inX.axono             STLADPSVVDSLVNER--LAR--- 647
inS.loihica           STLADPAVIDTLIETR--LNRSE- 650
inA.hydro             STLADPGVVDKLIREKSEAA---- 648
inP.ingraha           STLADPSVVEQLIKENRETS---- 649
inX.campest           STLADPSVVDSLVNER--LTR--- 647
inP.profund           STLADPSVVDKLIAEKQTIL---- 649
inM.sp.MWyl           STLADPSVVDDLIENR--LNV--- 652
inS.degrad            STLADPSVVDDLIENR--MNR--- 645
inS.amazonen          STLADPSVIDTLIESR--LNRAD- 650
inV.choler            STLADPSVVDRLIAEKAQLK---- 649
inP.putida            STLADPGVVQHLIDTHKAMNLASA 653
inP.articus           STLADSSVINELVEVVKTERAK-- 653
inV.parahae           STLADPSVVDKLIAEKAELV---- 650
inS.oneiden           STLADPAVIETLIETR--LNRNE- 650
inS.baltica           STLADPAVIETLIESR--LNRTE- 650
outT.denitrif         STLENPAILDQLKEAVK------- 655
outN.europaea         STLENPVILEQLSQTV-------- 655
outN.eutropha         STLENPVILEQFSQTI-------- 655
outM.flagellatus      STLDNPAILDQLRQSAG------- 654
outL.hongkong         STLENPQILDQLQEIA-------- 653
                      .*: :. ::  :            

-------------------------------------------------------------------------------------------------------

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 26
Alignment assumed to be: Protein
New number of positions: 178 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        -----------------------------MTYLQQHARSIAEPAA---FWAEQA-RSLAW
inM.aquae        -------MTDKQVYPVSPEVAERALVNK-SQYEEMYRQSVEDPNT---FWGEHG-KRIDW
inA.ehrli        -------MSDTKVYPVPDYIREKAHITK-DTYEEMYRRSLDDPEG---FWGEQAEKFLDW
inV.vulnifi      -------MSEAHIYPVKENIKAHTHADN-DTYLAMYQQSVTDPEG---FWSEHG-KIVDW
inS.frigidima    -------MTPQSLYKVPSDIAENALVNN-DQYKKMYQESIINPEG---FWREHG-KRIDW
inX.axono        ---------MADVYPVDPAFAADARVTR-EQYAALYRESIQHPEQ---FWGKAA-QRLEW
inS.loihica      -------MSTQSLYKVPSEIAANAHIND-EKYKKMYQESVVNPEG---FWREHG-QRIDW
inA.hydro        -------MSESKVYPVKAHISNGALLDK-AGYEAMYRASVQDPDA---FWGEQG-KILDW
inP.ingraha      -------MSEEHIYPVTDNLAKNSLLTN-EEYLTQYQASISDPSA---FWGEKG-KILDW
inX.campest      ---------MADVYPVDPAFAADARITR-EQYATLYRESIEHPEQ---FWGKAA-QRLDW
inP.profund      -------MSEVHVYPVNQEIAATAHVND-EQYREMYQQSVINPEG---FWREHG-QIVDW
inM.sp.MWyl      --------MKSLYSATSNEAAKNANVSQ-AEFEKRYQESIENPDE---FWGREG-KRIDW
inS.degrad       -------MSTPHLYPVPEALAANAHINN-EKYHTDYARSINEPDV---FWAEKAREFLTW
inS.amazonen     -------MSTQSLYSVPADIAANALVNN-EQYQKMYQESVANPEG---FWGEHA-KRIDW
inV.choler       -------MSEAHIYPVKQNIKAHTHADN-DTYLAMYQQSIKDPEG---FWSEHG-KIVDW
inP.putida       -------MSAAPLYPVRPEVAATTLTDE-ATYKAMYQQSVINPDG---FWREQA-QRIDW
inP.articus      --------MTQKSFPITPEFLAAANVTA-EQYVEQYQQSIASPEATDAFWAKQA-ELIDW
inV.parahae      -------MSEAHVYPVKENIKTHTHADN-DTYLAMYQQSVTDPEG---FWNEHG-KIVDW
inS.oneiden      -------MSSQSLYKVSGNIAANALVNN-DQYKTMYQESIVNPEG---FWREHG-KRIDW
inS.baltica      -------MSSQSLYKVSGNIAANALVNN-DKYKTMYQESIVNPEG---FWREHG-KRIDW
outT.denitrif    MAAIESVLTETRVFPPAEAFVTQANVAGMEAYQALCRRAEADYEG---FWAELARQHIDW
outN.europaea    MATIESILHENRIFPPASEFVRNANLSGREAYETLRQEAEHDYTG---FWAKLAQQYIAW
outN.eutropha    MATIESILRENRIFPPANEFVRHANITGMKTYEALRQEAERDYAG---FWAKLAKQYITW
outM.flagellatu  MSSIESVLTETRVFAPHETFRQAATVSGLPGYQALCDAAEQDYTG---FWANLARQEISW
outL.hongkong    MSTIESVLKETRSFPPSEAFRQQATVSGMQAYNDLCEKANADYEG---FWADLARELLSW
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        YQAPANILES---LPDGTHRWFADGRLNSAYLALDRQIEEGRGEQTALIYDSPVTGTQDR
inM.aquae        IKPFTKVKNSTYDYNNLSIKWFEDGVLNASANCLDRHLEQRGDQTAIIFEGD-DPSVSRN
inA.ehrli        FSKWDKVYHSDLKNG--EIRFFEGGKLNVAHNCLDRHLEQRGDQTAIIWEGD-DPNNSEH
inV.vulnifi      IKPFTKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAERGDDVAIIWEGD-NPADDKT
inS.frigidima    IKPYTKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLEEHGDKLAIIWEGD-DANEQRK
inX.axono        FKQPTQIKDVSYALDDFHIRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDAASYP
inS.loihica      MKPFTKVKKTSFDDHNLSINWFYDGTLNASVNCLDRHLADNADKLAIIWEGD-DAADQRT
inA.hydro        MKPYTRVKNTSYDPGHVSIKWYEDGLLNVSANCLDRHLAQRGDKVAIIWEGD-NPAEDRK
inP.ingraha      IKPYTKVKNSSFDSGHVSIKWFEDGKLNVSANCIDRHLATKGDQVAILWEGD-TADKDEK
inX.campest      FKQPTQIKDVSFALDDFHVRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDSPSYP
inP.profund      IKPFTKVKHTSFDTGHVSVKWFEDGTLNVSANCIDRHLATRGDQPAIIWEGD-DPTDDAT
inM.sp.MWyl      FKPYTKVKNTSFKRGEVSIKWFEDGELNVAYNCIDRHLAKSANKVAYYCEGDKESDEKVA
inS.degrad       DKPWQSVRSFDFHKG--EATWFEGGKLNVTVNCIDRHLPTKANDVAIIWEGD-DPSVDAS
inS.amazonen     IKPFTQVKDTSYDDQNLYIKWFHDGTLNASANCLDRHLASKGDDVAIIWEGD-DASEQRK
inV.choler       IKPFTKVKHTSFDPGHIDIRWFEDGTLNVSANCIDRHLATRGDQVAIIWEGD-DPTQDKT
inP.putida       IKPFTKVKQTSFDDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGD-DPSEHRN
inP.articus      IKKPTKISDVSYDLEDFRIKWFEDGELNISVNCLDRHVKNNPYKPAIIWEGD-HPSLHKI
inV.parahae      IKPFTKVKSTSFDTGHVDIRWFEDGTLNVSANCIDRHLAEHGDDVAIIWEGD-DPADDKT
inS.oneiden      IKPYTKIKKTTFDDHNLSINWFYDGTLNASANCLDRHLAAHSDRVAIIWEGD-NANEQRK
inS.baltica      IKPYTKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGD-NASEQRK
outT.denitrif    KTPFTRTLD---ESDAPFYRWFDDGELNVSYNCLDRHLATRGDKTALIFEAD--DGSVRT
outN.europaea    HKPFTRVLN---DANPPFYKWFDDGELNISWNCLDRHLATQADKTAIIFESD--AGEVNH
outN.eutropha    HKPFTRILD---DTNPPFYKWFDDGELNISWNCLDRHLTTQANKTAIIFESD--EGEVIR
outM.flagellatu  QTPFTEVLD---ESNAPFYRWFADGKLNASYNCIDRHLEKRANKIALIFEAD--NGDVAN
outL.hongkong    KKPFTQVFD---GSQAPFFKWFADGQLNVSYNCLDRHLEHNANKTAIIYETD--DGQVTP
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        YSYLRLRDEVARLAGALRALGVGKGDRVIIYMPMVPQAAMAMLACARLGAVHSVVFGGFA
inM.aquae        VTYRELYEETCKFANVLKDQGVKKGDVVTIYMPMIVETAVAMLACARIGAIHSVVFGGFS
inA.ehrli        ITYKDLHERVCRLANAMKARGVKKGDRVCIYLPMIPEAAVAMLACARIGAIHSIVFGGFS
inV.vulnifi      LTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTIVFGGFS
inS.frigidima    LTYAELHTQVCKFANALRSQGVNKGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS
inX.axono        VTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFA
inS.loihica      LTYGELHTEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVVMLACARIGAIHSVVFGGFS
inA.hydro        LTYRELHTEVCKFANVLKAQGVHRGDVVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFS
inP.ingraha      ITYKQLHQRVCQFANVLKSQGVRKGDVVCLYMPMTPEAAVAMLACTRIGAVHSIVFGGFS
inX.campest      VTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFA
inP.profund      FTYNELHEQVCKFSNALKSQGVRKGDVVCLYMPMVAEAAIAMLACTRIGAVHTIVFGGFS
inM.sp.MWyl      ITYQTLHDEVGRLANLLKRQGVKKGDRVAIYMPMIPQAVYAMLACARIGAIHSVIFGGFS
inS.degrad       ITYQQLHDAVCKFANVLKARGVAKGDRVCIYMPMIPEAAYAMLACARIGAVHSIVFGGFS
inS.amazonen     VTYRELHAEVCQFANALKAEGVKRGDVVTIYMPMVVEATVAMLACARIGAVHSVVFGGFS
inV.choler       LTYKQLHQEVCRFANALKEQGVRKGDVVCIYMPMVPEAAVAMLACTRIGAVHTIVFGGFS
inP.putida       ITYRELHEQVCKFANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFS
inP.articus      ISFKELHEAVCRLGNAMRKLGVKKGDRVTLYMPMIPEAVVAMLACTRIGAVHSVVFGGFS
inV.parahae      LTFNELHKEVCKFSNALKDQGVRKGDVVCLYMPMVPEAAIAMLACTRIGAVHTVVFGGFS
inS.oneiden      ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS
inS.baltica      ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFS
outT.denitrif    VTYKELHARVCQFANGLKSLGVGKGDRVIVYMPMSIEAVVAMQACARIGAIHSVVFGGFS
outN.europaea    CSYRELHRQVCHFANGLKSLGIRQGDRVVIYMPMRIEAVVAMQACARIGAIHSVVFGGFS
outN.eutropha    CSYRELHQRVCRFANGLKALGIRQGDRIVIYMPMRIEAVVAMQACARIGVIHSVVFGGFS
outM.flagellatu  ITYRELHQRVCRFANALKKQGVGLGDRVIIYLPMSIEAIVAMQACARIGAIHSVVFGGFS
outL.hongkong    ISYRSLYEQVCQFANGLKSLGVGKGDRVVIYMPMVPQAIVAMQACARIGAIHSVVFGGFS
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        PYELALRIDDATPKLVLTASCGLEFDRVIEYKPLVDKALELAIHQPAHVMVWQRPQAP--
inM.aquae        PEALAARIVNGKSRFVITADEGLRGGRAIPLKKNVDSALKHEDDAKVDKVIVVSRTGNDQ
inA.ehrli        PDALKDRIQNADCETVITADEGVRGGRNVALKSNADKALES--CPDVKNVFVVKRTGG-D
inV.vulnifi      PEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVFKRTGG-N
inS.frigidima    PDSIAARVIDGKSKVLITADEGIRGGRKIPLKRSIDEAISNPDVTCVEKVIVFKRTGG-D
inX.axono        ANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGG-A
inS.loihica      PDSIASRVIDGKSKVVITADEGVRGGRTIPLKANIDEALSHPDVTCVEKVIVLERTGN-P
inA.hydro        PEALAGRIIDSGSSIVITADEGLRGGRPVPLKKNVDEALTNPETK-VNNVIVLKRTGG-N
inP.ingraha      PDAIAGRIVDSSAKIVITADEGRRGGRVVPLKANVDEALTKDGTDCVKSVIVFKNTGG-E
inX.campest      ANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGG-A
inP.profund      PEALAGRIVDSNAKLVITADEGVRAGRAVPLKKNVDDALANKNVTSIEKVIVLKRTGG-N
inM.sp.MWyl      AHAIADRLNDCEVKLVITADEGRRAGNTIPLKHNVDMALDNNACPTVENVIVYRYTEK-D
inS.degrad       PEALKDRIVDSDCKVLITADEGLRGGRAVALKANADKAVAH--CPQVHSVIVVKRTGA-D
inS.amazonen     PDSIASRVIDGKSKLLITADEGVRGGRKIPLKGNIDEALNRPDVTTVETVIVLKRTGG-A
inV.choler       PEALAGRIIDSNAKLVITADEGVRGGRAVPLKKNVDEALCNPEVKNISKVMVLKRTGG-N
inP.putida       PEALAGRIIDCKSKVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGG-D
inP.articus      TQSLGNRIIDSQSKLVITADEGIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTGN-S
inV.parahae      PEALSGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVLKRTGG-N
inS.oneiden      PDSIASRVIDGKSKIVITSDEGMRGGRAIPLKRNIDDALKHPDVTSVEKVIVLKRTGG-K
inS.baltica      PDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNIDDALKNPDVTTVEKVIVLKRTGG-K
outT.denitrif    AKSLFERIEDAQAKLIVTADESLRGGKAVPLKRAADEALAMGDTSCVERVVVYRRSGG-E
outN.europaea    AKSVYERIIDAGASAVITADEQIRGGRYHPLKATVDEALAMGDTATVHSVIVFRHTGT-G
outN.eutropha    AKSVYERIIDAGASAVITADEQTRGGKRHALKATVDEALAMGDTTSVHSVIVFRHTGT-D
outM.flagellatu  AKSLHERIVDVGAKLVITADAGIRGGKQVALKASVDEALELGGCESVEKVIVYQRTGV-D
outL.hongkong    AGALRDRIQDAAAKVVITANESVRGGKLVPLKATVDEALAMDGCDSIEKVVVLQRTYT-P
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        ARLHPGRDLDWQDCLAAAEP-ADPLPVASGDPLYIMYTSGTTGKPKGIVRDNGGHAVAVR
inM.aquae        VPWTEGRDLRYEDLMKNASAECQPEPMNAEDPLFMLYTSGSTGAPKGVLHTTGGYMVYAS
inA.ehrli        IDWKEGRDIWYHEAVADVSADCPAEELDAEDPLFILYTSGSTGKPKGVQHCSAGYLLGAA
inV.vulnifi      IDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT
inS.frigidima    IDWVEGRDVWWHSLMEVASEFCQPAEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAS
inX.axono        VEMQAPRDRWFHDVVDGQPAACEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFAS
inS.loihica      VNWVEGRDIKWASLMETASEHCVAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAS
inA.hydro        IAWHNHRDIWWHDAVATVSADCPPEAMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT
inP.ingraha      VNWVVGRDLDWESVCADESSECEPEAMNAEDPLFILYTSGSTGTPKGVLHTTGGYLVYAA
inX.campest      VDMQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFAS
inP.profund      VEWHSERDVWWHEATAVASSHCEPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT
inM.sp.MWyl      VPWFEGRDLDWAVEVENESTECPAERMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAS
inS.degrad       VAWNTERDIWLHEAQQSVDTVCEPESMDSEDPLFILYTSGSTGKPKGVLHTTGGYLLQAA
inS.amazonen     VNWVEGRDKWWHQVTDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAS
inV.choler       VAWHEHRDIWWHEATAKASDNCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAT
inP.putida       IAWHQHRDIWYEDLMKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAA
inP.articus      VPMSGRRDIWYHSLVDGESQYCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYAL
inV.parahae      VDWHGHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAA
inS.oneiden      IDWVEGRDVWWHSLVETASEHCAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAS
inS.baltica      VDWVEGRDVWWHSLMETASEYCQPEEMDAEAPLFLLYTSGSTGNPKGVLHTTGGYMVYAS
outT.denitrif    VNWS-ARDLWWHELTQTQAETCEPVWVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLGAL
outN.europaea    ITWQPERDHWWHDLIAGQPDECEPAWINAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAV
outN.eutropha    IPWQPERDRWWHNLTASQSDECEPIWVNAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAI
outM.flagellatu  IAWNPHRDAWWHEVEAAENDNCEPVWVDAEHPLFILYTSGSTGTPKGVQHSTGGYLLGAI
outL.hongkong    CSMG-ARDITWDALTAGQPLECEPEWMSAEDPLFILYTSGSTGKPKGIQHSSAGYLLGAA
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        YAVRTIYGMQA-GDVWWGISDVGWVVGHSLIVYGPLMCGCTTVFYEGKPVRTPDAGAYWR
inM.aquae        MTHQYVFDYHD-GDVYWCTADFGWVTGHSYILYGPLANGAITLLFEGVPN-YPDSSRMGQ
inA.ehrli        MTHKYVFDYQE-GEVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPT-YPSAARCWE
inV.vulnifi      MTFKYVFDYQP-GETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPN-YPNTSRMSE
inS.frigidima    MTHEYVFDYKA-DEVYWCTADVGWITGHSYMVYGPFANAATVLIHEGVPN-HPTPARLGE
inX.axono        YTHEVVFDLRE-DDIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPN-YPNVSRFWE
inS.loihica      MTHEYVFDYKE-GEIYWCTADVGWITGHSYMVYGPLANGATILIHEGIPN-YPTPARLGE
inA.hydro        LTFKYIFDYHE-EDIYWCTADVGWVTGHSYLVYGPLANGATTIMFEGVPN-YPATNRMSQ
inP.ingraha      MTFKYVFDYQE-GDIYWCTADVGWITGHTYSVYGPLANGATSLIFEGVPN-YPTPARMSE
inX.campest      YTHEVVFDLRE-DDIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPN-YPNVSRFWE
inP.profund      MTFKYVFDYQE-GDVYWCTADVGWITGHSYLVYGPLANGATTVLFEGVPN-YPSTSRMSE
inM.sp.MWyl      LTHELVFDLKP-DDVYWCAADVGWITGHSYMVYGPLANGTTSILFEGVPT-YPDSGRIGR
inS.degrad       MTHKYVFDYQP-GEVYWCTADVGWVTGHTYIVYGPLTNGATTLMFEGVPT-YPTAARCWE
inS.amazonen     MTHEYVFDYKP-GEVYWCTADVGWITGHSYMVYGPLANGATILIHEGIPN-FPSPARLGE
inV.choler       MTFKYVFDYQP-NEVFWCTADVGWITGHSYLVYGPLANGAKTILFEGVPN-YPTTARMSE
inP.putida       LTHERVFDYRP-GEVYWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPN-YPDITRVSK
inP.articus      STFRDVFDVKD-DDVYWCTADVGWVTGHTYATYAPLANGTTTVMFEGVPE-YPTWARIGH
inV.parahae      MTFKYVFDYQP-GETFWCTADVGWITGHTYLIYGPLANGAKTILFEGVPN-YPNTSRMSE
inS.oneiden      MTHEYVFDYKP-GEIYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPN-HPSPARLGE
inS.baltica      MTHEYVFDYKA-GEVYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPN-HPSPARLGE
outT.denitrif    LSMLWVFDAKADNDVYWCTADVGWITGHTYVAYGPLALGMTEVIFEGIPT-YPHAGRFWE
outN.europaea    TSMQWVFDYHA-DDVFWCTADVGWVTGHSYVAYGPLAIGATQVIFEGTPT-HPHAGRFWE
outN.eutropha    VSMQWVFDYHS-EDIFWCTADVGWVTGHSYVTYGPLAIGATQVIFEGTPT-YPHAGRFWE
outM.flagellatu  MSMKWVFDHKA-TDIFWCTADVGWITGHSYVAYGPLALGSTQVVFEGVPT-YPDAGRFWQ
outL.hongkong    NSFRWAFDYKP-NDIYWCTADVGWITGHSYICYGPLAMGATQVVFEGIPT-YPDAGRFWR
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Translation      ------------------------------------------------------------
inP.aerug        VIEEHRVNSLFCAPTAIRAIRKEDPHGERVKRYDLGSLRHLFLAGEKLDSSTQHWLEEHT
inM.aquae        VVDKHKVNILYTAPTAIRALMAQGES--CMDGTTRGSLKLLGSVGEPINPEAWEWYHRVI
inA.ehrli        VVDKHNVSIFYTAPTAIRALMGQGNE--HVTKTSRKSLRILGTVGEPINPEAWEWYYNVV
inV.vulnifi      VVDKHQVNILYTAPTAIRALMAKGNE--AIEGTDRSSLRIMGSVGEPINPEAWEWYYKTI
inS.frigidima    MIDRHKVNILYTAPTLIRALMAEGKE--QFSSYKGDSLRIMGSVGEPINPEAWRWYHEVI
inX.axono        VIDKHQVTIFYTAPTAIRALMRDGAD--PVKKTSRKSLRLLGSVGEPINPEAWRWYYEVV
inS.loihica      MIDRHKVNILYTAPTLIRALMAEGKE--QFDGFDGSSLRIMGSVGEPINPEAWRWYHEVI
inA.hydro        VVDKHQVSILYTAPTAIRALMAKGNE--AVADTSRSSLRIMGSVGEPINPEAWEWYYRTI
inP.ingraha      VVDKHKVSILYTAPTAIRALMAKGDQ--AIEGTHRSSLRILGSVGEPINPEAWEWYYNKI
inX.campest      VIDKHQVTIFYTAPTAIRALMREGEA--PVKKTSRSSLRLLGSVGEPINPEAWRWYYEVV
inP.profund      VVDKHNVSILYTAPTAIRALMAKGTE--AIKGTSRSSLRIMGSVGEPINPEAWEWYHHTI
inM.sp.MWyl      VVDKFDVTILYTAPTAIRALMAKGDE--ATRSSKRDSLRVLGSVGEPINPEAWSWYYSEI
inS.degrad       VCDKHNVNIFYTAPTAIRALMGQGDE--FVASTQRKSLRILGTVGEPINPEAWEWYYNVV
inS.amazonen     IVDRHQVNILYTAPTLIRALMAEGKQ--HFDNFDGKSLRIMGSVGEPINPEAWRWYHEVI
inV.choler       VVDKHKVNILYTAPTAIRALMAKGDE--AIKGTSRDSLRIMGSVGEPINPEAWEWYYRTI
inP.putida       IVDKHKVNILYTAPTAIRAMMAEGQA--AVEGADGSSLRLLGSVGEPINPEAWNWYYKTV
inP.articus      IIDKHQITVLYTAPTAIRAMMKEGDT--FVRESDRSSLRLLGTVGEPINPEAWDWYYHIV
inV.parahae      VVDKHQVNILYTAPTAIRALMAKGNE--AVAGTSRSSLRIMGSVGEPINPEAWEWYYKTI
inS.oneiden      MIDRHKVNILYTAPTLIRALMAEGKQ--HFDKYNGSSLRIMGSVGEPINPEAWRWYHEVI
inS.baltica      MIDRHKVSILYTAPTLIRALMAEGKQ--HFDKFDGSSLRIMGSVGEPINPEAWRWYHEVI
outT.denitrif    TIAKHKVTTFYTAPTAIRSLIKLGSE--LPAQYDLSSLRLLGTVGEPINPEAWMWYHEVI
outN.europaea    IIQKHRITTFYTAPTAIRSLIKLGSD--LPAKYDLSSLRLLGSVGEPINPEAWMWYYTVV
outN.eutropha    IIQKHRVTTFYTAPTAIRSLIKLGPD--LPEKYDLSSLRLLGSVGEPINPEAWMWYYTVI
outM.flagellatu  MIERHKVSIFYTAPTAIRSLIKLGGD--LPHKYDLSSLRLLGTVGEPINPEAWMWYYKVV
outL.hongkong    MIEQHKVNIFYTAPTAIRSLIKLGAD--LPKQFDLSSLRVLGTVGEPINPEAWMWYYEVV
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Translation      ----------------------------------------VPGYDVKIIKSDQSLAKP--
inP.aerug        GR---PVHDHWWQTETGWPVTAPCIGIAGHDLRAGSTNRAVPGYHVQVLDDEGRPLGA--
inM.aquae        GNSKCPIVDTWWQTETGGILISPLPG--AVDLKPGSATLPFFGVQPALVDNEGNILEG--
inA.ehrli        GDGRCPIVDTWWQTETGSILIAPLPG--ATDLKPGSATLPFFGVEPALVDPEGKELEG--
inV.vulnifi      GNEKSPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPALVDNMGNVIEDQ-
inS.frigidima    GHENCPIVDTWWQTETGGILISPLPG--ATDTKPGSATRPFFGVQPALVDNMGDIVEG--
inX.axono        GDSRCPIVDTWWQTETGGILISPLAG--AVDLKPGSATLPFFGVQPALVDAEGKILEG--
inS.loihica      GHENCPIVDTWWQTETGGILISPLPG--ATDTKPGSATRPFFGVQPALVDNMGNIIDG--
inA.hydro        GEERCPIVDTWWQTETGGILISPLPG--VTDLKPGSATRPFFGVQPALVDNMGEPLEG--
inP.ingraha      GDERCPIVDTWWQTETGGILISPLPG--ATDLKPGSATRPFFGVQPAIVDSEGVVLEG--
inX.campest      GDSRCPIVDTWWQTETGGILISPLAG--AVDLKPGSATLPFFGVQPALVDAEGKILEG--
inP.profund      GDSRCPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPAIVDNMGNILEG--
inM.sp.MWyl      GNSSCPIVDTWWQTETGGMMMTPRIV--QGDVKPGSCTGPLYGVQPALVDAQGVLQEEQG
inS.degrad       GDRRCPIMDTWWQTETGGHMLTPLPG--AIDLKPGSATLPFFGVEPVLLDGEGNIIEG--
inS.amazonen     GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNEGNILEG--
inV.choler       GNEKSPIVDTWWQTETGGILITPLPG--ATALKPGSATRPFFGVQPALVDNMGEIVEG--
inP.putida       GKERCPIVDTWWQTETGGILISPLPG--ATGLKPGSATRPFFGVVPALVDNLGNLIDG--
inP.articus      GGGKCPVVDTWWQTETGGIMLAPIPG--TVAMKPGAVMNPLYGIIPEVIDTDGVALEG--
inV.parahae      GNENSPIVDTWWQTETGGILIAPLPG--ATDLKPGSATRPFFGVQPALVDNMGNILEDT-
inS.oneiden      GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNMGNILEG--
inS.baltica      GHEHCPIVDTWWQTETGGILITPLPG--ATDTKPGSATRPFFGVQPALVDNMGNILEG--
outT.denitrif    GGGRCPIVDTWWQTETGAHMIAPLPG--AVPTKPGSCTLPLPGIMAAVTDEHGGPVAK--
outN.europaea    GQSRCPVVDTWWQTETGCHMIAPAPG--AISTKPGSCTLPLPGIDAAVVDETGHPVEQ--
outN.eutropha    GQSRCPVVDTWWQTETGSHMIAPIPG--AIPAKPGSCTLPLPGIDAAVVDETGLPAEQ--
outM.flagellatu  GKERCPIADTWWQTETGAHMIAPLPG--AIDLKPGSCTRPLPGIIMDIVEEDGTHIEG--
outL.hongkong    GGGRCPIVDTWWQTETGSAMIAPMPG--AVATKPGSCTLPLPGIMADIVDESGAQVEP--
                                                           ################  


