GOS 1326010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858510
Annotathon code: GOS_1326010
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : MIEBbestteam1
Annotated on : 2010-07-12 11:17:59
  • DianaFilipaNunesReis a36795@ualg.pt
  • RicardoJorgePereira a36809@ualg.pt
  • TiagoPereiraFernandes a36810@ualg.pt

Synopsis

  • Taxonomy: Rhizobiales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 356
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rhizobiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;

Genomic Sequence

>JCVI_READ_1091118858510 GOS_1326010 Genomic DNA
TAGAGCCTTATGGCCGTTGCTATAGATAACTGATAATCCCTCAACAAGCAGGCTAGTTTCCTTCACTAAGACCCTCATAAATCCTATCTAAAGTTTCGCT
AATCAGTTTTATATAAGTTGGCACGCGGCCTTTCGCGTCGCTAAGGGAGTCCACGTATAAGACGCCCCCATAAGCTGCGCCCGTTTCTCTCGCAACTTGT
AGGGCTGGTTTGGGCGATATCGTGCTTTCACTAAAAATCACAGGGATCTTAAATTCATTTATCAAATCAATAACCCTTTGTATCTGGCGAGGCGTTCCTT
GACCATCTGAATTCATTGGCCACAAATAGGCTTCTTTCAATTTGAACTCTGCCGCGAGATAACTAAACGCTCCCTCCGAAGTCACTAACCATTTTCGCTC
TTCAGCAAGTTCACTGAACTTCTGATGGTAATTCTCAAATAGTCTACGCAGTTTTTCCTTGTAACTATTCGCATTTGATTCATAAACTCTCGCATTTGCA
GGGTCATGCTGAGCAAGAGCCCTTTCAACGTTATCAACGTAAATCATAACGTTTGTTGGCGACATCCAAGCGTGAGGGTTAGGCTTATCTTTATACGGAC
CCTGGCGAATGCTTATTTGTTTGATGTTACGACTTATGACCACACTCGGCACATCGTCTAAGTTCTGAAAGAATTTATCAAACCACACTTCAAGATTCAG
ACCATTATAGATAAGAAGGTCGACCCCTCTCGCCCTGCGAAGATCGCCGGGAGTCGCCTGATAATTATGTATTTCTGCATTGGGTTTCGTAATGGACTCG
ACTGACGCGGCGTCACCCGCCACGTTTTTTACAATATCGGCAATCACGGTAAAAGTGGTCATCACCTTTAGCTTTTTCTCATCGGCTTGCAGAGGTATGA
CGATAAACGTAAGGATCAAAAATACGAGTA

Translation

[3 - 875/930]   indirect strand
>GOS_1326010 Translation [3-875   indirect strand]
LVFLILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISR
NIKQISIRQGPYKDKPNPHAWMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVTSEGAFSYLAAEFKLKEA
YLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEGN

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

After the comparison of all the result obtained in the project we can conclude several facts, such as, there is a high probably our ORF will be coding since our sequence have more then 280 aa and it was found homologies.

With a further analyse we can also find that our protein may be related with the family of ABC transporter metal-binding lipoprotein and from this data we can say that probably the function this protein have is the transport of metal ions such as iron (Fe3+) since we got good E-value such as 8e-101, 1e-100, 4e-100, and 3e-99, where the proteins with homology have the same function. We also believe that this protein comes from the order Rhizobiales and it’s possible to be an a-proteobacteria because in the Taxonomy report we got good scores like 343. In the Rhizobiales order the amino acid L can be an M if the codon that translate it is a TTG, in this case our ORF doesn’t have a start codon and starts with a L but the codon is a CTC so this does not apply to our ORF




ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS:


a) Forward strand: only one ORF have been found on direct strand


In forward strand finding sequence we obtain one ORF that extends from base 479 to base 661


b) reverse strand: only one ORF have been found on reverse strand


In reverse strand we obtained one ORF that we had chosen because it was the longest nucleotide sequence given because this is the one that have a higher chenge of having biological function. This DNA fragment extends from base 3 to base 878 and contains a stop codon but doesn’t have a codon start, there is a chance that the amino acid L may be a M, in proteins from the order Rhizobiales the codon TTG may have this error but it doesn't happen in this ORF since the codon that translate to the L in this case is a CTC


RAW RESULTS

a) forward strand
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 479 to base 661.
TTCATAAACTCTCGCATTTGCAGGGTCATGCTGAGCAAGAGCCCTTTCAACGTTATCAAC
GTAAATCATAACGTTTGTTGGCGACATCCAAGCGTGAGGGTTAGGCTTATCTTTATACGG
ACCCTGGCGAATGCTTATTTGTTTGATGTTACGACTTATGACCACACTCGGCACATCGTC
TAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
FINSRICRVMLSKSPFNVINVNHNVCWRHPSVRVRLIFIRTLANAYLFDVTTYDHTRHIV
*

No ORFs were found in reading frame 3.


------------------------------------------------------------------------------------------------------------------------

b)reverse strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 878.
CTCGTATTTTTGATCCTTACGTTTATCGTCATACCTCTGCAAGCCGATGAGAAAAAGCTA
AAGGTGATGACCACTTTTACCGTGATTGCCGATATTGTAAAAAACGTGGCGGGTGACGCC
GCGTCAGTCGAGTCCATTACGAAACCCAATGCAGAAATACATAATTATCAGGCGACTCCC
GGCGATCTTCGCAGGGCGAGAGGGGTCGACCTTCTTATCTATAATGGTCTGAATCTTGAA
GTGTGGTTTGATAAATTCTTTCAGAACTTAGACGATGTGCCGAGTGTGGTCATAAGTCGT
AACATCAAACAAATAAGCATTCGCCAGGGTCCGTATAAAGATAAGCCTAACCCTCACGCT
TGGATGTCGCCAACAAACGTTATGATTTACGTTGATAACGTTGAAAGGGCTCTTGCTCAG
CATGACCCTGCAAATGCGAGAGTTTATGAATCAAATGCGAATAGTTACAAGGAAAAACTG
CGTAGACTATTTGAGAATTACCATCAGAAGTTCAGTGAACTTGCTGAAGAGCGAAAATGG
TTAGTGACTTCGGAGGGAGCGTTTAGTTATCTCGCGGCAGAGTTCAAATTGAAAGAAGCC
TATTTGTGGCCAATGAATTCAGATGGTCAAGGAACGCCTCGCCAGATACAAAGGGTTATT
GATTTGATAAATGAATTTAAGATCCCTGTGATTTTTAGTGAAAGCACGATATCGCCCAAA
CCAGCCCTACAAGTTGCGAGAGAAACGGGCGCAGCTTATGGGGGCGTCTTATACGTGGAC
TCCCTTAGCGACGCGAAAGGCCGCGTGCCAACTTATATAAAACTGATTAGCGAAACTTTA
GATAGGATTTATGAGGGTCTTAGTGAAGGAAACTAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
LVFLILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATP
GDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHA
WMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKW
LVTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPK
PALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEGN*

Multiple Alignement

PROTOCOL

Phylogeny.fr / Muscle


RESULTS ANALYSIS


Using the MSA we could find that our ORF doesn't have a start codon but the amino acid L can be an M if the translation comes from the codon TTG, this is a normal error in the Rhizobiales order but in this case the L is translated from a CTC codon.

In the MSA the sequences doesn't have the same size, at start there is a considerable difference between them but the rest of the sequence is much similar so we can say that in a general look they have almost the same size. As we follow the alignment we will find that the sequences have a considerable number of conserved regions with significant dimensions(for exemple from 193 to 364) which will show us that the sequences may be related.

In the result our sequence starts in the position 55 and it ends at the position 367, we can find 22 gaps in these intervals, so we have 290 aa in the sequence in the protein domains we have the interval from 2 to 287 with means we have 285 aa in this case.


RAW RESULTS

Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 26
Alignment assumed to be: Protein
New number of positions: 248 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  ------------------------------------------------MLRYFICLLFSY
Hoeflea_phototr  MWGDLLSIADDIPPQCSKFAPLLQMICKSIDTGLIQHRLPFANHSQEAPMLFIKVLVLSV
GOS_1326010      ------------------------------------------------------LVFLIL
Haemophilus_inf  ------------------------------------------------MRNSFKIMTALA
Rhodopseudomo_s  --------------------------------------MKLKQIGSGWVRSVVVAAVAGV
Rhodopseudomo    --------------------------------------MKPKADHRRLAWTAFAGALACL
Agrobacterium_t  --------------------------------------------MTDVNLHKIRHALFAF
Bartonella_baci  ----------------------------------------------MKIKAFFTTIFLST
Bartonella_trib  ----------------------------------------------MNIKRIFTLILGSL
Bartonella_quin  ----------------------------------------------MNVKTFFIIIWGSV
Bartonella_grah  ----------------------------------------------MNVRTFFSIVFGSV
Bartonella_hens  ----------------------------------------------MNVKTFFIIIWASA
Xanthobacter_au  -------------------------MRCRSCLTAGSTAPSLVRSWAGRVFSAAGAVLLAA
Ochrobactrum_an  -------------------------------------------MLRRILRTTTLGLVSGA
Ochrobactrum_in  -----------------------MSVDCYSIMQLQIISNKDWNMRNCILRTATLGLLSAA
Rhizobium_sp._N  ------------------------------------------MIDRTRRMILTAATAMAA
Sinorhizobium_d  ------------------------------------------MIQSTRRMIVAAAAAMAV
Sinorhizobium_e  ------------------------------------------MIHPTRRMIVAAAAAMAA
Rhizobium_legum  ---------------------------------------MLYRERRSVLAGMIGVAFAAV
Rhizobium_etli   ------------------------------------------------------MVAVAA
Agrobacterium_r  ------------------------------------------MFDRARRRVLAGLAGFAA
Aliivibrio_salm  -----------------------------------------------MSNTLFTIPVLAL
Dickeya_dadanti  ------------------------------------------------MKRSILVMTLSS
Leptothrix_chol  -----------------------------------------MNIASRRKLLLAGLGFGAG
Aromatoleum_aro  ----------------------------------------------MNHLKIALLAALAL
Bordetella_para  --------------------------------------------------MKSRILALAA
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  IPM----SASATTQ----KKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTS
Hoeflea_phototr  LVALG--GAGSASA----KIKVLTSFTVFADMARNVAGEHADVVSITREGAEIHMFRPTP
GOS_1326010      TFIVI--PLQADEK----KLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATP
Haemophilus_inf  LGLFA----MQANA----KFKVVTTFTVIQDIAQNVAGNAATVESITKPGAEIHEYEPTP
Rhodopseudomo_s  LLAGP--CQAQARK----PFRVVTTFTVIQDIAQNVAGDKAIVESITKPGAEIHDYQPTP
Rhodopseudomo    LLAGP--SLAETRK----PFRVVTTFTIIQDIAQNVAGDRAVVESITKPGAEIHDYQPTP
Agrobacterium_t  SLFLP--GVAVAQE----KPKVVTTFTIIADMARNVAGDAADVESITKPGAEIHNYQPTP
Bartonella_baci  IFLIP--GLALSAN----KFKAVTTFTIIADMARNVAGDIADVESITKPGAEIHEYQPTP
Bartonella_trib  IFFTP--DLAVCAG----KFKAVTTFTIIADMARNVAGDAADVESITKPGAEIHEYQPTP
Bartonella_quin  IFLTP--NLALCAS----KFKAVTTFTIIADMARNVAGDAATVESITKPGAEIHEYQPTP
Bartonella_grah  IFFTP--NFALCAG----KFKAVTTFTIIADMARNVAGDAAEVESITKPGAEIHEYQPTP
Bartonella_hens  IFFTS--DFALCAG----KFKAVTTFTIIADMARNVAGDVADVESITKPGAEIHEYQPTP
Xanthobacter_au  LVATSSTAPARAAD----KLKVVTTFTIIADMAKNVAGDAAQVDSITKPGAEIHNYQPTP
Ochrobactrum_an  LLWTS--ASVAFAE----KFKAVTTFTVIADIAQNVAGDAATVESITKPGAEIHNYQPTP
Ochrobactrum_in  LVWSS--ATGALAE----KFKAVTTFTVIADIAQNVAGDAAIVESITKPGAEIHNYQPTS
Rhizobium_sp._N  LSLLS--GAAAAAE----KFKAVTTFTVIADMAQNVAGDAAIVESITKPGAEIHNYQPTP
Sinorhizobium_d  CSIMP--AAAPAAE----KLKAVTTFTVIADMAQNVAGDVAVVESITKPGAEIHNYQPTP
Sinorhizobium_e  LSLMP--AAARAAE----KLKAVTTFTVIADMAQNVAGDAAVVESITKPGAEIHNYQPTP
Rhizobium_legum  LVAFPAAAQQTTNS----KFKVVTTFTVIADMVKNVAGDAAIVESITKPGAEIHNYAPTP
Rhizobium_etli   LGLLA--GGAAAQE----KFKAVTTFTVIADMAKNVAGDAAIVESITKPGAEIHEYQPTP
Agrobacterium_r  LGLMA--GGVAAEEAANQKFKAVTTFTVIADMAKNVAGDAAIVESITKPGAEIHEYQPTP
Aliivibrio_salm  TLGLS--HSAIASE----QMPVITSFSILGDIVSQIGGDHIAITNLVKANGDAHVYQPTP
Dickeya_dadanti  LLLSP----LAMAK----ELNVVASFSVLGDMVSQIGGQHVHVTDLVQPNGDPHEFEPSP
Leptothrix_chol  LTAF---GPARAQSAKAQPLRLVASFSILADILRQIAPADAEVGALVGPEGDAHAYAPTP
Aromatoleum_aro  GLALA--APALRAA----PLEVVASFSILGDFVTRVGGERVAVTTLVGAGADAHNYQPRP
Bordetella_para  AVLLA--PLVAAAQ----PLQVVASFSILADIAAQVGGPDVAVQSLVGPDGDAHEYEPTP
                                       ######################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  ADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSE----------
Hoeflea_phototr  GDIKRGLGADVVLWNGLGLETWFERYLENLGDVPAFTLSD-GIEPIAIAE----------
GOS_1326010      GDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISR-NIKQISIRQ----------
Haemophilus_inf  KDIVKAQSADLILWNGLNLERWFERFFQNVKDKPAVVVTE-GIQPLSIYE----------
Rhodopseudomo_s  LDIVRAQAADLVLWNGFNLERWFERFFENVKDVPSVVVTE-GIAPMGIAQ----------
Rhodopseudomo    RDIVRAQSADLVLWNGFNLERWFERFFQSVKQVPSVVVTE-GIAPMGIAD----------
Agrobacterium_t  RDILKARKADLVLRNGLNLELWFEKFLANLSGVPDVTVSD-GVQPMAISG----------
Bartonella_baci  HDLMRAQGANLILWNGLDLELWFEKFFQNIENVPSVVVSK-GVKPIKIGE----------
Bartonella_trib  RDLMRAQGANLILWNGLELELWFEKFFQNIKDIPSVVVSE-GVVPITIGE----------
Bartonella_quin  RDLMRAQGANLILWNGLELELWFEKFFQNIKDVPSVVVSK-GIVPIKIGE----------
Bartonella_grah  RDLMRAQGANLVLWNGLELELWFEKFFQNIKDVPSVVVSK-GIVPIKIGE----------
Bartonella_hens  RDLMRAQGANLILWNGLELELWFEKFFQNIKDVPSVVVSK-GIVPIKIGE----------
Xanthobacter_au  GDLIKAQGANLILWNGLNLELWFEKFFSRLKGVPSVVVSD-GVEPMGITE----------
Ochrobactrum_an  GDLIKAQDAKLVLWNGLGLELWFEKFFSRLKDVPSAVVSD-GVEPIDISE----------
Ochrobactrum_in  GDLIKAQDAKLVLWNGLGLELWFEKFFARLNNVPSAIVSN-GVEPMDITE----------
Rhizobium_sp._N  RDILKAHDAKLILWNGLNLELWFEKFFQNFDDIPGVVVSE-GVEPMGIAE----------
Sinorhizobium_d  RDILKAHDADLILWNGLNLELWFERFFQNFDDVPGIVVSQ-GVEPMGIAE----------
Sinorhizobium_e  RDILKAHDADLILWNGLNLELWFERFFQNFDGVPGVVVSE-GVEPMGIAE----------
Rhizobium_legum  GDIQRAQGAQLILWNGLNLERWFEKFFQNLHDVPGAVVSD-GIEPMGISE----------
Rhizobium_etli   GDIRRAQGTRILLSNGLNLELWFQKFYQNLKDVPDVVVST-GVEPMGISE----------
Agrobacterium_r  RDIQRAQGAQLLFSNGLNLELWFQKFYRHLKDVPDVVVST-GVEPMGITE----------
Aliivibrio_salm  IDAKEISQAKLVIMNGLGFEGWMPRLIESSNFKGIEIIASNGITPLTREE-------EDH
Dickeya_dadanti  KDSKTLSQADVVFVSGLGLEGWLDRLVKASGYKGEVITASNGIKTLKMEE----------
Leptothrix_chol  GDVKRLAAADLVAINGLGFEGWIERLVKASGYRGVLQVASAGLVPRKLGP----------
Aromatoleum_aro  SDARRLGNARLIVANGLGFDAWIERLAQSAGYRGRILIASAGIRPLAEED----------
Bordetella_para  ADARKLAAAQVLVVNGLDFEAWLPRLQKAAGFAGRTVVASEGIEPRRLDDAHEEHGDHDH
                 #######################################                     


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  ----DTSVDSEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSI
Hoeflea_phototr  ----G-AYEGRANPHGWMSPGNAMIYIDNIVRALSETDPDNADAYAANGARYKDEITATF
GOS_1326010      ----G-PYKDKPNPHAWMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLF
Haemophilus_inf  ----G-PYKDAPNPHAWMSPSNALIYIENIKNALVKYDPQNAAVYEKNAADYAQKIKQLD
Rhodopseudomo_s  ----G-PYSGKPNPHAWMSPSNALIYVENIRKALVKYDPANAAAYDQNAADYAARIKALD
Rhodopseudomo    ----G-PYAGKPNPHAWMSPSNALIYVENIRKALVTYDPSNKDAYDRNAADYSARIRALD
Agrobacterium_t  ----G-AYQGKPNPHAWMSPDNALIYVENIRKGLAEIDPAHADVYTANAKAYSDKIKATV
Bartonella_baci  ----G-PYNGKPNPHAWMSPISALIYIDNIRDAFVKYDPKNAAIYKENAEIYKQKIRLSI
Bartonella_trib  ----G-PFSGKPNPHAWMSPTSALIYVDNIRDAFVKYDPEHAAVYKENAEIYKQKIRATI
Bartonella_quin  ----G-PFSGKPNPHAWMSQTSALIYVDNIRDAFVKYDPEHAAIYKENAEIYKQKIRATI
Bartonella_grah  ----G-PFSGKPNPHAWMSPTSALIYVDNIRDAFVKYDPEHAAIYKENAEIYKQKIRATI
Bartonella_hens  ----G-PFSGKPNPHAWMSPTSALIYVDNIRDAFVKYDPEHAPIYKENAEIYKQKIRSTI
Xanthobacter_au  ----G-PYSGKPNPHAWMSPTAALVYVDNIRDALVKYDPANATTYKANAEAYKAKITATI
Ochrobactrum_an  ----G-PYSGKPNPHAWMSPNAALIYVDNIRDAFVKNDPANADIYKANAEIYKAKIKATI
Ochrobactrum_in  ----G-PYNGKPNPHAWMSPNAALIYVDNIRDAFVKNDPANAATYKSNAEAYKAKIKAAI
Rhizobium_sp._N  ----G-PYTGKPNPHAWMSPSAAMIYVDNIRDAFVKFDPDNAETYKANAEAYKKKIEATI
Sinorhizobium_d  ----G-PYTGKPNPHAWMSPSAALVYVDNIRDAFVKYDPANEAAYKANAEAYKKKIEAAV
Sinorhizobium_e  ----G-PYTGKPNPHAWMSPSAALIYVDNIRDAFVQHDPPNAEVYKANAEAYKKKIEAAV
Rhizobium_legum  ----G-PYQGKPNPHAWMSPKNALIYVDNIRDAFAKYDPANAETYNANAEAYKQKIEATI
Rhizobium_etli   ----G-PYSGKPNPHAWMSPKNAIIYVDNIRDAFVKYDPKNAEVYKANAEAYKKEIEATI
Agrobacterium_r  ----G-PYNGKPNPHAWMSPKNAIIYVDNIRDAFVKYDPKNAEIYKANAEAYKTKIAATI
Aliivibrio_salm  HHETD-HQHGNYDPHAWNSVKNVKIYVKNIEAGLIKADPKNSNDYKRNADNYLQKLDKLE
Dickeya_dadanti  ------DGKTITDPHAWNSMKNGIVYAHNIVSALVKADPEHADDYRKQGDSYIQQLQQLD
Leptothrix_chol  ----------TPDPHAWHDPASVRLYVRNLSTALQALRPAQAASVRERTDAYLQQIDRFD
Aromatoleum_aro  --EHGHAHEGAVDPHAWQDVSNAIRYVANIAEALSQADPAGAAVYRQNAARYIAELEALD
Bordetella_para  DHDHGHHHHGDLDPHAWQDLANGATYARNIARAFAEADPAHAQAYRQRADAYVARIEALD
                             ################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  LPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMR
Hoeflea_phototr  APIRAQIEALPESRRWLVSSEAAFSYLAADFGLKEASIWAINADSQGSPQQVRRIIDLIR
GOS_1326010      ENYHQKFSELAEERKWLVTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLIN
Haemophilus_inf  EPLRAKLAQIPEAQRWLVTSEGAFSYLAKDYNLKEGYLWPINAEQQGTPQQVRKVIDLVR
Rhodopseudomo_s  EPLRRRLAAIPENQRWLVSSEGAFSYLTRDYQMKEAFLWPINADEQGTPQQVRKVIDLVR
Rhodopseudomo    EPLRKRLAEIPKDKRWLVSSEGAFSYLARDYEMKEAFLWPINADEQGTPQQVRKVIDLVR
Agrobacterium_t  QPIRDALSVLPDNKRWLVTSEGAFSYLARDFGLKELFLWPVNADSQGTPQQVRGVIDAMR
Bartonella_baci  DPIKTKLKTLPKGKRWLVTSEGAFSYLARDFGLKELYLWPINADQQGTPQQVKRVIDMVR
Bartonella_trib  DPIRAELQAVPQDKRWLVTSEGAFSYLARDFDLKELYLWPINADQQGTPQQVKHVVDMVR
Bartonella_quin  DPIRAELEAVPQDKRWLVTSEGAFSYLARDFDLKELYLWPINADQQGTPQQVKHVIDMVR
Bartonella_grah  DPIKAELEAVPQDKRWLVTSEGAFSYLARDFNLKELYLWPINADQQGTPQQVKHVIDMVR
Bartonella_hens  DPIKTELEAVPQDKRWLVTSEGAFSYLARDFDLKELYLWPINADQQGTPQQVKHVIDMVR
Xanthobacter_au  APIRAELDKVPADQRWLVTSEGAFSYLARDFGLKPLYLWPINADQQGTPQQVRRVVDRMR
Ochrobactrum_an  DPIRAELAAIPEDKRWLVSSEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVIDAVR
Ochrobactrum_in  DPIRAEMEAIPKEKRWLVSSEGAFSYLARDFNLKELYLWPINADQQGTPQQVRKVIDGVR
Rhizobium_sp._N  APIKAELDKIPAEKRWLVSSEGAFSYLTRDFGLKELYLWPINADQQGTPQQVRKVIDAVR
Sinorhizobium_d  APIRAQLDGIPLERRWLVSSEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVIDAVR
Sinorhizobium_e  APIRTELERIPAERRWLVSSEGAFSYLARDFGMKELYLWPINADQQGTPQQVRKVIDVVR
Rhizobium_legum  TPIRATLDKIPEDKRWLVSSEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVIDAVE
Rhizobium_etli   APIREKLDTIPEDKRWLVSSEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVVDAVR
Agrobacterium_r  APIREKLDTIPEDKRWLVSSEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVVDTMS
Aliivibrio_salm  ITIHQELDQIPQSKRTIITPHDAFGYFSRDYNVTFYAPQGTSTESEASAADVATIIRQIR
Dickeya_dadanti  NYATQTFAAIPKEKRKVLTSHDAFGYFAAAYGVRFLSPVGYSTESEASSKTVAKLINQIK
Leptothrix_chol  HSARARLGAIPESGRRVITSHGGFGYLGGAYGLEFLSPLGWRNDQEPSAAAVARLIAQIR
Aromatoleum_aro  ATIRRTLATVPAERRKVVSSHDAFGYFSHAYDVRFLAAAGVSTQSEPSAGGIAQLIRQLR
Bordetella_para  QRVRQLFEAIEPARRKVVSSHDAFGYFGQAYGVRFVALAGVSTDAEPSAADMARIIEQVR
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Liberibacter_as  SHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIV
Hoeflea_phototr  DNDIPVIFSESTVSPKPAEQVARETGIAYGGILYVDSLSTPDGPVPTYLDLLRVTSQTIV
GOS_1326010      EFKIPVIFSESTISPKPALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIY
Haemophilus_inf  KNNIPVVFSESTISAKPAQQVAKESGAKYGGVLYVDSLSAKNGPVPTYIDLLNVTVSTIV
Rhodopseudomo_s  KNKIPVVFSESTISDRAAKQVARESGARYGGVLYVDSLSAAGGPVPTYLDLLEVTVETIA
Rhodopseudomo    NNDIPVVFSESTISDRAAKQVAREAGARYGGVLYVDSLSAAGGPVPTYLDLLKVTVETIA
Agrobacterium_t  EHNIQVIFSESTVSADPAKQVAKETGASYGGILYVDSLSEADGPVPTYLDLLCVTSETIA
Bartonella_baci  KYNIQAVFSESTISDAPAKQVARETKAKYGGVLYVDSLSEEDGEVPTYIDLLRVTSARIA
Bartonella_trib  KYNIHAVFSESTISPAPAKQVARETGAKYGGVLYVDSLSEKNGEVPTYIDLLRVTSGRIS
Bartonella_quin  KYNIQVVFSESTISPAPAKQVARETGAKYGGVLYVDSLSEKNGEVPTYIDLLRVTSGRIS
Bartonella_grah  KYNIHAVFSESTISPAPAKQVAKETGAKYGGVLYVDSLSEKNGEVPTYIDLLRVTSGRIS
Bartonella_hens  KYNIHAVFSESTISPAPAKQVARETGAKYGGVLYVDSLSEKNGEVPTYIDLLRVTSGRIS
Xanthobacter_au  ADKIPAIFSESTISAEPAKQVARETGARYGGVLYVDSLSDAAGPVPTYLDLLRVTSTTIA
Ochrobactrum_an  ENGITAVFSESTVSPAPAKQVARETSAKYAGVLYVDSLSDPDGPVPTYIDLLKVTSSAIA
Ochrobactrum_in  KNGISAVFSESTVSPAPAKQVARETGAKYAGVLYVDSLSEPDGPVPTYIDLLKVTSRTIA
Rhizobium_sp._N  ANHIPVVFSESTISPDPAMQVARETGAKYGGVLYVDSLSEADGPVPTYADLLRVTSETIA
Sinorhizobium_d  ANNIPVVFSESTISPDPAEQVARETGAKYGGVLYVDSLSEADGPVPTYIDLLRVTSETIA
Sinorhizobium_e  ANRIPVVFSESTISPDPAEQVARETGAKYGGVLYVDSLSEADGPVPTYIDLLRVTSETIA
Rhizobium_legum  ENKIPTVFSESTVSDKPARQVARETGAHYGGVLYVDSLSEADGPVPTYIDLLRVTSDTVA
Rhizobium_etli   ANKIPAVFSESTVSDKPARQVARETGARYGGVLYVDSLSEADGPTPTYIDLLRVTSDTVV
Agrobacterium_r  VNKISAVFSESTISDKPARQVARETGTHYGGVLYVDSLSEADGPVPTYVDLLRVTSDTVA
Aliivibrio_salm  KDDIQAVFIENITDNRMIEQISNETHAHIGGKLYSDALSGPDEPATSYIKLMQHNVNTIT
Dickeya_dadanti  KEHVKLYFIENQTDPRLVKQIADASGAQPGGELYPEALTDSNGPAATYTAAFKHNVDTIA
Leptothrix_chol  KLQVRAVFIDSLKDSRLMQQIARDSGAVVGGQLHGDALTRPGGEADSYLRLMEHNVATLA
Aromatoleum_aro  REKAPAVFVESISDPRLAERISHESGARLGGMLYSDALSNADGPAPTYLDMMRHNLETLI
Bordetella_para  RERVPAVFVENIANPRLAQQLVRETQARLGGTLYSDALAQPGKPAGTYLGMFEWNAQQLA
                 ############################################################


                        370
                 =========+=
Liberibacter_as  DTLF-------
Hoeflea_phototr  NGLTATQ----
GOS_1326010      EGLSEGN----
Haemophilus_inf  KGFGK------
Rhodopseudomo_s  KGFGT------
Rhodopseudomo    KGFGA------
Agrobacterium_t  KGLSS------
Bartonella_baci  HALSEGFKGQ-
Bartonella_trib  KALLEGVKNQ-
Bartonella_quin  NALLDGVKGQ-
Bartonella_grah  NALLEGVKSQ-
Bartonella_hens  AALLEGVKGQ-
Xanthobacter_au  EGLTGGTAR--
Ochrobactrum_an  QGLKQ------
Ochrobactrum_in  NGLKQ------
Rhizobium_sp._N  KGLSQ------
Sinorhizobium_d  KGLSQ------
Sinorhizobium_e  KGLSQ------
Rhizobium_legum  KGLADGLSQ--
Rhizobium_etli   KGLAEGLSQ--
Agrobacterium_r  KGLAEGLSQ--
Aliivibrio_salm  QALK-------
Dickeya_dadanti  AGMK-------
Leptothrix_chol  SALGAAPAPRN
Aromatoleum_aro  KGLAPPP----
Bordetella_para  AALRP------
                 ###        






Parameters used
Minimum Number Of Sequences For A Conserved Position: 14
Minimum Number Of Sequences For A Flanking Position: 22
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 2 selected block(s)
Flanks: [83  159]  [193  363]  

New number of positions in input.fasta-gb:  248  (66% of the original 371 positions)





Protein Domains

PROTOCOL


Interpro, default parameters at EBI


RESULTS ANALYSIS


After we have done analyses we obtained 18 results with 2 distinct E values with a good significance (1.2e-38 ,2.6e-34) that show us two domains named Adhesion lipoprotein and Adhesin B, which have the same biological process, cell adhesion (GO:0007155). This is a family of ABC transporter metal-binding lipoprotein, an exemple we can find in the interpro is is the periplasmic zinc-binding protein TroA P96116 that interacts with an ATP-binding cassette transport system in Treponema pallidum and it participates in the transport of zinc across the cytoplasmic membrane, we also can find related proteins in gram-positive and gram-negative bacteria.