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
Translation      -NEMGDIVVKLPLPPGTFPTLWNADQRYKENYM-SNYEG--YYQTYDAGHIDDDGYIWIM
inP.aerug        -NRQGAIVIALPLPPGCAQTLWGDHPRYLQAYL-GNYPG--YYHTGDGGYLDEDGFVYIM
inM.aquae        -KTEGNLVILDSWP-GQMRTIYGDHERFVQTYF-STYKG--MYFTGDGARRDEDGYYWIT
inA.ehrli        -AASGNLVIKRAWP-SMMRTVYGDHKRFMETYL-AAYPG--MYFTGDGARRDEDGYYWIT
inV.vulnifi      -AAEGNLVILDSWP-GQMRTVYGDHERFEQTYF-STFKG--MYFTGDGARRDEDGYYWIT
inS.frigidima    -TGEGNLVILDSWP-GQMRTVYGDHDRFALTYF-KTFRG--MYFTGDGARRDEDGYYWIT
inX.axono        -ATEGNLVLLDSWP-GQMRSVYGDHQRFIDTYF-RTYPG--SYFTGDGCRRDADGYYWIT
inS.loihica      -AAEGNLVILDSWP-GQMRTVYGDHDRFALTYF-KTFRG--MYFTGDGARRDEDGYYWIT
inA.hydro        -ATEGNLVITDSWP-GQMRTVFGDHERFEQTYF-STFPG--RYFTGDGARRDEDGYYWIT
inP.ingraha      -EAAGNLVMLDSWP-GQMRTLYNNHDRFEQTYF-STFKG--MYFTGDGARRDSDGYYWIT
inX.campest      -ATEGNLVLLDSWP-GQMRTVYGDHQRFIDTYF-RTYPG--SYFTGDGCRRDADGYYWIT
inP.profund      -VAEGNLVMVDSWP-GQMRTLWGDHERFEQTYF-STFQG--MYFTGDGARRDEDGYYWIT
inM.sp.MWyl      VLVEGGLVITDSWP-GQARTVYGDHERFEQTYF-STFDG--MYFTGDGASRDADGHYWIT
inS.degrad       -EGEGSLAIKSSWP-GQIRTVYGDHDRLIQTYF-STYPG--YYFTGDGARRDADGYYWIT
inS.amazonen     -ATEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT
inV.choler       -ATEGNLVLLDSWP-GQMRTVYGDHDRFEQTYF-STFKG--MYFTGDGARRDEDGYYWIT
inP.putida       -AAEGNLVILDSWP-GQSRSLYGDHDRFVDTYF-KTFRG--MYFTGDGARRDEDGYYWIT
inP.articus      -AAEGNLVINGSWP-GQMRTIYKDHARFLETYF-TEYPG--YYFTGDGVQRDEDGHYWIT
inV.parahae      -VAEGNLVILDSWP-GQMRTVYGDHERFEQTYF-STFKG--MYFTSDGARRDEDGYYWIT
inS.oneiden      -ATEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT
inS.baltica      -ENEGNLVLLDSWP-GQMRTVYGDHERFVLTYF-KTFRG--MYFTGDGARRDEDGYYWIT
outT.denitrif    -GQGGYLVIKRPFP-SQLRTLWGDPERFKKTYFPEEMGGK-TYLAGDSAHRDDDGYFWIM
outN.europaea    -GKGGFLVIKRPFP-SMLRTLWNDPERFRKTYFPTDIAGGRYYLAGDSAHRDQDGYFWIM
outN.eutropha    -GKGGFLVIKRPFP-SMLRTLWNDPERFRNTYFPADIAGGHYYLAGDSAHRDQDGYFWIM
outM.flagellatu  -TGGGLLVVKKPWP-SMIRNIWGNPERFRKAYFPEELNG--LYLAGDSAHRDEDGYFWIM
outL.hongkong    -GRGGFLVIKKPFP-SLVRTIWNDPDRFKKTYFPEEFNGQ-YYLAGDSANRDESGYFWIM
                    ########### ##################        ###################


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
Translation      SRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGVD--K
inP.aerug        GRTDDVINVSGHRLSTGEMEERVAQHQAVAECAVIGVRDELKGHVPLGLVVLKDDAG--I
inM.aquae        GRVDDVLNVSGHRLGTAEVESALVAHDKVAEAAVVGYPHDIKGQGIYVYVTLVQGE---E
inA.ehrli        GRVDDVINVSGHRMGTAEVESALVLHDAVAEAAVVGYPHDIKGQGIYAYVTLMAGV---E
inV.vulnifi      GRVDDVLNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGE---Y
inS.frigidima    GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGI---E
inX.axono        GRVDDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGQ---T
inS.loihica      GRVDDVINVSGHRLGTAEVESALVAHEHVAEAAVVGYPHDIKGQGIYAYVTLTKGT---Q
inA.hydro        GRVDDVLNVSGHRMGTAEIESALVSHPKIAEAAVVGVPHEIKGQGIYAYVTLIAGE---E
inP.ingraha      GRVDDVLNVSGHRMGTAEIESALVSHPKIAEAAVVGVPHEIKGQGIYAYVTLNEGE---Y
inX.campest      GRVDDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGE---T
inP.profund      GRVDDVLNISGHRMGTAEIESALVAFDKIAEAAIVGVPHDIKGQAIYAYITLNDGE---I
inM.sp.MWyl      GRMDDVLNVSGHRLGTAEIESALVAHPSVAEAAIVGFPHDIKGQGIYVYVSAIAGV---I
inS.degrad       GRVDDVLNVSGHRMGTAEVESALVLHPKVAEAAVVGYPHDVKGQGIYAYVTLMTGV---E
inS.amazonen     GRVDDVINVSGHRLGTAEVESALVAHDLVAEAAVVGYPHDIKGQGIYAYVTLTKGT---E
inV.choler       GRVDDVLNVSGHRMGTAEIESALVAFNKIAEAAVVGVPHDIKGQAIYAYITLNDGV---Y
inP.putida       GRVDDVLNVSGHRMGTAEIESAMVAHSKVAEAAVVGVPHDIKGQGIYVYVTLNAGI---E
inP.articus      GRVDDVLNVSGHRLGTAEIESAIVAHPATAEAAVVGMPHDIRGIGICAFVILKSSE---T
inV.parahae      GRVDDVLNVSGHRMGTAEIESALVAHHKIAEAAIVGIPHDIKGQAIYAYITLNDGE---F
inS.oneiden      GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGT---E
inS.baltica      GRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGT---E
outT.denitrif    GRIDDVLNVSGHRLGTMEIESALVSNPRVAEAAVVGRPHEVKGEAVVAYVVLKGARAVGD
outN.europaea    GRVDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEIKGEVVVAFVTLREKLPDDQ
outN.eutropha    GRIDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEIRGEVIVAFVVLRGKLPDDQ
outM.flagellatu  GRIDDVLNVSGHRLGTMEIESALVANPLVAEAAIVGKPHDIKGESIVAYVVLKGERPEGE
outL.hongkong    GRIDDVLNVSGHRLGTMEIESALVANPLVAEAAVVGKPHDVKGEAVVAFVVLKGIRPEGD
                 #######################################################     


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
Translation      SHEDISKECIQMVREKIGPVAAFKVAIVIK-RLPKTRSGKILRGTIRKIADNEEYKMP--
inP.aerug        AAEQLQRELVALVREQIGALACFQRVVVVK-RLPKTRSGKILRAVLRKIADGEDYAAP--
inM.aquae        PSDELKKELVQWVRKEIGPIASPDVIQWAP-GLPKTRSGKIMRRILRKIAANEHDQLGDT
inA.ehrli        PSDELKKELVKLVSNEIGPIAKPDVIQWAP-GLPKTRSGKIMRRILRKVAANELDSLGDT
inV.vulnifi      PTAELHKEVKDWVRKEIGPIATPDVLHWTD-ALPKTRSGKIMRRILRKIATGDTSNLGDT
inS.frigidima    PTEELRQELRQWVRKEIGALATPDLIQWAS-GLPKTRSGKIMRRFLRKIAANEVTNLGDS
inX.axono        PSEDLHKELVSWVRKEIGPIASPDHLQWAP-GLPKTRSGKIMRRILRKIAENAPDQLGDT
inS.loihica      ESEELRQELRQWVRKEIGALATPDLIQWAG-GLPKTRSGKIMRRFLRKIAANEVTNLGDA
inA.hydro        PSRELHKEVKEWVRKEIGAIATPDVIHWAE-GLPKTRSGKIMRRILRKIATGETDSLGDI
inP.ingraha      PSPELYAEVKQWVRKEIGAIATPDILHWAE-GLPKTRSGKIMRRILRKIATGESDSLGDI
inX.campest      PSEELHKELVSWVRKEIGPIASPDHLQWAP-GLPKTRSGKIMRRILRKIAENAPDQLGDT
inP.profund      PSAELHKEVKDWVRKEIGPIATPDFLHWTD-ALPKTRSGKIMRRILRKIATGDTGSLGDT
inM.sp.MWyl      PDEELTKSLKLFVRQEIGPIATPDLIQWTSKGLPKTRSGKIMRRILRKIAANEHDQLGDT
inS.degrad       PDDGLRKELVAMCTQEIGPIAKPDLIQWAP-GLPKTRSGKIMRRILRKVAANELDTLGDT
inS.amazonen     ATEELRQELRQWVRKEIGALATPDLIQWAS-GLPKTRSGKIMRRFLRKIAANEITNLGDA
inV.choler       PSAELHKEVKDWVRKEIGAIATPDVLHWTD-ALPKTRSGKIMRRILRKIATGDTSNLGDT
inP.putida       ASEQLRLELKNWVRKEIGPIASPDVIQWAP-GLPKTRSGKIMRRILRKIATGEYDALGDI
inP.articus      ATESLKAELNRHVRTEIGPIANLDAIYMVN-VLPKTRSGKIMRRILRSLAAGQYVGLGDL
inV.parahae      PSAELHKEVKDWVRKEIGPIATPDVLHWTD-SLPKTRSGKIMRRILRKIATGDTSNLGDT
inS.oneiden      ESEELRQELRQWVRKEIGALATPDLIQWAT-GLPKTRSGKIMRRFLRKIAANEVTNLGDA
inS.baltica      ETEELRQELRQWVRKEIGALATPDLIQWAT-GLPKTRSGKIMRRFLRKIAANEVTNLGDA
outT.denitrif    EAKDIARELRDWVGKEIGPIAKPDEIRFGE-NLPKTRSGKIMRRLLRAIAKGE-EITQDV
outN.europaea    RAAEIAATLREWVASEIGAIARPEEIRFGE-NLPKTRSGKIMRRLLRALARGE-TITQDV
outN.eutropha    QAAEIAETLREWVSSEIGAIARPEEIRFGE-NLPKTRSGKLMRRLLRSLARGE-TITQDI
outM.flagellatu  AAKTIAGQLREWVGKEIGPIAKPDEIRFGE-NLPKTRSGKIMRRLLRSLAKGE-EITSDI
outL.hongkong    EAKKVAAELKSWVAHEIGKIAQPDDIRFGE-NLPKTRSGKIMRRLLRSIAKGE-EITQDT
                    #########################   ######################       