This domains may correspond to a superfamily named "Helical backbone" with the function of transport metal-binding lipoproteins.


RAW RESULTS:

Translation	5719A58CDDEBF608	291	Gene3D	G3DSA:3.40.50.1980	no description	18	160	3.8e-44	T	17-Mar-2010	NULL	NULL	
Translation	5719A58CDDEBF608	291	Gene3D	G3DSA:3.40.50.1980	no description	159	289	3.6e-35	T	17-Mar-2010	NULL	NULL	
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	19	37	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	50	63	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	63	80	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	174	195	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	227	245	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00690	ADHESNFAMILY	253	272	1.2e-38	T	17-Mar-2010	IPR006128	Adhesion lipoprotein	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	19	40	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	44	62	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	63	82	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	174	191	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	200	218	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	223	240	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	FPrintScan	PR00691	ADHESINB	245	263	2.6e-34	T	17-Mar-2010	IPR006129	Adhesin B	Biological Process: cell adhesion (GO:0007155)
Translation	5719A58CDDEBF608	291	SignalPHMM	SignalP	signal-peptide	1	15	NA	?	17-Mar-2010	NULL	NULL
Translation	5719A58CDDEBF608	291	HMMPfam	PF01297	SBP_bac_9	2	287	1.2e-70	T	17-Mar-2010	IPR006127	ABC transporter metal-binding lipoprotein	Biological Process: metal ion transport (GO:0030001), Molecular Function: metal ion binding (GO:0046872)
Translation	5719A58CDDEBF608	291	superfamily	SSF53807	"Helical backbone" metal receptor	18	289	8.7e-85	T	17-Mar-2010	NULL	NULL	

Phylogeny

PROTOCOL


a) Phylogeny.fr / BioNJ method / default step by step / out group:(b-proteobacteria,g-proteobacteria)

b) Phylogeny.fr / PhyML method / default step by step / out group:(b-proteobacteria,g-proteobacteria)


RESULTS ANALYSIS


In the tree made with the BioNJ method we got a conclusive result because our ORF is close to the ingroups and all the outgroup have a significant distance, so we can say that our sequence have a homology with the ingroups, by using the bootstraps values(0,97) we see that our ORF probably is related with the Hoeflea present in the phylogenetic tree.

For the PhyML tree we got similar results, the ingroups are close to the ORF and the outgroup have a significant distance from our sequence, using the bootstraps values we will obtain the same result (0,97), which confirm that our sequence have a high probability of being related with the Hoeflea and consequently it may be an a-proteobacteria.



RAW RESULTS

    a) BioNJ
                         -----0.1----
 
                                                                          +---------Bartonella_bacilliformis (a-proteobacteria)
                                                                    1     |
                                                                +---------+   +--Bartonella_tribocorum_CIP (a-proteobacteria)
                                                                |         |   |
                                                                |     0,99+---+--Bartonella_quintana_str (a-proteobacteria)
                                                                |             |
                                                                |         0,36|+--Bartonella_grahamii_as4aup (a-proteobacteria)
                                                           0,53++             ++
                                                               ||         0.53 +---Bartonella_henselae_str.(a-proteobacteria)
                                                               ||
                                                               ||
                                                          0,49++|   1  +-----Ochrobactrum_anthropi_ATCC_49188 (a-proteobacteria)
                                                              ||+------+
                                                              ||       +------Ochrobactrum_intermedium_LMG_3301 (a-proteobacteria)
                                                              ||
                                                        0,87  |+--------------Xanthobacter_autotrophicus (a-proteobacteria)
                                                          +---+
                                                          |   |      +-----Rhizobium_sp._NGR234 (a-proteobacteria)
                                                          |   |   1  |
                                                          |   |+-----++----Sinorhizobium_medicae (a-proteobacteria)
                                                          |   || 0,86++
                                                          |   ||      +----Sinorhizobium_meliloti_1021 (a-proteobacteria)
                                                          |   ++0,57
                                                    0,31  |    |    +-------Rhizobium_leguminosarum_bv._trifolii_WSM1325 (a-proteobacteria)
                                                        +-+    |  1 |
                                                        | |    +----+  1 +----Rhizobium_etli_Kim_5 (a-proteobacteria)
                                                        | |         +----+
                                                        | |              |
                                                        | |              +------Agrobacterium_radiobacter_K84 (a-proteobacteria)
                                                        | |
                                                  0,42+-+ |           +-------------Haemophilus_influenzae_Rd (a-proteobacteria)
                                                      | | +-----------+
                                                      | |             |       +-----Rhodopseudomonas_palustris_DX-1 (a-proteobacteria)
                                                 0,39 | |             +-------+
                                                    +-+ |                     +-------Rhodopseudomo (a-proteobacteria)
                                                    | | |
                                          0,97      | | +-------------------Agrobacterium_tumefaciens_str._C58 (a-proteobacteria)
                                    +---------------+ |
                                    |               | +--------------------------------------GOS_1326010
                 1                  |               |
 +----------------------------------+               +----------------------------------Hoeflea_phototrophica_DFL-43 (a-proteobacteria)
 |                                  |
 |                                  +------------------------------------------------------Liberibacter_asiaticus_str (a-proteobacteria)
 |
 |
 |                           +-------------------------------------Aromatoleum_aromaticum_Out (b-proteobacteria)
 |           1               |
 +---------------------------+    0,72   +--------------------------------------Aliivibrio_salmonicida_Out (g-proteobacteria)
                             | +---------+
                             | |         +------------------------------------------------Dickeya_dadantii_Out (Enterobacteria)
                         0,32+-+
                               |0,42 +-------------------------------------------------------Leptothrix_cholodnii_Out (b-proteobacteria)
                               +-----+
                                     +--------------------------------------Bordetella_parapertussis_Out (b-proteobacteria)


___________________________________________________________________________________________________________________________________________


                                                                           ------0.2-----
 b) PhyML

                                    +----------------------------------Liberibacter_asiaticus_str (a-proteobacteria)
                                    |
             1                      |                  +------------------------Hoeflea_phototrophica_DFL-43 (a-proteobacteria)
 +----------------------------------+                  |
 |                                  |     0,97         |  +---------------------------GOS_1326010 
 |                                  +------------------+  |
 |                                                     |  | +--------------Agrobacterium_tumefaciens_str._C58 (a-proteobacteria)
 |                                                     |  | |
 |                                                0,071+--+ |              +-------Haemophilus_influenzae_Rd (a-proteobacteria)
 |                                                        | |         1    |
 |                                                        | |   +----------+
 |                                                        | |   |          |0,99  +--Rhodopseudomonas_palustris_DX-1 (a-proteobacteria)
 |                                                    0,41+-+   |          +------+
 |                                                          |   |                 +-----Rhodopseudomo (a-proteobacteria)
 |                                                          |   |
 |                                                          |   |  0,98+---Rhizobium_sp._NGR234 (a-proteobacteria)
 |                                                          |   |  +---+
 |                                                          |   |  |   | +--Sinorhizobium_medicae (a-proteobacteria)
 |                                                      0,71+---+  |   +-+0,89
 |                                                              |  |     +---Sinorhizobium_meliloti_1021 (a-proteobacteria)
 |                                                              |+-+0,3
 |                                                              || |   +----Rhizobium_leguminosarum_bv._trifolii_WSM1325 (a-proteobacteria)
 |                                                              || |   |0,96
 |                                                              || +---+   +---Rhizobium_etli_Kim_5 (a-proteobacteria)
 |                                                              ||     +---+0,98
 |                                                              ||         +----Agrobacterium_radiobacter_K84 (a-proteobacteria)
 |                                                          0,79++
 |                                                               |
 |                                                               |    +----------Xanthobacter_autotrophicus (a-proteobacteria)
 |                                                               |  +-+0,87
 |                                                               |  | |    +--Ochrobactrum_anthropi_ATCC_49188 (a-proteobacteria)
 |                                                               |  | +----+1
 |                                                               |  |      +-----Ochrobactrum_intermedium_LMG_3301 (a-proteobacteria)
 |                                                               +--+0,87
 |                                                                  |       +------Bartonella_bacilliformis (a-proteobacteria)
 |                                                                  |    1  |
 |                                                                  +-------+ +-Bartonella_quintana_str (a-proteobacteria)
 |                                                                          | |0,68
 |                                                                          +-+--Bartonella_tribocorum_CIP (a-proteobacteria)
 |                                                                            |0,74
 |                                                                            |+-Bartonella_grahamii_as4aup (a-proteobacteria)
 |                                                                            ++0,77
 |                                                                             +-Bartonella_henselae_str. (a-proteobacteria)
 |
 |
 |                                0,42 +-------------------------------Aliivibrio_salmonicida_Out (g-proteobacteria)
 |                             +-------+
 |            1                |       +--------------------------------Dickeya_dadantii_Out (Enterobacteria)
 +-----------------------------+
                               |   +------------------------Aromatoleum_aromaticum_Out (b-proteobacteria)
                               +---+
                             0,54  |      +---------------------------------------------Leptothrix_cholodnii_Out (b-proteobacteria)
                                   +------+
                                     0,68 +------------------------Bordetella_parapertussis_Out (b-proteobacteria)



Taxonomy report

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Max target sequences _1000"


RESULTS ANALYSIS


All results that belong to the Rhizobiales order are a-proteobacterias with good mean of scores such as 343.A high score suggest that it is a credible result with a low E-value like 8e-101. This will suggest that our protein belongs to an a-proteobacteria since they are the ones with the best homology.

The ingroups we choose were all a-proteobacterias so they have the maxim proximity to the protein sequence in study, the outgroups that were selected belong to different classes but have the same order, b-proteobacteria, g-proteobacteria and Enterobacteria, this will allow a comparison between this species in a phylogenetic tree.


RAW RESULTS:


Lineage Report

cellular organisms
. Bacteria                             [bacteria]
. . Proteobacteria                       [proteobacteria]
. . . Alphaproteobacteria                  [a-proteobacteria]
. . . . Rhizobiales                          [a-proteobacteria]
. . . . . Rhizobiaceae                         [a-proteobacteria]
. . . . . . Rhizobium/Agrobacterium group        [a-proteobacteria]
. . . . . . . Rhizobium                            [a-proteobacteria]
. . . . . . . . Rhizobium leguminosarum              [a-proteobacteria]
. . . . . . . . . Rhizobium leguminosarum bv. trifolii [a-proteobacteria]
. . . . . . . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ---------------  370  4 hits [a-proteobacteria]    periplasmic solute binding protein [Rhizobium leguminosarum
. . . . . . . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...............  149  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhizobium leguminosarum
. . . . . . . . . Rhizobium leguminosarum bv. viciae 3841 ----------------------  368  4 hits [a-proteobacteria]    iron ABC transporter substrate binding protein [Rhizobium l
. . . . . . . . Rhizobium etli Kim 5 -------------------------------------------  360  1 hit  [a-proteobacteria]    iron ABC transporter substrate binding protein [Rhizobium e
. . . . . . . . Rhizobium sp. NGR234 ...........................................  347  2 hits [a-proteobacteria]    putative iron transport protein, periplasmic-binding protei
. . . . . . . . Rhizobium etli Brasil 5 ........................................  177  1 hit  [a-proteobacteria]    probable zinc ABC transporter, substrate-binding protein [R
. . . . . . . . Rhizobium etli CIAT 652 ........................................  176  2 hits [a-proteobacteria]    probable zinc ABC transporter, substrate-binding protein [R
. . . . . . . . Rhizobium etli CIAT 894 ........................................  151  1 hit  [a-proteobacteria]    putative solute-binding component of ABC transporter [Rhizo
. . . . . . . . Rhizobium etli CFN 42 ..........................................  149  2 hits [a-proteobacteria]    zinc ABC transporter substrate-binding protein [Rhizobium e
. . . . . . . . Rhizobium etli GR56 ............................................  147  1 hit  [a-proteobacteria]    probable zinc ABC transporter, substrate-binding protein [R
. . . . . . . Agrobacterium radiobacter K84 ------------------------------------  347  4 hits [a-proteobacteria]    zinc ABC transporter [Agrobacterium radiobacter K84] >gi|22
. . . . . . . Agrobacterium tumefaciens str. C58 ...............................  337  2 hits [a-proteobacteria]    ABC transporter, substrate binding protein (iron) [Agrobact
. . . . . . . Agrobacterium vitis S4 ...........................................  163  2 hits [a-proteobacteria]    ABC transporter substrate binding protein [Agrobacterium vi
. . . . . . Sinorhizobium meliloti 1021 ----------------------------------------  359  2 hits [a-proteobacteria]    putative IRON-binding periplasmic ABC transporter protein [
. . . . . . Sinorhizobium medicae WSM419 .......................................  350  2 hits [a-proteobacteria]    periplasmic solute binding protein [Sinorhizobium medicae W
. . . . . . Candidatus Liberibacter asiaticus str. psy62 .......................  236  2 hits [a-proteobacteria]    periplasmic solute binding protein [Candidatus Liberibacter
. . . . . Xanthobacter autotrophicus Py2 ---------------------------------------  357  4 hits [a-proteobacteria]    periplasmic solute binding protein [Xanthobacter autotrophi
. . . . . Bartonella bacilliformis KC583 .......................................  356  4 hits [a-proteobacteria]    iron chelate ABC transporter, periplasmic iron chelate-bind
. . . . . Bartonella tribocorum CIP 105476 .....................................  353  4 hits [a-proteobacteria]    Iron transport protein, periplasmic-binding protein [Barton
. . . . . Bartonella grahamii as4aup ...........................................  351  4 hits [a-proteobacteria]    iron transport protein YfeA [Bartonella grahamii as4aup] >g
. . . . . Bartonella quintana str. Toulouse ....................................  350  4 hits [a-proteobacteria]    Iron transport protein yfeA [Bartonella quintana str. Toulo
. . . . . Bartonella henselae str. Houston-1 ...................................  349  4 hits [a-proteobacteria]    Iron transport protein yfeA [Bartonella henselae str. Houst
. . . . . Rhodopseudomonas palustris DX-1 ......................................  343  4 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . . Ochrobactrum anthropi ATCC 49188 .....................................  342  2 hits [a-proteobacteria]    periplasmic solute binding protein [Ochrobactrum anthropi A
. . . . . Ochrobactrum intermedium LMG 3301 ....................................  333  2 hits [a-proteobacteria]    Metal ABC transporter substrate-binding lipoprotein precurs
. . . . . Rhodopseudomonas palustris HaA2 ......................................  332  4 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . . Fulvimarina pelagi HTCC2506 ..........................................  327  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . . Hoeflea phototrophica DFL-43 .........................................  320  2 hits [a-proteobacteria]    putative substrate-binding Fur regulated iron ABC transport
. . . . . Aurantimonas manganoxydans SI85-9A1 ..................................  315  2 hits [a-proteobacteria]    ABC-type metal transport system protein [Aurantimonas manga
. . . . . Methylobacterium extorquens AM1 ......................................  177  2 hits [a-proteobacteria]    putative ABC transporter, periplasmic protein [Methylobacte
. . . . . Methylobacterium extorquens PA1 ......................................  176  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium extorq
. . . . . Methylobacterium extorquens DM4 ......................................  176  2 hits [a-proteobacteria]    putative ABC transporter, periplasmic protein [Methylobacte
. . . . . Beijerinckia indica subsp. indica ATCC 9039 ..........................  175  2 hits [a-proteobacteria]    periplasmic solute binding protein [Beijerinckia indica sub
. . . . . Methylobacterium chloromethanicum CM4 ................................  173  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium chloro
. . . . . Rhodopseudomonas palustris BisB18 ....................................  167  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . . Methylobacterium populi BJ001 ........................................  167  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium populi
. . . . . Nitrobacter sp. Nb-311A ..............................................  166  2 hits [a-proteobacteria]    Periplasmic solute binding protein [Nitrobacter sp. Nb-311A
. . . . . Rhodopseudomonas palustris TIE-1 .....................................  164  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . . Nitrobacter hamburgensis X14 .........................................  160  2 hits [a-proteobacteria]    periplasmic solute binding protein [Nitrobacter hamburgensi
. . . . . Bradyrhizobium japonicum USDA 110 ....................................  159  2 hits [a-proteobacteria]    ABC transporter substrate-binding protein [Bradyrhizobium j
. . . . . Bradyrhizobium sp. ORS278 ............................................  158  2 hits [a-proteobacteria]    ABC transporter substrate-binding protein [Bradyrhizobium s
. . . . . Nitrobacter winogradskyi Nb-255 ......................................  158  2 hits [a-proteobacteria]    periplasmic solute binding protein [Nitrobacter winogradsky
. . . . . Rhodopseudomonas palustris BisA53 ....................................  158  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . . Methylobacterium nodulans ORS 2060 ...................................  156  4 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium nodula
. . . . . Azorhizobium caulinodans ORS 571 .....................................  156  2 hits [a-proteobacteria]    ABC transporter periplasmic binding protein precursor [Azor
. . . . . Rhodopseudomonas palustris CGA009 ....................................  156  2 hits [a-proteobacteria]    ABC transporter, periplasmic binding protein [Rhodopseudomo
. . . . . Oligotropha carboxidovorans OM5 ......................................  152  2 hits [a-proteobacteria]    periplasmic chelated iron-binding protein YfeA [Oligotropha
. . . . . Methylobacterium sp. 4-46 ............................................  151  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium sp. 4-
. . . . . Methylocella silvestris BL2 ..........................................  145  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylocella silvestris
. . . . . Methylobacterium radiotolerans JCM 2831 ..............................  142  2 hits [a-proteobacteria]    periplasmic solute binding protein [Methylobacterium radiot
. . . . . Rhodopseudomonas palustris BisB5 .....................................  137  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodopseudomonas palust
. . . . Rhodospirillum rubrum ATCC 11170 ---------------------------------------  348  4 hits [a-proteobacteria]    twin-arginine translocation pathway signal [Rhodospirillum 
. . . . Labrenzia alexandrii DFL-11 ............................................  342  4 hits [a-proteobacteria]    Periplasmic solute binding protein family [Labrenzia alexan
. . . . Roseovarius sp. HTCC2601 ...............................................  335  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Octadecabacter antarcticus 307 .........................................  335  2 hits [a-proteobacteria]    Periplasmic solute binding protein family [Octadecabacter a
. . . . Rhodobacter sphaeroides ATCC 17025 .....................................  334  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodobacter sphaeroides
. . . . Rhodobacter sphaeroides 2.4.1 ..........................................  331  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Octadecabacter antarcticus 238 .........................................  330  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Rhodobacter sphaeroides KD131 ..........................................  330  2 hits [a-proteobacteria]    Periplasmic solute binding protein precursor [Rhodobacter s
. . . . Rhodobacter sphaeroides ATCC 17029 .....................................  329  2 hits [a-proteobacteria]    periplasmic solute binding protein [Rhodobacter sphaeroides
. . . . Labrenzia aggregata IAM 12614 ..........................................  329  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Rhodobacterales bacterium Y4I ..........................................  327  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Rhodobacterales bacterium HTCC2150 .....................................  323  2 hits [a-proteobacteria]    Iron transport protein yfeA [Rhodobacterales bacterium HTCC
. . . . Sulfitobacter sp. NAS-14.1 .............................................  323  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Sulfitobacter sp. EE-36 ................................................  322  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Rhodobacterales bacterium HTCC2654 .....................................  322  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Paracoccus denitrificans PD1222 ........................................  319  2 hits [a-proteobacteria]    periplasmic solute binding protein [Paracoccus denitrifican
. . . . Thalassiobium sp. R2A62 ................................................  318  2 hits [a-proteobacteria]    periplasmic chelated iron-binding protein YfeA [Thalassiobi
. . . . Dinoroseobacter shibae DFL 12 ..........................................  316  2 hits [a-proteobacteria]    metal ABC transporter substrate-binding lipoprotein [Dinoro
. . . . Roseobacter sp. GAI101 .................................................  316  2 hits [a-proteobacteria]    ABC Mn+2/Fe+2 transporter, periplasmic substrate-binding pr
. . . . Citreicella sp. SE45 ...................................................  311  2 hits [a-proteobacteria]    periplasmic chelated iron-binding protein YfeA [Citreicella
. . . . Roseobacter sp. CCS2 ...................................................  308  2 hits [a-proteobacteria]    putative iron-binding periplasmic abc transporter protein [
. . . . Azospirillum sp. B510 ..................................................  136  2 hits [a-proteobacteria]    zinc/manganese transport system substrate-binding protein [
. . . Shewanella violacea DSS12 ------------------------------------------------  370  2 hits [g-proteobacteria]    Iron transport protein, periplasmic-binding protein [Shewan
. . . Photobacterium sp. SKA34 .................................................  365  2 hits [g-proteobacteria]    Iron transport protein [Photobacterium sp. SKA34] >gi|89051
. . . Photobacterium angustum S14 ..............................................  364  2 hits [g-proteobacteria]    Iron transport protein, periplasmic-binding protein [Vibrio
. . . Escherichia coli .........................................................  356 15 hits [enterobacteria]      ABC transport system, periplasmic binding protein SitA [Esc
. . . Escherichia coli ED1a ....................................................  355  2 hits [enterobacteria]      iron transport protein, periplasmic-binding protein [Escher
. . . Haemophilus influenzae 22.4-21 ...........................................  355  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Escherichia coli SMS-3-5 .................................................  355  4 hits [enterobacteria]      iron/manganese transport system periplasmic binding protein
. . . Escherichia coli 042 .....................................................  354  1 hit  [enterobacteria]      iron ABC transporter, substrate-binding protein [Escherichi
. . . Haemophilus influenzae R3021 .............................................  354  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Yersinia mollaretii ATCC 43969 ...........................................  354  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia mo
. . . Shigella sonnei Ss046 ....................................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella boydii Sb227 ....................................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella dysenteriae Sd197 ...............................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella flexneri 5 str. 8401 ............................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella dysenteriae 1012 ................................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella flexneri ........................................................  354  1 hit  [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella flexneri 2002017 ................................................  354  1 hit  [enterobacteria]      Iron transport protein [Shigella sonnei Ss046] >gi|82544177
. . . Shigella flexneri 2a str. 2457T ..........................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella flexneri 2a str. 2457T] >g
. . . Shigella flexneri 2a str. 301 ............................................  354  2 hits [enterobacteria]      Iron transport protein [Shigella flexneri 2a str. 2457T] >g
. . . Escherichia coli APEC O1 .................................................  353  4 hits [enterobacteria]      SitA [Escherichia coli APEC O1] >gi|170650778|ref|YP_001739
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  353  4 hits [enterobacteria]      SitA [Escherichia coli APEC O1] >gi|170650778|ref|YP_001739
. . . Escherichia coli S88 .....................................................  353  4 hits [enterobacteria]      SitA [Escherichia coli APEC O1] >gi|170650778|ref|YP_001739
. . . Psychromonas sp. CNPT3 ...................................................  353  2 hits [g-proteobacteria]    iron transporter: fur regulated [Psychromonas sp. CNPT3] >g
. . . Haemophilus influenzae PittHH ............................................  353  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Haemophilus influenzae PittGG ............................................  353  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Escherichia coli SE15 ....................................................  353  1 hit  [enterobacteria]      iron ABC transporter substrate binding component [Escherich
. . . Escherichia coli UTI89 ...................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli 536 .....................................................  353  4 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli F11 .....................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli IAI39 ...................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli UMN026 ..................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli 83972 ...................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli FVEC1412 ................................................  353  2 hits [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Escherichia coli IHE3034 .................................................  353  1 hit  [enterobacteria]      putative iron transport protein, periplasmic-binding protei
. . . Shigella boydii CDC 3083-94 ..............................................  353  2 hits [enterobacteria]      iron/manganese transport system periplasmic binding protein
. . . Haemophilus influenzae Rd KW20 ...........................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae 86-028NP ..........................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae 3655 ..............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae PittAA ............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae 6P18H1 ............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae 7P49H1 ............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae RdAW ..............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae NT127 .............................................  353  2 hits [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae ...................................................  353  1 hit  [g-proteobacteria]    iron-chelated ABC transporter periplasmic-binding protein [
. . . Haemophilus influenzae PittEE ............................................  352  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Haemophilus influenzae PittII ............................................  352  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Moritella sp. PE36 .......................................................  352  2 hits [g-proteobacteria]    iron transporter: fur regulated [Moritella sp. PE36] >gi|14
. . . Haemophilus influenzae R2846 .............................................  352  1 hit  [g-proteobacteria]    COG0803: ABC-type metal ion transport system, periplasmic c
. . . Haemophilus influenzae R2866 .............................................  352  1 hit  [g-proteobacteria]    COG0803: ABC-type metal ion transport system, periplasmic c
. . . Yersinia rohdei ATCC 43380 ...............................................  351  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia ro
. . . Citrobacter rodentium ICC168 .............................................  351  2 hits [enterobacteria]      iron ABC transporter, substrate-binding protein [Citrobacte
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  350  2 hits [enterobacteria]      periplasmic-binding protein [Yersinia enterocolitica subsp.
. . . Providencia stuartii ATCC 25827 ..........................................  350  2 hits [enterobacteria]      hypothetical protein PROSTU_02238 [Providencia stuartii ATC
. . . Providencia alcalifaciens DSM 30120 ......................................  350  2 hits [enterobacteria]      hypothetical protein PROVALCAL_02504 [Providencia alcalifac
. . . Citrobacter sp. 30_2 .....................................................  349  2 hits [enterobacteria]      iron transporter [Citrobacter sp. 30_2] >gi|226908295|gb|EE
. . . Yersinia frederiksenii ATCC 33641 ........................................  349  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia fr
. . . Yersinia kristensenii ATCC 33638 .........................................  349  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia kr
. . . Haemophilus influenzae 22.1-21 ...........................................  349  2 hits [g-proteobacteria]    putative periplasmic chelated iron binding protein [Haemoph
. . . Yersinia bercovieri ATCC 43970 ...........................................  349  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia be
. . . Pasteurella dagmatis ATCC 43325 ..........................................  348  2 hits [g-proteobacteria]    iron ABC superfamily ATP binding cassette transporter, bind
. . . Yersinia pseudotuberculosis YPIII ........................................  348  2 hits [enterobacteria]      periplasmic solute binding protein [Yersinia pseudotubercul
. . . Yersinia intermedia ATCC 29909 ...........................................  348  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia in
. . . Citrobacter koseri ATCC BAA-895 ..........................................  347  4 hits [enterobacteria]      hypothetical protein CKO_00940 [Citrobacter koseri ATCC BAA
. . . Enterobacter hormaechei ..................................................  347  1 hit  [enterobacteria]      hypothetical protein CKO_00940 [Citrobacter koseri ATCC BAA
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  347  2 hits [enterobacteria]      hypothetical protein SARI_00111 [Salmonella enterica subsp.
. . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  347  4 hits [enterobacteria]      iron chelate ABC superfamily ATP binding cassette transport
. . . Yersinia pestis KIM 10 ...................................................  347  2 hits [enterobacteria]      periplasmic-binding protein [Yersinia pestis KIM 10] >gi|45
. . . Yersinia pestis biovar Microtus str. 91001 ...............................  347  2 hits [enterobacteria]      periplasmic-binding protein [Yersinia pestis KIM 10] >gi|45
. . . Yersinia pestis CA88-4125 ................................................  347  2 hits [enterobacteria]      periplasmic-binding protein [Yersinia pestis KIM 10] >gi|45
. . . Yersinia pestis CO92 .....................................................  347  2 hits [enterobacteria]      periplasmic-binding protein [Yersinia pestis KIM 10] >gi|45
. . . Yersinia pseudotuberculosis IP 32953 .....................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Antiqua ..................................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Nepal516 .................................................  347  4 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Pestoides F ..............................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Angola ...................................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Orientalis str. IP275 .............................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis FV-1 .....................................................  347  1 hit  [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pseudotuberculosis PB1/+ ........................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Pestoides A ..............................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis biovar Orientalis str. India 195 .........................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis KIM D27 ..................................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis Z176003 ..................................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis ..........................................................  347  2 hits [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis D106004 ..................................................  347  1 hit  [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pestis D182038 ..................................................  347  1 hit  [enterobacteria]      ABC transporter, periplasmic iron siderophore-binding prote
. . . Yersinia pseudotuberculosis IP 31758 .....................................  346  2 hits [enterobacteria]      chelated iron ABC transporter, periplasmic iron binding pro
. . . Erwinia tasmaniensis Et1/99 ..............................................  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Erwini
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  346  2 hits [enterobacteria]      iron transporter: fur regulated [Salmonella enterica subsp.
. . . Enterobacter cancerogenus ATCC 35316 .....................................  346  2 hits [enterobacteria]      iron chelate ABC transporter, periplasmic iron chelate-bind
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhi ........................  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  346  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  346  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Salmon
. . . Proteus mirabilis HI4320 .................................................  345  2 hits [enterobacteria]      iron ABC transporter, periplasmic substrate-binding protein
. . . Proteus mirabilis ATCC 29906 .............................................  345  2 hits [enterobacteria]      iron ABC transporter, periplasmic substrate-binding protein
. . . Salmonella enterica subsp. salamae serovar Sofia .........................  345  1 hit  [enterobacteria]      iron transporter SitA [Salmonella enterica subsp. salamae s
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  345  2 hits [enterobacteria]      periplasmic chelated iron-binding protein YfeA [Salmonella 
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  345  2 hits [enterobacteria]      periplasmic chelated iron-binding protein YfeA [Salmonella 
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  345  2 hits [enterobacteria]      periplasmic chelated iron-binding protein YfeA [Salmonella 
. . . Aggregatibacter actinomycetemcomitans D7S-1 ..............................  344  2 hits [g-proteobacteria]    iron ABC superfamily ATP binding cassette transporter, bind
. . . Aggregatibacter actinomycetemcomitans ....................................  344  1 hit  [g-proteobacteria]    iron ABC superfamily ATP binding cassette transporter, bind
. . . Aggregatibacter aphrophilus NJ8700 .......................................  344  2 hits [g-proteobacteria]    AfeA [Aggregatibacter aphrophilus NJ8700] >gi|247533576|gb|
. . . Aggregatibacter actinomycetemcomitans D11S-1 .............................  344  2 hits [g-proteobacteria]    AfeA [Aggregatibacter actinomycetemcomitans D11S-1] >gi|261
. . . Providencia rustigianii DSM 4541 .........................................  344  2 hits [enterobacteria]      iron chelate ABC transporter, periplasmic iron chelate-bind
. . . Photorhabdus asymbiotica .................................................  343  2 hits [enterobacteria]      iron (chelated) abc transporter, periplasmic-binding protei
. . . Serratia odorifera DSM 4582 ..............................................  343  2 hits [enterobacteria]      iron ABC superfamily ATP binding cassette transporter, bind
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................  342  2 hits [g-proteobacteria]    YfeA [Pasteurella multocida subsp. multocida str. Pm70] >gi
. . . Erwinia pyrifoliae Ep1/96 ................................................  342  2 hits [enterobacteria]      Iron transport protein, periplasmic-binding protein [Erwini
. . . Erwinia pyrifoliae DSM 12163 .............................................  342  1 hit  [enterobacteria]      Iron transport protein, periplasmic-binding protein [Erwini
. . . Citrobacter youngae ATCC 29220 ...........................................  342  2 hits [enterobacteria]      iron chelate ABC transporter, periplasmic iron chelate-bind
. . . Providencia rettgeri DSM 1131 ............................................  342  2 hits [enterobacteria]      iron chelate ABC transporter, periplasmic iron chelate-bind
. . . Klebsiella pneumoniae 342 ................................................  342  2 hits [enterobacteria]      iron ABC transporter, periplasmic iron-binding protein [Kle
. . . Klebsiella pneumoniae NTUH-K2044 .........................................  342  2 hits [enterobacteria]      iron ABC transporter, periplasmic iron-binding protein [Kle
. . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  342  2 hits [enterobacteria]      Iron (chelated) ABC transporter, periplasmic-binding protei
. . . Enterobacter sp. 638 .....................................................  342  4 hits [enterobacteria]      periplasmic solute binding protein [Enterobacter sp. 638] >
. . . Serratia odorifera 4Rx13 .................................................  342  2 hits [enterobacteria]      hypothetical protein SOD_a07800 [Serratia odorifera 4Rx13] 
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  342  2 hits [enterobacteria]      iron transporter: fur regulated [Klebsiella pneumoniae subs
. . . Xenorhabdus bovienii SS-2004 .............................................  342  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA precursor [X
. . . Pectobacterium wasabiae WPP163 ...........................................  341  6 hits [enterobacteria]      periplasmic solute binding protein [Pectobacterium wasabiae
. . . Klebsiella variicola At-22 ...............................................  341  2 hits [enterobacteria]      periplasmic solute binding protein [Klebsiella variicola At
. . . Klebsiella sp. 1_1_55 ....................................................  341  2 hits [enterobacteria]      manganese/iron transport system substrate-binding protein [
. . . Sodalis glossinidius str. 'morsitans' ....................................  340  2 hits [enterobacteria]      iron ABC transporter periplasmic component [Sodalis glossin
. . . Yersinia ruckeri ATCC 29473 ..............................................  340  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia ru
. . . Erwinia amylovora ........................................................  338  1 hit  [enterobacteria]      Iron ABC transport system, periplasmic component [Erwinia a
. . . Erwinia amylovora ATCC 49946 .............................................  338  2 hits [enterobacteria]      Iron ABC transport system, periplasmic component [Erwinia a
. . . Erwinia amylovora CFBP1430 ...............................................  338  1 hit  [enterobacteria]      Iron ABC transport system, periplasmic component [Erwinia a
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  338  3 hits [enterobacteria]      periplasmic chelated iron-binding protein [Pectobacterium c
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  338  2 hits [enterobacteria]      periplasmic chelated iron-binding protein [Pectobacterium c
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  338  4 hits [enterobacteria]      periplasmic solute binding protein [Pectobacterium carotovo
. . . Pectobacterium atrosepticum SCRI1043 .....................................  337  4 hits [enterobacteria]      periplasmic chelated iron-binding protein [Pectobacterium a
. . . Yersinia aldovae ATCC 35236 ..............................................  337  2 hits [enterobacteria]      Periplasmic chelated iron-binding protein yfeA [Yersinia al
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................  335  2 hits [enterobacteria]      chelated iron ABC transporter, periplasmic iron binding pro
. . . Arsenophonus nasoniae ....................................................  333  1 hit  [enterobacteria]      iron ABC transporter, periplasmic substrate-binding protein
. . . Serratia proteamaculans 568 ..............................................  330  2 hits [enterobacteria]      periplasmic solute binding protein [Serratia proteamaculans
. . . Eikenella corrodens ATCC 23834 ...........................................  330  2 hits [b-proteobacteria]    hypothetical protein EIKCOROL_00734 [Eikenella corrodens AT
. . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  329  2 hits [g-proteobacteria]    periplasmic-binding protein [Mannheimia haemolytica serotyp
. . . Mannheimia haemolytica serotype A2 str. OVINE ............................  329  2 hits [g-proteobacteria]    periplasmic-binding protein [Mannheimia haemolytica serotyp
. . . Dickeya zeae Ech1591 .....................................................  329  4 hits [enterobacteria]      periplasmic solute binding protein [Dickeya zeae Ech1591] >
. . . Cardiobacterium hominis ATCC 15826 .......................................  328  2 hits [g-proteobacteria]    iron chelate ABC superfamily ATP binding cassette transport
. . . Mannheimia haemolytica PHL213 ............................................  328  2 hits [g-proteobacteria]    iron (Fe3+) ABC superfamily ATP binding cassette transporte
. . . Haemophilus ducreyi 35000HP ..............................................  322  2 hits [g-proteobacteria]    iron (chelated) ABC transporter, periplasmic-binding protei
. . . Haemophilus somnus 2336 ..................................................  321  2 hits [g-proteobacteria]    periplasmic solute binding protein [Haemophilus somnus 2336
. . . Haemophilus somnus 129PT .................................................  321  2 hits [g-proteobacteria]    chelated iron ABC transporter, periplasmic-binding protein 
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  320  2 hits [g-proteobacteria]    iron (chelated) ABC transporter, periplasmic- binding prote
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  320  1 hit  [g-proteobacteria]    COG0803: ABC-type metal ion transport system, periplasmic c
. . . Actinobacillus pleuropneumoniae L20 ......................................  320  2 hits [g-proteobacteria]    COG0803: ABC-type metal ion transport system, periplasmic c
. . . Actinobacillus minor NM305 ...............................................  316  2 hits [g-proteobacteria]    chelated iron ABC transporter, periplasmic-binding protein 
. . . Actinobacillus minor 202 .................................................  316  2 hits [g-proteobacteria]    chelated iron ABC transporter, periplasmic-binding protein 
. . . Escherichia coli CFT073 ..................................................  314  2 hits [enterobacteria]      SitA protein [Escherichia coli CFT073] >gi|26107869|gb|AAN8
. . . Haemophilus parasuis SH0165 ..............................................  313  2 hits [g-proteobacteria]    chelated iron ABC transporter, periplasmic-binding protein 
. . . Haemophilus parasuis 29755 ...............................................  313  3 hits [g-proteobacteria]    phosphoribosylglycinamide formyltransferase [Haemophilus pa
. . . Pantoea ananatis LMG 20103 ...............................................  309  2 hits [enterobacteria]      YfeA [Pantoea ananatis LMG 20103] >gi|291154783|gb|ADD79367
. . . Dichelobacter nodosus VCS1703A ...........................................  298  2 hits [g-proteobacteria]    periplasmic iron-binding protein YfeA [Dichelobacter nodosu
. . . Campylobacter fetus subsp. fetus 82-40 ...................................  285  2 hits [e-proteobacteria]    AfeA [Campylobacter fetus subsp. fetus 82-40] >gi|118413441
. . . Campylobacter fetus subsp. venerealis str. Azul-94 .......................  281  1 hit  [e-proteobacteria]    AfeA [Campylobacter fetus subsp. venerealis str. Azul-94]
. . . Proteus penneri ATCC 35198 ...............................................  268  2 hits [enterobacteria]      hypothetical protein PROPEN_04329 [Proteus penneri ATCC 351
. . . Salmonella enterica subsp. enterica serovar Typhi str. AG3 ...............  251  1 hit  [enterobacteria]      periplasmic chelated iron-binding protein YfeA [Salmonella 
. . . Pantoea sp. At-9b ........................................................  201  2 hits [enterobacteria]      periplasmic solute binding protein [Pantoea sp. At-9b] >gi|
. . . Halorhodospira halophila SL1 .............................................  196  2 hits [g-proteobacteria]    periplasmic solute binding protein [Halorhodospira halophil
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  195  1 hit  [enterobacteria]      periplasmic chelated iron-binding protein YfeA [Salmonella 
. . . Mannheimia haemolytica ...................................................  189  1 hit  [g-proteobacteria]    ABC transport system periplasmic protein [Mannheimia haemol
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................  167  2 hits [g-proteobacteria]    periplasmic solute binding protein [Alkalilimnicola ehrlich
. . . Escherichia sp. 3_2_53FAA ................................................  167  2 hits [enterobacteria]      SitA [Escherichia sp. 3_2_53FAA] >gi|226903118|gb|EEH89377.
. . . Aromatoleum aromaticum EbN1 ..............................................  153  2 hits [b-proteobacteria]    ABC transporter, periplasmic binding protein precursor [Aro
. . . Geobacter sp. M18 ........................................................  153  2 hits [d-proteobacteria]    periplasmic solute binding protein [Geobacter sp. M18] >gi|
. . . Azoarcus sp. BH72 ........................................................  152  2 hits [b-proteobacteria]    putative manganese transport system, periplasmic-binding pr
. . . Desulfobacterium autotrophicum HRM2 ......................................  150  2 hits [d-proteobacteria]    putative ABC-type manganese/zinc transport system, substrat
. . . Pseudomonas fluorescens Pf0-1 ............................................  149  2 hits [g-proteobacteria]    periplasmic solute binding protein [Pseudomonas fluorescens
. . . Curvibacter putative symbiont of Hydra magnipapillata ....................  149  1 hit  [b-proteobacteria]    hypothetical protein [Curvibacter putative symbiont of Hydr
. . . Pseudomonas syringae pv. oryzae str. 1_6 .................................  148  1 hit  [g-proteobacteria]    periplasmic solute binding protein [Pseudomonas syringae pv
. . . Pseudomonas syringae pv. syringae B728a ..................................  148  2 hits [g-proteobacteria]    periplasmic solute binding protein [Pseudomonas syringae pv
. . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  146  1 hit  [enterobacteria]      hypothetical protein SentesT_29730 [Salmonella enterica sub
. . . Geobacter sp. M21 ........................................................  146  2 hits [d-proteobacteria]    periplasmic solute binding protein [Geobacter sp. M21] >gi|
. . . Variovorax paradoxus S110 ................................................  145  2 hits [b-proteobacteria]    periplasmic solute binding protein [Variovorax paradoxus S1
. . . Dickeya dadantii Ech703 ..................................................  145  2 hits [enterobacteria]      periplasmic solute binding protein [Dickeya dadantii Ech703
. . . Polaromonas naphthalenivorans CJ2 ........................................  144  2 hits [b-proteobacteria]    periplasmic solute binding protein [Polaromonas naphthaleni
. . . Pseudomonas fluorescens SBW25 ............................................  144  2 hits [g-proteobacteria]    putative ABC transport system, periplasmic protein [Pseudom
. . . Tolumonas auensis DSM 9187 ...............................................  144  2 hits [g-proteobacteria]    periplasmic solute binding protein [Tolumonas auensis DSM 9
. . . Geobacter bemidjiensis Bem ...............................................  144  2 hits [d-proteobacteria]    periplasmic solute binding protein [Geobacter bemidjiensis 
. . . Photobacterium profundum SS9 .............................................  143  2 hits [g-proteobacteria]    hypothetical protein PBPRB0544 [Photobacterium profundum SS
. . . Laribacter hongkongensis HLHK9 ...........................................  142  2 hits [b-proteobacteria]    ZnuA [Laribacter hongkongensis HLHK9] >gi|226715201|gb|ACO7
. . . Rhodoferax ferrireducens T118 ............................................  142  2 hits [b-proteobacteria]    periplasmic solute binding protein [Rhodoferax ferrireducen
. . . Pseudomonas syringae pv. tomato T1 .......................................  141  2 hits [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Bordetella pertussis Tohama I ............................................  140  2 hits [b-proteobacteria]    putative periplasmic solute binding protein [Bordetella per
. . . Dickeya dadantii Ech586 ..................................................  140  2 hits [enterobacteria]      periplasmic solute binding protein [Dickeya dadantii Ech586
. . . Photobacterium profundum 3TCK ............................................  140  2 hits [g-proteobacteria]    hypothetical protein P3TCK_06312 [Photobacterium profundum 
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  140  2 hits [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Pseudomonas syringae pv. aesculi str. 2250 ...............................  140  1 hit  [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ..........................  139  1 hit  [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  139  1 hit  [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  139  2 hits [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Pseudomonas fluorescens Pf-5 .............................................  139  2 hits [g-proteobacteria]    cation ABC transporter, periplasmic cation-binding protein 
. . . Bordetella parapertussis 12822 ...........................................  139  1 hit  [b-proteobacteria]    putative periplasmic solute binding protein [Bordetella par
. . . Bordetella bronchiseptica RB50 ...........................................  139  2 hits [b-proteobacteria]    putative periplasmic solute binding protein [Bordetella par
. . . Bordetella parapertussis .................................................  139  1 hit  [b-proteobacteria]    putative periplasmic solute binding protein [Bordetella par
. . . Aliivibrio salmonicida LFI1238 ...........................................  138  2 hits [g-proteobacteria]    periplasmic solute binding protein [Aliivibrio salmonicida 
. . . Verminephrobacter eiseniae EF01-2 ........................................  137  2 hits [b-proteobacteria]    periplasmic solute binding protein [Verminephrobacter eisen
. . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................  137  2 hits [b-proteobacteria]    periplasmic solute binding protein [Candidatus Accumulibact
. . . Leptothrix cholodnii SP-6 ................................................  137  2 hits [b-proteobacteria]    periplasmic solute binding protein [Leptothrix cholodnii SP
. . Verrucomicrobium spinosum DSM 4136 -----------------------------------------  319  1 hit  [verrucomicrobia]     periplasmic-binding protein [Verrucomicrobium spinosum DSM 
. . Treponema vincentii ATCC 35580 .............................................  307  2 hits [spirochetes]         Periplasmic solute binding protein [Treponema vincentii ATC
. . Cyanothece sp. PCC 7425 ....................................................  303  2 hits [cyanobacteria]       periplasmic solute binding protein [Cyanothece sp. PCC 7425
. . Cyanothece sp. CCY0110 .....................................................  298  2 hits [cyanobacteria]       Mn transporter; MntC [Cyanothece sp. CCY0110] >gi|126621472
. . Cyanothece sp. ATCC 51142 ..................................................  298  2 hits [cyanobacteria]       Mn2+ ABC transporter, periplasmic binding protein [Cyanothe
. . Crocosphaera watsonii WH 8501 ..............................................  295  2 hits [cyanobacteria]       Periplasmic solute binding protein [Crocosphaera watsonii W
. . Synechococcus sp. PCC 7335 .................................................  293  2 hits [cyanobacteria]       Periplasmic solute binding protein family [Synechococcus sp
. . Thermosynechococcus elongatus BP-1 .........................................  293  2 hits [cyanobacteria]       periplasmic-binding protein of chelated iron ABC transporte
. . Arthrobacter sp. FB24 ......................................................  291  2 hits [high GC Gram+]       periplasmic solute binding protein [Arthrobacter sp. FB24] 
. . Synechocystis sp. PCC 6803 .................................................  290  5 hits [cyanobacteria]       Mn transporter; MntC [Synechocystis sp. PCC 6803] >gi|75507
. . Synechocystis sp. ..........................................................  290  1 hit  [cyanobacteria]       Mn transporter; MntC [Synechocystis sp. PCC 6803] >gi|75507
. . Arthrobacter aurescens TC1 .................................................  283  2 hits [high GC Gram+]       putative ABC-type metal ion transport system [Arthrobacter 
. . Brevibacterium linens BL2 ..................................................  280  1 hit  [high GC Gram+]       manganese ABC transporter manganese-binding protein [Brevib
. . Synechococcus sp. RS9916 ...................................................  279  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Sy
. . Rhodococcus erythropolis PR4 ...............................................  278  2 hits [high GC Gram+]       manganese ABC transporter manganese-binding protein [Rhodoc
. . Rhodococcus erythropolis SK121 .............................................  277  2 hits [high GC Gram+]       periplasmic chelated iron-binding protein YfeA [Rhodococcus
. . marine actinobacterium PHSC20C1 ............................................  277  2 hits [high GC Gram+]       putative ABC transporter substrate-binding protein [marine 
. . Nocardia farcinica IFM 10152 ...............................................  277  2 hits [high GC Gram+]       putative ABC transporter substrate-binding protein [Nocardi
. . Thermobifida fusca YX ......................................................  275  2 hits [high GC Gram+]       putative ABC transporter substrate-binding protein [Thermob
. . Prochlorococcus marinus str. NATL2A ........................................  273  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Rothia mucilaginosa DY-18 ..................................................  273  2 hits [high GC Gram+]       ABC-type metal ion transport system, periplasmic component/
. . Prochlorococcus marinus str. NATL1A ........................................  273  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Rothia mucilaginosa ATCC 25296 .............................................  273  2 hits [high GC Gram+]       periplasmic chelated iron-binding protein YfeA [Rothia muci
. . Synechococcus sp. PCC 7002 .................................................  271  2 hits [cyanobacteria]       periplasmic solute binding protein [Synechococcus sp. PCC 7
. . Rhodococcus opacus B4 ......................................................  270  2 hits [high GC Gram+]       manganese ABC transporter manganese-binding protein [Rhodoc
. . Saccharopolyspora erythraea NRRL 2338 ......................................  266  3 hits [high GC Gram+]       iron transport protein-binding protein [Saccharopolyspora e
. . Thermosynechococcus vulcanus ...............................................  266  1 hit  [cyanobacteria]       manganese solute binding protein [Thermosynechococcus vulca
. . Mycobacterium gilvum PYR-GCK ...............................................  265  2 hits [high GC Gram+]       periplasmic solute binding protein [Mycobacterium gilvum PY
. . Rhodococcus jostii RHA1 ....................................................  264  2 hits [high GC Gram+]       ABC metal ion transporter, substrate-binding protein [Rhodo
. . Synechococcus sp. WH 7805 ..................................................  259  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Sy
. . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ....................  258  2 hits [high GC Gram+]       ABC-type metal ion transport system, periplasmic component/
. . Synechococcus sp. CC9605 ...................................................  258  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Synechococcus sp
. . Prochlorococcus marinus subsp. marinus str. CCMP1375 .......................  257  2 hits [cyanobacteria]       ABC-type Mn2+/Zn2+ transport system periplasmic component [
. . Mycobacterium vanbaalenii PYR-1 ............................................  256  2 hits [high GC Gram+]       periplasmic solute binding protein [Mycobacterium vanbaalen
. . Synechococcus sp. WH 5701 ..................................................  256  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Sy
. . Brachybacterium faecium DSM 4810 ...........................................  256  2 hits [high GC Gram+]       ABC-type metal ion transport system, periplasmic component/
. . Synechococcus sp. WH 7803 ..................................................  255  2 hits [cyanobacteria]       ABC-type Mn2+ transport system, periplasmic component [Syne
. . Cyanobium sp. PCC 7001 .....................................................  254  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Cy
. . Synechococcus sp. WH 8109 ..................................................  254  2 hits [cyanobacteria]       periplasmic chelated iron-binding protein YfeA [Synechococc
. . Actinomyces coleocanis DSM 15436 ...........................................  253  2 hits [high GC Gram+]       metal cation ABC superfamily ATP binding cassette transport
. . Actinomyces sp. oral taxon 848 str. F0332 ..................................  252  2 hits [high GC Gram+]       iron chelate ABC transporter, periplasmic iron chelate-bind
. . Aeromicrobium marinum DSM 15272 ............................................  251  2 hits [high GC Gram+]       iron chelate ABC superfamily ATP binding cassette transport
. . Sanguibacter keddieii DSM 10542 ............................................  251  2 hits [high GC Gram+]       ABC-type metal ion transport system, periplasmic component/
. . Kocuria rhizophila DC2201 ..................................................  251  2 hits [high GC Gram+]       manganese ABC transporter substrate-binding protein [Kocuri
. . Atopobium parvulum DSM 20469 ...............................................  249  2 hits [high GC Gram+]       periplasmic solute binding protein [Atopobium parvulum DSM 
. . Mobiluncus curtisii ATCC 43063 .............................................  248  2 hits [high GC Gram+]       metal cation ABC superfamily ATP binding cassette transport
. . Corynebacterium jeikeium K411 ..............................................  248  2 hits [high GC Gram+]       manganese ABC transport system, solute-binding protein [Cor
. . Corynebacterium jeikeium ATCC 43734 ........................................  248  2 hits [high GC Gram+]       iron chelate ABC superfamily ATP binding cassette transport
. . Mobiluncus mulieris ATCC 35243 .............................................  247  2 hits [high GC Gram+]       metal cation ABC superfamily ATP binding cassette transport
. . Mobiluncus mulieris 28-1 ...................................................  247  2 hits [high GC Gram+]       metal cation ABC superfamily ATP binding cassette transport
. . Synechococcus sp. BL107 ....................................................  247  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Sy
. . Atopobium rimae ATCC 49626 .................................................  246  2 hits [high GC Gram+]       periplasmic chelated iron-binding protein YfeA [Atopobium r
. . Corynebacterium kroppenstedtii DSM 44385 ...................................  246  2 hits [high GC Gram+]       manganese ABC transport system, solute-binding protein [Cor
. . Synechococcus sp. CC9902 ...................................................  246  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Synechococcus sp
. . Synechococcus sp. RCC307 ...................................................  246  2 hits [cyanobacteria]       ABC-type Mn2+ transport system, periplasmic component [Syne
. . Synechococcus sp. CC9311 ...................................................  243  2 hits [cyanobacteria]       cation ABC transporter, cation-binding protein [Synechococc
. . Prochlorococcus marinus str. MIT 9313 ......................................  241  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Prochlorococcus marinus str. MIT 9215 ......................................  241  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Prochlorococcus marinus str. MIT 9202 ......................................  241  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Pr
. . Synechococcus sp. WH 8102 ..................................................  239  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Synechococcus sp
. . Prochlorococcus marinus str. MIT 9303 ......................................  239  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . uncultured Prochlorococcus marinus clone HF10-11A3 .........................  238  1 hit  [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [un
. . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ......................  238  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Prochlorococcus marinus str. MIT 9515 ......................................  238  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Prochlorococcus marinus str. MIT 9211 ......................................  237  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Prochlorococcus marinus str. MIT 9301 ......................................  236  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Synechococcus sp. RS9917 ...................................................  234  2 hits [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [Sy
. . uncultured Prochlorococcus marinus clone HF10-11H7 .........................  232  1 hit  [cyanobacteria]       ABC transporter, substrate binding protein, possibly Mn [un
. . Beutenbergia cavernae DSM 12333 ............................................  231  2 hits [high GC Gram+]       periplasmic solute binding protein [Beutenbergia cavernae D
. . Prochlorococcus marinus str. AS9601 ........................................  229  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Jonesia denitrificans DSM 20603 ............................................  226  2 hits [high GC Gram+]       periplasmic solute binding protein [Jonesia denitrificans D
. . Prochlorococcus marinus str. MIT 9312 ......................................  225  2 hits [cyanobacteria]       ABC transporter substrate-binding protein [Prochlorococcus 
. . Actinosynnema mirum DSM 43827 ..............................................  222  2 hits [high GC Gram+]       periplasmic solute binding protein [Actinosynnema mirum DSM
. . Listeria innocua Clip11262 .................................................  207  1 hit  [firmicutes]          hypothetical protein lin1961 [Listeria innocua Clip11262] >
. . Listeria innocua ...........................................................  207  2 hits [firmicutes]          hypothetical protein lin1961 [Listeria innocua Clip11262] >
. . Listeria monocytogenes str. 4b F2365 .......................................  207  4 hits [firmicutes]          ABC transporter, manganese-binding protein [Listeria monocy
. . Listeria monocytogenes str. 4b H7858 .......................................  207  2 hits [firmicutes]          ABC transporter, manganese-binding protein [Listeria monocy
. . Listeria monocytogenes Clip80459 ...........................................  207  4 hits [firmicutes]          ABC transporter, manganese-binding protein [Listeria monocy
. . Listeria monocytogenes FSL J1-194 ..........................................  206  4 hits [firmicutes]          ABC transporter [Listeria monocytogenes FSL J1-194] >gi|254
. . Listeria monocytogenes FSL R2-503 ..........................................  206  2 hits [firmicutes]          ABC transporter [Listeria monocytogenes FSL J1-194] >gi|254
. . Listeria monocytogenes HPB2262 .............................................  206  4 hits [firmicutes]          ABC transporter [Listeria monocytogenes FSL J1-194] >gi|254
. . Listeria monocytogenes FSL J2-064 ..........................................  206  2 hits [firmicutes]          ABC transporter [Listeria monocytogenes FSL J1-194] >gi|254
. . Listeria monocytogenes FSL J1-175 ..........................................  206  2 hits [firmicutes]          ABC transporter [Listeria monocytogenes FSL J1-194] >gi|254
. . Listeria welshimeri serovar 6b str. SLCC5334 ...............................  206  2 hits [firmicutes]          manganese ABC transporter substrate-binding protein [Lister
. . Listeria monocytogenes Finland 1988 ........................................  206  1 hit  [firmicutes]          hypothetical protein LmonF1_10519 [Listeria monocytogenes F
. . Listeria monocytogenes 10403S ..............................................  205  1 hit  [firmicutes]          hypothetical protein Lmon1_09363 [Listeria monocytogenes 10
. . Listeria monocytogenes FSL J2-003 ..........................................  205  1 hit  [firmicutes]          hypothetical protein LmonocytFSL_02309 [Listeria monocytoge
. . Listeria seeligeri serovar 1/2b str. SLCC3954 ..............................  205  2 hits [firmicutes]          ABC transporter, manganese-binding protein [Listeria seelig
. . Listeria monocytogenes EGD-e ...............................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes str. 1/2a F6854 .....................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes FSL R2-561 ..........................................  205  2 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes J0161 ...............................................  205  2 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes J2818 ...............................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes F6900 ...............................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes LO28 ................................................  205  1 hit  [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes 08-5578 .............................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes 08-5923 .............................................  205  4 hits [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes .....................................................  205  1 hit  [firmicutes]          hypothetical protein lmo1847 [Listeria monocytogenes EGD-e]
. . Listeria monocytogenes FSL N3-165 ..........................................  205  4 hits [firmicutes]          ABC transporter manganese-binding protein [Listeria monocyt
. . Exiguobacterium sibiricum 255-15 ...........................................  205  2 hits [firmicutes]          periplasmic solute binding protein [Exiguobacterium sibiric
. . Listeria monocytogenes FSL N1-017 ..........................................  204  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Listeria monocytogenes FSL J2-071 ..........................................  204  4 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Listeria monocytogenes HCC23 ...............................................  204  4 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Bacillus cereus BDRD-ST196 .................................................  201  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus cereus BDRD-ST
. . Brevibacillus brevis NBRC 100599 ...........................................  201  2 hits [firmicutes]          manganese ABC transporter substrate binding protein [Brevib
. . Bacillus pumilus ATCC 7061 .................................................  201  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Bacillus cytotoxicus NVH 391-98 ............................................  200  2 hits [firmicutes]          periplasmic solute binding protein [Bacillus cereus subsp. 
. . Bacillus cereus Rock1-3 ....................................................  199  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus cereus Rock1-3
. . Bacillus cereus G9842 ......................................................  199  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [Ba
. . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .....................  199  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus thuringiensis 
. . Bacillus thuringiensis serovar israelensis ATCC 35646 ......................  199  2 hits [firmicutes]          Manganese-binding protein [Bacillus thuringiensis serovar i
. . Bacillus thuringiensis IBL 4222 ............................................  199  2 hits [firmicutes]          Manganese-binding protein [Bacillus thuringiensis serovar i
. . Bacillus thuringiensis serovar sotto str. T04001 ...........................  199  2 hits [firmicutes]          Manganese-binding protein [Bacillus thuringiensis serovar i
. . Bacillus cereus AH603 ......................................................  199  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus cereus AH603] 
. . Bacillus cereus Rock3-29 ...................................................  199  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus cereus Rock3-2
. . Bacillus anthracis str. A2012 ..............................................  198  1 hit  [firmicutes]          COG0803: ABC-type metal ion transport system, periplasmic c
. . Bacillus anthracis str. Ames ...............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. 'Ames Ancestor' ....................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. Sterne .............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0488 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0442 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0193 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0465 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0389 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0174 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis Tsiankovskii-I ..........................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus cereus NVH0597-99 .................................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. CDC 684 ............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus cereus Rock3-42 ...................................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A0248 ..............................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. CNEVA-9066 .........................................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. A1055 ..............................................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. Western North America USA6153 ......................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. Kruger B ...........................................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. Vollum .............................................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus anthracis str. Australia 94 .......................................  198  1 hit  [firmicutes]          adhesion lipoprotein [Bacillus anthracis str. Ames] >gi|475
. . Bacillus cereus R309803 ....................................................  198  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus cereus R309803
. . Bacillus cereus E33L .......................................................  198  2 hits [firmicutes]          adhesion lipoprotein [Bacillus cereus E33L] >gi|66970667|gb
. . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ........................  197  2 hits [firmicutes]          Manganese-binding lipoprotein mntA [Bacillus thuringiensis 
. . Bacillus thuringiensis str. Al Hakam .......................................  196  2 hits [firmicutes]          manganese ABC transporter, manganese-binding protein [Bacil
. . Bacillus cereus 03BB108 ....................................................  196  2 hits [firmicutes]          manganese ABC transporter, manganese-binding protein [Bacil
. . Bacillus cereus 03BB102 ....................................................  196  2 hits [firmicutes]          manganese ABC transporter, manganese-binding protein [Bacil
. . Bacillus cereus BGSC 6E1 ...................................................  196  2 hits [firmicutes]          manganese ABC transporter, manganese-binding protein [Bacil
. . Enterococcus faecium Com15 .................................................  196  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium Co
. . Enterococcus faecium DO ....................................................  194  3 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium 1,230,933 .............................................  194  4 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium 1,231,502 .............................................  194  4 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium 1,231,410 .............................................  194  4 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium C68 ...................................................  194  4 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium E1039 .................................................  194  2 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium E1162 .................................................  194  4 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium E1071 .................................................  194  2 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium U0317 .................................................  194  2 hits [firmicutes]          Periplasmic solute binding protein [Enterococcus faecium DO
. . Enterococcus faecium 1,231,501 .............................................  194  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium TC 6 ..................................................  194  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium D344SRF ...............................................  194  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium E1636 .................................................  194  1 hit  [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Bacillus pumilus SAFR-032 ..................................................  194  2 hits [firmicutes]          metal cation ABC transporter ATP-binding protein [Bacillus 
. . Enterococcus faecium 1,141,733 .............................................  194  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium E1679 .................................................  194  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [En
. . Granulicatella adiacens ATCC 49175 .........................................  194  2 hits [firmicutes]          manganese ABC superfamily ATP binding cassette transporter,
. . Streptococcus sanguinis ....................................................  194  3 hits [firmicutes]          RecName: Full=Manganese ABC transporter substrate-binding l
. . Bacillus licheniformis ATCC 14580 ..........................................  193  4 hits [firmicutes]          manganese transport system substrate-binding protein [Bacil
. . Enterococcus faecium E980 ..................................................  193  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [En
. . Enterococcus faecium 1,231,408 .............................................  193  4 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium Com12 .................................................  193  2 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecium 1,
. . Enterococcus faecium TX1330 ................................................  193  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis PC1.1 ................................................  193  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Bacillus pseudofirmus OF4 ..................................................  193  4 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [Ba
. . Catonella morbi ATCC 51271 .................................................  192  2 hits [firmicutes]          hypothetical protein GCWU000282_00081 [Catonella morbi ATCC
. . Streptococcus anginosus ....................................................  192  2 hits [firmicutes]          RecName: Full=Manganese ABC transporter substrate-binding l
. . Streptococcus sanguinis SK36 ...............................................  192  2 hits [firmicutes]          manganese/Zinc ABC transporter substrate-binding protein [S
. . Streptococcus oralis ATCC 35037 ............................................  192  3 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Streptococcus oralis .......................................................  192  3 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Streptococcus sp. M143 .....................................................  191  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipop
. . Streptococcus parasanguinis ................................................  191  2 hits [firmicutes]          RecName: Full=Manganese ABC transporter substrate-binding l
. . Staphylococcus warneri L37603 ..............................................  189  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [St
. . Streptococcus salivarius SK126 .............................................  189  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [St
. . Streptococcus mitis ........................................................  189  3 hits [firmicutes]          PsaA [Streptococcus mitis]
. . Streptococcus infantis .....................................................  189  1 hit  [firmicutes]          PsaA [Streptococcus infantis]
. . Gemella haemolysans ATCC 10379 .............................................  188  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [Ge
. . Streptococcus pneumoniae ...................................................  187 15 hits [firmicutes]          PsaA [Streptococcus pneumoniae]
. . Streptococcus pneumoniae JJA ...............................................  187  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Streptococcus pneumoniae SP18-BS74 .........................................  187  2 hits [firmicutes]          D-tyrosyl-tRNA deacylase [Streptococcus pneumoniae SP18-BS7
. . Streptococcus pneumoniae R6 ................................................  187  3 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae D39 ...............................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP3-BS71 ..........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP6-BS73 ..........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP9-BS68 ..........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP19-BS75 .........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP23-BS72 .........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CDC1873-00 ........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CDC1087-00 ........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae SP195 .............................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CDC0288-04 ........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CDC3059-06 ........................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae ATCC 700669 .......................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae P1031 .............................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae 70585 .............................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae Taiwan19F-14 ......................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CCRI 1974 .........................................  187  1 hit  [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae CCRI 1974M2 .......................................  187  1 hit  [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae TCH8431/19A .......................................  187  2 hits [firmicutes]          ABC transporter substrate-binding protein - manganese trans
. . Streptococcus pneumoniae G54 ...............................................  187  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [St
. . Streptococcus pneumoniae CGSP14 ............................................  187  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus cristatus ....................................................  187  2 hits [firmicutes]          RecName: Full=Metal ABC transporter substrate-binding lipop
. . Streptococcus pneumoniae Hungary19A-6 ......................................  187  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (ad
. . Streptococcus mitis B6 .....................................................  187  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Pn
. . Enterococcus faecalis CH188 ................................................  186  4 hits [firmicutes]          periplasmic solute binding protein [Enterococcus faecalis C
. . Streptococcus sp. 2_1_36FAA ................................................  186  2 hits [firmicutes]          metal ABC transporter substrate-binding lipoprotein [Strept
. . Enterococcus faecalis ......................................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis]
. . Enterococcus faecalis V583 .................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis TX0104 ...............................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis HH22 .................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis ATCC 29200 ...........................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis TUSoD Ef11 ...........................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis T1 ...................................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis ATCC 4200 ............................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis DS5 ..................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis Merz96 ...............................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis HIP11704 .............................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis JH1 ..................................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis Fly1 .................................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis AR01/DG ..............................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis T11 ..................................................  186  2 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis X98 ..................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis R712 .................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis V583] 
. . Bacteroides vulgatus EK4.2 .................................................  186  1 hit  [CFB group bacteria]  endocarditis specific antigen [Enterococcus faecalis V583] 
. . Enterococcus faecalis TX1322 ...............................................  186  4 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis T2 ...................................................  186  4 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis T3 ...................................................  186  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis E1Sol ................................................  186  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis D6 ...................................................  186  4 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Enterococcus faecalis T8 ...................................................  186  4 hits [firmicutes]          endocarditis specific antigen [Enterococcus faecalis T8] >g
. . Enterococcus faecalis S613 .................................................  185  4 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Enterococcus faecium .......................................................  185  3 hits [firmicutes]          Efafm [Enterococcus faecium]
. . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ...................  185  2 hits [firmicutes]          ABC-type metal ion transport system, periplasmic component/
. . Lactobacillus sakei subsp. sakei 23K .......................................  185  2 hits [firmicutes]          manganese ABC transporter, substrate-binding lipoprotein pr
. . Streptococcus pneumoniae TIGR4 .............................................  185  3 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus pneumoniae SP11-BS70 .........................................  185  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus pneumoniae MLV-016 ...........................................  185  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus gordonii str. Challis substr. CH1 ............................  184  2 hits [firmicutes]          metal ABC transporter substrate-binding lipoprotein precurs
. . Listeria grayi DSM 20601 ...................................................  184  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Bacillus cellulosilyticus DSM 2522 .........................................  184  2 hits [firmicutes]          periplasmic solute binding protein [Bacillus cellulosilytic
. . Staphylococcus carnosus subsp. carnosus TM300 ..............................  183  2 hits [firmicutes]          putative lipoprotein, AdhesinB family protein [Staphylococc
. . Enterococcus casseliflavus EC20 ............................................  183  2 hits [firmicutes]          ABC transporter, substrate binding lipoprotein [Enterococcu
. . Enterococcus casseliflavus EC30 ............................................  183  2 hits [firmicutes]          ABC transporter [Enterococcus casseliflavus EC30] >gi|25787
. . Enterococcus casseliflavus EC10 ............................................  183  2 hits [firmicutes]          ABC transporter [Enterococcus casseliflavus EC30] >gi|25787
. . Streptococcus mutans .......................................................  183  2 hits [firmicutes]          SloC [Streptococcus mutans]
. . Streptococcus equi subsp. equi 4047 ........................................  182  2 hits [firmicutes]          metal ABC transporter substrate-binding lipoprotein precurs
. . Streptococcus mutans UA159 .................................................  182  2 hits [firmicutes]          ABC transporter [Streptococcus mutans UA159] >gi|26007007|s
. . Enterococcus gallinarum EG2 ................................................  182  2 hits [firmicutes]          cation ABC transporter [Enterococcus gallinarum EG2] >gi|25
. . Granulicatella elegans ATCC 700633 .........................................  182  2 hits [firmicutes]          manganese ABC transporter manganese-binding adhesion liprot
. . Weissella paramesenteroides ATCC 33313 .....................................  182  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Streptococcus gordonii .....................................................  181  2 hits [firmicutes]          RecName: Full=Metal ABC transporter substrate-binding lipop
. . Bacillus halodurans C-125 ..................................................  181  2 hits [firmicutes]          surface adhesin A precursor [Bacillus halodurans C-125] >gi
. . Bacillus halodurans ........................................................  181  1 hit  [firmicutes]          surface adhesin A precursor [Bacillus halodurans C-125] >gi
. . Streptococcus mutans NN2025 ................................................  180  2 hits [firmicutes]          putative ABC transporter metal binding lipoprotein [Strepto
. . Lactococcus lactis subsp. lactis KF147 .....................................  179  2 hits [firmicutes]          Manganese ABC transporter, substrate-binding lipoprotein [L
. . Lactobacillus casei ATCC 334 ...............................................  179  2 hits [firmicutes]          ABC-type metal ion transport system, periplasmic component/
. . Lactobacillus casei BL23 ...................................................  179  2 hits [firmicutes]          Substrate binding protein [Lactobacillus casei BL23] >gi|22
. . Lactobacillus paracasei subsp. paracasei ATCC 25302 ........................  179  2 hits [firmicutes]          Substrate binding protein [Lactobacillus casei BL23] >gi|22
. . Lactobacillus paracasei subsp. paracasei 8700:2 ............................  179  2 hits [firmicutes]          Substrate binding protein [Lactobacillus casei BL23] >gi|22
. . Lactobacillus casei ........................................................  179  1 hit  [firmicutes]          Substrate binding protein [Lactobacillus casei BL23] >gi|22
. . Tropheryma whipplei str. Twist .............................................  179  2 hits [high GC Gram+]       iron ABC transporter substrate-binding protein [Tropheryma 
. . Tropheryma whipplei TW08/27 ................................................  178  2 hits [high GC Gram+]       ABC-transporter periplasmic solute-binding subunit [Tropher
. . Lactococcus lactis subsp. lactis Il1403 ....................................  178  2 hits [firmicutes]          manganese ABC transporter substrate binding protein [Lactoc
. . Lactococcus lactis subsp. lactis ...........................................  178  1 hit  [firmicutes]          manganese ABC transporter substrate binding protein [Lactoc
. . Streptococcus agalactiae 2603V/R ...........................................  177  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus agalactiae A909 ..............................................  177  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus agalactiae H36B ..............................................  177  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus agalactiae COH1 ..............................................  177  2 hits [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Streptococcus agalactiae ...................................................  177  1 hit  [firmicutes]          manganese ABC transporter, manganese-binding adhesion lipro
. . Lactobacillus plantarum JDM1 ...............................................  177  2 hits [firmicutes]          manganese ABC transporter, substrate binding protein [Lacto
. . Lactobacillus plantarum WCFS1 ..............................................  177  2 hits [firmicutes]          manganese ABC transporter, substrate binding protein [Lacto
. . Lactobacillus plantarum subsp. plantarum ATCC 14917 ........................  177  2 hits [firmicutes]          manganese ABC transporter, substrate binding protein [Lacto
. . Lactobacillus plantarum ....................................................  177  1 hit  [firmicutes]          manganese ABC transporter, substrate binding protein [Lacto
. . Macrococcus caseolyticus JCSC5402 ..........................................  176  2 hits [firmicutes]          ABC transporter extracellular binding protein homolog [Macr
. . Staphylococcus hominis SK119 ...............................................  175  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein [St
. . Streptococcus pyogenes MGAS5005 ............................................  174  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS5005]
. . Streptococcus pyogenes MGAS315 .............................................  174  2 hits [firmicutes]          putative metal binding protein of ABC transporter [Streptoc
. . Streptococcus pyogenes str. Manfredo .......................................  174  2 hits [firmicutes]          metal ABC transporter substrate-binding lipoprotein precurs
. . Streptococcus pyogenes MGAS10394 ...........................................  174  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS10394
. . Streptococcus pyogenes MGAS8232 ............................................  174  2 hits [firmicutes]          putative metal binding protein of ABC transporter (lipoprot
. . Streptococcus pyogenes serotype M18 ........................................  174  1 hit  [firmicutes]          putative metal binding protein of ABC transporter (lipoprot
. . Streptococcus pyogenes serotype M6 .........................................  174  1 hit  [firmicutes]          putative metal binding protein of ABC transporter (lipoprot
. . Streptococcus pyogenes MGAS6180 ............................................  174  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS6180]
. . Streptococcus pyogenes MGAS10270 ...........................................  174  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS6180]
. . Streptococcus pyogenes MGAS10750 ...........................................  174  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS6180]
. . Streptococcus pyogenes M1 GAS ..............................................  174  2 hits [firmicutes]          metal binding protein of ABC transporter (lipoprotein) [Str
. . Streptococcus pyogenes serotype M1 .........................................  174  2 hits [firmicutes]          metal binding protein of ABC transporter (lipoprotein) [Str
. . Streptococcus pyogenes serotype M3 .........................................  174  1 hit  [firmicutes]          metal binding protein of ABC transporter (lipoprotein) [Str
. . Streptococcus equi subsp. zooepidemicus MGCS10565 ..........................  174  2 hits [firmicutes]          ABC metal transporter substrate-binding lipoprotein precurs
. . Streptococcus equi subsp. zooepidemicus ....................................  174  2 hits [firmicutes]          metal ABC transporter substrate-binding lipoprotein precurs
. . Staphylococcus epidermidis W23144 ..........................................  173  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Streptococcus agalactiae NEM316 ............................................  173  2 hits [firmicutes]          hypothetical protein gbs1589 [Streptococcus agalactiae NEM3
. . Streptococcus agalactiae 515 ...............................................  173  2 hits [firmicutes]          hypothetical protein gbs1589 [Streptococcus agalactiae NEM3
. . Lactococcus lactis subsp. cremoris MG1363 ..................................  173  2 hits [firmicutes]          manganese ABC transporter substrate binding protein [Lactoc
. . Streptococcus pyogenes MGAS9429 ............................................  173  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS9429]
. . Streptococcus pyogenes MGAS2096 ............................................  173  2 hits [firmicutes]          manganese-binding protein [Streptococcus pyogenes MGAS9429]
. . Streptococcus pyogenes .....................................................  172  3 hits [firmicutes]          lipoprotein mtsA, metal binding [validated] - Streptococcus
. . Staphylococcus haemolyticus JCSC1435 .......................................  172  2 hits [firmicutes]          hypothetical protein SH0141 [Staphylococcus haemolyticus JC
. . Staphylococcus aureus A9635 ................................................  172  2 hits [firmicutes]          periplasmic solute binding protein [Staphylococcus aureus A
. . Staphylococcus capitis SK14 ................................................  172  2 hits [firmicutes]          manganese ABC transporter substrate-binding lipoprotein (Ad
. . Streptococcus uberis 0140J .................................................  172  2 hits [firmicutes]          extracellular manganese-binding protein [Streptococcus uber
. . Streptococcus uberis .......................................................  172  1 hit  [firmicutes]          extracellular manganese-binding protein [Streptococcus uber
. . Lactobacillus rhamnosus GG .................................................  171  3 hits [firmicutes]          ABC transporter manganese-binding lipoprotein [Lactobacillu
. . Staphylococcus aureus subsp. aureus Mu50 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus N315 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus MW2 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus MRSA252 ................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus MSSA476 ................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus COL ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus RF122 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus USA300_FPR3757 .........................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus JH9 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus JH1 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus str. Newman ............................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus Mu3 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus USA300_TCH1516 .........................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus str. JKD6008 ...........................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus str. JKD6009 ...........................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus MN8 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus TCH60 ..................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus TCH70 ..................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus str. CF-Marseille ......................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus USA300_TCH959 ..........................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus TCH130 .................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus Mu50-omega .............................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus 55/2053 ................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus 65-1322 ................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus 68-397 .................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus E1410 ..................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus M876 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A9781 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A9763 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A9719 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A9299 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A8115 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A6300 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A6224 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A5948 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A5937 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus D30 ..................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus ED98 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A8117 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus C160 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus Btn1260 ................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus WW2703/97 ..............................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus WBG10049 ...............................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus M899 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus D139 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus C427 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A9765 ................................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus C101 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus A10102 ...............................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus H19 ....................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus A017934/97 .............................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus 132 ....................................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus 58-424 .................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus M809 ...................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus M1015 ..................................  170  2 hits [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus TW20 ...................................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus subsp. aureus ST398 ..................................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Staphylococcus aureus 04-02981 .............................................  170  1 hit  [firmicutes]          lipoprotein [Staphylococcus aureus subsp. aureus Mu50] >gi|
. . Lactobacillus rhamnosus LMS2-1 .............................................  170  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Lactobacillus rhamnosus Lc 705 .............................................  170  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Lactobacillus rhamnosus HN001 ..............................................  170  2 hits [firmicutes]          ABC-type metal ion transport system, periplasmic component/
. . Staphylococcus lugdunensis HKU09-01 ........................................  169  2 hits [firmicutes]          Manganese ABC transporter, periplasmic-binding protein SitA
. . Streptococcus pyogenes NZ131 ...............................................  169  2 hits [firmicutes]          Metal ABC transporter substrate-binding lipoprotein precurs
. . Staphylococcus epidermidis ATCC 12228 ......................................  168  2 hits [firmicutes]          lipoprotein [Staphylococcus epidermidis ATCC 12228] >gi|578
. . Staphylococcus epidermidis RP62A ...........................................  168  2 hits [firmicutes]          lipoprotein [Staphylococcus epidermidis ATCC 12228] >gi|578
. . Staphylococcus epidermidis BCM-HMP0060 .....................................  168  2 hits [firmicutes]          lipoprotein [Staphylococcus epidermidis ATCC 12228] >gi|578
. . Staphylococcus epidermidis SK135 ...........................................  168  2 hits [firmicutes]          lipoprotein [Staphylococcus epidermidis ATCC 12228] >gi|578
. . Staphylococcus epidermidis .................................................  168  1 hit  [firmicutes]          lipoprotein [Staphylococcus epidermidis ATCC 12228] >gi|578
. . Streptococcus gallolyticus UCN34 ...........................................  168  2 hits [firmicutes]          Putative manganese ABC transporter, substrate-binding lipro
. . Staphylococcus epidermidis M23864:W2(grey) .................................  167  2 hits [firmicutes]          iron ABC superfamily ATP binding cassette transporter, perm
. . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ......................  166  2 hits [firmicutes]          manganese-binding protein [Streptococcus dysgalactiae subsp
. . Streptococcus gallolyticus .................................................  166  1 hit  [firmicutes]          FimB [Streptococcus gallolyticus]
. . Staphylococcus aureus subsp. aureus NCTC 8325 ..............................  166  2 hits [firmicutes]          ABC transporter, substrate-binding protein, putative [Staph
. . Staphylococcus aureus ......................................................  166  2 hits [firmicutes]          ABC transporter, substrate-binding protein, putative [Staph
. . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...............  164  2 hits [firmicutes]          putative ABC-type Mn Zn transport system periplasmic Mn Zn-
. . Bacillus selenitireducens MLS10 ............................................  162  2 hits [firmicutes]          ABC-type metal ion transport system periplasmic component/s
. . Staphylococcus xylosus .....................................................  161  1 hit  [firmicutes]          ABC metal ion transport system extracellular binding protei
. . Staphylococcus epidermidis M23864:W1 .......................................  160  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, binding p
. . Natranaerobius thermophilus JW/NM-WN-LF ....................................  153  2 hits [firmicutes]          periplasmic solute binding protein [Natranaerobius thermoph
. . uncultured bacterium .......................................................  152  1 hit  [bacteria]            putative abc transporter; periplasmic binding protein precu
. . Alkaliphilus metalliredigens QYMF ..........................................  151  2 hits [firmicutes]          periplasmic solute binding protein [Alkaliphilus metallired
. . Clostridium botulinum B str. Eklund 17B ....................................  144  2 hits [firmicutes]          ABC transporter, substrate-binding protein [Clostridium bot
. . Streptococcus pneumoniae SP14-BS69 .........................................  143  2 hits [firmicutes]          D-tyrosyl-tRNA deacylase [Streptococcus pneumoniae SP14-BS6
. . Clostridium botulinum E3 str. Alaska E43 ...................................  143  2 hits [firmicutes]          ABC transporter, substrate-binding protein [Clostridium bot
. . Deinococcus geothermalis DSM 11300 .........................................  142  2 hits [bacteria]            periplasmic solute binding protein [Deinococcus geothermali
. . Clostridium botulinum E1 str. 'BoNT E Beluga' ..............................  141  2 hits [firmicutes]          periplasmic solute binding protein family [Clostridium botu
. . Sebaldella termitidis ATCC 33386 ...........................................  141  2 hits [fusobacteria]        periplasmic solute binding protein [Sebaldella termitidis A
. . Corynebacterium urealyticum DSM 7109 .......................................  141  2 hits [high GC Gram+]       ABC transport system, permease protein [Corynebacterium ure
. . Acidaminococcus fermentans DSM 20731 .......................................  140  2 hits [firmicutes]          periplasmic solute binding protein [Acidaminococcus ferment
. . Clostridium beijerinckii NCIMB 8052 ........................................  140  4 hits [firmicutes]          periplasmic solute binding protein [Clostridium beijerincki
. . Treponema denticola ATCC 35405 .............................................  140  2 hits [spirochetes]         ABC transporter, substrate-binding protein, putative [Trepo
. . Acidaminococcus sp. D21 ....................................................  138  2 hits [firmicutes]          metal binding protein [Acidaminococcus sp. D21] >gi|2269049
. . Fusobacterium periodonticum ATCC 33693 .....................................  137  2 hits [fusobacteria]        zinc ABC transporter, periplasmic zinc-binding protein [Fus
. . Denitrovibrio acetiphilus DSM 12809 ........................................  137  2 hits [bacteria]            periplasmic solute binding protein [Denitrovibrio acetiphil
. . Fusobacterium sp. 2_1_31 ...................................................  137  2 hits [fusobacteria]        high-affinity zinc uptake system protein znuA [Fusobacteriu
. . Fusobacterium sp. 1_1_41FAA ................................................  137  1 hit  [fusobacteria]        zinc ABC transporter, periplasmic zinc-binding protein [Fus
. . Listeria monocytogenes FSL J1-208 ..........................................  137  1 hit  [firmicutes]          hypothetical protein LmonocyFSL_00845 [Listeria monocytogen
. . Ethanoligenens harbinense YUAN-3 ...........................................  137  2 hits [firmicutes]          periplasmic solute binding protein [Ethanoligenens harbinen
. Ricinus communis -------------------------------------------------------------  271  2 hits [eudicots]            Periplasmic chelated iron-binding protein yfeA precursor, p