                        670       680
                 =========+=========+====
Translation      PTIDDPAILDEIKTDLINNNILKL
inP.aerug        STIDDPTILGEIEAALRVRKAG--
inM.aquae        STLADPGVVDELISSR--AFK---
inA.ehrli        STLADPTVVDNLIEDR--PNK---
inV.vulnifi      STLADPSVVDKLIAEKAELV----
inS.frigidima    STLADPAVIDTLIESR--LNKTE-
inX.axono        STLADPSVVDSLVNER--LAR---
inS.loihica      STLADPAVIDTLIETR--LNRSE-
inA.hydro        STLADPGVVDKLIREKSEAA----
inP.ingraha      STLADPSVVEQLIKENRETS----
inX.campest      STLADPSVVDSLVNER--LTR---
inP.profund      STLADPSVVDKLIAEKQTIL----
inM.sp.MWyl      STLADPSVVDDLIENR--LNV---
inS.degrad       STLADPSVVDDLIENR--MNR---
inS.amazonen     STLADPSVIDTLIESR--LNRAD-
inV.choler       STLADPSVVDRLIAEKAQLK----
inP.putida       STLADPGVVQHLIDTHKAMNLASA
inP.articus      STLADSSVINELVEVVKTERAK--
inV.parahae      STLADPSVVDKLIAEKAELV----
inS.oneiden      STLADPAVIETLIETR--LNRNE-
inS.baltica      STLADPAVIETLIESR--LNRTE-
outT.denitrif    STLENPAILDQLKEAVK-------
outN.europaea    STLENPVILEQLSQTV--------
outN.eutropha    STLENPVILEQFSQTI--------
outM.flagellatu  STLDNPAILDQLRQSAG-------
outL.hongkong    STLENPQILDQLQEIA--------
                 ############            





Parameters used
Minimum Number Of Sequences For A Conserved Position: 14
Minimum Number Of Sequences For A Flanking Position: 22
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 7 selected block(s)
Flanks: [463  478]  [484  494]  [496  513]  [522  595]  [604  628]  [632  653]  [661  672]  

New number of positions in input.fasta-gb:  178  (26% of the original 684 positions)

Protein Domains

PROTOCOL


InterPro, default parameters at EBI


RESULTS ANALYSIS



The ORF shows only one domain significant, AMP-binding with the E-value of 3.1e-25. The AMP-binding is a enzyme which appear to act via an ATP-dependent covalent binding of AMP to their substrate. Because of this domain probably the protein participates in the enzyme activity.

In the raw results we can see that there is a domain, ACETYL-COENZYME A SYNTHETASE, that has lower E-value,4.4e-71 [1-211]T and belongs to the same family of AMP-binding domain , and a domain ATP-DEPENDENT AMP-BINDING ENZYME FAMILY MEMBER 4.4e-71 [1-211]T, but they are redundant.

RAW RESULTS

Sequence_1	C62B79FACD029F0B	213	HMMPanther	PTHR11968:SF42	ACETYL-COENZYME A SYNTHETASE (ACETATE--COA LIGASE)	1	211	4.4e-71	T	16-Mar-2010	NULL	NULL	
Sequence_1	C62B79FACD029F0B	213	HMMPanther	PTHR11968	ATP-DEPENDENT AMP-BINDING ENZYME FAMILY MEMBER	1	211	4.4e-71	T	16-Mar-2010	NULL	NULL	
Sequence_1	C62B79FACD029F0B	213	Gene3D	G3DSA:2.30.38.10	no description	1	76	1.1e-05	T	16-Mar-2010	NULL	NULL	
Sequence_1	C62B79FACD029F0B	213	Gene3D	G3DSA:3.30.300.30	no description	78	191	9.5e-22	T	16-Mar-2010	NULL	NULL	
Sequence_1	C62B79FACD029F0B	213	superfamily	SSF56801	Acetyl-CoA synthetase-like	1	207	1e-52	T	16-Mar-2010	NULL	NULL	
Sequence_1	C62B79FACD029F0B	213	HMMPfam	PF00501	AMP-binding	1	108	3.1e-25	T	16-Mar-2010	IPR000873	AMP-dependent synthetase/ligase	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)

Phylogeny

PROTOCOL


a) Phylogeny.fr / BioNJ method / out group: Beta-Proteobacteria

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / out group: Beta-Proteobacteria


RESULTS ANALYSIS



a) Analyzing the tree, by BioNj method, may appear that there is monophyletic, there is a clade to the ingroup and other to the outgroup. Our protein is in a clade with the organisms Pseudomonas aeruginosa (conclued by subroutine BLASTp be the organism with the highest homology to our protein), which means that probably belongs to class g-proteobacteria.



b) The tree, by PhyML, reflects the results of the first tree. Have the same topology and the GOS_1364010 in the same clade with Pseudomonas aeruginosa. So we concluded that probably belongs to class g-proteobacteria but we can't really be sure.


RAW RESULTS


a) BioNJ


                                                       --------0.1-------
 
                   1                   +---------------------------------------------------------------------GOS_1364010
 +-------------------------------------+
 |                                     +-----------------------------------------Pseudomonas aeruginosa                                      [g-proteobacteria]
 |
 |                                                                      +-------------------------Marinomonas sp.MWYL1                       [g-proteobacteria]
 |                                                                      |
 |                                                                      |              1      +--Xanthomonas axonopodis pv.citri             [g-proteobacteria]
 |                                                                      |   +-----------------+
 |                                                                  0,31|   |                 +Xanthomonas campestris pv campestris          [g-proteobacteria]
 |                                                                     ++   |
 |                                                                     || +-+ 0,42
 |                                                                     || | |   +--------------------Alkalilimnicola ehrlichei LHE-1         [g-proteobacteria]
 |                                                                     || | +---+0,79
 |                                                                     |+-+0,37 +---------------------Saccharophagus degradans 2-40          [g-proteobacteria]
 |                                                                     |  |
 |                                                                     |  |  +--------Marinobacter aquaeolei VT8                             [g-proteobacteria]
 |                                                                     |  |  |
 |                                                                     |  +--+0,61      +---Shewanella amazonensis SB2B                      [g-proteobacteria]
 |                                                             1       |     |          |
 |                                                     +---------------+     |    1     |  +---Shewanella frigidimarina NCIMB 400            [g-proteobacteria]
 |                                                     |               |     +----------+ ++ 0,58
 |                                                     |               |                | |+---Shewanella loihica pv-4                       [g-proteobacteria]
 |                                                     |               |           0,55 +-+
 |                                                     |               |                  |  +Shewanella oneidensis                          [g-proteobacteria]
 |                                                     |               |                  +--+ 0,98
 |                                                     |               |                     +Shewanella baltica OS155                       [g-proteobacteria]
 |                                                     |               |
 |                                                     |               |
 |                                                     |               | +-------------------Pseudomonas putida KT2440                       [g-proteobacteria]
 |                                                     |               | |
 |                                            0,98     |           0,61+-+    +-----------------Psychromonas ingrahamii 37                   [g-proteobacteria]
 |                                     +---------------+                 | 0,9|
 |                                     |               |                 +----++---------Aeromonas hydrophila Subsp.hydrophila ATCC 7966     [g-proteobacteria]
 |                                     |               |                      ||
 |                                     |               |                  0,37++    0,5+---------Photobacterium profundum                    [g-proteobacteria]
 |                                     |               |                       |     +-+
 |                                     |               |                       | 0,95| +------Vibrio cholerae                                [g-proteobacteria]
 |                  1                  |               |                       +-----+
 |                                     |               |                             | +--Vibrio vulnificus YJ016                            [g-proteobacteria]
 +-------------------------------------+               |                             +-+0,43
                                       |               |                               +----Vibrio parahaemolyticus                          [g-proteobacteria]
                                       |               |
                                       |               +----------------------------------------Psychrobacter arcticus 273-4                 [g-proteobacteria]
                                       |
                                       |
                                       |                             +------------------------Methylobacillus flagellatus KT                 [b-proteobacteria]
                                       |           1                 |
                                       +-----------------------------+ +----------------Thiobacillus denitrificans ATCC 25259                [b-proteobacteria] 
                                                                     | |
                                                                0,44 +-+           1        +--Nitrosomonas europaea                         [b-proteobacteria]
                                                                       |   +----------------+
                                                                       +---+ 0,53           +----------Nitrosomonas eutropha C91             [b-proteobacteria]
                                                                           |                                                                           
                                                                           +------------------------Laribacter hongkongensis HLHK9           [b-proteobacteria]

----------------------------------------------------------------------------------------------------------------------------------------------------------------
 b) PhyML


         ----0.1---
 
                          1                       +----------------------------------------------------------GOS_1364010
 +------------------------------------------------+
 |                                                +-------------------Pseudomonas aeruginosa                                                 [g-proteobacteria]
 |
 |                                                                 +------------Methylobacillus flagellatus KT                               [b-proteobacteria]
 |                                                   0,97          |
 |                                     +---------------------------+  +--------------Laribacter hongkongensis HLHK9                          [b-proteobacteria]
 |                                     |                           |  |  
 |                                     |                           |0,78|               +--Nitrosomonas europaea                             [b-proteobacteria]
 |                                     |                           +--+          0,99   |
 |                                     |                              |0,12+------------+
 |                                     |                              +----+            +----Nitrosomonas eutropha C91                       [b-proteobacteria]
 |                                     |                                   |
 |                 1                   |                                   +-----------Thiobacillus denitrificans ATCC 25259                 [b-proteobacteria]
 +-------------------------------------+
                                       |               +----------------------------Psychrobacter arcticus 273-4                             [g-proteobacteria]
                                       |               |
                                       |               |                 0,77+-------------Alkalilimnicola ehrlichei LHE-1                   [g-proteobacteria]
                                       |               |                +----+
                                       |               |                |    +-------------Saccharophagus degradans 2-40                     [g-proteobacteria]
                                       |     0,93      |                |
                                       +---------------+                |   +-----------------Marinomonas sp.MWYL1                           [g-proteobacteria]
                                                       |                |   |
                                                       |                |  0,58 +-------------Pseudomonas putida KT2440                      [g-proteobacteria]
                                                       |                | +-+   |
                                                       |                | | |   |       +Vibrio vulnificus YJ016                             [g-proteobacteria]
                                                       |                | | |0,93|      |
                                                       |    0,96        | | +---+   0,96|
                                                       +----------------+ |     |  +----+   +----Photobacterium profundum                    [g-proteobacteria]
                                                                        | |     |  |    | +-+ 0,88
                                                                        | |     |o,92   +-+ +----Vibrio cholerae                             [g-proteobacteria]
                                                                        | |     +--+  0,77|
                                                                        | |        |      +-Vibrio parahaemolyticus                          [g-proteobacteria]
                                                                        | |        |
                                                                        | |        | +-----Aeromonas hydrophila Subsp.hydrophila ATCC 7966   [g-proteobacteria]
                                                                        | |        +-+ 0,75
                                                                        | |          +------------Psychromonas ingrahamii 37                 [g-proteobacteria]
                                                                        | |
                                                                   0,38 +-+      1     +-Xanthomonas axonopodis pv.citri                     [g-proteobacteria]
                                                                          |------------+
                                                                          |            +Xanthomonas campestris pv campestris                 [g-proteobacteria]
                                                                          |
                                                                          |+---Marinobacter aquaeolei VT8                                    [g-proteobacteria]
                                                                          ||
                                                                          ||
                                                                    0,81  ++        +Shewanella amazonensis SB2B                             [g-proteobacteria]
                                                                           |   1    |
                                                                           +--------+    +-Shewanella frigidimarina NCIMB 400                [g-proteobacteria]
                                                                                    |  +-+0,83
                                                                                    |  | +--Shewanella loihica pv-4                          [g-proteobacteria]
                                                                               0,94 +--+
                                                                                       |Shewanella oneidensis                                [g-proteobacteria]
                                                                                       | 0,74
                                                                                       +Shewanella baltica OS155                             [g-proteobacteria]

Taxonomy report

PROTOCOL


BLASTp vs SWISSPROT,default NCBI parameters + 1000 Max targuet sequences


RESULTS ANALYSIS



The Lineage Reports shows several organisms belonging to the phylum of Proteobacterias and it´s indicated that probably our organisms is the class gamma-proteobacteria. So was chosen as ingroup twenty organisms of class: gamma-proteobacteria, for having the lowest E-value and the highest scores ( the first organism, Pseudomonas aeruginosa, have a E-value of 2e-63 and a score of 241). In the outgroup were included five organisms of class: beta-proteobacteria. The organisms selected were those with higher number of hits.



In groups: Gamma-Proteobacteria

sp|P28812.2| Paeruginosa 2e-63 Pseudomonas aeruginosa [g-proteobacteria]

sp|A1U2S9.1| Maquaeolei 1e-32 Marinobacter aquaeolei VT8 [g-proteobacteria]

sp|Q0AAW0.1| Aehrlichei 2e-31 Alkalilimnicola ehrlichei LHE-1 [g-proteobacteria]

sp|Q7MGU3.2| Vvulnificus 2e-30 Vibrio vulnificus YJ016 [g-proteobacteria]

sp|Q8EDK3.1| Soneidensis 2e-30 Shewanella oneidensis [g-proteobacteria]

sp|Q084J4.1| Sfrigidimarina 2e-30 Shewanella frigidimarina NCIMB 400 [g-proteobacteria]

sp|Q87KU7.1| Vparahaemolyticus 2e-30 Vibrio parahaemolyticus [g-proteobacteria]

sp|A0KNI2.1| Ahydrophila 4e-30 Aeromonas hydrophila Subsp.hydrophila ATCC 7966 [g-proteobacteria]

sp|Q8PF09.1| Xaxonopodis 4e-30 Xanthomonas axonopodis pv.citri [g-proteobacteria]

sp|A3QD52.1| Sloihica 4e-30 Shewanella loihica pv-4 [g-proteobacteria]

sp|A1SZA2.1| Pingrahamii 5e-30 Psychromonas ingrahamii 37 [g-proteobacteria]

sp|Q8P3L1.1| Xcampestris 6e-30 Xanthomonas campestris pv campestris [g-proteobacteria]

sp|Q6LLZ1.1| Pprofundum 1e-29 Photobacterium profundum [g-proteobacteria]

sp|A3D3E8.1| Sbaltica 1e-29 Shewanella baltica OS155 [g-proteobacteria]

sp|A6VZN8.1| Marinomonas 3e-29 Marinomonas sp.MWYL1 [g-proteobacteria]

sp|Q21LV0.1| Sdegradans 5e-29 Saccharophagus degradans 2-40 [g-proteobacteria]

sp|A1S7C8.1| Samazonensis 5e-29 Shewanella amazonensis SB2B [g-proteobacteria]

sp|Q9KV59.2| Vcholerae 1e-28 Vibrio cholerae [g-proteobacteria]

sp|Q88EH6.1| Pputida 3e-28 Pseudomonas putida KT2440 [g-proteobacteria]

sp|Q4FVA1.1| Parcticus 3e-27 Psychrobacter arcticus 273-4 [g-proteobacteria]



Out grup: Beta-Proteobacteria

sp|Q3SLF4.1| Tdenitrificans 5e-32 Thiobacillus denitrificans ATCC 25259 [b-proteobacteria]

sp|Q82SI5.1| Neuropaea 3e-29 Nitrosomonas europaea [b-proteobacteria]

sp|Q0AFF1.1| Neutropha 6e-29 Nitrosomonas eutropha C91 [b-proteobacteria]

sp|Q1H0J2.1| Mflagellatus 6e-28 Methylobacillus flagellatus KT [b-proteobacteria]

sp|C1D6V9.1| Lhongkongensis 3e-27 Laribacter hongkongensis HLHK9 [b-proteobacteria]