BLAST

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Max target sequences _1000"


RESULTS ANALYSIS


The results obtained show us several results with significant E-value such as 8e-101, 1e-100, 4e-100, and 3e-99, a large number of hits with the same function, so we can conclude that our sequence will have a possible biological function similar to the results we got. Our sequence may belong to a super-family named as troA-like superfamily (Helical backbone metal receptor). The function of these protein may be related to the transport of metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+. For example, to the E-values 1e-100 and 4e-100 we have an (ABC transporter)Iron transport protein.


ingroup: a-proteobacteria


ref|YP_989559.1| Bartonella_bacilliformis 2e-96 Bartonella bacilliformis KC583 (a-proteobacteria)

ref|YP_001608583.1| Bartonella_tribocorum_CIP 1e-95 Bartonella tribocorum CIP 105476 (a-proteobacteria)

ref|YP_031804.1| Bartonella_quintana_str 1e-94 Bartonella quintana str. Toulouse (a-proteobacteria)

ref|YP_002971151.1| Bartonella_grahamii_as4aup 7e-95 Bartonella grahamii as4aup (a-proteobacteria)

ref|YP_032949.1| Bartonella_henselae_str. 2e-94 Bartonella henselae str. Houston-1 (a-proteobacteria)

ref|YP_001372233.1| Ochrobactrum_anthropi_ATCC_49188 2e-92 Ochrobactrum anthropi ATCC 49188 (a-proteobacteria)

ref|ZP_04682313.1| Ochrobactrum_intermedium_LMG_3301 2e-89 Ochrobactrum intermedium LMG 3301 (a-proteobacteria)

ref|YP_001416113.1| Xanthobacter_autotrophicus 9e-97 Xanthobacter autotrophicus Py2 (a-proteobacteria)

ref|YP_002827590.1| Rhizobium_sp._NGR234 7e-94 Rhizobium sp. NGR234 (a-proteobacteria)

ref|YP_001328578.1| Sinorhizobium_medicae 7e-95 Sinorhizobium medicae WSM419 (a-proteobacteria)

ref|NP_387132.1| Sinorhizobium_meliloti_1021 2e-97 Sinorhizobium meliloti 1021 (a-proteobacteria)

ref|YP_002977237.1| Rhizobium_leguminosarum_bv._trifolii_WSM1325 8e-101 Rhizobium leguminosarum bv.trifolii WSM1325(a-proteobacteria)

ref|ZP_03499741.1| Rhizobium_etli_Kim_5 7e-98 Rhizobium etli Kim 5 (a-proteobacteria)

ref|YP_002541241.1| Agrobacterium_radiobacter_K84 7e-94 Agrobacterium radiobacter K84 (a-proteobacteria)

ref|NP_438524.1| Haemophilus_influenzae_Rd 2e-95 Haemophilus influenzae Rd KW20 (a-proteobacteria)

ref|ZP_06358813.1| Rhodopseudomonas_palustris_DX-1 2e-92 Rhodopseudomonas palustris DX-1 (a-proteobacteria)

ref|YP_487009.1| Rhodopseudomo 4e-89 Rhodopseudomonas palustris HaA2 (a-proteobacteria)

ref|NP_356186.2| Agrobacterium_tumefaciens_str._C58 7e-91 Agrobacterium tumefaciens str. C58 (a-proteobacteria)

ref|ZP_02165220.1| Hoeflea_phototrophica_DFL-43 1e-85 Hoeflea phototrophica DFL-43 (a-proteobacteria)

ref|YP_003064950.1| Liberibacter_asiaticus_str 3e-60 Candidatus Liberibacter asiaticus str. psy62 (a-proteobacteria)



Outgroups: g-proteobacteria and b-proteobacteria


ref|YP_158007.1| Aromatoleum_aromaticum_Out 2e-35 Aromatoleum aromaticum EbN1 (b-proteobacteria)

ref|YP_002263360.1| Aliivibrio_salmonicida_Out 7e-31 Aliivibrio salmonicida LFI1238 (g-proteobacteria)

ref|YP_002986336.1| Dickeya_dadantii_Out 4e-33 Dickeya dadantii Ech703 (Enterobacteria)

ref|YP_001792579.1| Leptothrix_cholodnii_Out 2e-30 Leptothrix cholodnii SP-6 (b-proteobacteria)

ref|NP_882544.1| Bordetella_parapertussis_Out 5e-31 Bordetella parapertussis 12822 (b-proteobacteria)