RAW RESULTS


Lineage Report

cellular organisms
. Bacteria                     [bacteria]
. . Proteobacteria               [proteobacteria]
. . . Gammaproteobacteria          [g-proteobacteria]
. . . . Pseudomonadales              [g-proteobacteria]
. . . . . Pseudomonas                  [g-proteobacteria]
. . . . . . Pseudomonas aeruginosa group [g-proteobacteria]
. . . . . . . Pseudomonas aeruginosa ---------------------------------------------  241  3 hits [g-proteobacteria]       RecName: Full=Uncharacterized protein PA3568
. . . . . . . Pseudomonas oleovorans .............................................   55  1 hit  [g-proteobacteria]       RecName: Full=Medium-chain-fatty-acid--CoA ligase; AltName:
. . . . . . Pseudomonas putida KT2440 --------------------------------------------  124  2 hits [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase 1; AltName: Full
. . . . . . Pseudomonas syringae pv. tomato ......................................  120  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . . . Pseudomonas syringae pv. syringae B728a ..............................  118  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . . . Pseudomonas syringae pv. phaseolicola 1448A ..........................  118  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . . . Pseudomonas stutzeri A1501 ...........................................  109  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . . Psychrobacter arcticus 273-4 -------------------------------------------  121  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . . Psychrobacter cryohalolentis K5 ........................................  120  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ------------------  141  4 hits [enterobacteria]         RecName: Full=Propionate--CoA ligase; AltName: Full=Propion
. . . . Marinobacter aquaeolei VT8 ...............................................  139  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  135  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Escherichia coli K-12 ....................................................  134  7 hits [enterobacteria]         RecName: Full=Propionate--CoA ligase; AltName: Full=Propion
. . . . Vibrio vulnificus YJ016 ..................................................  132  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Vibrio parahaemolyticus ..................................................  132  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Vibrio vulnificus ........................................................  132  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella frigidimarina NCIMB 400 .......................................  132  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella oneidensis ....................................................  132  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella sp. MR-4 ......................................................  131  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella sp. MR-7 ......................................................  131  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella sp. ANA-3 .....................................................  131  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xanthomonas axonopodis pv. citri .........................................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella loihica PV-4 ..................................................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Psychromonas ingrahamii 37 ...............................................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xanthomonas campestris pv. campestris ....................................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xanthomonas campestris pv. campestris str. 8004 ..........................  130  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella sp. W3-18-1 ...................................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella putrefaciens CN-32 ............................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Serratia proteamaculans 568 ..............................................  129  1 hit  [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Photobacterium profundum .................................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella baltica OS155 .................................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella baltica OS185 .................................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella baltica OS195 .................................................  129  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Marinomonas sp. MWYL1 ....................................................  128  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  128  3 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  127  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella denitrificans OS217 ...........................................  127  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Citrobacter koseri ATCC BAA-895 ..........................................  127  3 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Saccharophagus degradans 2-40 ............................................  127  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella amazonensis SB2B ..............................................  127  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  126  2 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella sediminis HAW-EB3 .............................................  126  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella pealeana ATCC 700345 ..........................................  126  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Shewanella halifaxensis HAW-EB4 ..........................................  126  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pestis ..........................................................  126  3 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pestis Antiqua ..................................................  126  2 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pestis Nepal516 .................................................  126  1 hit  [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pestis Pestoides F ..............................................  126  2 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Vibrio cholerae ..........................................................  125  2 hits [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Escherichia coli O6 ......................................................  125  3 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Salmonella enterica subsp. enterica serovar Typhi ........................  125  3 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Halorhodospira halophila SL1 .............................................  125  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Pseudoalteromonas haloplanktis TAC125 ....................................  125  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pseudotuberculosis ..............................................  125  2 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Yersinia pseudotuberculosis IP 31758 .....................................  125  2 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Alcanivorax borkumensis SK2 ..............................................  124  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Pseudoalteromonas atlantica T6c ..........................................  124  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Photorhabdus luminescens subsp. laumondii ................................  124  1 hit  [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Escherichia coli O157:H7 .................................................  123  5 hits [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Pasteurella multocida ....................................................  123  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xylella fastidiosa Temecula1 .............................................  122  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Xylella fastidiosa .......................................................  120  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Sodalis glossinidius str. 'morsitans' ....................................  120  1 hit  [enterobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . uncultured marine gamma proteobacterium EBAC31A08 ........................  112  1 hit  [g-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . . Escherichia coli SE11 ....................................................   62  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli 55989 ...................................................   62  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Shigella sonnei Ss046 ....................................................   62  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli HS ......................................................   62  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli E24377A .................................................   62  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Proteus sp. LE138 ........................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Shigella flexneri ........................................................   61  2 hits [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli O157:H7 str. EC4115 .....................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli UMN026 ..................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli SMS-3-5 .................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   61  2 hits [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli ATCC 8739 ...............................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Proteus mirabilis HI4320 .................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli IAI1 ....................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica ......................................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Shigella dysenteriae Sd197 ...............................................   61  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli IAI39 ...................................................   60  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli 536 .....................................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli APEC O1 .................................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli UTI89 ...................................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli ED1a ....................................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli S88 .....................................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................   59  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia fergusonii ATCC 35469 ........................................   59  2 hits [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Escherichia coli BW2952 ..................................................   58  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Escherichia coli str. K-12 substr. DH10B .................................   58  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase 
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   58  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Haemophilus influenzae ...................................................   56  2 hits [g-proteobacteria]       RecName: Full=Long-chain-fatty-acid--CoA ligase; AltName: F
. . . . Shigella flexneri 5 str. 8401 ............................................   52  1 hit  [enterobacteria]         RecName: Full=Probable crotonobetaine/carnitine-CoA ligase
. . . . Listonella anguillarum ...................................................   39  1 hit  [g-proteobacteria]       RecName: Full=Protein angR
. . . . Pectobacterium atrosepticum ..............................................   36  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Yersinia pestis Angola ...................................................   35  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Yersinia pseudotuberculosis PB1/+ ........................................   34  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Yersinia pseudotuberculosis YPIII ........................................   34  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Halorhodospira halophila .................................................   34  1 hit  [g-proteobacteria]       RecName: Full=4-coumarate--CoA ligase; Short=4CL; AltName: 
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   33  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Enterobacter sp. 638 .....................................................   32  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Colwellia psychrerythraea 34H ............................................   31  2 hits [g-proteobacteria]       RecName: Full=Lipoprotein-releasing system ATP-binding prot
. . . . Erwinia tasmaniensis .....................................................   31  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   31  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . . Klebsiella pneumoniae 342 ................................................   31  1 hit  [enterobacteria]         RecName: Full=Bifunctional protein aas; Includes: RecName: 
. . . Bdellovibrio bacteriovorus -------------------------------------------------  152  1 hit  [d-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Caulobacter vibrioides .....................................................  143  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhodobacter capsulatus .....................................................  141  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bradyrhizobium japonicum ...................................................  140  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Syntrophobacter fumaroxidans MPOB ..........................................  139  1 hit  [d-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Thiobacillus denitrificans ATCC 25259 ......................................  137  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylocella silvestris BL2 ................................................  136  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bartonella henselae ........................................................  136  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella ovis ATCC 25840 ...................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Magnetococcus sp. MC-1 .....................................................  135  1 hit  [proteobacteria]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bartonella quintana ........................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella suis ATCC 23445 ...................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella suis ..............................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella abortus ...........................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella melitensis biovar Abortus 2308 ....................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella canis ATCC 23365 ..................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella abortus S19 .......................................................  135  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Novosphingobium aromaticivorans DSM 12444 ..................................  134  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Ochrobactrum anthropi ATCC 49188 ...........................................  132  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Parvibaculum lavamentivorans DS-1 ..........................................  132  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bradyrhizobium sp. ORS278 ..................................................  131  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bartonella bacilliformis KC583 .............................................  131  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella melitensis ........................................................  131  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Brucella melitensis ATCC 23457 .............................................  131  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhodopseudomonas palustris BisA53 ..........................................  130  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylobacterium populi BJ001 ..............................................  130  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Beijerinckia indica subsp. indica ATCC 9039 ................................  129  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Agrobacterium rhizogenes ...................................................  129  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Bartonella tribocorum CIP 105476 ...........................................  129  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylobacterium radiotolerans JCM 2831 ....................................  129  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Agrobacterium radiobacter K84 ..............................................  128  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Helicobacter pylori G27 ....................................................  128  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Nitrosomonas europaea ......................................................  128  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Desulfatibacillum alkenivorans AK-01 .......................................  128  1 hit  [d-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Xanthobacter autotrophicus Py2 .............................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Helicobacter pylori ........................................................  127  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhizobium etli CFN 42 ......................................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhizobium etli CIAT 652 ....................................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Mesorhizobium loti .........................................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhizobium sp. NGR234 .......................................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylobacterium chloromethanicum CM4 ......................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Agrobacterium vitis S4 .....................................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylobacterium extorquens PA1 ............................................  127  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Nitrosomonas eutropha C91 ..................................................  127  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Sinorhizobium medicae WSM419 ...............................................  126  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Helicobacter pylori P12 ....................................................  126  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Helicobacter pylori HPAG1 ..................................................  126  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Helicobacter acinonychis str. Sheeba .......................................  125  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Agrobacterium tumefaciens str. C58 .........................................  125  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Rhizobium leguminosarum bv. trifolii WSM2304 ...............................  124  1 hit  [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Methylobacillus flagellatus KT .............................................  124  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Sinorhizobium meliloti .....................................................  124  2 hits [a-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. . . Laribacter hongkongensis HLHK9 .............................................  121  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Chromobacterium violaceum ..................................................  121  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Wolinella succinogenes .....................................................  119  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Campylobacter jejuni subsp. jejuni 81116 ...................................  118  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Campylobacter jejuni .......................................................  117  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Campylobacter jejuni subsp. jejuni 81-176 ..................................  117  1 hit  [e-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Syntrophus aciditrophicus SB ...............................................  116  1 hit  [d-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia sp. 383 .......................................................  109  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Ralstonia eutropha JMP134 ..................................................  108  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia thailandensis E264 ............................................  108  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Ralstonia pickettii 12J ....................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia mallei ........................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia pseudomallei ..................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia pseudomallei 1710b ............................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia mallei NCTC 10247 .............................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia mallei NCTC 10229 .............................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia mallei SAVP1 ..................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia pseudomallei 1106a ............................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia pseudomallei 668 ..............................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Cupriavidus taiwanensis ....................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Ralstonia eutropha H16 .....................................................  107  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Burkholderia phymatum STM815 ...............................................  106  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Cupriavidus metallidurans CH34 .............................................  105  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Herminiimonas arsenicoxydans ...............................................  103  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Ralstonia solanacearum .....................................................  102  1 hit  [b-proteobacteria]       RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . . Thauera aromatica ..........................................................   62  2 hits [b-proteobacteria]       RecName: Full=Benzoate--CoA ligase; AltName: Full=Benzoyl-C
. . . Rhodopseudomonas palustris .................................................   59  1 hit  [a-proteobacteria]       RecName: Full=4-hydroxybenzoate--CoA/benzoate--CoA ligase; 
. . . Rhodobacter sphaeroides 2.4.1 ..............................................   36  1 hit  [a-proteobacteria]       RecName: Full=4-coumarate--CoA ligase; Short=4CL; AltName: 
. . . Rickettsia typhi ...........................................................   30  1 hit  [a-proteobacteria]       RecName: Full=Outer membrane protein B; AltName: Full=rOmp 
. . Chlorobaculum tepidum --------------------------------------------------------  136  1 hit  [green sulfur bacteria]  RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Mycobacterium tuberculosis ...................................................  130  4 hits [high GC Gram+]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Mycobacterium bovis ..........................................................  129  4 hits [high GC Gram+]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Gemmatimonas aurantiaca T-27 .................................................  127  1 hit  [bacteria]               RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Rubrobacter xylanophilus DSM 9941 ............................................  127  1 hit  [high GC Gram+]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Streptomyces coelicolor ......................................................  127  1 hit  [high GC Gram+]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira interrogans serovar Copenhageni ...................................  127  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira borgpetersenii serovar Hardjo-bovis L550 ..........................  126  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira borgpetersenii serovar Hardjo-bovis JB197 .........................  125  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira interrogans .......................................................  125  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .....................  121  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ....................  121  1 hit  [spirochetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Streptomyces avermitilis .....................................................  120  1 hit  [high GC Gram+]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Thermus thermophilus HB27 ....................................................  119  1 hit  [bacteria]               RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Thermus thermophilus HB8 .....................................................  119  1 hit  [bacteria]               RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Synechocystis sp. PCC 6803 ...................................................  116  1 hit  [cyanobacteria]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Thermosynechococcus elongatus BP-1 ...........................................  115  1 hit  [cyanobacteria]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Rhodopirellula baltica .......................................................  110  1 hit  [planctomycetes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Deinococcus radiodurans ......................................................  105  1 hit  [bacteria]               RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Bacillus subtilis ............................................................  103 36 hits [firmicutes]             RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. . Bacillus weihenstephanensis KBAB4 ............................................   87  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus thuringiensis serovar konkukian .....................................   85  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus anthracis (anthrax) .................................................   85  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus anthracis str. A0248 ................................................   85  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus anthracis str. CDC 684 ..............................................   85  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus AH820 ........................................................   85  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus E33L .........................................................   84  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus thuringiensis str. Al Hakam .........................................   84  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus AH187 ........................................................   84  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus Q1 ...........................................................   83  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus ATCC 10987 ...................................................   83  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cereus ATCC 14579 ...................................................   83  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Geobacillus sp. WCH70 ........................................................   80  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus licheniformis ATCC 14580 ............................................   78  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Geobacillus kaustophilus .....................................................   75  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus amyloliquefaciens FZB42 .............................................   75  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Listeria innocua .............................................................   74  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Listeria monocytogenes str. 4b F2365 .........................................   72  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus cytotoxicus NVH 391-98 ..............................................   71  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Listeria monocytogenes .......................................................   71  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus epidermidis RP62A .............................................   61  3 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Lactococcus lactis subsp. lactis .............................................   60  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus epidermidis ATCC 12228 ........................................   58  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Oceanobacillus iheyensis .....................................................   58  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus pumilus SAFR-032 ....................................................   54  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Brevibacillus parabrevis .....................................................   51 24 hits [firmicutes]             RecName: Full=Tyrocidine synthase 2; AltName: Full=Tyrocidi
. . Enterococcus faecalis ........................................................   51  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Bacillus licheniformis .......................................................   51 12 hits [firmicutes]             RecName: Full=Bacitracin synthase 1; Short=BA1; Includes: R
. . Mycobacterium avium subsp. paratuberculosis ..................................   50  1 hit  [high GC Gram+]          RecName: Full=Long-chain-fatty-acid--[acyl-carrier-protein]
. . Mycobacterium sp. MCS ........................................................   49  1 hit  [high GC Gram+]          RecName: Full=Long-chain-fatty-acid--[acyl-carrier-protein]
. . Staphylococcus aureus subsp. aureus MW2 ......................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus MSSA476 ..................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus ........................................................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus COL ......................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus NCTC 8325 ................................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus USA300 ...................................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus str. Newman ..............................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus USA300_TCH1516 ...........................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus N315 .....................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus Mu50 .....................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus Mu3 ......................................   48  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus JH1 ......................................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus JH9 ......................................   48  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus RF122 ..................................................   47  1 hit  [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Staphylococcus aureus subsp. aureus MRSA252 ..................................   46  2 hits [firmicutes]             RecName: Full=2-succinylbenzoate--CoA ligase; AltName: Full
. . Brevibacillus brevis .........................................................   44  5 hits [firmicutes]             RecName: Full=Gramicidin S synthase 2; AltName: Full=Gramic
. . Aneurinibacillus migulanus ...................................................   44  5 hits [firmicutes]             RecName: Full=Gramicidin S synthase 2; AltName: Full=Gramic
. . Staphylococcus haemolyticus JCSC1435 .........................................   43  2 hits [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Listeria monocytogenes HCC23 .................................................   40  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Listeria monocytogenes Clip80459 .............................................   40  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Clostridium scindens .........................................................   40  1 hit  [firmicutes]             RecName: Full=Bile acid-coenzyme A ligase
. . Listeria welshimeri serovar 6b str. SLCC5334 .................................   38  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus mutans .........................................................   38  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus equi subsp. equi 4047 ..........................................   38  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus agalactiae serogroup III .......................................   35  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus agalactiae serogroup V .........................................   35  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus agalactiae serogroup Ia ........................................   35  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Amycolatopsis lactamdurans ...................................................   35  3 hits [high GC Gram+]          RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-
. . Lactobacillus plantarum ......................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae ATCC 700669 .........................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae Taiwan19F-14 ........................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Bacillus cereus B4264 ........................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae .....................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae R6 ..................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae D39 .................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pneumoniae P1031 ...............................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Staphylococcus xylosus .......................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Bacillus cereus G9842 ........................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Bacillus cereus 03BB102 ......................................................   32  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes serotype M3 ...........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes serotype M1 ...........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes serotype M6 ...........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes MGAS9429 ..............................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes NZ131 .................................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes MGAS10750 .............................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes serotype M18 ..........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes MGAS10270 .............................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes str. Manfredo .........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptococcus pyogenes serotype M28 ..........................................   31  1 hit  [firmicutes]             RecName: Full=D-alanine--poly(phosphoribitol) ligase subuni
. . Streptomyces clavuligerus ....................................................   31  1 hit  [high GC Gram+]          RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-
. . Desulfotomaculum reducens MI-1 ...............................................   31  1 hit  [firmicutes]             RecName: Full=Biotin synthase
. . Heliobacterium modesticaldum Ice1 ............................................   30  1 hit  [firmicutes]             RecName: Full=ATP synthase subunit beta; AltName: Full=F-AT
. . Rhodococcus opacus B4 ........................................................   30  1 hit  [high GC Gram+]          RecName: Full=Anthranilate phosphoribosyltransferase
. . Rhodococcus jostii RHA1 ......................................................   30  1 hit  [high GC Gram+]          RecName: Full=Anthranilate phosphoribosyltransferase
. Mus musculus (mouse) -----------------------------------------------------------  222 15 hits [rodents]                RecName: Full=Acyl-CoA synthetase short-chain family member
. Pongo abelii (Orang-utan) ......................................................  215  3 hits [primates]               RecName: Full=Acyl-CoA synthetase short-chain family member
. Bos taurus (cow) ...............................................................  214  6 hits [even-toed ungulates]    RecName: Full=Acyl-CoA synthetase short-chain family member
. Homo sapiens (man) .............................................................  214 17 hits [primates]               RecName: Full=Acyl-CoA synthetase short-chain family member
. Dictyostelium discoideum .......................................................  209  5 hits [cellular slime molds]   RecName: Full=Acyl-CoA synthetase short-chain family member
. Penicillium chrysogenum ........................................................  160  2 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Emericella nidulans ............................................................  153  1 hit  [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Eremothecium gossypii ..........................................................  151  3 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 1; AltName: Full
. Kluyveromyces lactis ...........................................................  150  2 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. Neurospora crassa ..............................................................  150  1 hit  [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Pyrobaculum aerophilum .........................................................  149  1 hit  [crenarchaeotes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Zygosaccharomyces bailii .......................................................  146  1 hit  [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. Candida glabrata ...............................................................  145  3 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. Coprinopsis cinerea okayama7#130 ...............................................  144  1 hit  [basidiomycetes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Coprinopsis cinerea ............................................................  144  1 hit  [basidiomycetes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Saccharomyces cerevisiae (yeast) ...............................................  143  6 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. Debaryomyces hansenii ..........................................................  141  2 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 1; AltName: Full
. Candida albicans ...............................................................  140  3 hits [ascomycetes]            RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full
. Schizosaccharomyces pombe ......................................................  137  3 hits [ascomycetes]            RecName: Full=Probable acetyl-coenzyme A synthetase; AltNam
. Phycomyces blakesleeanus .......................................................  134  1 hit  [fungi]                  RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Pyrobaculum arsenaticum DSM 13514 ..............................................  127  1 hit  [crenarchaeotes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Drosophila melanogaster ........................................................  122  2 hits [flies]                  RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Methanosaeta concilii ..........................................................  119  1 hit  [euryarchaeotes]         RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Cryptosporidium parvum .........................................................  108  1 hit  [apicomplexans]          RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=A
. Rattus norvegicus (brown rat) ..................................................   98 10 hits [rodents]                RecName: Full=Acyl-coenzyme A synthetase ACSM5, mitochondri
. Oryza sativa Japonica Group (Japanese rice) ....................................   82 14 hits [monocots]               RecName: Full=4-coumarate--CoA ligase-like 3
. Arabidopsis thaliana (thale-cress) .............................................   78 14 hits [eudicots]               RecName: Full=4-coumarate--CoA ligase-like 5; AltName: Full
. Luciola cruciata (genji firefly) ...............................................   70  1 hit  [beetles]                RecName: Full=Luciferin 4-monooxygenase; Short=Luciferase
. Photuris pennsylvanica .........................................................   66  1 hit  [beetles]                RecName: Full=Luciferin 4-monooxygenase; Short=Luciferase
. Luciola lateralis ..............................................................   65  1 hit  [beetles]                RecName: Full=Luciferin 4-monooxygenase; Short=Luciferase
. Nicotiana tabacum (tobacco) ....................................................   65  2 hits [eudicots]               RecName: Full=4-coumarate--CoA ligase 1; Short=4CL 1; AltNa
. Pinus taeda ....................................................................   61  1 hit  [conifers]               RecName: Full=4-coumarate--CoA ligase; Short=4CL; AltName: 
. Luciola mingrelica .............................................................   61  1 hit  [beetles]                RecName: Full=Luciferin 4-monooxygenase; Short=Luciferase
. Xenopus laevis (common platanna) ...............................................   59  2 hits [frogs & toads]          RecName: Full=Acyl-CoA synthetase family member 3, mitochon
. Photinus pyralis (North American firefly) ......................................   58  1 hit  [beetles]                RecName: Full=Luciferin 4-monooxygenase; Short=Luciferase
. Petroselinum crispum ...........................................................   55  2 hits [eudicots]               RecName: Full=4-coumarate--CoA ligase 1; Short=4CL 1; AltNa
. Glycine max (soybeans) .........................................................   53  2 hits [eudicots]               RecName: Full=4-coumarate--CoA ligase 1; Short=4CL 1; AltNa
. Caenorhabditis elegans (nematode) ..............................................   53  1 hit  [nematodes]              RecName: Full=Acetoacetyl-CoA synthetase; AltName: Full=Sup
. Danio rerio (zebra fish) .......................................................   53  1 hit  [bony fishes]            RecName: Full=Acyl-CoA synthetase family member 2, mitochon
. Macaca fascicularis (cynomolgus monkey) ........................................   52  2 hits [primates]               RecName: Full=Acyl-CoA synthetase family member 2, mitochon
. Solanum tuberosum (potatoes) ...................................................   50  2 hits [eudicots]               RecName: Full=4-coumarate--CoA ligase 1; Short=4CL 1; AltNa
. Vanilla planifolia .............................................................   48  1 hit  [monocots]               RecName: Full=4-coumarate--CoA ligase; Short=4CL; AltName: 
. Gallus gallus (bantam) .........................................................   45  2 hits [birds]                  RecName: Full=Acetoacetyl-CoA synthetase
. Cochliobolus carbonum ..........................................................   38  2 hits [ascomycetes]            RecName: Full=HC-toxin synthetase; Short=HTS
. Acremonium chrysogenum .........................................................   36  1 hit  [ascomycetes]            RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-
. Fusarium equiseti ..............................................................   34  1 hit  [ascomycetes]            RecName: Full=Enniatin synthetase; Includes: RecName: Full=
. Plasmodium falciparum NF7/Ghana ................................................   31  1 hit  [apicomplexans]          RecName: Full=Octapeptide-repeat antigen; Short=ORA