RAW RESULTS

------------------------------------------------------------------------------------------------------------------------
                                                                      Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_002977237.1|  periplasmic solute binding protein [Rhizo...   370    8e-101
ref|YP_003557774.1|  Iron transport protein, periplasmic-bindi...   370    1e-100
ref|YP_769462.1|  iron ABC transporter substrate binding prote...   368    4e-100
ref|ZP_01159456.1|  Iron transport protein [Photobacterium sp....   365    3e-99 
ref|ZP_01233288.1|  Iron transport protein, periplasmic-bindin...   364    6e-99 
ref|ZP_03499741.1|  iron ABC transporter substrate binding pro...   360    7e-98 
ref|NP_387132.1|  putative IRON-binding periplasmic ABC transp...   359    2e-97 
ref|YP_001416113.1|  periplasmic solute binding protein [Xanth...   357    9e-97 
ref|YP_002527472.1|  ABC transport system, periplasmic binding...   356    2e-96 
ref|YP_989559.1|  iron chelate ABC transporter, periplasmic ir...   356    2e-96 
ref|YP_002397314.1|  iron transport protein, periplasmic-bindi...   355    2e-96 
ref|ZP_01795897.1|  putative periplasmic chelated iron binding...   355    4e-96 
ref|YP_001745164.1|  iron/manganese transport system periplasm...   355    5e-96 
emb|CBG34345.1|  iron ABC transporter, substrate-binding prote...   354    5e-96 
ref|ZP_01787575.1|  putative periplasmic chelated iron binding...   354    6e-96 
ref|ZP_04640889.1|  Periplasmic chelated iron-binding protein ...   354    7e-96 
ref|YP_310672.1|  Iron transport protein [Shigella sonnei Ss04...   354    8e-96 
ref|NP_837465.1|  Iron transport protein [Shigella flexneri 2a...   354    8e-96 
ref|YP_001481336.1|  SitA [Escherichia coli APEC O1] >ref|YP_0...   353    9e-96 
emb|CAJ21596.1|  iron transport protein, periplasmic binding p...   353    1e-95 
ref|ZP_01216945.1|  iron transporter: fur regulated [Psychromo...   353    1e-95 
ref|ZP_01792039.1|  putative periplasmic chelated iron binding...   353    1e-95 
dbj|BAI54640.1|  iron ABC transporter substrate binding compon...   353    1e-95 
ref|YP_540352.1|  putative iron transport protein, periplasmic...   353    1e-95 
ref|YP_001608583.1|  Iron transport protein, periplasmic-bindi...   353    1e-95 
ref|YP_001880202.1|  iron/manganese transport system periplasm...   353    1e-95 
ref|NP_438524.1|  iron-chelated ABC transporter periplasmic-bi...   353    2e-95 
ref|YP_444048.1|  SitA [Escherichia coli] >gb|ABA54731.1| SitA...   352    2e-95 
ref|YP_001290109.1|  putative periplasmic chelated iron bindin...   352    2e-95 
ref|ZP_01794338.1|  putative periplasmic chelated iron binding...   352    3e-95 
ref|ZP_01897717.1|  iron transporter: fur regulated [Moritella...   352    3e-95 
ref|ZP_00349622.1|  COG0803: ABC-type metal ion transport syst...   352    4e-95 
ref|ZP_04610997.1|  Periplasmic chelated iron-binding protein ...   351    6e-95 
ref|YP_003366582.1|  iron ABC transporter, substrate-binding p...   351    6e-95 
ref|YP_002971151.1|  iron transport protein YfeA [Bartonella g...   351    7e-95 
ref|YP_001328578.1|  periplasmic solute binding protein [Sinor...   350    7e-95 
ref|YP_001006162.1|  periplasmic-binding protein [Yersinia ent...   350    1e-94 
ref|ZP_02960299.1|  hypothetical protein PROSTU_02238 [Provide...   350    1e-94 
ref|YP_031804.1|  Iron transport protein yfeA [Bartonella quin...   350    1e-94 
ref|ZP_03319559.1|  hypothetical protein PROVALCAL_02504 [Prov...   350    2e-94 
ref|ZP_04560170.1|  iron transporter [Citrobacter sp. 30_2] >g...   349    2e-94 
ref|ZP_04630880.1|  Periplasmic chelated iron-binding protein ...   349    2e-94 
ref|YP_032949.1|  Iron transport protein yfeA [Bartonella hens...   349    2e-94 
ref|ZP_04626164.1|  Periplasmic chelated iron-binding protein ...   349    2e-94 
ref|ZP_01784519.1|  putative periplasmic chelated iron binding...   349    2e-94 
ref|ZP_04627414.1|  Periplasmic chelated iron-binding protein ...   349    2e-94 
ref|ZP_05920353.1|  iron ABC superfamily ATP binding cassette ...   348    3e-94 
ref|YP_427979.1|  twin-arginine translocation pathway signal [...   348    4e-94 
ref|YP_001720559.1|  periplasmic solute binding protein [Yersi...   348    4e-94 
ref|ZP_04635356.1|  Periplasmic chelated iron-binding protein ...   348    4e-94 
ref|YP_002827590.1|  putative iron transport protein, periplas...   347    7e-94 
ref|YP_002541241.1|  zinc ABC transporter [Agrobacterium radio...   347    7e-94 
ref|YP_001452526.1|  hypothetical protein CKO_00940 [Citrobact...   347    7e-94 
ref|YP_001569206.1|  hypothetical protein SARI_00111 [Salmonel...   347    8e-94 
ref|ZP_06016624.1|  iron chelate ABC superfamily ATP binding c...   347    1e-93 
ref|NP_669213.1|  periplasmic-binding protein [Yersinia pestis...   347    1e-93 
ref|YP_070862.1|  ABC transporter, periplasmic iron siderophor...   347    1e-93 
ref|YP_001400682.1|  chelated iron ABC transporter, periplasmi...   346    2e-93 
ref|YP_001907346.1|  Iron transport protein, periplasmic-bindi...   346    2e-93 
ref|YP_217781.1|  iron transporter: fur regulated [Salmonella ...   346    2e-93 
ref|ZP_05969046.1|  iron chelate ABC transporter, periplasmic ...   346    2e-93 
ref|NP_457255.1|  Iron transport protein, periplasmic-binding ...   346    2e-93 
ref|YP_002150777.1|  iron ABC transporter, periplasmic substra...   345    2e-93 
gb|ACL13587.1|  iron transporter SitA [Salmonella enterica sub...   345    2e-93 
ref|ZP_02832448.1|  periplasmic chelated iron-binding protein ...   345    3e-93 
ref|ZP_06636331.1|  iron ABC superfamily ATP binding cassette ...   344    5e-93 
ref|YP_003006909.1|  AfeA [Aggregatibacter aphrophilus NJ8700]...   344    6e-93 
ref|YP_003256224.1|  AfeA [Aggregatibacter actinomycetemcomita...   344    6e-93 
ref|ZP_05971670.1|  iron chelate ABC transporter, periplasmic ...   344    7e-93 
ref|YP_003040700.1|  iron (chelated) abc transporter, periplas...   343    9e-93 
ref|YP_001455592.1|  hypothetical protein CKO_04090 [Citrobact...   343    1e-92 
ref|ZP_06358813.1|  periplasmic solute binding protein [Rhodop...   343    2e-92 
ref|ZP_06640660.1|  iron ABC superfamily ATP binding cassette ...   343    2e-92 
ref|YP_001372233.1|  periplasmic solute binding protein [Ochro...   342    2e-92 
ref|NP_245337.1|  YfeA [Pasteurella multocida subsp. multocida...   342    2e-92 
ref|YP_002648492.1|  Iron transport protein, periplasmic-bindi...   342    3e-92 
ref|ZP_06355273.1|  iron chelate ABC transporter, periplasmic ...   342    3e-92 
ref|ZP_06126780.2|  iron chelate ABC transporter, periplasmic ...   342    3e-92 
ref|YP_002236913.1|  iron ABC transporter, periplasmic iron-bi...   342    3e-92 
ref|NP_929907.1|  Iron (chelated) ABC transporter, periplasmic...   342    3e-92 
ref|ZP_05116682.1|  Periplasmic solute binding protein family ...   342    3e-92 
ref|YP_001175843.1|  periplasmic solute binding protein [Enter...   342    3e-92 
ref|ZP_06189821.1|  hypothetical protein SOD_a07800 [Serratia ...   342    4e-92 
ref|YP_001336709.1|  iron transporter: fur regulated [Klebsiel...   342    4e-92 
ref|YP_003468296.1|  Periplasmic chelated iron-binding protein...   342    4e-92 
ref|ZP_06017081.1|  iron ABC superfamily ATP binding cassette ...   341    5e-92 
ref|YP_003259588.1|  periplasmic solute binding protein [Pecto...   341    6e-92 
ref|YP_003437928.1|  periplasmic solute binding protein [Klebs...   341    6e-92 
ref|ZP_06550419.1|  manganese/iron transport system substrate-...   341    7e-92 
ref|YP_455196.1|  iron ABC transporter periplasmic component [...   340    8e-92 
ref|ZP_04615058.1|  Periplasmic chelated iron-binding protein ...   340    9e-92 
ref|YP_003531518.1|  Iron ABC transport system, periplasmic co...   338    3e-91 
ref|ZP_03825171.1|  periplasmic chelated iron-binding protein ...   338    3e-91 
ref|ZP_03831825.1|  periplasmic chelated iron-binding protein ...   338    5e-91 
ref|YP_003017496.1|  periplasmic solute binding protein [Pecto...   338    5e-91 
ref|NP_356186.2|  ABC transporter, substrate binding protein (...   337    7e-91 
ref|YP_050487.1|  periplasmic chelated iron-binding protein [P...   337    9e-91 
ref|ZP_04618974.1|  Periplasmic chelated iron-binding protein ...   337    1e-90 
ref|ZP_01443827.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   335    3e-90 
ref|YP_002924837.1|  chelated iron ABC transporter, periplasmi...   335    3e-90 
ref|ZP_05054635.1|  Periplasmic solute binding protein family ...   335    4e-90 
ref|YP_001166464.1|  periplasmic solute binding protein [Rhodo...   334    8e-90 
emb|CBA71505.1|  iron ABC transporter, periplasmic substrate-b...   333    1e-89 
ref|ZP_04682313.1|  Metal ABC transporter substrate-binding li...   333    2e-89 
gb|AAD30042.1|AF132545_1  putative periplasmic-binding protein...   333    2e-89 
ref|YP_487009.1|  periplasmic solute binding protein [Rhodopse...   332    4e-89 
ref|YP_353987.1|  ABC Mn+2/Fe+2 transporter, periplasmic subst...   331    7e-89 
ref|ZP_05064281.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   330    1e-88 
ref|YP_001478362.1|  periplasmic solute binding protein [Serra...   330    2e-88 
ref|ZP_03713060.1|  hypothetical protein EIKCOROL_00734 [Eiken...   330    2e-88 
ref|YP_002526637.1|  Periplasmic solute binding protein precur...   330    2e-88 
ref|YP_001044437.1|  periplasmic solute binding protein [Rhodo...   329    2e-88 
ref|ZP_05990625.1|  periplasmic-binding protein [Mannheimia ha...   329    2e-88 
ref|ZP_01545083.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   329    2e-88 
ref|YP_003004912.1|  periplasmic solute binding protein [Dicke...   329    2e-88 
ref|ZP_05705905.1|  iron chelate ABC superfamily ATP binding c...   328    3e-88 
ref|ZP_04978963.1|  iron (Fe3+) ABC superfamily ATP binding ca...   328    4e-88 
ref|YP_001711861.1|  SitA [Escherichia coli] >gb|ACA34755.1| S...   328    5e-88 
ref|ZP_05079743.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   327    8e-88 
ref|ZP_01438664.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   327    1e-87 
ref|ZP_01741331.1|  Iron transport protein yfeA [Rhodobacteral...   323    1e-86 
ref|ZP_00962878.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   323    2e-86 
ref|ZP_00955443.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   322    2e-86 
ref|NP_874177.1|  iron (chelated) ABC transporter, periplasmic...   322    4e-86 
ref|ZP_01011503.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   322    4e-86 
ref|YP_001783550.1|  periplasmic solute binding protein [Haemo...   321    6e-86 
ref|YP_718536.1|  chelated iron ABC transporter, periplasmic-b...   321    7e-86 
ref|YP_001968068.1|  iron (chelated) ABC transporter, periplas...   320    8e-86 
ref|ZP_00135383.1|  COG0803: ABC-type metal ion transport syst...   320    1e-85 
ref|ZP_02165220.1|  putative substrate-binding Fur regulated i...   320    1e-85 
ref|ZP_02931468.1|  periplasmic-binding protein [Verrucomicrob...   319    2e-85 
ref|YP_915060.1|  periplasmic solute binding protein [Paracocc...   319    2e-85 
ref|ZP_05341941.1|  periplasmic chelated iron-binding protein ...   318    7e-85 
ref|YP_001533002.1|  metal ABC transporter substrate-binding l...   316    2e-84 
ref|ZP_04753574.1|  chelated iron ABC transporter, periplasmic...   316    2e-84 
ref|ZP_05629001.1|  chelated iron ABC transporter, periplasmic...   316    2e-84 
ref|ZP_05101130.1|  ABC Mn+2/Fe+2 transporter, periplasmic sub...   316    2e-84 
ref|ZP_01226419.1|  ABC-type metal transport system protein [A...   315    5e-84 
ref|NP_753508.1|  SitA protein [Escherichia coli CFT073] >gb|A...   314    8e-84 
ref|YP_002475662.1|  chelated iron ABC transporter, periplasmi...   313    1e-83 
ref|ZP_02478297.1|  phosphoribosylglycinamide formyltransferas...   313    2e-83 
ref|ZP_05783528.1|  periplasmic chelated iron-binding protein ...   311    6e-83 
ref|YP_003522495.1|  YfeA [Pantoea ananatis LMG 20103] >gb|ADD...   309    3e-82 
ref|ZP_01752431.1|  putative iron-binding periplasmic abc tran...   308    6e-82 
ref|ZP_05622947.1|  Periplasmic solute binding protein [Trepon...   307    8e-82 
ref|YP_002483950.1|  periplasmic solute binding protein [Cyano...   303    2e-80 
ref|ZP_01728367.1|  Mn transporter; MntC [Cyanothece sp. CCY01...   298    4e-79 
ref|YP_001802658.1|  Mn2+ ABC transporter, periplasmic binding...   298    6e-79 
ref|YP_001209553.1|  periplasmic iron-binding protein YfeA [Di...   298    6e-79 
ref|ZP_00517215.1|  Periplasmic solute binding protein [Crocos...   295    5e-78 
ref|ZP_05036793.1|  Periplasmic solute binding protein family ...   293    2e-77 
ref|NP_681609.1|  periplasmic-binding protein of chelated iron...   293    2e-77 
ref|YP_832756.1|  periplasmic solute binding protein [Arthroba...   291    6e-77 
ref|NP_441239.1|  Mn transporter; MntC [Synechocystis sp. PCC ...   290    1e-76 
pdb|1XVL|A  Chain A, The Three-Dimensional Structure Of Mntc F...   290    2e-76 
ref|YP_891897.1|  AfeA [Campylobacter fetus subsp. fetus 82-40...   285    3e-75 
ref|YP_948968.1|  putative ABC-type metal ion transport system...   283    2e-74 
ref|ZP_06009338.1|  AfeA [Campylobacter fetus subsp. venereali...   281    7e-74 
ref|ZP_05912982.1|  manganese ABC transporter manganese-bindin...   280    1e-73 
ref|ZP_01471787.1|  ABC transporter, substrate binding protein...   279    3e-73 
gb|AAZ67658.1|  putative iron (chelated) ABC transporter perip...   278    6e-73 
ref|YP_002769424.1|  manganese ABC transporter manganese-bindi...   278    6e-73 
ref|ZP_04385059.1|  periplasmic chelated iron-binding protein ...   277    8e-73 
ref|ZP_01130541.1|  putative ABC transporter substrate-binding...   277    9e-73 
ref|YP_118645.1|  putative ABC transporter substrate-binding p...   277    1e-72 
ref|YP_289721.1|  putative ABC transporter substrate-binding p...   275    5e-72 
ref|YP_291232.1|  ABC transporter substrate-binding protein [P...   273    1e-71 
ref|YP_003361787.1|  ABC-type metal ion transport system, peri...   273    1e-71 
ref|YP_001014484.1|  ABC transporter substrate-binding protein...   273    2e-71 
ref|ZP_05367230.1|  periplasmic chelated iron-binding protein ...   273    2e-71 
ref|XP_002540121.1|  Periplasmic chelated iron-binding protein...   271    5e-71 
ref|YP_001734980.1|  periplasmic solute binding protein [Synec...   271    7e-71 
ref|YP_002784249.1|  manganese ABC transporter manganese-bindi...   270    1e-70 
ref|ZP_03805929.1|  hypothetical protein PROPEN_04329 [Proteus...   268    6e-70 
ref|YP_001108126.1|  iron transport protein-binding protein [S...   266    1e-69 
gb|AAV65297.1|  manganese solute binding protein [Thermosynech...   266    2e-69 
ref|ZP_06562117.1|  iron transport protein-binding protein [Sa...   266    2e-69 
ref|YP_001134433.1|  periplasmic solute binding protein [Mycob...   265    4e-69 
ref|YP_707193.1|  ABC metal ion transporter, substrate-binding...   264    7e-69 
ref|ZP_01123816.1|  ABC transporter, substrate binding protein...   259    2e-67 
ref|ZP_04333431.1|  ABC-type metal ion transport system, perip...   258    6e-67 
ref|YP_381793.1|  ABC transporter substrate-binding protein [S...   258    7e-67 
ref|NP_875452.1|  ABC-type Mn2+/Zn2+ transport system periplas...   257    9e-67 
ref|YP_954174.1|  periplasmic solute binding protein [Mycobact...   256    1e-66 
ref|ZP_01086101.1|  ABC transporter, substrate binding protein...   256    2e-66 
ref|YP_003156483.1|  ABC-type metal ion transport system, peri...   256    3e-66 
ref|YP_001224701.1|  ABC-type Mn2+ transport system, periplasm...   255    3e-66 
ref|ZP_05046398.1|  ABC transporter, substrate binding protein...   254    6e-66 
ref|ZP_05789102.1|  periplasmic chelated iron-binding protein ...   254    9e-66 
ref|ZP_03924602.1|  metal cation ABC superfamily ATP binding c...   253    1e-65 
ref|ZP_06161831.1|  iron chelate ABC transporter, periplasmic ...   252    3e-65 
ref|ZP_06606048.1|  iron chelate ABC superfamily ATP binding c...   251    6e-65 
ref|ZP_06536843.1|  periplasmic chelated iron-binding protein ...   251    7e-65 
ref|YP_003314093.1|  ABC-type metal ion transport system, peri...   251    7e-65 
ref|YP_001853983.1|  manganese ABC transporter substrate-bindi...   251    8e-65 
ref|YP_003179304.1|  periplasmic solute binding protein [Atopo...   249    2e-64 
ref|ZP_03923708.1|  metal cation ABC superfamily ATP binding c...   248    5e-64 
ref|YP_251277.1|  manganese ABC transport system, solute-bindi...   248    6e-64 
ref|ZP_05845650.1|  iron chelate ABC superfamily ATP binding c...   248    7e-64 
ref|ZP_03992895.1|  metal cation ABC superfamily ATP binding c...   247    9e-64 
ref|ZP_01468012.1|  ABC transporter, substrate binding protein...   247    1e-63 
ref|ZP_03567941.1|  periplasmic chelated iron-binding protein ...   246    2e-63 
ref|YP_002906843.1|  manganese ABC transport system, solute-bi...   246    2e-63 
ref|YP_377018.1|  ABC transporter substrate-binding protein [S...   246    2e-63 
ref|YP_001228442.1|  ABC-type Mn2+ transport system, periplasm...   246    2e-63 
ref|YP_730962.1|  cation ABC transporter, cation-binding prote...   243    1e-62 
ref|NP_894251.1|  ABC transporter substrate-binding protein [P...   241    6e-62 
ref|YP_001483884.1|  ABC transporter substrate-binding protein...   241    8e-62 
ref|ZP_05138880.1|  ABC transporter, substrate binding protein...   241    1e-61 
ref|NP_897434.1|  ABC transporter substrate-binding protein [S...   239    2e-61 
ref|YP_001017876.1|  ABC transporter substrate-binding protein...   239    3e-61 
gb|ABE11055.1|  ABC transporter, substrate binding protein, po...   238    4e-61 
ref|NP_892719.1|  ABC transporter substrate-binding protein [P...   238    5e-61 
ref|YP_001010982.1|  ABC transporter substrate-binding protein...   238    7e-61 
ref|YP_001550934.1|  ABC transporter substrate-binding protein...   237    1e-60 
ref|YP_003064950.1|  periplasmic solute binding protein [Candi...   236    3e-60 
ref|YP_001090851.1|  ABC transporter substrate-binding protein...   236    3e-60 
ref|ZP_01079957.1|  ABC transporter, substrate binding protein...   234    1e-59 
gb|ABE11193.1|  ABC transporter, substrate binding protein, po...   232    3e-59 
ref|YP_002881409.1|  periplasmic solute binding protein [Beute...   231    1e-58 
ref|YP_001009050.1|  ABC transporter substrate-binding protein...   229    3e-58 
ref|YP_003160272.1|  periplasmic solute binding protein [Jones...   226    2e-57 
ref|YP_397098.1|  ABC transporter substrate-binding protein [P...   225    6e-57 
ref|YP_003102131.1|  periplasmic solute binding protein [Actin...   222    4e-56 
ref|NP_471295.1|  hypothetical protein lin1961 [Listeria innoc...   207    1e-51 
ref|YP_014468.1|  ABC transporter, manganese-binding protein [...   207    1e-51 
ref|ZP_05231112.1|  ABC transporter [Listeria monocytogenes FS...   206    2e-51 
ref|YP_850063.1|  manganese ABC transporter substrate-binding ...   206    2e-51 
ref|ZP_03668426.1|  hypothetical protein LmonF1_10519 [Listeri...   206    3e-51 
ref|ZP_05236207.1|  hypothetical protein Lmon1_09363 [Listeria...   205    4e-51 
ref|ZP_05297431.1|  hypothetical protein LmonocytFSL_02309 [Li...   205    4e-51 
ref|YP_003465062.1|  ABC transporter, manganese-binding protei...   205    4e-51 
ref|NP_465372.1|  hypothetical protein lmo1847 [Listeria monoc...   205    4e-51 
ref|ZP_05233844.1|  ABC transporter manganese-binding protein ...   205    4e-51 
ref|YP_001815215.1|  periplasmic solute binding protein [Exigu...   205    5e-51 
ref|ZP_05245256.1|  manganese ABC transporter substrate-bindin...   204    1e-50 
ref|YP_002349678.1|  manganese ABC transporter substrate-bindi...   204    1e-50 
ref|ZP_04262837.1|  Manganese-binding lipoprotein mntA [Bacill...   201    7e-50 
ref|YP_002770961.1|  manganese ABC transporter substrate bindi...   201    8e-50 
ref|ZP_05730262.1|  periplasmic solute binding protein [Pantoe...   201    1e-49 
ref|ZP_03053979.1|  manganese ABC transporter substrate-bindin...   201    1e-49 
ref|YP_001376826.1|  periplasmic solute binding protein [Bacil...   200    2e-49 
ref|ZP_04246049.1|  Manganese-binding lipoprotein mntA [Bacill...   199    2e-49 
ref|YP_002446649.1|  manganese ABC transporter substrate-bindi...   199    2e-49 
ref|ZP_04085159.1|  Manganese-binding lipoprotein mntA [Bacill...   199    2e-49 
ref|ZP_00742892.1|  Manganese-binding protein [Bacillus thurin...   199    2e-49 
ref|ZP_04198132.1|  Manganese-binding lipoprotein mntA [Bacill...   199    3e-49 
ref|ZP_04228617.1|  Manganese-binding lipoprotein mntA [Bacill...   199    3e-49 
ref|ZP_00393406.1|  COG0803: ABC-type metal ion transport syst...   198    6e-49 
ref|NP_845499.1|  adhesion lipoprotein [Bacillus anthracis str...   198    6e-49 
ref|ZP_04290010.1|  Manganese-binding lipoprotein mntA [Bacill...   198    6e-49 
ref|YP_245979.1|  adhesion lipoprotein [Bacillus cereus E33L] ...   198    7e-49 
ref|ZP_04079342.1|  Manganese-binding lipoprotein mntA [Bacill...   197    2e-48 
ref|YP_895627.1|  manganese ABC transporter, manganese-binding...   196    2e-48 
ref|YP_001003742.1|  periplasmic solute binding protein [Halor...   196    2e-48 
ref|ZP_05677338.1|  periplasmic solute binding protein [Entero...   196    4e-48 
ref|ZP_03361904.1|  periplasmic chelated iron-binding protein ...   195    4e-48 
ref|ZP_00603070.1|  Periplasmic solute binding protein [Entero...   194    7e-48 
ref|ZP_05663379.1|  periplasmic solute binding protein [Entero...   194    8e-48 
ref|YP_001488227.1|  metal cation ABC transporter ATP-binding ...   194    8e-48 
ref|ZP_05666132.1|  periplasmic solute binding protein [Entero...   194    9e-48 
gb|EFF27623.1|  manganese ABC transporter substrate-binding li...   194    1e-47 
ref|ZP_05737909.1|  manganese ABC superfamily ATP binding cass...   194    1e-47 
sp|P31304.1|MTSA_STRSA  RecName: Full=Manganese ABC transporte...   194    1e-47 
ref|YP_080639.1|  manganese transport system substrate-binding...   193    2e-47 
ref|ZP_06682429.1|  manganese ABC transporter substrate-bindin...   193    2e-47 
ref|ZP_05672339.1|  periplasmic solute binding protein [Entero...   193    2e-47 
ref|ZP_03982399.1|  ABC superfamily ATP binding cassette trans...   193    2e-47 
ref|YP_003428988.1|  manganese ABC transporter substrate-bindi...   193    2e-47 
ref|ZP_04448862.1|  hypothetical protein GCWU000282_00081 [Cat...   192    3e-47 
sp|Q9L5X1.1|MTSA_STRAP  RecName: Full=Manganese ABC transporte...   192    3e-47 
ref|YP_001034269.1|  manganese/Zinc ABC transporter substrate-...   192    3e-47 
ref|ZP_06611646.1|  ABC superfamily ATP binding cassette trans...   192    4e-47 
ref|ZP_06199423.1|  manganese ABC transporter, manganese-bindi...   191    7e-47 
sp|P31305.1|MTSA_STRPA  RecName: Full=Manganese ABC transporte...   191    1e-46 
ref|ZP_04677758.1|  manganese ABC transporter substrate-bindin...   189    2e-46 
gb|ACI90324.1|  PsaA [Streptococcus oralis]                         189    3e-46 
ref|ZP_04061546.1|  manganese ABC transporter substrate-bindin...   189    3e-46 
gb|ACI90327.1|  PsaA [Streptococcus mitis]                          189    4e-46 
gb|ACI90329.1|  PsaA [Streptococcus infantis]                       189    4e-46 
gb|ABG89162.1|  ABC transport system periplasmic protein [Mann...   189    4e-46 
ref|ZP_04776189.1|  manganese ABC transporter substrate-bindin...   188    7e-46 
gb|AAF70665.1|  PsaA [Streptococcus pneumoniae]                     187    9e-46 
gb|AAF70667.1|  PsaA [Streptococcus pneumoniae] >gb|ACI90328.1...   187    9e-46 
sp|Q9L5X0.1|MTSA_STRMT  RecName: Full=Manganese ABC transporte...   187    1e-45 
gb|AAF70668.1|  PsaA [Streptococcus pneumoniae]                     187    1e-45 
ref|YP_002736592.1|  manganese ABC transporter substrate-bindi...   187    1e-45 
ref|ZP_01830403.1|  D-tyrosyl-tRNA deacylase [Streptococcus pn...   187    1e-45 
ref|NP_359087.1|  ABC transporter substrate-binding protein - ...   187    1e-45 
ref|YP_002038265.1|  manganese ABC transporter substrate-bindi...   187    1e-45 
ref|YP_001836340.1|  manganese ABC transporter, manganese-bind...   187    1e-45 
sp|Q53891.1|MTSA_STRCR  RecName: Full=Metal ABC transporter su...   187    1e-45 
ref|YP_001695035.1|  manganese ABC transporter substrate-bindi...   187    1e-45 
ref|YP_003445751.1|  manganese ABC transporter substrate-bindi...   187    2e-45 
ref|ZP_05584713.1|  periplasmic solute binding protein [Entero...   186    2e-45 
ref|ZP_06061207.1|  metal ABC transporter substrate-binding li...   186    2e-45 
gb|AAA70056.1|  endocarditis specific antigen [Enterococcus fa...   186    2e-45 
ref|NP_815739.1|  endocarditis specific antigen [Enterococcus ...   186    3e-45 
ref|ZP_04434066.1|  ABC superfamily ATP binding cassette trans...   186    3e-45 
ref|ZP_05558955.1|  endocarditis specific antigen [Enterococcu...   186    3e-45 
ref|ZP_06632708.1|  manganese ABC transporter, manganese-bindi...   185    4e-45 
gb|AAC64251.1|  Efafm [Enterococcus faecium]                        185    4e-45 
ref|YP_818432.1|  ABC-type metal ion transport system, peripla...   185    4e-45 
ref|YP_394791.1|  manganese ABC transporter, substrate-binding...   185    6e-45 
pdb|1PSZ|A  Chain A, Pneumococcal Surface Antigen Psaa              185    6e-45 
ref|NP_346089.1|  manganese ABC transporter, manganese-binding...   185    6e-45 
ref|YP_001451071.1|  metal ABC transporter substrate-binding l...   184    8e-45 
ref|ZP_04442640.1|  ABC superfamily ATP binding cassette trans...   184    9e-45 
gb|AAL66356.1|AF459738_1  pneumococcal surface adhesin A [Stre...   184    9e-45 
ref|ZP_06365663.1|  periplasmic solute binding protein [Bacill...   184    1e-44 
ref|YP_002633371.1|  putative lipoprotein, AdhesinB family pro...   183    2e-44 
ref|ZP_05654797.1|  ABC transporter, substrate binding lipopro...   183    2e-44 
ref|ZP_05645181.1|  ABC transporter [Enterococcus casseliflavu...   183    2e-44 
gb|AAF81674.1|AF232688_3  SloC [Streptococcus mutans]               183    2e-44 
ref|ZP_03947582.1|  ABC superfamily ATP binding cassette trans...   182    3e-44 
ref|ZP_05660072.1|  adhesion lipoprotein [Enterococcus faecium...   182    3e-44 
ref|ZP_04435149.1|  ABC superfamily ATP binding cassette trans...   182    4e-44 
ref|YP_002746904.1|  metal ABC transporter substrate-binding l...   182    4e-44 
ref|ZP_05424245.1|  manganese ABC transporter substrate-bindin...   182    4e-44 
ref|ZP_05580300.1|  manganese ABC transporter substrate-bindin...   182    4e-44 
ref|NP_720653.1|  ABC transporter [Streptococcus mutans UA159]...   182    4e-44 
ref|ZP_05648510.1|  cation ABC transporter [Enterococcus galli...   182    5e-44 
ref|ZP_05852848.1|  manganese ABC transporter manganese-bindin...   182    5e-44 
ref|ZP_04782423.1|  ABC superfamily ATP binding cassette trans...   182    5e-44 
ref|NP_814342.1|  adhesion lipoprotein [Enterococcus faecalis ...   181    6e-44 
sp|P42364.1|MTSA_STRGN  RecName: Full=Metal ABC transporter su...   181    7e-44 
ref|NP_241382.1|  surface adhesin A precursor [Bacillus halodu...   181    8e-44 
ref|ZP_05474333.1|  manganese ABC transporter substrate-bindin...   181    1e-43 
ref|YP_003484074.1|  putative ABC transporter metal binding li...   180    1e-43 
ref|YP_003353839.1|  Manganese ABC transporter, substrate-bind...   179    3e-43 
ref|YP_807599.1|  ABC-type metal ion transport system, peripla...   179    3e-43 
ref|YP_001988516.1|  Substrate binding protein [Lactobacillus ...   179    3e-43 
ref|NP_787790.1|  iron ABC transporter substrate-binding prote...   179    4e-43 
ref|ZP_05674147.1|  adhesion lipoprotein [Enterococcus faecium...   178    5e-43 
ref|NP_789606.1|  ABC-transporter periplasmic solute-binding s...   178    5e-43 
ref|NP_267472.1|  manganese ABC transporter substrate binding ...   178    7e-43 
ref|NP_688527.1|  manganese ABC transporter, manganese-binding...   177    1e-42 
ref|YP_002964105.1|  putative ABC transporter, periplasmic pro...   177    1e-42 
ref|ZP_03507447.1|  probable zinc ABC transporter, substrate-b...   177    1e-42 
ref|YP_003062490.1|  manganese ABC transporter, substrate bind...   177    1e-42 
ref|NP_784780.1|  manganese ABC transporter, substrate binding...   177    2e-42 
ref|YP_001640336.1|  periplasmic solute binding protein [Methy...   176    2e-42 
ref|YP_002559496.1|  ABC transporter extracellular binding pro...   176    2e-42 
sp|P42363.1|MTSA2_STRPN  RecName: Full=Manganese ABC transport...   176    2e-42 
ref|YP_001977231.1|  probable zinc ABC transporter, substrate-...   176    3e-42 
ref|YP_003069134.1|  putative ABC transporter, periplasmic pro...   176    4e-42 
ref|ZP_04060318.1|  manganese ABC transporter substrate-bindin...   175    5e-42 
ref|YP_001831326.1|  periplasmic solute binding protein [Beije...   175    5e-42 
gb|AAC68699.1|  EfmA [Enterococcus faecium]                         174    7e-42 
ref|YP_281731.1|  manganese-binding protein [Streptococcus pyo...   174    9e-42 
ref|NP_664122.1|  putative metal binding protein of ABC transp...   174    9e-42 
ref|YP_001129021.1|  metal ABC transporter substrate-binding l...   174    9e-42 
ref|YP_059710.1|  manganese-binding protein [Streptococcus pyo...   174    9e-42 
ref|NP_606716.1|  putative metal binding protein of ABC transp...   174    1e-41 
ref|YP_279826.1|  manganese-binding protein [Streptococcus pyo...   174    1e-41 
ref|NP_268747.1|  metal binding protein of ABC transporter (li...   174    1e-41 
ref|YP_002123815.1|  ABC metal transporter substrate-binding l...   174    1e-41 
ref|ZP_05713251.1|  endocarditis specific antigen [Enterococcu...   174    1e-41 
ref|YP_002744039.1|  metal ABC transporter substrate-binding l...   174    1e-41 
ref|ZP_04796441.1|  ABC superfamily ATP binding cassette trans...   173    2e-41 
ref|NP_736025.1|  hypothetical protein gbs1589 [Streptococcus ...   173    2e-41 
ref|YP_002421867.1|  periplasmic solute binding protein [Methy...   173    2e-41 
ref|YP_001032452.1|  manganese ABC transporter substrate bindi...   173    2e-41 
ref|YP_596103.1|  manganese-binding protein [Streptococcus pyo...   173    2e-41 
pir||T48894  lipoprotein mtsA, metal binding [validated] - Str...   172    3e-41 
pdb|3HH8|A  Chain A, Crystal Structure And Metal Binding Prope...   172    3e-41 
ref|YP_252056.1|  hypothetical protein SH0141 [Staphylococcus ...   172    3e-41 
gb|AAD56936.1|AF180520_1  lipoprotein MtsA [Streptococcus pyog...   172    3e-41 
ref|ZP_05686172.1|  periplasmic solute binding protein [Staphy...   172    3e-41 
ref|ZP_03613094.1|  manganese ABC transporter substrate-bindin...   172    4e-41 
ref|YP_002561824.1|  extracellular manganese-binding protein [...   172    5e-41 
ref|YP_003172165.1|  ABC transporter manganese-binding lipopro...   171    8e-41 
ref|NP_371155.1|  lipoprotein [Staphylococcus aureus subsp. au...   170    1e-40 
ref|ZP_04441500.1|  ABC superfamily ATP binding cassette trans...   170    2e-40 
ref|ZP_03212296.1|  ABC-type metal ion transport system, perip...   170    2e-40 
ref|YP_003472410.1|  Manganese ABC transporter, periplasmic-bi...   169    2e-40 
ref|YP_002285412.1|  Metal ABC transporter substrate-binding l...   169    3e-40 
ref|NP_763960.1|  lipoprotein [Staphylococcus epidermidis ATCC...   168    5e-40 
ref|YP_003431455.1|  Putative manganese ABC transporter, subst...   168    6e-40 
ref|YP_741884.1|  periplasmic solute binding protein [Alkalili...   167    1e-39 
ref|YP_534671.1|  periplasmic solute binding protein [Rhodopse...   167    1e-39 
ref|YP_001925688.1|  periplasmic solute binding protein [Methy...   167    1e-39 
ref|ZP_06614721.1|  iron ABC superfamily ATP binding cassette ...   167    2e-39 
ref|ZP_04533193.1|  SitA [Escherichia sp. 3_2_53FAA] >gb|EEH89...   167    2e-39 
ref|YP_002996204.1|  manganese-binding protein [Streptococcus ...   166    2e-39 
gb|AAQ82593.1|  FimB [Streptococcus gallolyticus]                   166    2e-39 
ref|ZP_01046858.1|  Periplasmic solute binding protein [Nitrob...   166    3e-39 
ref|YP_499195.1|  ABC transporter, substrate-binding protein, ...   166    4e-39 
ref|YP_766660.1|  putative solute-binding component of ABC tra...   165    7e-39 
ref|YP_302178.1|  putative ABC-type Mn Zn transport system per...   164    8e-39 
ref|YP_001989961.1|  periplasmic solute binding protein [Rhodo...   164    1e-38 
gb|ACQ82556.1|  cell wall adhesins [Enterococcus faecium]           163    2e-38 
ref|YP_002548761.1|  ABC transporter substrate binding protein...   163    3e-38 
ref|ZP_02170002.1|  ABC-type metal ion transport system peripl...   162    3e-38 
gb|ABR57162.1|  ABC metal ion transport system extracellular b...   161    9e-38 
ref|ZP_04818438.1|  ABC superfamily ATP binding cassette trans...   160    1e-37 
ref|YP_578616.1|  periplasmic solute binding protein [Nitrobac...   160    2e-37 
ref|NP_774409.1|  ABC transporter substrate-binding protein [B...   159    3e-37 
ref|YP_001208124.1|  ABC transporter substrate-binding protein...   158    5e-37 
ref|YP_003426777.1|  surface adhesin A precursor [Bacillus pse...   158    6e-37 
ref|YP_317530.1|  periplasmic solute binding protein [Nitrobac...   158    7e-37 
ref|YP_783692.1|  periplasmic solute binding protein [Rhodopse...   158    9e-37 
ref|YP_002498152.1|  periplasmic solute binding protein [Methy...   156    2e-36 
ref|YP_001523480.1|  ABC transporter periplasmic binding prote...   156    3e-36 
ref|NP_946213.1|  ABC transporter, periplasmic binding protein...   156    3e-36 
ref|YP_488151.1|  periplasmic solute binding protein [Rhodopse...   155    6e-36 
ref|YP_001918941.1|  periplasmic solute binding protein [Natra...   153    2e-35 
ref|YP_158007.1|  ABC transporter, periplasmic binding protein...   153    2e-35 
ref|ZP_05311732.1|  periplasmic solute binding protein [Geobac...   153    3e-35 
ref|YP_002287909.1|  periplasmic chelated iron-binding protein...   152    5e-35 
ref|YP_932144.1|  putative manganese transport system, peripla...   152    5e-35 
ref|YP_002974521.1|  periplasmic solute binding protein [Rhizo...   152    6e-35 
emb|CAJ01547.1|  putative abc transporter; periplasmic binding...   152    6e-35 
ref|YP_033042.1|  ABC transporter, periplasmic binding protein...   152    6e-35 
ref|ZP_03528915.1|  putative solute-binding component of ABC t...   151    7e-35 
ref|YP_001769529.1|  periplasmic solute binding protein [Methy...   151    9e-35 
ref|YP_001319482.1|  periplasmic solute binding protein [Alkal...   151    1e-34 
ref|YP_002604652.1|  putative ABC-type manganese/zinc transpor...   150    1e-34 
ref|YP_031886.1|  ABC transporter, periplasmic binding protein...   150    2e-34 
ref|YP_002280146.1|  periplasmic solute binding protein [Rhizo...   149    2e-34 
ref|YP_351388.1|  periplasmic solute binding protein [Pseudomo...   149    3e-34 
emb|CBA33747.1|  hypothetical protein [Curvibacter putative sy...   149    3e-34 
ref|YP_468509.1|  zinc ABC transporter substrate-binding prote...   149    4e-34 
ref|ZP_04589274.1|  periplasmic solute binding protein [Pseudo...   148    7e-34 
ref|YP_235445.1|  periplasmic solute binding protein [Pseudomo...   148    8e-34 
ref|ZP_06356550.1|  periplasmic solute binding protein [Rhodop...   147    1e-33 
ref|ZP_03521085.1|  probable zinc ABC transporter, substrate-b...   147    1e-33 
ref|YP_003261023.1|  periplasmic solute binding protein [Pecto...   146    3e-33 
ref|ZP_03386205.1|  hypothetical protein SentesT_29730 [Salmon...   146    3e-33 
ref|YP_003023505.1|  periplasmic solute binding protein [Geoba...   146    3e-33 
ref|YP_002944672.1|  periplasmic solute binding protein [Vario...   145    4e-33 
ref|YP_002986336.1|  periplasmic solute binding protein [Dicke...   145    4e-33 
ref|YP_002543666.1|  zinc ABC transporter [Agrobacterium radio...   145    5e-33 
ref|YP_002361639.1|  periplasmic solute binding protein [Methy...   145    6e-33 
ref|YP_981379.1|  periplasmic solute binding protein [Polaromo...   144    1e-32 
ref|YP_001884753.1|  ABC transporter, substrate-binding protei...   144    1e-32 
ref|YP_002875573.1|  putative ABC transport system, periplasmi...   144    1e-32 
ref|YP_002894090.1|  periplasmic solute binding protein [Tolum...   144    1e-32 
ref|YP_002971243.1|  ABC transporter, periplasmic binding prot...   144    1e-32 
ref|YP_002140412.1|  periplasmic solute binding protein [Geoba...   144    2e-32 
ref|ZP_03824962.1|  hypothetical protein PcarbP_00005 [Pectoba...   143    2e-32 
ref|ZP_01826883.1|  D-tyrosyl-tRNA deacylase [Streptococcus pn...   143    2e-32 
ref|YP_002500869.1|  periplasmic solute binding protein [Methy...   143    3e-32 
ref|YP_003003014.1|  periplasmic solute binding protein [Dicke...   143    3e-32 
ref|YP_132217.1|  hypothetical protein PBPRB0544 [Photobacteri...   143    3e-32 
ref|YP_001919932.1|  ABC transporter, substrate-binding protei...   143    3e-32 
ref|YP_003019084.1|  periplasmic solute binding protein [Pecto...   142    3e-32 
ref|YP_001758219.1|  periplasmic solute binding protein [Methy...   142    3e-32 
ref|YP_604005.1|  periplasmic solute binding protein [Deinococ...   142    3e-32 
ref|YP_003259840.1|  periplasmic solute binding protein [Pecto...   142    4e-32 
ref|YP_002795348.1|  ZnuA [Laribacter hongkongensis HLHK9] >gb...   142    6e-32 
ref|YP_523307.1|  periplasmic solute binding protein [Rhodofer...   142    6e-32 
ref|ZP_04822132.1|  periplasmic solute binding protein family ...   141    7e-32 
ref|ZP_05112715.1|  Periplasmic solute binding protein family ...   141    7e-32 
ref|ZP_03398084.1|  cation ABC transporter, periplasmic cation...   141    9e-32 
ref|YP_003310054.1|  periplasmic solute binding protein [Sebal...   141    1e-31 
ref|YP_001799919.1|  ABC transport system, permease protein [C...   141    1e-31 
ref|YP_051847.1|  ABC transporter substrate-binding protein [P...   140    1e-31 
ref|YP_003397811.1|  periplasmic solute binding protein [Acida...   140    1e-31 
ref|NP_881651.1|  putative periplasmic solute binding protein ...   140    1e-31 
ref|YP_003335024.1|  periplasmic solute binding protein [Dicke...   140    1e-31 
ref|ZP_01219170.1|  hypothetical protein P3TCK_06312 [Photobac...   140    1e-31 
ref|NP_792443.1|  cation ABC transporter, periplasmic cation-b...   140    1e-31 
ref|ZP_06477939.1|  cation ABC transporter, periplasmic cation...   140    2e-31 
ref|YP_001307621.1|  periplasmic solute binding protein [Clost...   140    2e-31 
ref|NP_972826.1|  ABC transporter, substrate-binding protein, ...   140    2e-31 
ref|YP_988669.1|  ABC transporter, periplasmic substrate-bindi...   139    3e-31 
ref|ZP_03831974.1|  ABC transporter substrate-binding protein ...   139    3e-31 
ref|ZP_06459288.1|  cation ABC transporter, periplasmic cation...   139    3e-31 
ref|YP_001608682.1|  ABC transporter, periplasmic binding prot...   139    4e-31 
ref|ZP_05642041.1|  cation ABC transporter, periplasmic cation...   139    4e-31 
ref|YP_274700.1|  cation ABC transporter, periplasmic cation-b...   139    4e-31 
ref|YP_001311732.1|  periplasmic solute binding protein [Clost...   139    4e-31 
ref|YP_671696.1|  putative periplasmic binding protein [Escher...   139    4e-31 
ref|YP_263238.1|  cation ABC transporter, periplasmic cation-b...   139    5e-31 
ref|NP_882544.1|  putative periplasmic solute binding protein ...   139    5e-31 
ref|ZP_05387374.1|  a probable high-affinity zinc ABC transpor...   138    7e-31 
ref|YP_002263360.1|  periplasmic solute binding protein [Aliiv...   138    7e-31 
ref|ZP_03989300.1|  metal binding protein [Acidaminococcus sp....   138    8e-31 
ref|ZP_03829055.1|  ABC transporter substrate-binding protein ...   138    9e-31 
ref|ZP_06027037.1|  zinc ABC transporter, periplasmic zinc-bin...   137    1e-30 
ref|YP_003504860.1|  periplasmic solute binding protein [Denit...   137    1e-30 
ref|YP_012778.1|  zinc ABC transporter, zinc-binding protein [...   137    1e-30 
ref|YP_998131.1|  periplasmic solute binding protein [Verminep...   137    1e-30 
ref|NP_463686.1|  hypothetical protein lmo0153 [Listeria monoc...   137    1e-30 
ref|YP_003167233.1|  periplasmic solute binding protein [Candi...   137    1e-30 
ref|YP_001419585.1|  periplasmic solute binding protein [Xanth...   137    1e-30 
ref|ZP_04570846.1|  high-affinity zinc uptake system protein z...   137    1e-30 
gb|EFG28960.1|  zinc ABC transporter, periplasmic zinc-binding...   137    1e-30 
ref|YP_567984.1|  periplasmic solute binding protein [Rhodopse...   137    1e-30 
ref|YP_002351435.1|  zinc-binding lipoprotein AdcA [Listeria m...   137    1e-30 
ref|ZP_00234546.1|  zinc ABC transporter, zinc-binding protein...   137    2e-30 
ref|ZP_05294411.1|  hypothetical protein LmonocyFSL_00845 [Lis...   137    2e-30 
ref|ZP_05232269.1|  zinc ABC transporter [Listeria monocytogen...   137    2e-30 
ref|YP_003414972.1|  hypothetical protein LM5578_2864 [Listeri...   137    2e-30 
ref|ZP_06471310.1|  periplasmic solute binding protein [Ethano...   137    2e-30 
ref|YP_001792579.1|  periplasmic solute binding protein [Lepto...   137    2e-30 
ref|YP_428785.1|  periplasmic solute binding protein [Rhodospi...   137    2e-30 