BLAST

PROTOCOL


1)BLASTp vs SWISSPROT,default NCBI parameters + '1000 Max targuet sequences'


RESULTS ANALYSIS



The results of BLAST show that the our ORF has several homologies with a Acetyl-coenzyme A synthetase. The first sequence has the small E-value, 2e-63, and the highest score, 241, but it is a sequence that is not characterized. Then we have several sequences of Acyl-CoA synthetase, with E-values significants (the smallest is 1e-57 and the score is 222), which probably means that our protein have similar function of the Acetyl-coenzyme A synthetase.

RAW RESULTS


                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P28812.2|Y3568_PSEAE  RecName: Full=Uncharacterized protein...   241    2e-63
sp|Q14DH7.2|ACSS3_MOUSE  RecName: Full=Acyl-CoA synthetase sho...   222    1e-57
sp|Q5REB8.1|ACSS3_PONAB  RecName: Full=Acyl-CoA synthetase sho...   215    2e-55
sp|A7MB45.1|ACSS3_BOVIN  RecName: Full=Acyl-CoA synthetase sho...   214    3e-55
sp|Q9H6R3.1|ACSS3_HUMAN  RecName: Full=Acyl-CoA synthetase sho...   214    3e-55
sp|Q554Z5.1|ACSB_DICDI  RecName: Full=Acyl-CoA synthetase shor...   209    1e-53
sp|P36333.1|ACSA_PENCH  RecName: Full=Acetyl-coenzyme A synthe...   160    5e-39
sp|P16928.2|ACSA_EMENI  RecName: Full=Acetyl-coenzyme A synthe...   153    9e-37
sp|Q6MNF1.1|ACSA_BDEBA  RecName: Full=Acetyl-coenzyme A synthe...   152    2e-36
sp|Q758X0.1|ACS1_ASHGO  RecName: Full=Acetyl-coenzyme A synthe...   151    3e-36
sp|Q9Y7B5.2|ACS2_KLULA  RecName: Full=Acetyl-coenzyme A synthe...   150    5e-36
sp|P16929.2|ACSA_NEUCR  RecName: Full=Acetyl-coenzyme A synthe...   150    6e-36
sp|Q750T7.1|ACS2_ASHGO  RecName: Full=Acetyl-coenzyme A synthe...   149    1e-35
sp|O93730.2|ACSA_PYRAE  RecName: Full=Acetyl-coenzyme A synthe...   149    1e-35
sp|Q96VC7.1|ACS2_ZYGBA  RecName: Full=Acetyl-coenzyme A synthe...   146    1e-34
sp|Q6FXI2.1|ACS2_CANGA  RecName: Full=Acetyl-coenzyme A synthe...   145    2e-34
sp|Q6FLU2.1|ACS1_CANGA  RecName: Full=Acetyl-coenzyme A synthe...   144    4e-34
sp|A8PDE3.1|ACSA_COPC7  RecName: Full=Acetyl-coenzyme A synthe...   144    5e-34
sp|O13440.1|ACSA_COPCI  RecName: Full=Acetyl-coenzyme A synthe...   144    5e-34
sp|O60011.2|ACS1_KLULA  RecName: Full=Acetyl-coenzyme A synthe...   144    6e-34
sp|P52910.1|ACS2_YEAST  RecName: Full=Acetyl-coenzyme A synthe...   143    6e-34
sp|Q9A2I0.1|ACSA_CAUCR  RecName: Full=Acetyl-coenzyme A synthe...   143    9e-34
sp|Q01574.2|ACS1_YEAST  RecName: Full=Acetyl-coenzyme A synthe...   142    1e-33
sp|P55912.2|PRPE_SALTY  RecName: Full=Propionate--CoA ligase; ...   141    3e-33
sp|O68040.1|ACSA_RHOCA  RecName: Full=Acetyl-coenzyme A synthe...   141    3e-33
sp|Q6BQF2.1|ACS1_DEBHA  RecName: Full=Acetyl-coenzyme A synthe...   141    3e-33
sp|Q8NJN3.2|ACS2_CANAL  RecName: Full=Acetyl-coenzyme A synthe...   140    5e-33
sp|Q89WV5.2|ACSA_BRAJA  RecName: Full=Acetyl-coenzyme A synthe...   140    8e-33
sp|A1U2S9.1|ACSA_MARAV  RecName: Full=Acetyl-coenzyme A synthe...   139    1e-32
sp|A0LG91.1|ACSA_SYNFM  RecName: Full=Acetyl-coenzyme A synthe...   139    2e-32
sp|Q3SLF4.1|ACSA_THIDA  RecName: Full=Acetyl-coenzyme A synthe...   137    5e-32
sp|P78773.2|ACSA_SCHPO  RecName: Full=Probable acetyl-coenzyme...   137    6e-32
sp|Q8KBY0.2|ACSA_CHLTE  RecName: Full=Acetyl-coenzyme A synthe...   136    8e-32
sp|B8EPJ0.1|ACSA_METSB  RecName: Full=Acetyl-coenzyme A synthe...   136    8e-32
sp|Q6G1W0.1|ACSA_BARHE  RecName: Full=Acetyl-coenzyme A synthe...   136    1e-31
sp|A5VSF3.1|ACSA_BRUO2  RecName: Full=Acetyl-coenzyme A synthe...   135    1e-31
sp|A0L576.1|ACSA_MAGSM  RecName: Full=Acetyl-coenzyme A synthe...   135    2e-31
sp|Q6FYL4.1|ACSA_BARQU  RecName: Full=Acetyl-coenzyme A synthe...   135    2e-31
sp|Q0AAW0.1|ACSA_ALHEH  RecName: Full=Acetyl-coenzyme A synthe...   135    2e-31
sp|A9WWT6.1|ACSA_BRUSI  RecName: Full=Acetyl-coenzyme A synthe...   135    2e-31
sp|Q8FYQ3.1|ACSA_BRUSU  RecName: Full=Acetyl-coenzyme A synthe...   135    3e-31
sp|P77495.1|PRPE_ECOLI  RecName: Full=Propionate--CoA ligase; ...   134    3e-31
sp|Q2G512.1|ACSA_NOVAD  RecName: Full=Acetyl-coenzyme A synthe...   134    4e-31
sp|Q6BS00.1|ACS2_DEBHA  RecName: Full=Acetyl-coenzyme A synthe...   134    4e-31
sp|O94049.1|ACS1_CANAL  RecName: Full=Acetyl-coenzyme A synthe...   134    5e-31
sp|Q01576.1|ACSA_PHYBL  RecName: Full=Acetyl-coenzyme A synthe...   134    6e-31
sp|A6WXV8.1|ACSA_OCHA4  RecName: Full=Acetyl-coenzyme A synthe...   132    1e-30
sp|A7HSR8.1|ACSA_PARL1  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q7MGU3.2|ACSA_VIBVY  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q87KU7.1|ACSA_VIBPA  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q8DCZ9.1|ACSA_VIBVU  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q084J4.1|ACSA_SHEFN  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q8EDK3.1|ACSA_SHEON  RecName: Full=Acetyl-coenzyme A synthe...   132    2e-30
sp|Q0HHN4.1|ACSA_SHESM  RecName: Full=Acetyl-coenzyme A synthe...   131    2e-30
sp|Q0HTY6.1|ACSA_SHESR  RecName: Full=Acetyl-coenzyme A synthe...   131    2e-30
sp|A4YK73.1|ACSA_BRASO  RecName: Full=Acetyl-coenzyme A synthe...   131    2e-30
sp|A0KY83.1|ACSA_SHESA  RecName: Full=Acetyl-coenzyme A synthe...   131    2e-30
sp|A1UR36.1|ACSA_BARBK  RecName: Full=Acetyl-coenzyme A synthe...   131    3e-30
sp|Q8YJ48.2|ACSA_BRUME  RecName: Full=Acetyl-coenzyme A synthe...   131    3e-30
sp|C0RF62.1|ACSA_BRUMB  RecName: Full=Acetyl-coenzyme A synthe...   131    3e-30
sp|Q8PF09.1|ACSA_XANAC  RecName: Full=Acetyl-coenzyme A synthe...   130    4e-30
sp|A3QD52.1|ACSA_SHELP  RecName: Full=Acetyl-coenzyme A synthe...   130    4e-30
sp|A0KNI2.1|ACSA_AERHH  RecName: Full=Acetyl-coenzyme A synthe...   130    4e-30
sp|A1SZA2.1|ACSA_PSYIN  RecName: Full=Acetyl-coenzyme A synthe...   130    5e-30
sp|Q07VK4.1|ACSA_RHOP5  RecName: Full=Acetyl-coenzyme A synthe...   130    5e-30
sp|A4SJM6.1|ACSA_AERS4  RecName: Full=Acetyl-coenzyme A synthe...   130    5e-30
sp|Q8P3L1.1|ACSA_XANCP  RecName: Full=Acetyl-coenzyme A synthe...   130    6e-30
sp|B1ZB59.1|ACSA_METPB  RecName: Full=Acetyl-coenzyme A synthe...   130    8e-30
sp|O69635.1|ACSA_MYCTU  RecName: Full=Acetyl-coenzyme A synthe...   130    8e-30
sp|A1RIK1.1|ACSA_SHESW  RecName: Full=Acetyl-coenzyme A synthe...   129    9e-30
sp|A4Y7Y7.1|ACSA_SHEPC  RecName: Full=Acetyl-coenzyme A synthe...   129    9e-30
sp|A8G8G7.1|ACSA_SERP5  RecName: Full=Acetyl-coenzyme A synthe...   129    9e-30
sp|P59871.1|ACSA_MYCBO  RecName: Full=Acetyl-coenzyme A synthe...   129    1e-29
sp|B2IB12.1|ACSA_BEII9  RecName: Full=Acetyl-coenzyme A synthe...   129    1e-29
sp|Q9KWA3.1|ACSA_AGRRH  RecName: Full=Acetyl-coenzyme A synthe...   129    1e-29
sp|Q6LLZ1.1|ACSA_PHOPR  RecName: Full=Acetyl-coenzyme A synthe...   129    1e-29
sp|A3D3E8.1|ACSA_SHEB5  RecName: Full=Acetyl-coenzyme A synthe...   129    1e-29
sp|A9KY56.1|ACSA_SHEB9  RecName: Full=Acetyl-coenzyme A synthe...   129    2e-29
sp|A9IYZ3.1|ACSA_BART1  RecName: Full=Acetyl-coenzyme A synthe...   129    2e-29
sp|B1M0M1.1|ACSA_METRJ  RecName: Full=Acetyl-coenzyme A synthe...   129    2e-29
sp|B9JEV4.1|ACSA_AGRRK  RecName: Full=Acetyl-coenzyme A synthe...   128    2e-29
sp|B5Z6E9.1|ACSA_HELPG  RecName: Full=Acetyl-coenzyme A synthe...   128    2e-29
sp|Q82SI5.1|ACSA_NITEU  RecName: Full=Acetyl-coenzyme A synthe...   128    3e-29
sp|B8FIN2.1|ACSA_DESAA  RecName: Full=Acetyl-coenzyme A synthe...   128    3e-29
sp|A6VZN8.1|ACSA_MARMS  RecName: Full=Acetyl-coenzyme A synthe...   128    3e-29
sp|A1JIK3.1|ACSA_YERE8  RecName: Full=Acetyl-coenzyme A synthe...   128    3e-29
sp|Q2NXE2.1|ACSA_XANOM  RecName: Full=Acetyl-coenzyme A synthe...   127    3e-29
sp|A4WJG1.1|ACSA_PYRAR  RecName: Full=Acetyl-coenzyme A synthe...   127    3e-29
sp|C1AA44.1|ACSA_GEMAT  RecName: Full=Acetyl-coenzyme A synthe...   127    3e-29
sp|A7IFD4.1|ACSA_XANP2  RecName: Full=Acetyl-coenzyme A synthe...   127    3e-29
sp|Q1AXQ5.1|ACSA_RUBXD  RecName: Full=Acetyl-coenzyme A synthe...   127    3e-29
sp|Q9NR19.1|ACSA_HUMAN  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|Q12MK0.1|ACSA_SHEDO  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|O25686.1|ACSA_HELPY  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|A8AN29.1|ACSA_CITK8  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|Q2K2T1.1|ACSA_RHIEC  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|B3PS41.1|ACSA_RHIE6  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|Q98ET8.1|ACSA_RHILO  RecName: Full=Acetyl-coenzyme A synthe...   127    4e-29
sp|Q21LV0.1|ACSA_SACD2  RecName: Full=Acetyl-coenzyme A synthe...   127    5e-29
sp|C3MAS0.1|ACSA_RHISN  RecName: Full=Acetyl-coenzyme A synthe...   127    5e-29
sp|A1S7C8.1|ACSA_SHEAM  RecName: Full=Acetyl-coenzyme A synthe...   127    5e-29
sp|Q9X928.1|ACSA_STRCO  RecName: Full=Acetyl-coenzyme A synthe...   127    5e-29
sp|B7KPN8.1|ACSA_METC4  RecName: Full=Acetyl-coenzyme A synthe...   127    5e-29
sp|B9JV43.1|ACSA_AGRVS  RecName: Full=Acetyl-coenzyme A synthe...   127    6e-29
sp|A9W5V0.1|ACSA_METEP  RecName: Full=Acetyl-coenzyme A synthe...   127    6e-29
sp|Q0AFF1.1|ACSA_NITEC  RecName: Full=Acetyl-coenzyme A synthe...   127    6e-29
sp|Q72LY9.1|ACSA_LEPIC  RecName: Full=Acetyl-coenzyme A synthe...   127    7e-29
sp|A6UED8.1|ACSA_SINMW  RecName: Full=Acetyl-coenzyme A synthe...   126    7e-29
sp|A7MPJ7.1|ACSA_ENTS8  RecName: Full=Acetyl-coenzyme A synthe...   126    8e-29
sp|A8FUF1.1|ACSA_SHESH  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|A8H5P1.1|ACSA_SHEPA  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|B0TPY4.1|ACSA_SHEHH  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|Q8D1G8.2|ACSA_YERPE  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|B6JKX8.1|ACSA_HELP2  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|Q056J9.1|ACSA_LEPBL  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|Q1CUA3.1|ACSA_HELPH  RecName: Full=Acetyl-coenzyme A synthe...   126    1e-28
sp|Q04P35.1|ACSA_LEPBJ  RecName: Full=Acetyl-coenzyme A synthe...   125    1e-28
sp|Q9KV59.2|ACSA_VIBCH  RecName: Full=Acetyl-coenzyme A synthe...   125    1e-28
sp|Q8FAY8.1|ACSA_ECOL6  RecName: Full=Acetyl-coenzyme A synthe...   125    1e-28
sp|P27550.2|ACSA_ECOLI  RecName: Full=Acetyl-coenzyme A synthe...   125    1e-28
sp|Q8ZKF6.1|ACSA_SALTY  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q8Z1R0.1|ACSA_SALTI  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q17WR1.1|ACSA_HELAH  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q8UBV5.2|ACSA_AGRT5  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q9I558.1|ACSA1_PSEAE  RecName: Full=Acetyl-coenzyme A synth...   125    2e-28
sp|A1WY97.1|ACSA_HALHL  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q8EYG2.1|ACSA_LEPIN  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q3IFM6.1|ACSA_PSEHT  RecName: Full=Acetyl-coenzyme A synthe...   125    2e-28
sp|Q66FM8.1|ACSA_YERPS  RecName: Full=Acetyl-coenzyme A synthe...   125    3e-28
sp|B5ZV36.1|ACSA_RHILW  RecName: Full=Acetyl-coenzyme A synthe...   124    3e-28
sp|Q0VSR6.1|ACSA_ALCBS  RecName: Full=Acetyl-coenzyme A synthe...   124    3e-28
sp|Q88EH6.1|ACSA1_PSEPK  RecName: Full=Acetyl-coenzyme A synth...   124    3e-28
sp|Q15YI8.1|ACSA_PSEA6  RecName: Full=Acetyl-coenzyme A synthe...   124    4e-28
sp|Q7MBA6.1|ACSA_PHOLL  RecName: Full=Acetyl-coenzyme A synthe...   124    5e-28
sp|Q1H0J2.1|ACSA_METFK  RecName: Full=Acetyl-coenzyme A synthe...   124    6e-28
sp|Q92KX2.1|ACSA2_RHIME  RecName: Full=Acetyl-coenzyme A synth...   124    6e-28
sp|Q8X5T5.1|ACSA_ECO57  RecName: Full=Acetyl-coenzyme A synthe...   123    7e-28
sp|Q9CMW1.1|ACSA_PASMU  RecName: Full=Acetyl-coenzyme A synthe...   123    7e-28
sp|Q9VP61.1|ACSA_DROME  RecName: Full=Acetyl-coenzyme A synthe...   122    1e-27
sp|Q87C00.1|ACSA_XYLFT  RecName: Full=Acetyl-coenzyme A synthe...   122    2e-27
sp|Q4FVA1.1|ACSA_PSYA2  RecName: Full=Acetyl-coenzyme A synthe...   121    3e-27
sp|C1D6V9.1|ACSA_LARHH  RecName: Full=Acetyl-coenzyme A synthe...   121    3e-27
sp|Q7NSY7.1|ACSA_CHRVO  RecName: Full=Acetyl-coenzyme A synthe...   121    3e-27
sp|B0S8X7.1|ACSA_LEPBA  RecName: Full=Acetyl-coenzyme A synthe...   121    4e-27
sp|Q9QXG4.1|ACSA_MOUSE  RecName: Full=Acetyl-coenzyme A synthe...   120    4e-27
sp|Q1QEB6.1|ACSA_PSYCK  RecName: Full=Acetyl-coenzyme A synthe...   120    4e-27
sp|Q9PB89.1|ACSA_XYLFA  RecName: Full=Acetyl-coenzyme A synthe...   120    5e-27
sp|Q885K7.1|ACSA_PSESM  RecName: Full=Acetyl-coenzyme A synthe...   120    5e-27
sp|Q2NR28.1|ACSA_SODGM  RecName: Full=Acetyl-coenzyme A synthe...   120    5e-27
sp|Q9NUB1.2|ACS2L_HUMAN  RecName: Full=Acetyl-coenzyme A synth...   120    5e-27
sp|Q54Z60.1|ACSA_DICDI  RecName: Full=Acetyl-coenzyme A synthe...   120    7e-27
sp|Q82EL5.1|ACSA_STRAW  RecName: Full=Acetyl-coenzyme A synthe...   120    7e-27
sp|Q72J95.1|ACSA_THET2  RecName: Full=Acetyl-coenzyme A synthe...   119    1e-26
sp|Q5SIW6.1|ACSA_THET8  RecName: Full=Acetyl-coenzyme A synthe...   119    1e-26
sp|Q7M9Y2.1|ACSA_WOLSU  RecName: Full=Acetyl-coenzyme A synthe...   119    2e-26
sp|P27095.1|ACSA_METSO  RecName: Full=Acetyl-coenzyme A synthe...   119    2e-26
sp|Q4ZQG8.1|ACSA_PSEU2  RecName: Full=Acetyl-coenzyme A synthe...   118    2e-26
sp|A8FNJ7.1|ACSA_CAMJ8  RecName: Full=Acetyl-coenzyme A synthe...   118    3e-26
sp|Q48G09.1|ACSA_PSE14  RecName: Full=Acetyl-coenzyme A synthe...   118    3e-26
sp|Q9HV66.1|ACSA2_PSEAE  RecName: Full=Acetyl-coenzyme A synth...   117    3e-26
sp|Q9PMD2.1|ACSA_CAMJE  RecName: Full=Acetyl-coenzyme A synthe...   117    4e-26
sp|Q99NB1.1|ACS2L_MOUSE  RecName: Full=Acetyl-coenzyme A synth...   117    6e-26
sp|Q55404.1|ACSA_SYNY3  RecName: Full=Acetyl-coenzyme A synthe...   116    7e-26
sp|Q2LW77.1|ACSA_SYNAS  RecName: Full=Acetyl-coenzyme A synthe...   116    1e-25
sp|Q8DKH2.1|ACSA_THEEB  RecName: Full=Acetyl-coenzyme A synthe...   115    2e-25
sp|Q9F7R5.1|ACSA_PRB01  RecName: Full=Acetyl-coenzyme A synthe...   112    1e-24
sp|P59872.1|ACSA_RHOBA  RecName: Full=Acetyl-coenzyme A synthe...   110    4e-24
sp|Q88DW6.1|ACSA2_PSEPK  RecName: Full=Acetyl-coenzyme A synth...   110    6e-24
sp|A4VKA0.1|ACSA_PSEU5  RecName: Full=Acetyl-coenzyme A synthe...   109    1e-23
sp|Q39EK2.1|ACSA_BURS3  RecName: Full=Acetyl-coenzyme A synthe...   109    1e-23
sp|Q46Z41.1|ACSA_RALEJ  RecName: Full=Acetyl-coenzyme A synthe...   108    2e-23
sp|Q27549.1|ACSA_CRYPV  RecName: Full=Acetyl-coenzyme A synthe...   108    2e-23
sp|Q2T3N9.1|ACSA_BURTA  RecName: Full=Acetyl-coenzyme A synthe...   108    3e-23
sp|B2U6V1.1|ACSA_RALPJ  RecName: Full=Acetyl-coenzyme A synthe...   107    4e-23
sp|Q62AD1.1|ACSA_BURMA  RecName: Full=Acetyl-coenzyme A synthe...   107    4e-23
sp|B3R1X2.1|ACSA_CUPTR  RecName: Full=Acetyl-coenzyme A synthe...   107    5e-23
sp|P31638.1|ACSA_RALEH  RecName: Full=Acetyl-coenzyme A synthe...   107    5e-23
sp|B2JD61.1|ACSA_BURP8  RecName: Full=Acetyl-coenzyme A synthe...   106    1e-22
sp|Q9RRL7.1|ACSA_DEIRA  RecName: Full=Acetyl-coenzyme A synthe...   105    3e-22
sp|Q1LL27.1|ACSA_RALME  RecName: Full=Acetyl-coenzyme A synthe...   105    3e-22
sp|P39062.1|ACSA_BACSU  RecName: Full=Acetyl-coenzyme A synthe...   103    6e-22
sp|A4G3L8.1|ACSA_HERAR  RecName: Full=Acetyl-coenzyme A synthe...   103    7e-22
sp|Q8XY11.1|ACSA_RALSO  RecName: Full=Acetyl-coenzyme A synthe...   102    2e-21
sp|Q8BGA8.1|ACSM5_MOUSE  RecName: Full=Acyl-coenzyme A synthet...  99.4    1e-20
sp|Q3UNX5.2|ACSM3_MOUSE  RecName: Full=Acyl-coenzyme A synthet...  99.4    1e-20
sp|Q6AYT9.1|ACSM5_RAT  RecName: Full=Acyl-coenzyme A synthetas...  99.0    2e-20
sp|Q5REV5.1|ACSM3_PONAB  RecName: Full=Acyl-coenzyme A synthet...  98.6    2e-20
sp|Q53FZ2.2|ACSM3_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  97.8    4e-20
sp|Q9BEA2.2|ACSM1_BOVIN  RecName: Full=Acyl-coenzyme A synthet...  96.7    9e-20
sp|Q08AH1.1|ACSM1_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  96.3    1e-19
sp|C0SPB0.1|YTCI_BACSU  RecName: Full=Uncharacterized acyl--Co...  96.3    1e-19
sp|Q6SKG1.1|ACSM3_RAT  RecName: Full=Acyl-coenzyme A synthetas...  95.1    3e-19
sp|Q6NUN0.2|ACSM5_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  95.1    3e-19
sp|A9VM74.1|MENE_BACWK  RecName: Full=2-succinylbenzoate--CoA ...  87.4    5e-17
sp|Q91VA0.1|ACSM1_MOUSE  RecName: Full=Acyl-coenzyme A synthet...  87.0    7e-17
sp|P0C7M7.1|ACSM4_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  85.9    1e-16
sp|Q6HC29.1|MENE_BACHK  RecName: Full=2-succinylbenzoate--CoA ...  85.5    2e-16
sp|Q81K97.1|MENE_BACAN  RecName: Full=2-succinylbenzoate--CoA ...  85.5    2e-16
sp|C3PCK3.1|MENE_BACAA  RecName: Full=2-succinylbenzoate--CoA ...  85.5    2e-16
sp|P94547.1|LCFA_BACSU  RecName: Full=Long-chain-fatty-acid--C...  85.5    2e-16
sp|B7JDD6.1|MENE_BACC0  RecName: Full=2-succinylbenzoate--CoA ...  85.1    3e-16
sp|Q632I5.1|MENE_BACCZ  RecName: Full=2-succinylbenzoate--CoA ...  84.7    3e-16
sp|A0RK73.1|MENE_BACAH  RecName: Full=2-succinylbenzoate--CoA ...  84.7    4e-16
sp|B7HTW3.1|MENE_BACC7  RecName: Full=2-succinylbenzoate--CoA ...  84.7    4e-16
sp|B9J2F2.1|MENE_BACCQ  RecName: Full=2-succinylbenzoate--CoA ...  83.6    8e-16
sp|Q72YK9.1|MENE_BACC1  RecName: Full=2-succinylbenzoate--CoA ...  83.6    8e-16
sp|Q816I1.1|MENE_BACCR  RecName: Full=2-succinylbenzoate--CoA ...  83.6    8e-16
sp|Q7TN78.1|ACSM4_RAT  RecName: Full=Acyl-coenzyme A synthetas...  82.4    2e-15
sp|Q80W40.1|ACSM4_MOUSE  RecName: Full=Acyl-coenzyme A synthet...  82.4    2e-15
sp|Q08AH3.2|ACS2A_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  82.4    2e-15
sp|Q6YYZ2.1|4CLL3_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  82.0    2e-15
sp|Q68CK6.1|ACS2B_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  81.6    3e-15
sp|Q7XXL2.2|4CLL9_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  81.3    4e-15
sp|C5D6U5.1|MENE_GEOSW  RecName: Full=2-succinylbenzoate--CoA ...  80.5    7e-15
sp|Q84P21.2|4CLL5_ARATH  RecName: Full=4-coumarate--CoA ligase...  79.0    2e-14
sp|Q65FT5.1|MENE_BACLD  RecName: Full=2-succinylbenzoate--CoA ...  78.6    2e-14
sp|Q84P24.2|4CLL6_ARATH  RecName: Full=4-coumarate--CoA ligase...  77.8    5e-14
sp|P23971.2|MENE_BACSU  RecName: Full=2-succinylbenzoate--CoA ...  77.0    7e-14
sp|Q10S72.1|4CLL4_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  77.0    7e-14
sp|Q5KVX9.1|MENE_GEOKA  RecName: Full=2-succinylbenzoate--CoA ...  75.9    2e-13
sp|A7Z809.1|MENE_BACA2  RecName: Full=2-succinylbenzoate--CoA ...  75.5    2e-13
sp|Q84P25.2|4CLL2_ARATH  RecName: Full=4-coumarate--CoA ligase...  75.1    3e-13
sp|Q92AY8.2|MENE_LISIN  RecName: Full=2-succinylbenzoate--CoA ...  74.7    4e-13
sp|P0C5B6.1|4CLL4_ARATH  RecName: Full=4-coumarate--CoA ligase...  74.7    4e-13
sp|Q8K0L3.1|ACSM2_MOUSE  RecName: Full=Acyl-coenzyme A synthet...  74.3    5e-13
sp|Q54P78.1|4CL2_DICDI  RecName: Full=Probable 4-coumarate--Co...  73.9    6e-13
sp|O70490.2|ACSM2_RAT  RecName: Full=Acyl-coenzyme A synthetas...  73.6    8e-13
sp|P96575.2|YDAB_BACSU  RecName: Full=Putative acyl--CoA ligas...  73.2    1e-12
sp|Q54P79.2|4CL3_DICDI  RecName: Full=Probable 4-coumarate--Co...  72.8    1e-12
sp|P38137.1|FAT2_YEAST  RecName: Full=Peroxisomal-coenzyme A s...  72.4    2e-12
sp|Q71YZ5.1|MENE_LISMF  RecName: Full=2-succinylbenzoate--CoA ...  72.4    2e-12
sp|A7GU88.1|MENE_BACCN  RecName: Full=2-succinylbenzoate--CoA ...  71.6    3e-12
sp|P58730.2|MENE_LISMO  RecName: Full=2-succinylbenzoate--CoA ...  71.6    3e-12
sp|Q54P77.1|4CL1_DICDI  RecName: Full=Probable 4-coumarate--Co...  71.2    4e-12
sp|P13129.1|LUCI_LUCCR  RecName: Full=Luciferin 4-monooxygenas...  70.1    1e-11
sp|Q84P26.2|4CLL8_ARATH  RecName: Full=4-coumarate--CoA ligase...  69.7    1e-11
sp|Q9S777.1|4CL3_ARATH  RecName: Full=4-coumarate--CoA ligase ...  69.7    1e-11
sp|Q3E6Y4.2|4CLL3_ARATH  RecName: Full=4-coumarate--CoA ligase...  69.7    1e-11
sp|Q3URE1.2|ACSF3_MOUSE  RecName: Full=Acyl-CoA synthetase fam...  68.9    2e-11
sp|Q9M0X9.1|4CLL7_ARATH  RecName: Full=4-coumarate--CoA ligase...  68.6    3e-11
sp|Q8GVF9.1|4CLL8_ORYSJ  RecName: Full=Putative 4-coumarate--C...  68.6    3e-11
sp|Q7F1X5.1|4CLL5_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  67.4    6e-11
sp|P17814.2|4CL1_ORYSJ  RecName: Full=Probable 4-coumarate--Co...  67.4    6e-11
sp|Q42982.2|4CL2_ORYSJ  RecName: Full=Probable 4-coumarate--Co...  67.4    6e-11
sp|Q58DN7.1|ACSF3_BOVIN  RecName: Full=Acyl-CoA synthetase fam...  67.4    7e-11
sp|O07610.2|LCFB_BACSU  RecName: Full=Long-chain-fatty-acid--C...  67.0    8e-11
sp|Q4G176.2|ACSF3_HUMAN  RecName: Full=Acyl-CoA synthetase fam...  66.6    9e-11
sp|Q27757.2|LUCI_PHOPE  RecName: Full=Luciferin 4-monooxygenas...  66.2    1e-10
sp|Q9LU36.1|4CL4_ARATH  RecName: Full=4-coumarate--CoA ligase ...  66.2    1e-10
sp|P38135.3|FADK_ECOLI  RecName: Full=Short-chain-fatty-acid--...  66.2    1e-10
sp|Q84P23.2|4CLL9_ARATH  RecName: Full=4-coumarate--CoA ligase...  65.9    2e-10
sp|Q01158.1|LUCI_LUCLA  RecName: Full=Luciferin 4-monooxygenas...  65.1    3e-10
sp|O24145.1|4CL1_TOBAC  RecName: Full=4-coumarate--CoA ligase ...  65.1    3e-10
sp|Q69RG7.1|4CLL7_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  64.7    3e-10
sp|Q8RU95.2|4CLL6_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  63.5    1e-09
sp|Q8GQN9.1|BCLA_THAAR  RecName: Full=Benzoate--CoA ligase; Al...  62.8    1e-09
sp|B6HYY8.2|CAIC_ECOSE  RecName: Full=Probable crotonobetaine/...  62.8    2e-09
sp|B7L4G0.2|CAIC_ECO55  RecName: Full=Probable crotonobetaine/...  62.8    2e-09
sp|Q3Z5X2.2|CAIC_SHISS  RecName: Full=Probable crotonobetaine/...  62.4    2e-09
sp|A7ZVY7.2|CAIC_ECOHS  RecName: Full=Probable crotonobetaine/...  62.4    2e-09
sp|Q0DV32.2|4CLL1_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  62.4    2e-09
sp|A7ZHC8.2|CAIC_ECO24  RecName: Full=Probable crotonobetaine/...  62.4    2e-09
sp|Q8ZES9.1|LCFA_YERPE  RecName: Full=Long-chain-fatty-acid--C...  62.4    2e-09
sp|Q6ETN3.1|4CL3_ORYSJ  RecName: Full=Probable 4-coumarate--Co...  62.0    2e-09
sp|Q8GB18.1|CAIC_PROSL  RecName: Full=Probable crotonobetaine/...  61.6    3e-09
sp|P41636.1|4CL_PINTA  RecName: Full=4-coumarate--CoA ligase; ...  61.6    3e-09
sp|Q83MG9.2|CAIC_SHIFL  RecName: Full=Probable crotonobetaine/...  61.6    3e-09
sp|Q8XA34.2|CAIC_ECO57  RecName: Full=Probable crotonobetaine/...  61.6    3e-09
sp|Q5HNB2.1|MENE_STAEQ  RecName: Full=2-succinylbenzoate--CoA ...  61.6    3e-09
sp|Q26304.1|LUCI_LUCMI  RecName: Full=Luciferin 4-monooxygenas...  61.6    3e-09
sp|B7N7R2.2|CAIC_ECOLU  RecName: Full=Probable crotonobetaine/...  61.6    4e-09
sp|B5F750.1|CAIC_SALA4  RecName: Full=Probable crotonobetaine/...  61.6    4e-09
sp|B5R1R0.1|CAIC_SALEP  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|Q8ZRX4.1|CAIC_SALTY  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B1LFX0.1|CAIC_ECOSM  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B4TWR4.1|CAIC_SALSV  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B5FHG5.1|CAIC_SALDC  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B4T6J6.1|CAIC_SALNS  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|Q8Z9L4.1|CAIC_SALTI  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|A9MYJ6.1|CAIC_SALPB  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B1IRD9.2|CAIC_ECOLC  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B4EY25.1|CAIC_PROMH  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|B7M0D4.2|CAIC_ECO8A  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|Q57TJ0.1|CAIC_SALCH  RecName: Full=Probable crotonobetaine/...  61.2    4e-09
sp|C0Q4L3.1|CAIC_SALPC  RecName: Full=Probable crotonobetaine/...  61.2    5e-09
sp|Q5PIL0.1|CAIC_SALPA  RecName: Full=Probable crotonobetaine/...  61.2    5e-09
sp|Q32K60.2|CAIC_SHIDS  RecName: Full=Probable crotonobetaine/...  61.2    5e-09
sp|B7NHE1.2|CAIC_ECO7I  RecName: Full=Probable crotonobetaine/...  60.8    6e-09
sp|Q9CHK3.2|MENE_LACLA  RecName: Full=2-succinylbenzoate--CoA ...  60.5    6e-09
sp|Q336M7.3|4CLL2_ORYSJ  RecName: Full=4-coumarate--CoA ligase...  60.5    7e-09
sp|P63522.1|LCFA_SALTI  RecName: Full=Long-chain-fatty-acid--C...  60.5    8e-09
sp|Q67W82.1|4CL4_ORYSJ  RecName: Full=Probable 4-coumarate--Co...  60.1    9e-09
sp|P69451.1|LCFA_ECOLI  RecName: Full=Long-chain-fatty-acid--C...  60.1    1e-08
sp|A8ALR6.1|CAIC_CITK8  RecName: Full=Probable crotonobetaine/...  60.1    1e-08
sp|Q0TLV2.2|CAIC_ECOL5  RecName: Full=Probable crotonobetaine/...  59.7    1e-08
sp|A1A787.2|CAIC_ECOK1  RecName: Full=Probable crotonobetaine/...  59.7    1e-08
sp|B7MNP4.2|CAIC_ECO81  RecName: Full=Probable crotonobetaine/...  59.7    1e-08
sp|B7MAG0.2|CAIC_ECO45  RecName: Full=Probable crotonobetaine/...  59.7    1e-08
sp|Q53005.1|4HBCL_RHOPA  RecName: Full=4-hydroxybenzoate--CoA/...  59.7    1e-08
sp|Q8XDR6.1|LCFA_ECO57  RecName: Full=Long-chain-fatty-acid--C...  59.7    1e-08
sp|Q9S725.2|4CL2_ARATH  RecName: Full=4-coumarate--CoA ligase ...  59.7    1e-08
sp|B7UI83.1|CAIC_ECO27  RecName: Full=Probable crotonobetaine/...  59.7    1e-08
sp|B7LWM8.2|CAIC_ESCF3  RecName: Full=Probable crotonobetaine/...  59.3    1e-08
sp|O74976.1|FAT2_SCHPO  RecName: Full=Putative peroxisomal-coe...  59.3    2e-08
sp|O07899.1|VIBE_VIBCH  RecName: Full=Vibriobactin-specific 2,...  59.3    2e-08
sp|Q6GLK6.1|ACSF3_XENLA  RecName: Full=Acyl-CoA synthetase fam...  59.3    2e-08
sp|Q8CS21.1|MENE_STAES  RecName: Full=2-succinylbenzoate--CoA ...  58.9    2e-08
sp|P31552.2|CAIC_ECOLI  RecName: Full=Probable crotonobetaine/...  58.2    3e-08
sp|A9MQH7.1|CAIC_SALAR  RecName: Full=Probable crotonobetaine/...  58.2    3e-08
sp|P08659.1|LUCI_PHOPY  RecName: Full=Luciferin 4-monooxygenas...  58.2    3e-08
sp|Q8ENZ7.1|MENE_OCEIH  RecName: Full=2-succinylbenzoate--CoA ...  58.2    4e-08
sp|P46450.1|LCFA_HAEIN  RecName: Full=Long-chain-fatty-acid--C...  56.6    1e-07
sp|Q499N5.1|ACSF2_RAT  RecName: Full=Acyl-CoA synthetase famil...  56.6    1e-07
sp|Q00594.1|ALKK_PSEOL  RecName: Full=Medium-chain-fatty-acid-...  55.8    2e-07
sp|Q8VCW8.1|ACSF2_MOUSE  RecName: Full=Acyl-CoA synthetase fam...  55.5    2e-07
sp|P14913.1|4CL2_PETCR  RecName: Full=4-coumarate--CoA ligase ...  55.1    3e-07
sp|A8FGK6.1|MENE_BACP2  RecName: Full=2-succinylbenzoate--CoA ...  54.7    4e-07
sp|O07619.1|YHFT_BACSU  RecName: Full=Uncharacterized acyl--Co...  54.3    5e-07
sp|P14912.1|4CL1_PETCR  RecName: Full=4-coumarate--CoA ligase ...  54.3    5e-07
sp|Q96CM8.2|ACSF2_HUMAN  RecName: Full=Acyl-CoA synthetase fam...  53.9    6e-07
sp|P31686.1|4CL1_SOYBN  RecName: Full=4-coumarate--CoA ligase ...  53.9    8e-07
sp|Q5R9G9.1|ACSF2_PONAB  RecName: Full=Acyl-CoA synthetase fam...  53.5    1e-06
sp|Q9Z3R3.2|ACSA1_RHIME  RecName: Full=Acetoacetyl-coenzyme A ...  53.5    1e-06
sp|Q9LQ12.1|4CLL1_ARATH  RecName: Full=4-coumarate--CoA ligase...  53.5    1e-06