ref|YP_001177891.1|  periplasmic solute binding protein [Enter...   137    2e-30 
ref|YP_003447659.1|  zinc/manganese transport system substrate...   136    2e-30 
ref|ZP_05297476.1|  hypothetical protein LmonocytFSL_02643 [Li...   136    2e-30 
ref|ZP_03666497.1|  hypothetical protein LmonF1_00035 [Listeri...   136    3e-30 
ref|ZP_05243073.1|  zinc ABC transporter [Listeria monocytogen...   136    3e-30 
emb|CAX65460.1|  hypothetical protein [Enterobacter hormaechei]     136    3e-30 
ref|YP_001452535.1|  hypothetical protein CKO_00949 [Citrobact...   136    3e-30 
ref|NP_926257.1|  ABC transporter solute-binding protein [Gloe...   136    3e-30 
ref|YP_003152229.1|  periplasmic solute binding protein [Anaer...   135    5e-30 
ref|YP_001211932.1|  ABC-type metal ion transport system, peri...   135    6e-30 
ref|ZP_05236982.1|  hypothetical protein Lmon1_13314 [Listeria...   135    7e-30 
ref|ZP_00049586.1|  COG0803: ABC-type metal ion transport syst...   135    8e-30 
ref|ZP_02951010.1|  ABC transporter, substrate-binding protein...   135    8e-30 
ref|ZP_03916357.1|  metal cation ABC superfamily ATP binding c...   134    8e-30 
ref|ZP_04612529.1|  Periplasmic solute binding protein [Yersin...   134    9e-30 
ref|ZP_06016614.1|  ABC superfamily ATP binding cassette trans...   134    1e-29 
ref|ZP_05091857.1|  Periplasmic solute binding protein family ...   134    1e-29 
ref|YP_003463376.1|  zinc ABC transporter, zinc-binding protei...   134    1e-29 
ref|ZP_06559941.1|  periplasmic solute binding family protein ...   134    1e-29 
ref|ZP_02094115.1|  hypothetical protein PEPMIC_00873 [Parvimo...   134    1e-29 
ref|NP_622049.1|  ABC-type Mn/Zn transport system, periplasmic...   134    1e-29 
ref|NP_108433.1|  ABC transporter, periplasmic binding protein...   134    1e-29 
ref|ZP_05622185.1|  ABC transporter, substrate-binding protein...   134    1e-29 
ref|YP_001237483.1|  ABC transporter substrate-binding protein...   133    2e-29 
emb|CBL39371.1|  ABC-type metal ion transport system, periplas...   133    3e-29 
ref|NP_357423.1|  ABC transporter, substrate binding protein [...   132    3e-29 
ref|ZP_05132300.1|  periplasmic solute binding protein [Clostr...   132    3e-29 
ref|ZP_06258676.1|  periplasmic solute binding family protein ...   132    3e-29 
ref|ZP_03305579.1|  hypothetical protein ANHYDRO_02021 [Anaero...   132    4e-29 
ref|ZP_01049927.1|  zinc ABC transporter, periplasmic zinc-bin...   132    4e-29 
gb|EFG22588.1|  zinc ABC transporter, zinc-binding lipoprotein...   132    4e-29 
ref|YP_003311207.1|  periplasmic solute binding protein [Veill...   132    4e-29 
ref|ZP_05812563.1|  periplasmic solute binding protein [Mesorh...   132    5e-29 
ref|ZP_05057830.1|  Periplasmic solute binding protein family ...   132    5e-29 
ref|ZP_05814701.1|  high-affinity zinc uptake system protein z...   132    6e-29 
ref|ZP_05054754.1|  hypothetical protein OA307_676 [Octadecaba...   132    6e-29 
ref|YP_002523465.1|  periplasmic solute binding protein [Therm...   131    8e-29 
ref|YP_003073717.1|  periplasmic solute binding protein [Tered...   131    8e-29 
ref|ZP_06684936.1|  ABC superfamily ATP binding cassette trans...   131    1e-28 
ref|ZP_04971008.1|  zinc (Zn2+) ABC superfamily ATP binding ca...   131    1e-28 
ref|ZP_06010992.1|  manganese-binding lipoprotein MntA [Leptot...   131    1e-28 
ref|NP_469536.1|  hypothetical protein lin0191 [Listeria innoc...   131    1e-28 
ref|ZP_05550428.1|  zinc ABC superfamily ATP binding cassette ...   130    1e-28 
ref|ZP_05390279.1|  periplasmic solute binding protein [Clostr...   130    2e-28 
ref|YP_001511478.1|  periplasmic solute binding protein [Frank...   130    2e-28 
ref|ZP_04575189.1|  high-affinity zinc uptake system protein z...   130    2e-28 
ref|ZP_01667464.1|  periplasmic solute binding protein [Thermo...   130    2e-28 
ref|ZP_04572124.1|  high-affinity zinc uptake system protein z...   129    3e-28 
ref|ZP_05440332.1|  high-affinity zinc uptake system protein z...   129    3e-28 
ref|YP_001396430.1|  metal binding protein [Clostridium kluyve...   129    3e-28 
ref|YP_001633409.1|  putative periplasmic solute-binding prote...   129    4e-28 
ref|YP_002473161.1|  hypothetical protein CKR_2696 [Clostridiu...   129    4e-28 
ref|ZP_06115021.1|  zinc ABC transporter, zinc-binding protein...   129    4e-28 
ref|YP_001786754.1|  manganese/zinc/iron chelate ABC transport...   128    7e-28 
ref|ZP_05400920.1|  periplasmic solute binding protein [Clostr...   128    7e-28 
ref|YP_003321202.1|  periplasmic solute binding protein [Sphae...   128    7e-28 
ref|YP_745029.1|  manganese-binding protein [Granulibacter bet...   128    8e-28 
ref|ZP_03625063.1|  Ribulose-phosphate 3-epimerase [Streptococ...   128    8e-28 
ref|ZP_02094493.1|  hypothetical protein PEPMIC_01260 [Parvimo...   128    1e-27 
ref|ZP_05727509.1|  periplasmic solute binding protein [Pantoe...   127    1e-27 
ref|YP_003239176.1|  periplasmic solute binding protein [Ammon...   127    1e-27 
ref|ZP_03945797.1|  metal cation ABC superfamily ATP binding c...   127    1e-27 
ref|YP_383459.1|  periplasmic solute binding protein [Geobacte...   127    1e-27 
ref|ZP_02996461.1|  hypothetical protein CLOSPO_03584 [Clostri...   127    1e-27 
ref|ZP_04600344.1|  hypothetical protein VEIDISOL_01794 [Veill...   127    2e-27 
ref|NP_603565.1|  high-affinity zinc uptake system protein znu...   127    2e-27 
ref|ZP_05054413.1|  hypothetical protein OA307_335 [Octadecaba...   127    2e-27 
ref|ZP_00144057.1|  High-affinity zinc uptake system protein z...   127    2e-27 
ref|YP_001544833.1|  periplasmic solute binding protein [Herpe...   127    2e-27 
ref|YP_001197482.1|  ABC-type metal ion transport system, peri...   127    2e-27 
ref|YP_001455554.1|  hypothetical protein CKO_04052 [Citrobact...   127    2e-27 
ref|ZP_01742291.1|  hypothetical protein RB2150_02079 [Rhodoba...   126    2e-27 
ref|YP_002803734.1|  manganese/zinc/iron chelate uptake ABC tr...   126    2e-27 
ref|YP_001253882.1|  manganese/zinc/iron chelate uptake ABC tr...   126    2e-27 
ref|ZP_05970001.2|  cation ABC transporter, periplasmic cation...   126    3e-27 
ref|YP_003013566.1|  periplasmic solute binding protein [Paeni...   126    3e-27 
ref|YP_003519313.1|  MntA [Pantoea ananatis LMG 20103] >gb|ADD...   126    3e-27 
ref|ZP_02618978.1|  manganese/zinc/iron chelate uptake ABC tra...   126    3e-27 
ref|YP_003305585.1|  periplasmic solute binding protein [Strep...   126    3e-27 
ref|ZP_02732461.1|  periplasmic solute binding protein [Gemmat...   126    3e-27 
ref|ZP_03930062.1|  metal cation ABC superfamily ATP binding c...   126    3e-27 
ref|ZP_05743980.1|  zinc ABC superfamily ATP binding cassette ...   125    4e-27 
ref|NP_902734.1|  high-affinity zinc transport system substrat...   125    4e-27 
ref|YP_001390726.1|  manganese/zinc/iron chelate ABC transport...   125    4e-27 
ref|YP_461251.1|  ABC-type metal ion transport system, peripla...   125    5e-27 
ref|YP_001781017.1|  manganese/zinc/iron chelate ABC transport...   125    5e-27 
ref|ZP_04852615.1|  periplasmic solute binding protein [Paenib...   125    6e-27 
ref|NP_487616.1|  adhesin precursor [Nostoc sp. PCC 7120] >dbj...   125    7e-27 
ref|ZP_03568434.1|  zinc-binding lipoprotein AdcA [Atopobium r...   125    7e-27 
ref|YP_001113976.1|  periplasmic solute binding protein [Desul...   124    8e-27 
ref|YP_001908406.1|  ABC transporter substrate-binding protein...   124    9e-27 
ref|YP_003506412.1|  periplasmic solute binding protein [Meiot...   124    1e-26 
ref|ZP_02328301.1|  ABC transporter permease protein [Paenibac...   124    1e-26 
ref|ZP_06304409.1|  Periplasmic solute binding protein [Raphid...   124    1e-26 
ref|YP_002456535.1|  periplasmic solute binding protein [Desul...   124    1e-26 
ref|ZP_02152838.1|  zinc/manganese/iron ABC transporter, perip...   124    1e-26 
ref|YP_784687.1|  cation ABC transporter,substrate-binding pro...   124    1e-26 
ref|YP_001545812.1|  periplasmic solute binding protein [Herpe...   124    1e-26 
ref|ZP_04805594.1|  periplasmic solute binding protein [Clostr...   124    2e-26 
ref|ZP_06572255.1|  zinc ABC transporter, zinc-binding protein...   124    2e-26 
ref|YP_002920888.1|  cation ABC transport system periplasmic c...   124    2e-26 
ref|YP_956101.1|  periplasmic solute binding protein [Mycobact...   123    2e-26 
ref|YP_003193475.1|  periplasmic solute binding protein [Desul...   123    2e-26 
ref|ZP_04631831.1|  Periplasmic solute binding protein [Yersin...   123    2e-26 
ref|YP_003437979.1|  periplasmic solute binding protein [Klebs...   123    2e-26 
ref|ZP_05378044.1|  periplasmic solute binding protein [Thermo...   123    2e-26 
ref|YP_001336664.1|  putative periplasmic solute binding prote...   123    2e-26 
ref|ZP_06636839.1|  cation ABC superfamily ATP binding cassett...   123    3e-26 
ref|ZP_03698383.1|  periplasmic solute binding protein [Lutiel...   123    3e-26 
ref|NP_390955.1|  manganese ABC transporter (manganese binding...   123    3e-26 
dbj|BAI86590.1|  manganese ABC transporter, membrane protein [...   123    3e-26 
ref|YP_002463367.1|  periplasmic solute binding protein [Chlor...   122    4e-26 
ref|ZP_03766360.1|  periplasmic solute binding protein ['Nosto...   122    4e-26 
ref|YP_322119.1|  periplasmic solute binding protein [Anabaena...   122    4e-26 
ref|YP_710455.1|  manganese ABC transporter [Frankia alni ACN1...   122    4e-26 
ref|ZP_06573086.1|  zinc ABC transporter, periplasmic zinc-bin...   122    4e-26 
ref|YP_516325.1|  hypothetical protein DSY0092 [Desulfitobacte...   122    4e-26 
ref|ZP_02638430.1|  ABC transporter, substrate-binding protein...   122    5e-26 
ref|ZP_05337352.1|  periplasmic solute binding protein [Thermo...   122    5e-26 
ref|NP_563074.1|  ABC transporter substrate-binding protein [C...   122    5e-26 
ref|ZP_06191867.1|  periplasmic solute binding protein [Serrat...   122    5e-26 
ref|ZP_05393423.1|  periplasmic solute binding protein [Clostr...   122    5e-26 
ref|ZP_06550370.1|  zinc/manganese transport system substrate-...   122    5e-26 
ref|YP_001007292.1|  periplasmic solute binding protein [Yersi...   122    5e-26 
ref|ZP_06017031.1|  cation ABC superfamily ATP binding cassett...   122    6e-26 
ref|YP_001661931.1|  periplasmic solute binding protein [Therm...   122    6e-26 
ref|ZP_05473238.1|  zinc ABC superfamily ATP binding cassette ...   122    6e-26 
ref|ZP_01117560.1|  zinc ABC transporter, periplasmic zinc-bin...   122    7e-26 
ref|ZP_02181480.1|  zinc ABC transporter, periplasmic zinc-bin...   122    7e-26 
ref|YP_002464827.1|  periplasmic solute binding protein [Chlor...   122    7e-26 
ref|ZP_06239095.1|  periplasmic solute binding protein [Franki...   122    7e-26 
ref|YP_003373176.1|  periplasmic solute binding protein [Pirel...   121    8e-26 
ref|YP_002236963.1|  cation ABC transporter, periplasmic catio...   121    8e-26 
ref|ZP_06290476.1|  zinc-binding lipoprotein AdcA [Peptoniphil...   121    8e-26 
ref|YP_453867.1|  metal ion ABC transporter periplasmic compon...   121    8e-26 
ref|ZP_01201375.1|  ABC-type metal ion transport system, perip...   121    8e-26 
ref|YP_932719.1|  putative periplasmic solute binding protein ...   121    9e-26 
ref|NP_971833.1|  zinc ABC transporter, periplasmic zinc-bindi...   121    9e-26 
ref|NP_782897.1|  high-affinity Zinc uptake system protein znu...   121    9e-26 
ref|NP_802801.1|  putative metal binding protein of ABC transp...   121    9e-26 
ref|YP_001665891.1|  periplasmic solute binding protein [Therm...   121    1e-25 
gb|EFG24454.1|  zinc ABC transporter, periplasmic zinc-binding...   121    1e-25 
ref|YP_003311169.1|  periplasmic solute binding protein [Veill...   121    1e-25 
ref|ZP_03386558.1|  periplasmic chelated iron-binding protein ...   120    1e-25 
ref|ZP_06258713.1|  periplasmic solute binding family protein ...   120    2e-25 
ref|ZP_02641410.1|  ABC transporter, substrate-binding protein...   120    2e-25 
ref|ZP_00230623.1|  zinc ABC transporter, zinc-binding protein...   120    2e-25 
ref|YP_848330.1|  zinc ABC transporter, zinc-binding lipoprote...   120    2e-25 
ref|YP_699434.1|  ABC transporter, substrate-binding protein [...   120    2e-25 
ref|YP_177453.1|  Mn2+/Zn2+ ABC transporter substrate-binding ...   120    2e-25 
ref|ZP_02951841.1|  ABC transporter, substrate-binding protein...   120    2e-25 
ref|ZP_04019795.1|  metal cation ABC superfamily ATP binding c...   120    2e-25 
gb|EFG22551.1|  zinc ABC transporter, periplasmic zinc-binding...   120    2e-25 
ref|NP_348220.1|  Zn-binding lipoprotein related (surface adhe...   120    2e-25 
ref|YP_003290556.1|  periplasmic solute binding protein [Rhodo...   120    3e-25 
ref|YP_001691331.1|  putative zinc ABC transporter substrate-b...   120    3e-25 
emb|CAO88298.1|  unnamed protein product [Microcystis aerugino...   119    3e-25 
ref|ZP_05089064.1|  zinc/manganese/iron ABC transporter, perip...   119    3e-25 
ref|YP_001581662.1|  periplasmic solute binding protein [Nitro...   119    3e-25 
ref|YP_003163341.1|  periplasmic solute binding protein [Lepto...   119    3e-25 
ref|ZP_05492101.1|  periplasmic solute binding protein [Thermo...   119    4e-25 
ref|YP_003549932.1|  periplasmic solute binding protein [Coral...   119    4e-25 
ref|YP_001036976.1|  periplasmic solute binding protein [Clost...   119    4e-25 
ref|NP_691352.1|  ABC transporter permease [Oceanobacillus ihe...   119    5e-25 
ref|ZP_04600305.1|  hypothetical protein VEIDISOL_01755 [Veill...   119    5e-25 
ref|ZP_05902792.1|  zinc ABC transporter, periplasmic zinc-bin...   119    5e-25 
ref|YP_001658158.1|  periplasmic solute binding protein [Micro...   118    6e-25 
ref|ZP_06494566.1|  periplasmic solute binding protein [Pseudo...   118    7e-25 
ref|ZP_05985558.2|  ABC transporter, periplasmic substrate-bin...   118    7e-25 
ref|ZP_03104400.1|  lipoprotein MtsA [Bacillus cereus W] >gb|E...   118    7e-25 
ref|ZP_01621441.1|  adhesin precursor [Lyngbya sp. PCC 8106] >...   118    7e-25 
ref|ZP_04758064.1|  periplasmic binding protein MntC [Neisseri...   118    8e-25 
ref|ZP_02440676.1|  hypothetical protein CLOSS21_03182 [Clostr...   118    8e-25 
ref|ZP_05317589.1|  ABC transporter, periplasmic substrate-bin...   118    8e-25 
ref|YP_003321378.1|  periplasmic solute binding protein [Sphae...   118    8e-25 
ref|YP_001582989.1|  periplasmic solute binding protein [Nitro...   118    9e-25 
ref|ZP_06160583.1|  zinc ABC transporter, zinc-binding lipopro...   117    1e-24 
ref|ZP_02146810.1|  zinc/manganese/iron ABC transporter, perip...   117    1e-24 
ref|YP_002890471.1|  periplasmic solute binding protein [Thaue...   117    1e-24 
ref|ZP_04635095.1|  Periplasmic solute binding protein [Yersin...   117    1e-24 
ref|ZP_04445128.1|  metal ABC superfamily ATP binding cassette...   117    2e-24 
ref|YP_075710.1|  ABC transporter substrate-binding protein [S...   117    2e-24 
ref|ZP_04788520.1|  periplasmic solute binding protein [Thermo...   117    2e-24 
ref|ZP_02631612.1|  ABC transporter, substrate-binding protein...   117    2e-24 
ref|ZP_06341262.1|  periplasmic solute binding family protein ...   117    2e-24 
ref|ZP_02150982.1|  zinc/manganese/iron ABC transporter, perip...   117    2e-24 
ref|YP_002949492.1|  periplasmic solute binding protein [Geoba...   117    2e-24 
ref|ZP_05733953.1|  zinc ABC transporter, periplasmic zinc-bin...   117    2e-24 
ref|ZP_03632035.1|  periplasmic solute binding protein [bacter...   116    2e-24 
ref|YP_001582462.1|  periplasmic solute binding protein [Nitro...   116    2e-24 
ref|NP_954028.1|  adhesion lipoprotein [Geobacter sulfurreduce...   116    3e-24 
ref|NP_218602.1|  ABC transporter, periplasmic binding protein...   116    3e-24 
ref|YP_722809.1|  periplasmic solute binding protein [Trichode...   116    3e-24 
gb|AAA92353.1|  Tromp1 [Treponema pallidum]                         116    3e-24 
ref|YP_172245.1|  ABC-type manganese transport system substrat...   116    3e-24 
pdb|1TOA|A  Chain A, Periplasmic Zinc Binding Protein Troa Fro...   116    4e-24 
ref|ZP_01092504.1|  ABC transporter solute-binding protein [Bl...   115    4e-24 
ref|YP_001431834.1|  periplasmic solute binding protein [Rosei...   115    4e-24 
ref|YP_572283.1|  periplasmic solute binding protein [Chromoha...   115    5e-24 
ref|YP_002785345.1|  putative metal ABC transporter, periplasm...   115    5e-24 
ref|YP_001413498.1|  periplasmic solute binding protein [Parvi...   115    5e-24 
ref|YP_003242991.1|  periplasmic solute binding protein [Geoba...   115    5e-24 
ref|YP_003132247.1|  ABC-type metal ion transport system, peri...   115    5e-24 
ref|ZP_00047645.1|  COG0803: ABC-type metal ion transport syst...   115    5e-24 
ref|ZP_04657922.1|  metal cation ABC superfamily ATP binding c...   115    6e-24 
ref|ZP_02185212.1|  hypothetical protein CAT7_02292 [Carnobact...   115    7e-24 
ref|ZP_01889326.1|  zinc ABC transporter, periplasmic zinc-bin...   115    7e-24 
ref|ZP_03720630.1|  hypothetical protein NEIFLAOT_02493 [Neiss...   115    7e-24 
ref|ZP_05091856.1|  Periplasmic solute binding protein family ...   115    7e-24 
ref|ZP_05978699.1|  ABC transporter, periplasmic substrate-bin...   114    9e-24 
pdb|1K0F|A  Chain A, Crystal Structure Of Zn(Ii)-Free T. Palli...   114    9e-24 
ref|YP_003150836.1|  ABC-type metal ion transport system, peri...   114    1e-23 
ref|YP_002377837.1|  periplasmic solute binding protein [Cyano...   114    1e-23 
ref|ZP_02084663.1|  hypothetical protein CLOBOL_02191 [Clostri...   114    1e-23 
ref|ZP_05300997.1|  hypothetical protein LmonL_07616 [Listeria...   114    1e-23 
gb|ACP21056.1|  hypothetical protein Aasi_1794 [Candidatus Amo...   114    1e-23 
ref|YP_001958111.1|  hypothetical protein Aasi_1034 [Candidatu...   114    1e-23 
ref|ZP_05085132.1|  zinc/manganese/iron ABC transporter, perip...   114    1e-23 
ref|YP_002787741.1|  putative metal ion ABC transporter, perip...   114    1e-23 
ref|YP_843525.1|  periplasmic solute binding protein [Methanos...   114    1e-23 
ref|NP_296243.1|  adhesin B [Deinococcus radiodurans R1]            114    2e-23 
ref|YP_477400.1|  cation ABC transporter, cation-binding prote...   114    2e-23 
ref|YP_001519242.1|  ABC transporter, periplasmic solute-bindi...   114    2e-23 
ref|ZP_03156558.1|  periplasmic solute binding protein [Cyanot...   114    2e-23 
ref|YP_003475402.1|  periplasmic solute binding family protein...   113    2e-23 
ref|ZP_06306831.1|  Periplasmic solute binding protein [Cylind...   113    2e-23 
ref|YP_003476200.1|  periplasmic solute binding protein [Therm...   113    3e-23 
ref|ZP_00949357.1|  zinc ABC transporter, periplasmic zinc-bin...   113    3e-23 
ref|ZP_04600723.1|  hypothetical protein GCWU000324_00175 [Kin...   113    3e-23 
ref|YP_002996648.1|  laminin binding protein [Streptococcus dy...   112    4e-23 
ref|YP_001633839.1|  periplasmic solute binding protein [Chlor...   112    4e-23 
emb|CAC85395.1|  laminin binding protein [Streptococcus dysgal...   112    4e-23 
ref|ZP_02160722.1|  zinc ABC transporter, periplasmic zinc-bin...   112    4e-23 
ref|ZP_03276616.1|  periplasmic solute binding protein [Arthro...   112    5e-23 
ref|ZP_05404804.1|  putative adhesion lipoprotein [Mitsuokella...   112    5e-23 
ref|NP_608045.1|  putative laminin adhesion [Streptococcus pyo...   112    5e-23 
ref|YP_001277383.1|  periplasmic solute binding protein [Rosei...   112    6e-23 
ref|ZP_01632786.1|  adhesin precursor [Nodularia spumigena CCY...   112    6e-23 
ref|NP_269968.1|  putative laminin adhesion [Streptococcus pyo...   112    6e-23 
pdb|3GI1|A  Chain A, Crystal Structure Of The Laminin-Binding ...   112    6e-23 
ref|YP_003139276.1|  periplasmic solute binding protein [Cyano...   112    7e-23 
gb|ACK77684.1|  ABC-type metal transporter [uncultured bacterium]   112    7e-23 
ref|YP_001546790.1|  periplasmic solute binding protein [Herpe...   112    7e-23 
emb|CBL20585.1|  ABC-type metal ion transport system, periplas...   111    8e-23 
ref|ZP_01078438.1|  hypothetical protein MED121_08256 [Marinom...   111    8e-23 
ref|ZP_00786698.1|  manganese ABC transporter, manganese-bindi...   111    1e-22 
ref|YP_001431702.1|  periplasmic solute binding protein [Rosei...   111    1e-22 
ref|YP_002746477.1|  laminin binding protein [Streptococcus eq...   111    1e-22 
ref|ZP_06604397.1|  metal cation ABC superfamily ATP binding c...   111    1e-22 
ref|YP_002123385.1|  laminin-binding surface protein Lmb [Stre...   111    1e-22 
ref|YP_075335.1|  ABC transporter permease protein [Symbiobact...   111    1e-22 
ref|YP_002744474.1|  laminin binding protein [Streptococcus eq...   110    1e-22 
ref|YP_001679798.1|  zinc-binding lipoprotein adca [Heliobacte...   110    1e-22 
ref|ZP_05982568.1|  ABC transporter, periplasmic substrate-bin...   110    1e-22 
ref|ZP_05737903.1|  zinc ABC superfamily ATP binding cassette ...   110    2e-22 
ref|NP_273630.1|  putative adhesin [Neisseria meningitidis MC5...   110    2e-22 
ref|YP_001450595.1|  metal binding lipoprotein [Streptococcus ...   110    2e-22 
ref|YP_003323306.1|  periplasmic solute binding protein [Therm...   110    2e-22 
ref|ZP_02143002.1|  zinc/manganese/iron ABC transporter, perip...   110    2e-22 
ref|YP_001228837.1|  periplasmic solute binding protein [Geoba...   110    2e-22 
ref|ZP_06539051.1|  periplasmic chelated iron-binding protein ...   110    2e-22 
ref|ZP_06476444.1|  periplasmic solute binding protein [Franki...   110    2e-22 
ref|YP_411927.1|  periplasmic solute binding protein [Nitrosos...   110    3e-22 
ref|YP_001136904.1|  hypothetical protein cgR_0041 [Corynebact...   109    3e-22 
ref|YP_003011798.1|  periplasmic solute binding protein [Paeni...   109    3e-22 
ref|YP_643919.1|  periplasmic solute binding protein [Rubrobac...   109    4e-22 
ref|YP_002315644.1|  ABC-type Mn2+ transport system, periplasm...   109    4e-22 
ref|ZP_05898367.1|  putative adhesion lipoprotein [Selenomonas...   109    4e-22 
ref|YP_324932.1|  periplasmic solute binding protein [Anabaena...   109    4e-22 
ref|ZP_04627605.1|  Periplasmic solute binding protein [Yersin...   109    4e-22 
ref|NP_484876.1|  periplasmic solute binding protein for ABC t...   109    4e-22 
ref|YP_001598685.1|  putative periplasmic binding protein [Nei...   109    4e-22 
ref|YP_974626.1|  putative periplasmic binding protein [Neisse...   109    5e-22 
ref|ZP_05987556.1|  ABC transporter, periplasmic substrate-bin...   108    5e-22 
ref|ZP_05582245.1|  periplasmic solute binding protein [Entero...   108    5e-22 
ref|ZP_04439376.1|  metal ABC superfamily ATP binding cassette...   108    5e-22 
ref|ZP_01878067.1|  zinc/manganese/iron ABC transporter, perip...   108    5e-22 
ref|YP_002456547.1|  periplasmic solute binding protein [Desul...   108    6e-22 
ref|ZP_05561135.1|  periplasmic solute binding protein [Entero...   108    6e-22 
ref|ZP_05475323.1|  periplasmic solute binding protein [Entero...   108    6e-22 
ref|YP_002372648.1|  periplasmic solute binding protein [Cyano...   108    6e-22 
gb|EFE49076.1|  hypothetical protein NEIELOOT_02087 [Neisseria...   108    6e-22 
ref|ZP_05122891.1|  zinc/manganese/iron ABC transporter, perip...   108    6e-22 
ref|ZP_00788829.1|  manganese ABC transporter, manganese-bindi...   108    6e-22 
emb|CAC85394.1|  laminin binding protein [Streptococcus dysgal...   108    6e-22 
ref|ZP_05631081.1|  hypothetical protein FgonA2_04970 [Fusobac...   108    7e-22 
ref|ZP_05568204.1|  periplasmic solute binding protein [Entero...   108    7e-22 
ref|ZP_05311930.1|  periplasmic solute binding protein [Geobac...   108    7e-22 
ref|YP_001545612.1|  periplasmic solute binding protein [Herpe...   108    7e-22 
ref|ZP_04648428.1|  zinc-binding lipoprotein AdcA [Enterococcu...   108    7e-22 
ref|YP_516336.1|  hypothetical protein DSY0103 [Desulfitobacte...   108    8e-22 
ref|ZP_05502485.1|  periplasmic solute binding protein [Entero...   108    8e-22 
ref|ZP_05618164.1|  periplasmic solute binding protein [Fusoba...   108    9e-22 
gb|EFG32097.1|  ABC transporter, periplasmic substrate-binding...   108    9e-22 
ref|ZP_05422184.1|  periplasmic solute binding protein [Entero...   108    9e-22 
ref|ZP_02184398.1|  zinc ABC transporter, zinc-binding protein...   108    1e-21 
ref|YP_781757.1|  periplasmic solute binding protein [Rhodopse...   108    1e-21 
ref|YP_003180077.1|  periplasmic solute binding protein [Atopo...   108    1e-21 
ref|ZP_05025934.1|  Periplasmic solute binding protein family ...   108    1e-21 
ref|NP_813865.1|  adhesion lipoprotein [Enterococcus faecalis ...   108    1e-21 
ref|ZP_03948107.1|  metal ABC superfamily ATP binding cassette...   108    1e-21 
ref|ZP_05425156.1|  periplasmic solute binding protein [Entero...   107    1e-21 
ref|ZP_05852365.1|  zinc ABC transporter zinc-binding lipoprot...   107    1e-21 
ref|NP_938989.1|  ABC transporter [Corynebacterium diphtheriae...   107    1e-21 
ref|ZP_05560391.1|  adhesion lipoprotein [Enterococcus faecali...   107    1e-21 
ref|ZP_01003920.1|  zinc/manganese/iron ABC transporter, perip...   107    1e-21 
ref|ZP_04639032.1|  Periplasmic solute binding protein [Yersin...   107    1e-21 
ref|NP_599279.1|  ABC-type transporter, periplasmic component ...   107    1e-21 
ref|YP_001867878.1|  periplasmic solute binding protein [Nosto...   107    1e-21 
ref|YP_001275613.1|  periplasmic solute binding protein [Rosei...   107    1e-21 
ref|ZP_01855527.1|  manganese ABC transporter substrate bindin...   107    2e-21 
ref|ZP_01754045.1|  zinc/manganese/iron ABC transporter, perip...   107    2e-21 
ref|ZP_04625774.1|  Periplasmic solute binding protein [Yersin...   107    2e-21 
ref|YP_002342235.1|  putative periplasmic binding protein [Nei...   107    2e-21 
ref|ZP_05627019.1|  periplasmic solute binding protein [Fusoba...   107    2e-21 
ref|YP_002535521.1|  periplasmic solute binding protein [Geoba...   107    2e-21 
ref|ZP_01057931.1|  zinc/manganese/iron ABC transporter, perip...   107    2e-21 
emb|CAG15046.1|  manganese ABC transporter [Actinoplanes teich...   107    2e-21 
ref|ZP_01631808.1|  hypothetical protein N9414_19032 [Nodulari...   107    2e-21 
emb|CBA04274.1|  putative periplasmic solute binding protein [...   106    2e-21 
ref|ZP_06380197.1|  periplasmic solute binding protein [Arthro...   106    2e-21 
ref|YP_003023379.1|  periplasmic solute binding protein [Geoba...   106    3e-21 
ref|ZP_01618856.1|  periplasmic solute binding protein for ABC...   106    3e-21 
ref|YP_003082690.1|  putative periplasmic solute binding prote...   106    3e-21 
ref|YP_002000845.1|  periplasmic binding protein MntC [Neisser...   106    3e-21 
ref|ZP_00788194.1|  adhesion lipoprotein [Streptococcus agalac...   106    3e-21 
ref|NP_688926.1|  adhesion lipoprotein [Streptococcus agalacti...   106    3e-21 
ref|YP_001477355.1|  periplasmic solute binding protein [Serra...   106    3e-21 
ref|YP_330493.1|  laminin-binding surface protein [Streptococc...   106    4e-21 
ref|YP_168562.1|  zinc/manganese/iron ABC transporter, peripla...   106    4e-21 
ref|YP_002140323.1|  periplasmic solute binding protein [Geoba...   106    4e-21 
ref|YP_947709.1|  putative solute binding protein [Arthrobacte...   105    4e-21 
ref|ZP_00784646.1|  adhesion lipoprotein [Streptococcus agalac...   105    4e-21 
ref|ZP_01035536.1|  zinc/manganese/iron ABC transporter, perip...   105    4e-21 
ref|YP_681276.1|  zinc/manganese/iron ABC transporter, peripla...   105    5e-21 
ref|ZP_00782116.1|  adhesion lipoprotein [Streptococcus agalac...   105    5e-21 
ref|ZP_02441064.1|  hypothetical protein ANACOL_00332 [Anaerot...   105    6e-21 
ref|ZP_04718219.1|  periplasmic binding protein MntC [Neisseri...   105    6e-21 
ref|YP_002509579.1|  periplasmic solute binding protein [Halot...   105    7e-21 
ref|ZP_04579348.1|  conserved hypothetical protein [Oxalobacte...   105    7e-21 
ref|YP_612093.1|  twin-arginine translocation pathway signal [...   105    7e-21 
ref|YP_392411.1|  periplasmic solute binding protein [Thiomicr...   105    7e-21 
ref|ZP_06308088.1|  Periplasmic solute binding protein [Cylind...   105    8e-21 
ref|ZP_01729872.1|  periplasmic solute binding protein for ABC...   104    9e-21 
ref|ZP_03767157.1|  periplasmic solute binding protein ['Nosto...   104    9e-21 
ref|YP_001806275.1|  putative periplasmic solute binding prote...   104    1e-20 
ref|ZP_04620405.1|  Periplasmic solute binding protein [Yersin...   104    1e-20 
ref|ZP_05497018.1|  periplasmic solute binding protein [Clostr...   104    1e-20 
ref|YP_678633.1|  Mn/Zn ABC transporter, substrate-binding pro...   104    1e-20 
ref|ZP_01079985.1|  Periplasmic solute binding protein [Synech...   104    1e-20 
ref|YP_003011016.1|  periplasmic solute binding protein [Paeni...   104    1e-20 
ref|YP_724338.1|  periplasmic solute binding protein [Trichode...   104    1e-20 
ref|YP_001931381.1|  periplasmic solute binding protein [Sulfu...   103    2e-20 
ref|ZP_05660086.1|  adhesion lipoprotein [Enterococcus faecium...   103    2e-20 
ref|YP_702511.1|  ABC metal transporter, substrate-binding com...   103    2e-20 
ref|YP_001220917.1|  putative Mn2+/Zn2+ ABC-type transporter,s...   103    2e-20 
ref|ZP_01746690.1|  zinc/manganese/iron ABC transporter, perip...   103    2e-20 
ref|YP_003189909.1|  periplasmic solute binding protein [Desul...   103    2e-20 
ref|ZP_06160796.1|  zinc ABC transporter, zinc-binding protein...   103    2e-20 
ref|ZP_06304702.1|  Periplasmic solute binding protein for ABC...   102    4e-20 
ref|NP_938561.1|  hypothetical protein DIP0169 [Corynebacteriu...   102    5e-20 
ref|ZP_00999602.1|  zinc/manganese/iron ABC transporter, perip...   102    5e-20 
ref|YP_002741451.1|  zinc-binding lipoprotein AdcA [Streptococ...   102    6e-20 
ref|ZP_05742013.1|  twin-arginine translocation pathway signal...   102    6e-20 
ref|YP_002990598.1|  periplasmic solute binding protein [Desul...   102    6e-20 
ref|YP_003484675.1|  putative surface adhesin [Streptococcus m...   102    6e-20 
ref|YP_002721086.1|  periplasmic solute binding protein [Brach...   102    6e-20 
ref|ZP_05647761.1|  periplasmic solute binding protein [Entero...   102    6e-20 
ref|YP_207336.1|  MntC [Neisseria gonorrhoeae FA 1090] >gb|AAW...   102    6e-20 
ref|YP_002505493.1|  periplasmic solute binding protein [Clost...   102    7e-20 
ref|YP_475099.1|  cation ABC transporter, cation-binding prote...   102    7e-20 
ref|ZP_06621484.1|  periplasmic solute binding family protein ...   101    8e-20 
ref|ZP_05314574.1|  periplasmic solute binding protein [Nitros...   101    8e-20 
ref|NP_721673.1|  putative surface adhesin; AdcA protein homol...   101    8e-20 
ref|YP_518075.1|  hypothetical protein DSY1842 [Desulfitobacte...   101    8e-20 
ref|YP_001129197.1|  laminin binding protein [Streptococcus py...   101    9e-20 
ref|YP_003397534.1|  periplasmic solute binding protein [Conex...   101    1e-19 
ref|ZP_05650783.1|  periplasmic solute binding protein [Entero...   101    1e-19 
ref|NP_688239.1|  laminin-binding surface protein [Streptococc...   101    1e-19 
ref|YP_002739247.1|  zinc-binding lipoprotein AdcA [Streptococ...   101    1e-19 
gb|AAQ13353.1|U66099_1  lraI homolog [Streptococcus pyogenes]       101    1e-19 
ref|NP_735748.1|  laminin-binding surface protein [Streptococc...   101    1e-19 
ref|ZP_00786239.1|  lipoprotein lmb [Streptococcus agalactiae ...   101    1e-19 
pdb|3HJT|A  Chain A, Structure Of Laminin Binding Protein (Lmb...   101    1e-19 
ref|ZP_00781539.1|  lipoprotein lmb [Streptococcus agalactiae ...   101    1e-19 
emb|CAC85393.1|  laminin binding protein [Streptococcus agalac...   101    1e-19 
ref|YP_061035.1|  laminin binding protein [Streptococcus pyoge...   101    1e-19 
ref|ZP_02080313.1|  hypothetical protein CLOLEP_01765 [Clostri...   101    1e-19 
gb|EFF24897.1|  zinc-binding lipoprotein AdcA [Enterococcus fa...   101    1e-19 
ref|ZP_05662100.1|  adhesion lipoprotein [Enterococcus faecium...   101    1e-19 
ref|ZP_05747794.1|  zinc ABC superfamily ATP binding cassette ...   100    1e-19 
ref|ZP_06425183.1|  high-affinity zinc uptake system protein Z...   100    2e-19 
ref|YP_002769609.1|  putative zinc ABC transporter substrate b...   100    2e-19 
ref|ZP_06611171.1|  zinc ABC superfamily ATP binding cassette ...   100    2e-19 
ref|NP_898570.1|  putative zinc transport system substrate-bin...   100    2e-19 
ref|YP_001513668.1|  periplasmic solute binding protein [Alkal...   100    2e-19 
ref|ZP_04449444.1|  hypothetical protein GCWU000282_00673 [Cat...   100    3e-19 
ref|ZP_05679640.1|  periplasmic solute binding protein [Entero...   100    3e-19 
ref|ZP_03709316.1|  hypothetical protein CORMATOL_00120 [Coryn...  99.8    3e-19 
ref|ZP_06681217.1|  zinc-binding lipoprotein AdcA [Enterococcu...  99.8    3e-19 
ref|ZP_01901310.1|  periplasmic solute binding protein [Roseob...  99.8    3e-19 
ref|ZP_06612052.1|  adhesion lipoprotein [Streptococcus oralis...  99.4    4e-19 
ref|YP_901805.1|  periplasmic solute binding protein [Pelobact...  99.4    4e-19 
ref|ZP_05861377.1|  zinc ABC transporter, periplasmic zinc-bin...  99.4    4e-19 
ref|ZP_02715843.1|  zinc-binding lipoprotein AdcA [Streptococc...  99.4    4e-19 
ref|ZP_04046444.1|  ABC-type metal ion transport system, perip...  99.4    4e-19 
ref|YP_915393.1|  periplasmic solute binding protein [Paracocc...  99.4    4e-19 
ref|ZP_06675630.1|  zinc-binding lipoprotein AdcA [Enterococcu...  99.4    4e-19 
emb|CAA96185.1|  AdcA protein [Streptococcus pneumoniae]           99.4    5e-19 
ref|NP_268946.1|  putative adhesion protein [Streptococcus pyo...  99.0    5e-19 
ref|ZP_00602848.1|  Periplasmic solute binding protein [Entero...  99.0    5e-19 
ref|YP_002562213.1|  laminin binding protein [Streptococcus ub...  99.0    5e-19 
ref|ZP_05665970.1|  periplasmic solute binding protein [Entero...  99.0    6e-19 
ref|ZP_01817757.1|  zinc ABC transporter, zinc-binding lipopro...  99.0    6e-19 
ref|YP_003447120.1|  ABC zinc transporter, metal-binding lipop...  98.6    6e-19 
ref|ZP_02718216.1|  zinc-binding lipoprotein AdcA [Streptococc...  98.6    6e-19 
ref|ZP_06198104.1|  zinc ABC transporter, zinc-binding lipopro...  98.6    7e-19 
ref|NP_359566.1|  zinc ABC transporter zinc-binding protein [S...  98.6    7e-19 
ref|YP_002124076.1|  zinc-binding lipoprotein LraI precursor, ...  98.6    7e-19 
ref|ZP_05075469.1|  zinc/manganese/iron ABC transporter, perip...  98.6    7e-19 
ref|ZP_01821752.1|  zinc ABC transporter, zinc-binding lipopro...  98.6    7e-19 
ref|NP_346583.1|  zinc ABC transporter, zinc-binding lipoprote...  98.6    8e-19 
ref|YP_002743496.1|  zinc-binding lipoprotein AdcA [Streptococ...  98.6    8e-19 
ref|YP_002038760.1|  zinc ABC transporter, zinc-binding lipopr...  98.6    8e-19 
ref|ZP_06198896.1|  adhesion lipoprotein [Streptococcus sp. M1...  98.6    8e-19 
ref|YP_002737174.1|  zinc-binding lipoprotein AdcA [Streptococ...  98.6    8e-19 
ref|YP_001836854.1|  zinc ABC transporter, zinc-binding lipopr...  98.6    8e-19 
ref|ZP_01408972.1|  hypothetical protein SpneT_02000550 [Strep...  98.6    8e-19 
ref|ZP_01825540.1|  zinc ABC transporter, zinc-binding lipopro...  98.6    8e-19 
ref|ZP_01830534.1|  zinc ABC transporter, zinc-binding lipopro...  98.2    9e-19 
ref|ZP_04523585.1|  zinc-binding lipoprotein AdcA [Streptococc...  98.2    9e-19 
ref|ZP_01820226.1|  zinc ABC transporter, zinc-binding lipopro...  98.2    9e-19 
ref|ZP_02708956.1|  zinc-binding lipoprotein AdcA [Streptococc...  98.2    9e-19 
ref|YP_001952069.1|  periplasmic solute binding protein [Geoba...  98.2    9e-19 
ref|YP_001698973.1|  manganese-binding lipoprotein mntA precur...  98.2    1e-18 
ref|YP_001695525.1|  zinc-binding lipoprotein AdcA [Streptococ...  98.2    1e-18 
dbj|BAB17621.1|  saliva-binding protein B (ssaB) homologue [Er...  98.2    1e-18 
ref|ZP_06414295.1|  periplasmic solute binding protein [Franki...  97.8    1e-18 
ref|ZP_01900235.1|  hypothetical protein PE36_02904 [Moritella...  97.8    1e-18 
ref|ZP_06424324.1|  zinc-binding lipoprotein AdcA [Peptostrept...  97.8    1e-18 
ref|ZP_03714277.1|  hypothetical protein EIKCOROL_01975 [Eiken...  97.8    1e-18 
ref|NP_388167.1|  Zn(II)-binding lipoprotein [Bacillus subtili...  97.8    1e-18 
ref|ZP_00365563.1|  COG0803: ABC-type metal ion transport syst...  97.8    1e-18 
ref|ZP_02094232.1|  hypothetical protein PEPMIC_00996 [Parvimo...  97.8    1e-18 
ref|ZP_03981149.1|  ABC superfamily ATP binding cassette trans...  97.8    1e-18 
ref|ZP_01631320.1|  periplasmic solute binding protein for ABC...  97.8    1e-18 
ref|ZP_01743402.1|  Periplasmic solute binding protein [Rhodob...  97.8    1e-18 
ref|YP_002743800.1|  laminin binding protein [Streptococcus eq...  97.4    1e-18 
ref|YP_139346.1|  zinc (Zn2+) ABC uptake transporter substrate...  97.4    1e-18 
ref|YP_001035289.1|  Zn/Mn ABC-type porter lipoprotein, putati...  97.4    1e-18 
ref|YP_141264.1|  zinc ABC transporter substrate binding prote...  97.4    1e-18 
ref|ZP_05673509.1|  periplasmic solute binding protein [Entero...  97.4    2e-18 
ref|YP_602118.1|  High-affinity zinc uptake system protein znu...  97.4    2e-18 
ref|YP_002779464.1|  putative ABC transporter substrate-bindin...  97.4    2e-18 
ref|YP_002512028.1|  zinc-binding protein AdcA precursor [Stre...  97.4    2e-18 
ref|YP_820321.1|  ABC-type metal ion transport system, peripla...  97.1    2e-18 
ref|YP_001034150.1|  putative Zn-binding lipoprotein [Streptoc...  97.1    2e-18 
ref|NP_938565.1|  hypothetical protein DIP0173 [Corynebacteriu...  97.1    2e-18 
gb|AAO43170.1|  metal-binding permease precursor [Streptococcu...  97.1    2e-18 
ref|YP_279990.1|  high-affinity zinc uptake system protein Znu...  97.1    2e-18 
ref|YP_181373.1|  cation ABC transporter, periplasmc-binding p...  96.7    3e-18 
ref|ZP_01725754.1|  ABC transporter permease [Bacillus sp. B14...  96.7    3e-18 
ref|NP_606949.1|  putative adhesion protein [Streptococcus pyo...  96.7    3e-18 
ref|YP_001419941.1|  YcdH [Bacillus amyloliquefaciens FZB42] >...  96.7    3e-18 
ref|YP_059881.1|  high-affinity zinc uptake system protein znu...  96.7    3e-18 
ref|ZP_03625336.1|  periplasmic solute binding protein [Strept...  96.7    3e-18 
ref|ZP_06061523.1|  metal-binding permease [Streptococcus sp. ...  96.3    3e-18 
ref|YP_001635597.1|  periplasmic solute binding protein [Chlor...  96.3    3e-18 
ref|ZP_05748199.1|  zinc ABC superfamily ATP binding cassette ...  96.3    4e-18 
ref|YP_001128800.1|  zinc-binding protein AdcA precursor [Stre...  96.3    4e-18 
ref|ZP_03157210.1|  periplasmic solute binding protein [Cyanot...  96.3    4e-18 
ref|YP_510022.1|  periplasmic solute binding protein [Jannasch...  96.3    4e-18 
ref|YP_001692217.1|  zinc ABC transporter substrate-binding pr...  96.3    4e-18 
ref|YP_261265.1|  cation ABC transporter, periplasmic cation-b...  96.3    4e-18 
ref|YP_003117704.1|  periplasmic solute binding protein [Caten...  95.9    4e-18 
ref|YP_596328.1|  high-affinity zinc uptake system protein znu...  95.9    5e-18 
ref|ZP_02929699.1|  ABC transporter, periplasmic binding prote...  95.9    5e-18 
ref|YP_001451202.1|  metal-binding (Mn) permease precursor, li...  95.9    5e-18 
ref|ZP_01173876.1|  manganese ABC transporter (membrane protei...  95.9    5e-18 
ref|ZP_06683862.1|  zinc-binding lipoprotein AdcA [Enterococcu...  95.9    5e-18 
ref|YP_003393335.1|  periplasmic solute binding protein [Conex...  95.5    6e-18 
gb|EFF25657.1|  zinc-binding lipoprotein AdcA [Enterococcus fa...  95.5    6e-18 
ref|ZP_03734928.1|  periplasmic solute binding protein [Dethio...  95.5    6e-18 
ref|YP_002561975.1|  zinc-binding protein AdcA precursor [Stre...  95.5    6e-18 
ref|YP_281906.1|  high-affinity zinc uptake system protein znu...  95.5    6e-18 
ref|YP_002285571.1|  Zinc-binding protein adcA precursor [Stre...  95.5    7e-18 
ref|ZP_01827934.1|  zinc ABC transporter, zinc-binding lipopro...  95.5    7e-18 
ref|ZP_03917254.1|  Zn2+ ABC superfamily ATP binding cassette ...  95.5    7e-18 
ref|ZP_04047511.1|  ABC-type metal ion transport system, perip...  95.1    7e-18 
ref|NP_602612.1|  manganese-binding protein [Fusobacterium nuc...  95.1    7e-18 
ref|NP_870512.1|  manganese ABC transporter substrate binding ...  95.1    8e-18 
ref|ZP_01407861.1|  hypothetical protein SpneT_02001707 [Strep...  95.1    8e-18 
gb|ADD72184.1|  manganese/zinc/iron chelate uptake ABC transpo...  95.1    8e-18 
ref|ZP_03982752.1|  metal cation ABC superfamily ATP binding c...  95.1    8e-18 
ref|ZP_05647582.1|  periplasmic solute binding protein [Entero...  95.1    8e-18 
ref|YP_002746196.1|  zinc-binding protein AdcA precursor [Stre...  95.1    8e-18 
ref|NP_358500.1|  adhesion lipoprotein [Streptococcus pneumoni...  95.1    8e-18 
ref|YP_003430165.1|  putative metal (zinc) ABC transporter, zi...  95.1    8e-18 
ref|ZP_05656476.1|  periplasmic solute binding protein [Entero...  95.1    8e-18 
ref|NP_345479.1|  adhesion lipoprotein [Streptococcus pneumoni...  95.1    9e-18 
ref|YP_003353799.1|  Metal ABC transporter, substrate-binding ...  95.1    9e-18 
ref|YP_002744744.1|  zinc-binding protein AdcA precursor [Stre...  95.1    9e-18 