sp|O31826.1|YNGI_BACSU  RecName: Full=Putative acyl-CoA synthe...  53.5    1e-06
sp|P40871.2|DHBE_BACSU  RecName: Full=2,3-dihydroxybenzoate-AM...  53.5    1e-06
sp|Q21166.1|SUR5_CAEEL  RecName: Full=Acetoacetyl-CoA syntheta...  53.1    1e-06
sp|P0A4X8.1|MBTM_MYCTU  RecName: Full=Long-chain-fatty-acid--[...  53.1    1e-06
sp|Q0P4F7.1|ACSF2_DANRE  RecName: Full=Acyl-CoA synthetase fam...  53.1    1e-06
sp|Q0T8F7.3|CAIC_SHIF8  RecName: Full=Probable crotonobetaine/...  52.8    2e-06
sp|P31687.2|4CL2_SOYBN  RecName: Full=4-coumarate--CoA ligase ...  52.4    2e-06
sp|Q4R4Z9.1|ACSF2_MACFA  RecName: Full=Acyl-CoA synthetase fam...  52.4    2e-06
sp|O30408.1|TYCB_BREPA  RecName: Full=Tyrocidine synthase 2; A...  51.6    3e-06
sp|P10378.3|ENTE_ECOLI  RecName: Full=Enterobactin synthase co...  51.2    4e-06
sp|Q838K1.1|MENE_ENTFA  RecName: Full=2-succinylbenzoate--CoA ...  51.2    4e-06
sp|Q8XBV3.1|ENTE_ECO57  RecName: Full=Enterobactin synthase co...  51.2    4e-06
sp|O68006.1|BACA_BACLI  RecName: Full=Bacitracin synthase 1; S...  51.2    4e-06
sp|Q6ZAC1.1|4CL5_ORYSJ  RecName: Full=Probable 4-coumarate--Co...  51.2    5e-06
sp|Q73ZP7.1|MBTM_MYCPA  RecName: Full=Long-chain-fatty-acid--[...  50.8    5e-06
sp|Q6P461.2|ACSM6_HUMAN  RecName: Full=Acyl-coenzyme A synthet...  50.8    6e-06
sp|Q70LM5.1|LGRC_BREPA  RecName: Full=Linear gramicidin syntha...  50.4    7e-06
sp|P31684.1|4CL1_SOLTU  RecName: Full=4-coumarate--CoA ligase ...  50.4    7e-06
sp|P31685.1|4CL2_SOLTU  RecName: Full=4-coumarate--CoA ligase ...  50.4    8e-06
sp|O24146.1|4CL2_TOBAC  RecName: Full=4-coumarate--CoA ligase ...  50.4    8e-06
sp|Q1BBA2.1|MBTM_MYCSS  RecName: Full=Long-chain-fatty-acid--[...  49.7    1e-05
sp|Q70LM6.1|LGRB_BREPA  RecName: Full=Linear gramicidin syntha...  49.3    1e-05
sp|Q9AJS8.1|3HBCL_THAAR  RecName: Full=3-hydroxybenzoate--CoA/...  49.3    2e-05
sp|O24540.1|4CL_VANPL  RecName: Full=4-coumarate--CoA ligase; ...  48.9    2e-05
sp|Q8NVZ4.1|MENE_STAAW  RecName: Full=2-succinylbenzoate--CoA ...  48.5    3e-05
sp|Q53634.1|MENE_STAAU  RecName: Full=2-succinylbenzoate--CoA ...  48.5    3e-05
sp|P63526.1|MENE_STAAN  RecName: Full=2-succinylbenzoate--CoA ...  48.5    3e-05
sp|P40806.3|PKSJ_BACSU  RecName: Full=Polyketide synthase pksJ...  48.1    3e-05
sp|Q2YTP0.1|MENE_STAAB  RecName: Full=2-succinylbenzoate--CoA ...  47.4    7e-05
sp|Q42524.1|4CL1_ARATH  RecName: Full=4-coumarate--CoA ligase ...  47.0    7e-05
sp|Q5HIA1.1|VRAA_STAAC  RecName: Full=Putative long chain fatt...  47.0    7e-05
sp|Q6GFR0.1|MENE_STAAR  RecName: Full=2-succinylbenzoate--CoA ...  46.6    1e-04
sp|P09095.2|TYCA_BREPA  RecName: Full=Tyrocidine synthase 1; A...  46.2    1e-04
sp|Q6GJ94.1|VRAA_STAAR  RecName: Full=Putative long chain fatt...  45.8    2e-04
sp|Q5ZLG0.1|AACS_CHICK  RecName: Full=Acetoacetyl-CoA synthetase   45.8    2e-04
sp|P44565.1|MENE_HAEIN  RecName: Full=2-succinylbenzoate--CoA ...  45.4    3e-04
sp|O68008.1|BACC_BACLI  RecName: Full=Bacitracin synthase 3; S...  45.1    3e-04
sp|P39846.1|PPSB_BACSU  RecName: Full=Plipastatin synthase sub...  45.1    3e-04
sp|P0C064.2|GRSB_BREBE  RecName: Full=Gramicidin S synthase 2;...  44.7    4e-04
sp|P48633.1|HMWP2_YERE8  RecName: Full=High-molecular-weight p...  44.7    4e-04
sp|P0C063.2|GRSB_ANEMI  RecName: Full=Gramicidin S synthase 2;...  44.7    4e-04
sp|P39847.2|PPSC_BACSU  RecName: Full=Plipastatin synthase sub...  44.7    4e-04
sp|O68007.1|BACB_BACLI  RecName: Full=Bacitracin synthase 2; S...  44.3    5e-04
sp|O30409.1|TYCC_BREPA  RecName: Full=Tyrocidine synthase 3; A...  44.3    5e-04
sp|P94459.2|PPSD_BACSU  RecName: Full=Plipastatin synthase sub...  43.9    8e-04
sp|P39845.2|PPSA_BACSU  RecName: Full=Plipastatin synthase sub...  43.9    8e-04
sp|Q4L4U5.1|DLTA_STAHJ  RecName: Full=D-alanine--poly(phosphor...  43.1    0.001
sp|Q17QJ1.1|ACSF2_BOVIN  RecName: Full=Acyl-CoA synthetase fam...  42.7    0.001
sp|Q70LM4.1|LGRD_BREPA  RecName: Full=Linear gramicidin syntha...  42.7    0.002
sp|P0C061.1|GRSA_ANEMI  RecName: Full=Gramicidin S synthase 1;...  42.4    0.002
sp|Q9R9I9.1|MYCC_BACSU  RecName: Full=Mycosubtilin synthase su...  42.0    0.003
sp|P27206.4|SRFAA_BACSU  RecName: Full=Surfactin synthetase su...  41.2    0.005
sp|Q92D47.1|DLTA_LISIN  RecName: Full=D-alanine--poly(phosphor...  41.2    0.005
sp|P0C062.1|GRSA_BREBE  RecName: Full=Gramicidin S synthase 1;...  40.8    0.007
sp|Q721J2.1|DLTA_LISMF  RecName: Full=D-alanine--poly(phosphor...  40.4    0.007
sp|B8DEG2.1|DLTA_LISMH  RecName: Full=D-alanine--poly(phosphor...  40.4    0.007
sp|C1L1P5.1|DLTA_LISMC  RecName: Full=D-alanine--poly(phosphor...  40.4    0.008
sp|P19409.1|BAIB_EUBSP  RecName: Full=Bile acid-coenzyme A ligase  40.0    0.009
sp|A1JPF0.1|AAS_YERE8  RecName: Full=Bifunctional protein aas;...  40.0    0.010
sp|P19828.1|ANGR_VIBAN  RecName: Full=Protein angR                 39.7    0.012
sp|Q7TYQ4.1|MBTB_MYCBO  RecName: Full=Phenyloxazoline synthase...  39.7    0.013
sp|P71717.2|MBTB_MYCTU  RecName: Full=Phenyloxazoline synthase...  39.7    0.013
sp|Q8Y8D4.1|DLTA_LISMO  RecName: Full=D-alanine--poly(phosphor...  39.7    0.013
sp|Q01886.2|HTS1_COCCA  RecName: Full=HC-toxin synthetase; Sho...  38.9    0.022
sp|P45745.4|DHBF_BACSU  RecName: Full=Dimodular nonribosomal p...  38.9    0.023
sp|A0AH92.1|DLTA_LISW6  RecName: Full=D-alanine--poly(phosphor...  38.5    0.031
sp|Q53526.4|DLTA_STRMU  RecName: Full=D-alanine--poly(phosphor...  38.5    0.031
sp|C0MBD6.1|DLTA_STRE4  RecName: Full=D-alanine--poly(phosphor...  38.1    0.038
sp|P25464.1|ACVS_CEPAC  RecName: Full=N-(5-amino-5-carboxypent...  37.0    0.087
sp|Q08787.2|SRFAC_BACSU  RecName: Full=Surfactin synthetase su...  36.6    0.10 
sp|O54075.1|PCL_RHOS4  RecName: Full=4-coumarate--CoA ligase; ...  36.6    0.11 
sp|Q12572.2|LYS2_CANAL  RecName: Full=L-aminoadipate-semialdeh...  36.6    0.12 
sp|Q6D107.1|AAS_ERWCT  RecName: Full=Bifunctional protein aas;...  36.2    0.13 
sp|O74298.1|LYS2_PENCH  RecName: Full=L-aminoadipate-semialdeh...  36.2    0.13 
sp|Q70LM7.1|LGRA_BREPA  RecName: Full=Linear gramicidin syntha...  36.2    0.14 
sp|Q4LDG0.2|S27A5_MOUSE  RecName: Full=Bile acyl-CoA synthetas...  36.2    0.14 
sp|Q80WC9.1|ACSF4_MOUSE  RecName: Full=Acyl-CoA synthetase fam...  36.2    0.16 
sp|Q924N5.1|ACBG1_RAT  RecName: Full=Long-chain-fatty-acid--Co...  35.8    0.18 
sp|Q8VM67.2|DLTA_STRA3  RecName: Full=D-alanine--poly(phosphor...  35.8    0.19 
sp|P59591.1|DLTA_STRA5  RecName: Full=D-alanine--poly(phosphor...  35.8    0.20 
sp|Q04747.3|SRFAB_BACSU  RecName: Full=Surfactin synthetase su...  35.8    0.20 
sp|Q96GR2.1|ACBG1_HUMAN  RecName: Full=Long-chain-fatty-acid--...  35.4    0.23 
sp|P27743.1|ACVS_NOCLA  RecName: Full=N-(5-amino-5-carboxypent...  35.4    0.24 
sp|Q74RZ6.2|AAS_YERPE  RecName: Full=Bifunctional protein aas;...  35.4    0.27 
sp|A4TLD3.1|AAS_YERPP  RecName: Full=Bifunctional protein aas;...  35.4    0.27 
sp|A7MR36.1|AAS_ENTS8  RecName: Full=Bifunctional protein aas;...  35.4    0.28 
sp|Q8XBV9.1|ENTF_ECO57  RecName: Full=Enterobactin synthase co...  35.0    0.29 
sp|Q4R4P9.2|ACBG1_MACFA  RecName: Full=Long-chain-fatty-acid--...  35.0    0.29 
sp|Q5HQN0.1|DLTA_STAEQ  RecName: Full=D-alanine--poly(phosphor...  35.0    0.30 
sp|P11454.3|ENTF_ECOLI  RecName: Full=Enterobactin synthase co...  35.0    0.31 
sp|Q10776.1|FAD11_MYCTU  RecName: Full=Putative fatty-acid--Co...  35.0    0.35 
sp|Q9Y2P5.1|S27A5_HUMAN  RecName: Full=Bile acyl-CoA synthetas...  34.7    0.38 
sp|P29698.2|ENTF_SHIFL  RecName: Full=Enterobactin synthase co...  34.7    0.38 
sp|Q667F1.1|AAS_YERPS  RecName: Full=Bifunctional protein aas;...  34.7    0.44 
sp|Q4L235.3|ACSF4_HUMAN  RecName: Full=Acyl-CoA synthetase fam...  34.7    0.45 
sp|O35547.1|ACSL4_RAT  RecName: Full=Long-chain-fatty-acid--Co...  34.7    0.45 
sp|Q9CG49.1|DLTA_LACLA  RecName: Full=D-alanine--poly(phosphor...  34.7    0.46 
sp|O31782.3|PKSN_BACSU  RecName: Full=Polyketide synthase pksN     34.3    0.49 
sp|Q00869.2|ESYN_FUSEQ  RecName: Full=Enniatin synthetase; Inc...  34.3    0.49 
sp|P42516.2|PCL_HALHA  RecName: Full=4-coumarate--CoA ligase; ...  34.3    0.51 
sp|Q7ZYC4.1|ACBG2_XENLA  RecName: Full=Long-chain-fatty-acid--...  34.3    0.56 
sp|Q6FMI5.1|LYS2_CANGA  RecName: Full=L-aminoadipate-semialdeh...  34.3    0.56 
sp|Q99PU5.1|ACBG1_MOUSE  RecName: Full=Long-chain-fatty-acid--...  34.3    0.57 
sp|Q02278.2|FAD28_MYCBO  RecName: Full=Putative fatty-acid--Co...  34.3    0.59 
sp|Q4L3Q0.1|VRAA_STAHJ  RecName: Full=Putative long chain fatt...  33.9    0.72 
sp|Q2KHW5.1|ACBG1_BOVIN  RecName: Full=Long-chain-fatty-acid--...  33.5    0.94 
sp|Q9ES38.1|S27A5_RAT  RecName: Full=Bile acyl-CoA synthetase;...  33.5    0.94 
sp|C6DE43.1|AAS_PECCP  RecName: Full=Bifunctional protein aas;...  33.5    0.99 
sp|Q9R9J0.1|MYCB_BACSU  RecName: Full=Mycosubtilin synthase su...  33.5    1.0  
sp|O60488.2|ACSL4_HUMAN  RecName: Full=Long-chain-fatty-acid--...  33.1    1.1  
sp|Q9R9J1.1|MYCA_BACSU  RecName: Full=Mycosubtilin synthase su...  33.1    1.2  
sp|Q08905.1|FRE3_YEAST  RecName: Full=Ferric reductase transme...  33.1    1.2  
sp|Q60714.1|S27A1_MOUSE  RecName: Full=Long-chain fatty acid t...  33.1    1.3  
sp|P97849.1|S27A1_RAT  RecName: Full=Long-chain fatty acid tra...  33.1    1.3  
sp|Q6PCB7.1|S27A1_HUMAN  RecName: Full=Long-chain fatty acid t...  32.7    1.6  
sp|Q9QUJ7.1|ACSL4_MOUSE  RecName: Full=Long-chain-fatty-acid--...  32.7    1.7  
sp|Q88VM6.1|DLTA_LACPL  RecName: Full=D-alanine--poly(phosphor...  32.7    1.8  
sp|Q8CT93.1|DLTA_STAES  RecName: Full=D-alanine--poly(phosphor...  32.7    1.8  
sp|B7HK95.1|DLTA_BACC7  RecName: Full=D-alanine--poly(phosphor...  32.7    1.8  
sp|B9IUW2.1|DLTA_BACCQ  RecName: Full=D-alanine--poly(phosphor...  32.7    1.8  
sp|B8ZQ14.1|DLTA_STRPJ  RecName: Full=D-alanine--poly(phosphor...  32.3    1.8  
sp|A7GMR0.1|DLTA_BACCN  RecName: Full=D-alanine--poly(phosphor...  32.3    1.9  
sp|Q73BD2.1|DLTA_BACC1  RecName: Full=D-alanine--poly(phosphor...  32.3    1.9  
sp|Q3ZKN0.1|S27A1_BOVIN  RecName: Full=Long-chain fatty acid t...  32.3    1.9  
sp|Q81G39.1|DLTA_BACCR  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|P0A398.1|DLTA_STRPN  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|Q9X2N4.1|DLTA_STAXY  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|P40976.3|LYS2_SCHPO  RecName: Full=L-aminoadipate-semialdeh...  32.3    2.0  
sp|B7IN64.1|DLTA_BACC2  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|O31827.1|PPSE_BACSU  RecName: Full=Plipastatin synthase sub...  32.3    2.0  
sp|Q81T97.1|DLTA_BACAN  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|Q6HLH7.1|DLTA_BACHK  RecName: Full=D-alanine--poly(phosphor...  32.3    2.0  
sp|A4WE11.1|AAS_ENT38  RecName: Full=Bifunctional protein aas;...  32.3    2.1  
sp|Q63E02.1|DLTA_BACCZ  RecName: Full=D-alanine--poly(phosphor...  32.3    2.1  
sp|A9VKV6.1|DLTA_BACWK  RecName: Full=D-alanine--poly(phosphor...  32.3    2.2  
sp|Q5ZKR7.2|ACBG2_CHICK  RecName: Full=Long-chain-fatty-acid--...  32.0    2.4  
sp|Q47YG8.1|LOLD_COLP3  RecName: Full=Lipoprotein-releasing sy...  32.0    2.5  
sp|Q8K744.1|DLTA_STRP3  RecName: Full=D-alanine--poly(phosphor...  32.0    2.5  
sp|Q99ZA6.1|DLTA_STRP1  RecName: Full=D-alanine--poly(phosphor...  32.0    2.5  
sp|P16405.1|ORA_PLAFN  RecName: Full=Octapeptide-repeat antige...  32.0    2.6  
sp|B2VFS7.1|AAS_ERWT9  RecName: Full=Bifunctional protein aas;...  32.0    2.8  
sp|B5XLX5.1|DLTA_STRPZ  RecName: Full=D-alanine--poly(phosphor...  32.0    2.9  
sp|Q1J667.1|DLTA_STRPF  RecName: Full=D-alanine--poly(phosphor...  32.0    2.9  
sp|Q8P0J9.1|DLTA_STRP8  RecName: Full=D-alanine--poly(phosphor...  32.0    3.0  
sp|P39581.1|DLTA_BACSU  RecName: Full=D-alanine--poly(phosphor...  32.0    3.1  
sp|Q48SZ3.1|DLTA_STRPM  RecName: Full=D-alanine--poly(phosphor...  31.6    3.3  
sp|P07702.2|LYS2_YEAST  RecName: Full=L-aminoadipate-semialdeh...  31.6    3.4  
sp|Q01757.1|ACVS_STRCL  RecName: Full=N-(5-amino-5-carboxypent...  31.6    3.6  
sp|A4J1M3.1|BIOB_DESRM  RecName: Full=Biotin synthase              31.6    4.0  
sp|A8AP56.1|AAS_CITK8  RecName: Full=Bifunctional protein aas;...  31.6    4.0  
sp|A6TDH2.1|AAS_KLEP7  RecName: Full=Bifunctional protein aas;...  31.2    4.2  
sp|B5XUP2.1|AAS_KLEP3  RecName: Full=Bifunctional protein aas;...  31.2    4.2  
sp|Q75BB3.1|LYS2_ASHGO  RecName: Full=L-aminoadipate-semialdeh...  31.2    5.2  
sp|P30624.1|LCF1_YEAST  RecName: Full=Long-chain-fatty-acid--C...  30.8    5.5  
sp|Q5HRH4.1|VRAA_STAEQ  RecName: Full=Putative long chain fatt...  30.8    5.6  
sp|Q48AS7.1|DNAA_COLP3  RecName: Full=Chromosomal replication ...  30.8    5.9  
sp|A7ZA74.1|DLTA_BACA2  RecName: Full=D-alanine--poly(phosphor...  30.8    6.2  
sp|Q94B74.1|NUDT2_ARATH  RecName: Full=Nudix hydrolase 2; Shor...  30.8    6.7  
sp|B4TUM9.1|AAS_SALSV  RecName: Full=Bifunctional protein aas;...  30.8    6.9  
sp|B0THN2.1|ATPB_HELMI  RecName: Full=ATP synthase subunit bet...  30.4    8.1  
sp|C1AU95.1|TRPD_RHOOB  RecName: Full=Anthranilate phosphoribo...  30.4    8.4  
sp|Q0SHN1.1|TRPD_RHOSR  RecName: Full=Anthranilate phosphoribo...  30.4    8.6  
sp|Q9V3S9.1|BGM_DROME  RecName: Full=Very long-chain-fatty-aci...  30.4    8.8  
sp|B7LNJ2.1|AAS_ESCF3  RecName: Full=Bifunctional protein aas;...  30.4    8.9  
sp|Q91V33.1|KHDR1_RAT  RecName: Full=KH domain-containing, RNA...  30.0    9.3  
sp|P96989.1|OMPB_RICTY  RecName: Full=Outer membrane protein B...  30.0    9.5  

ALIGNMENTS
>sp|P28812.2|Y3568_PSEAE RecName: Full=Uncharacterized protein PA3568
Length=628

 Score =  241 bits (615),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 149/205 (72%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            VPGY V+++  +      N  G IV+ LPLPPG   TLW    RY + Y+ NY GYY T 
Sbjct  418  VPGYHVQVLDDEGRPLGANRQGAIVIALPLPPGCAQTLWGDHPRYLQAYLGNYPGYYHTG  477

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            D G++D+DG+++IM RTDD+INV+GHRLSTG +EE +++HQ+VAECAV+G+ D+LKG +P
Sbjct  478  DGGYLDEDGFVYIMGRTDDVINVSGHRLSTGEMEERVAQHQAVAECAVIGVRDELKGHVP  537

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
            +GLVVLK     + E + +E + +VRE+IG +A F+  +V+KRLPKTRSGKILR  +RKI
Sbjct  538  LGLVVLKDDAGIAAEQLQRELVALVREQIGALACFQRVVVVKRLPKTRSGKILRAVLRKI  597

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
            AD E+Y  P TIDDP IL EI+  L
Sbjct  598  ADGEDYAAPSTIDDPTILGEIEAAL  622


>sp|Q14DH7.2|ACSS3_MOUSE RecName: Full=Acyl-CoA synthetase short-chain family member 3, 
mitochondrial; Flags: Precursor
Length=682

 Score =  222 bits (565),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 144/205 (70%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            VPGY+V I+  +    K   +G+IVVKLPLPPG F  LW   + +K  Y   + GYY T 
Sbjct  474  VPGYNVMILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTM  533

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            DAG++D++GY+++MSR DD+INVAGHR+S GAIEE +  H +VA+CAV+G  D LKG +P
Sbjct  534  DAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVP  593

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
            + L VLK  V+ S E + +E ++ VR+ IGPVAAF+ A+ +K+LPKTRSGKI R T+  +
Sbjct  594  LALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSAL  653

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
             + + YK+ PTI+DP+I   I+  L
Sbjct  654  VNGKPYKVTPTIEDPSIFGHIEEVL  678


>sp|Q5REB8.1|ACSS3_PONAB RecName: Full=Acyl-CoA synthetase short-chain family member 3, 
mitochondrial; Flags: Precursor
Length=686

 Score =  215 bits (547),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (47%), Positives = 142/205 (69%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            VPGY+V I+  +    K   +G+IVVKLPLPPG F  LW   + +K  Y   + GYY T 
Sbjct  479  VPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTM  538

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            DAG++D++GY+++MSR DD+INVAGHR+S GAIEE +  H +VA+CAV+G  D LKG +P
Sbjct  539  DAGYMDEEGYVYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVP  598

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
            + L VL+  ++ + E + +E ++ VR+ IGPVAAF+ A+ +K+LPKTRSGKI R  +  I
Sbjct  599  LALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAI  658

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
             + + YK+  TI+DP+I   ++  L
Sbjct  659  VNGKPYKITSTIEDPSIFGHVEEML  683


>sp|A7MB45.1|ACSS3_BOVIN RecName: Full=Acyl-CoA synthetase short-chain family member 3, 
mitochondrial; Flags: Precursor
Length=686

 Score =  214 bits (546),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 142/205 (69%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            VPGY+V I+  +    K   +G+IVVKLPLPPG F  LW   + +K  Y   + GYY T 
Sbjct  478  VPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTM  537

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            DAG++D++GY+++MSR DD+INVAGHR+S GA+EE +     VA+CAV+G  D LKG +P
Sbjct  538  DAGYMDEEGYVYVMSRVDDVINVAGHRISAGALEESILSLGIVADCAVVGKEDSLKGHIP  597

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
            + L VLK  ++ + E + +E ++ VR+ IGPVAAF+ A+ +K+LPKTRSGKI R T+  +
Sbjct  598  LALCVLKKDINTTEEHVLEEIVKHVRQTIGPVAAFRKAVFVKQLPKTRSGKIPRSTLSAL  657

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
             + + YK+ PTI+DP I + I+  L
Sbjct  658  VNGKPYKVSPTIEDPGIFEHIEAML  682


>sp|Q9H6R3.1|ACSS3_HUMAN RecName: Full=Acyl-CoA synthetase short-chain family member 3, 
mitochondrial; Flags: Precursor
Length=686

 Score =  214 bits (545),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (47%), Positives = 142/205 (69%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            VPGY+V I+  +    K   +G+IVVKLPLPPG F  LW   + +K  Y   + GYY T 
Sbjct  479  VPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTM  538

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            DAG++D++GY+++MSR DD+INVAGHR+S GAIEE +  H +VA+CAV+G  D LKG +P
Sbjct  539  DAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVP  598

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
            + L VL+  ++ + E + +E ++ VR+ IGPVAAF+ A+ +K+LPKTRSGKI R  +  I
Sbjct  599  LALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAI  658

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
             + + YK+  TI+DP+I   ++  L
Sbjct  659  VNGKPYKITSTIEDPSIFGHVEEML  683


>sp|Q554Z5.1|ACSB_DICDI RecName: Full=Acyl-CoA synthetase short-chain family member B, 
mitochondrial; Flags: Precursor
Length=688

 Score =  209 bits (531),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/205 (47%), Positives = 140/205 (68%), Gaps = 0/205 (0%)

Query  1    VPGYDVKIIKSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            +PGY   ++         +++G++ +KLP+ PG   TL+   + YK  Y++ Y GY +T 
Sbjct  473  MPGYQFHVLSPTSERLGADKIGEVCIKLPVAPGFTNTLYLNPEGYKNAYLNEYPGYLRTA  532

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            D+G+ D++GY  I+SR DDIINV+GHRLSTG+IEE+L +H  + ECAV+G+ D+LKG++P
Sbjct  533  DSGYYDENGYYHIISRVDDIINVSGHRLSTGSIEEILVKHPKIVECAVIGVHDELKGEIP  592

Query  121  IGLVVLKAGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKI  180
             GLVVLK       E++  E I+ VRE IGPVA FK  + + RLPKTRSGKILR  +RK+
Sbjct  593  FGLVVLKPQYKDCAEEVENELIKEVRENIGPVATFKKVLSVNRLPKTRSGKILRNILRKM  652

Query  181  ADNEEYKMPPTIDDPAILDEIKTDL  205
             + EEY +PPTI+D  +L EI  + 
Sbjct  653  YNKEEYTVPPTIEDMEVLKEIDIEF  677


>sp|P36333.1|ACSA_PENCH RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=Acetate--CoA 
ligase; AltName: Full=Acyl-activating enzyme
Length=669

 Score =  160 bits (405),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 112/182 (61%), Gaps = 5/182 (2%)

Query  22   GDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGYIWIMSRTDDII  81
            G +  K P P     T+W A +RY + Y++ Y+GYY T D    D DGY WI  R DD++
Sbjct  481  GVLAFKQPWP-SMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVV  539

Query  82   NVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGVDKSHEDISKEC  141
            NV+GHRLST  IE  L EH SVAE AV+GIAD+L GQ     V LK G  K  E ISK+ 
Sbjct  540  NVSGHRLSTAEIEAALLEHPSVAEAAVVGIADELTGQAVNAFVSLKEG--KPTEQISKDL  597

Query  142  IQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKIADNEEYKM--PPTIDDPAILD  199
               VR+ IGP AA K   V+  LPKTRSGKI+R  +RKI   EE  +    T+ DP+++D
Sbjct  598  AMQVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVD  657

Query  200  EI  201
            +I
Sbjct  658  KI  659


>sp|P16928.2|ACSA_EMENI RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=Acetate--CoA 
ligase; AltName: Full=Acyl-activating enzyme
Length=670

 Score =  153 bits (386),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 4/193 (2%)

Query  11   SDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGY  70
            S + ++  +  G +  K P P     T+W A +RY + Y++ Y+GYY T D    D +GY
Sbjct  470  SGEEISGNDVEGVLAFKQPWP-SMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHEGY  528

Query  71   IWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGV  130
             WI  R DD++NV+GHRLST  IE  L EH  VAE AV+GIAD+L GQ     V LK G 
Sbjct  529  YWIRGRVDDVVNVSGHRLSTAEIEAALIEHPMVAEAAVVGIADELTGQAVNAFVSLKEG-  587

Query  131  DKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKIADNEEYKMP-  189
            +++++ + K+ I  VR+ IGP AA K   V+  LPKTRSGKI+R  +RKI   EE  +  
Sbjct  588  NETNDQVRKDLILQVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGD  647

Query  190  -PTIDDPAILDEI  201
              T+ DP++++ I
Sbjct  648  ISTLSDPSVVERI  660


>sp|Q6MNF1.1|ACSA_BDEBA RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=Acetate--CoA 
ligase; AltName: Full=Acyl-activating enzyme
Length=645

 Score =  152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 110/179 (61%), Gaps = 3/179 (1%)

Query  32   PGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGYIWIMSRTDDIINVAGHRLSTG  91
            PG   T++   +R+++ Y SNY GYY T D    D DGY WI  R DD+INV+GHRL T 
Sbjct  468  PGQMRTVYRNHERFEDTYFSNYPGYYFTGDGCRRDQDGYYWITGRVDDVINVSGHRLGTA  527

Query  92   AIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGVDKSHEDISKECIQMVREKIGP  151
             IE  L  H  VAE AV+G    +KGQ     V LK+G + + E++ KE IQ VR++IGP
Sbjct  528  EIESALVAHHKVAEAAVVGYPHDIKGQGIYAFVTLKSG-ETASEELRKELIQTVRKEIGP  586

Query  152  VAAFKVAIVIKRLPKTRSGKILRGTIRKIADNEEYKM--PPTIDDPAILDEIKTDLINN  208
            +A   +     RLPKTRSGKI+R  +RKIA+N   ++    T+ +PA++ E+  + +N 
Sbjct  587  IATPDLIQWAPRLPKTRSGKIMRRILRKIAENHPDQLGDTTTLSEPAVVQELVDNRMNR  645


>sp|Q758X0.1|ACS1_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 1; AltName: Full=Acetate--CoA 
ligase 1; AltName: Full=Acyl-activating enzyme 1
Length=694

 Score =  151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 121/209 (57%), Gaps = 11/209 (5%)

Query  3    GYDVKII--KSDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTY  60
            G D+ I+  ++ + L  PN  G + VK P P  T  T+WN   RY + Y++ Y+GYY   
Sbjct  481  GIDLAILDPQTGEELLGPNVEGVLAVKQPWPSFT-RTIWNNHDRYLDTYLNPYKGYYFAG  539

Query  61   DAGHIDDDGYIWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLP  120
            D    D  G+IWI+ R DD++NV+GHRLST  +E  + +   VAECAV+G AD+L GQ  
Sbjct  540  DGAARDSQGFIWILGRVDDVVNVSGHRLSTAEVEAAIIQESMVAECAVVGFADELTGQAI  599

Query  121  IGLVVLK------AGVDKSHEDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILR  174
               VVLK         ++  ++I K  I  VR  IGP AA K+ +++  LPKTRSGKI+R
Sbjct  600  AAFVVLKQKSSWNTASERELQEIKKHLILSVRRDIGPFAAPKLIVLVDDLPKTRSGKIMR  659

Query  175  GTIRKIADNEEYKMP--PTIDDPAILDEI  201
              +RKI   E  ++    T+ +P I+  +
Sbjct  660  RILRKILAGEADQLGDVSTLSNPGIVKHL  688


>sp|Q9Y7B5.2|ACS2_KLULA RecName: Full=Acetyl-coenzyme A synthetase 2; AltName: Full=Acetate--CoA 
ligase 2; AltName: Full=Acyl-activating enzyme 2
Length=684

 Score =  150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 108/185 (58%), Gaps = 12/185 (6%)

Query  11   SDQSLAKPNEMGDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGY  70
            S + L   +  G + VK P P     ++WN   RY E Y+  Y GYY T D    D DGY
Sbjct  468  SGEELKGNDVEGVLAVKSPWP-SMARSVWNNHARYFETYLKPYPGYYFTGDGAGRDHDGY  526

Query  71   IWIMSRTDDIINVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGV  130
             WI  R DD++NV+GHRLST  IE  L+EH+ V+E AV+GI D+L GQ  I  V LK G 
Sbjct  527  YWIRGRVDDVVNVSGHRLSTAEIEAALAEHEGVSEAAVVGITDELTGQAVIAFVSLKDGY  586

Query  131  --------DKSH---EDISKECIQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRK  179
                    D +H   +++ +E I  VR +IGP AA K  +V+  LPKTRSGKI+R  +RK
Sbjct  587  LSENAVEGDSTHISPDNLRRELILQVRGEIGPFAAPKTVVVVNDLPKTRSGKIMRRVLRK  646

Query  180  IADNE  184
            +A  E
Sbjct  647  VASKE  651


>sp|P16929.2|ACSA_NEUCR RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=Acetate--CoA 
ligase; AltName: Full=Acyl-activating enzyme
Length=667

 Score =  150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 111/182 (60%), Gaps = 4/182 (2%)

Query  22   GDIVVKLPLPPGTFPTLWNADQRYKENYMSNYEGYYQTYDAGHIDDDGYIWIMSRTDDII  81
            G +  K P P     T+W A +RY E Y+  Y+GYY T D    D +G+ WI  R DD++
Sbjct  479  GVLAFKQPWP-SMARTVWGAHKRYMETYLHVYKGYYFTGDGAARDHEGFYWIRGRVDDVV  537

Query  82   NVAGHRLSTGAIEEVLSEHQSVAECAVLGIADKLKGQLPIGLVVLKAGVDKSHEDISKEC  141
            NV+GHRLST  IE  L EH S+AE AV+G+AD+L GQ     V +K G  + ++ + KE 
Sbjct  538  NVSGHRLSTAEIEAALIEHHSIAEAAVVGVADELTGQAVNAFVAVKEGT-QINDALRKEF  596

Query  142  IQMVREKIGPVAAFKVAIVIKRLPKTRSGKILRGTIRKIADNEEYKMP--PTIDDPAILD  199
            +  VR  IGP AA K   ++  LPKTRSGKI+R  +RKI   EE ++    T+ DP+++ 
Sbjct  597  VLQVRRSIGPFAAPKAIYIVPDLPKTRSGKIMRRILRKIVAGEEDQLGDITTLSDPSVVA  656

Query  200  EI  201
            +I
Sbjct  657  KI  658