ALIGNMENTS
>ref|YP_002977237.1| periplasmic solute binding protein [Rhizobium leguminosarum bv. 
trifolii WSM1325]
 gb|ACS57698.1| periplasmic solute binding protein [Rhizobium leguminosarum bv. 
trifolii WSM1325]
Length=310

 Score =  370 bits (951),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 172/287 (59%), Positives = 219/287 (76%), Gaps = 0/287 (0%)

Query  4    LILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDL  63
            +++ F     Q    K KV+TTFTVIAD+VKNVAGDAA VESITKP AEIHNY  TPGD+
Sbjct  21   VLVAFPAAAQQTTNSKFKVVTTFTVIADMVKNVAGDAAIVESITKPGAEIHNYAPTPGDI  80

Query  64   RRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMS  123
            +RA+G  L+++NGLNLE WF+KFFQNL DVP  V+S  I+ + I +GPY+ KPNPHAWMS
Sbjct  81   QRAQGAQLILWNGLNLERWFEKFFQNLHDVPGAVVSDGIEPMGISEGPYQGKPNPHAWMS  140

Query  124  PTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVT  183
            P N +IYVDN+  A A++DPANA  Y +NA +YK+K+            ++ E+++WLV+
Sbjct  141  PKNALIYVDNIRDAFAKYDPANAETYNANAEAYKQKIEATITPIRATLDKIPEDKRWLVS  200

Query  184  SEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPAL  243
            SEGAFSYLA +F LKE YLWP+N+D QGTP+Q+++VID + E KIP +FSEST+S KPA 
Sbjct  201  SEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVIDAVEENKIPTVFSESTVSDKPAR  260

Query  244  QVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            QVARETGA YGGVLYVDSLS+A G VPTYI L+  T D + +GL++G
Sbjct  261  QVARETGAHYGGVLYVDSLSEADGPVPTYIDLLRVTSDTVAKGLADG  307


>ref|YP_003557774.1| Iron transport protein, periplasmic-binding protein [Shewanella 
violacea DSS12]
 dbj|BAJ02996.1| Iron transport protein, periplasmic-binding protein [Shewanella 
violacea DSS12]
Length=297

 Score =  370 bits (949),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/290 (58%), Positives = 226/290 (77%), Gaps = 1/290 (0%)

Query  1    LVFLILTFIVIPLQADE-KKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQAT  59
            L+ + L+F    L A +  K KV+TTFTVIAD+ +NVAGDAA VESITKPNAEIHNYQAT
Sbjct  8    LLTITLSFWSHELLASQGDKFKVITTFTVIADMARNVAGDAAIVESITKPNAEIHNYQAT  67

Query  60   PGDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPH  119
            PGD+RRA+G DL++YNGLNLE+WF+KFFQNL++VP  ++++ I+ + I QGPY  KPNPH
Sbjct  68   PGDIRRAQGADLILYNGLNLELWFNKFFQNLNEVPRTIVTQGIEPMGISQGPYSGKPNPH  127

Query  120  AWMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERK  179
            AWMS  N +IYV+N+ +AL ++D  NA +Y +NA  Y  ++    E +  +   +++ER+
Sbjct  128  AWMSAPNALIYVENIRKALVRYDSDNAAIYNTNAKRYSAQILAAVEPFKAQLDAVSKERR  187

Query  180  WLVTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISP  239
            WLVTSEGAFSYL  ++ L+E YLWP+N+D QGTP+Q+++VID + + KIPVIFSEST+S 
Sbjct  188  WLVTSEGAFSYLTRDYDLQELYLWPINADAQGTPQQVRKVIDQMRQHKIPVIFSESTVSA  247

Query  240  KPALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSE  289
            KPA QVARETGA YGG+LYVDSLS + G VPTYI L++ TLD I +GL +
Sbjct  248  KPAQQVARETGAKYGGMLYVDSLSSSSGPVPTYISLLTSTLDTIAKGLKD  297


>ref|YP_769462.1| iron ABC transporter substrate binding protein [Rhizobium leguminosarum 
bv. viciae 3841]
 emb|CAK09374.1| putative substrate-binding Fur regulated salmonella iron ABC 
transporter [Rhizobium leguminosarum bv. viciae 3841]
Length=310

 Score =  368 bits (945),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 219/287 (76%), Gaps = 0/287 (0%)

Query  4    LILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDL  63
            +++ F     Q    K KV+TTFTVIAD+ KNVAGDAA VESITKP AEIHNY  TPGD+
Sbjct  21   VLVAFPAAAQQTTNSKFKVVTTFTVIADMAKNVAGDAAIVESITKPGAEIHNYAPTPGDI  80

Query  64   RRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMS  123
            +RA+G  L+++NGLNLE WF+KFFQNL DVP  V+S  I+ + I +GPY+ KPNPHAWMS
Sbjct  81   QRAQGAQLILWNGLNLERWFEKFFQNLHDVPGAVVSDGIEPMGISEGPYEGKPNPHAWMS  140

Query  124  PTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVT  183
            P N +IYVDN+  A A++DPANA  Y++NA +YK+K+            ++ E+++WLV+
Sbjct  141  PKNALIYVDNIRDAFAKYDPANAETYKANAEAYKQKIEATITPIRATLEKIPEDKRWLVS  200

Query  184  SEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPAL  243
            SEGAFSYLA +F LKE YLWP+N+D QGTP+Q+++VID + E +IP +FSEST+S KPA 
Sbjct  201  SEGAFSYLARDFGLKELYLWPINADQQGTPQQVRKVIDAVKENQIPTVFSESTVSDKPAR  260

Query  244  QVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            QVARETGA YGGVLYVDSLS+A G VPTYI L+  T D + +GL++G
Sbjct  261  QVARETGAHYGGVLYVDSLSEADGPVPTYIDLLRVTSDTVAKGLADG  307


>ref|ZP_01159456.1| Iron transport protein [Photobacterium sp. SKA34]
 gb|EAR56876.1| Iron transport protein [Photobacterium sp. SKA34]
Length=303

 Score =  365 bits (937),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/287 (58%), Positives = 219/287 (76%), Gaps = 0/287 (0%)

Query  2    VFLILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPG  61
            V L +  ++  +   + K KV+TTFT+IAD+ KNVAGDAA VESITKPNAEIHNYQ TPG
Sbjct  16   VLLSVGLLISTVSHADDKFKVITTFTIIADMAKNVAGDAAIVESITKPNAEIHNYQVTPG  75

Query  62   DLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAW  121
            DL+RA+G DL++YNGLNLE+WF+KFFQNL D+PSV ++ NI  +SI QGPY  KPNPHAW
Sbjct  76   DLKRAQGADLILYNGLNLELWFNKFFQNLHDIPSVTVTENITPLSITQGPYNGKPNPHAW  135

Query  122  MSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWL  181
            MSP N +IYV+N+ RAL ++DP NA +Y  NA  Y ++++R       + + +  +++WL
Sbjct  136  MSPENGIIYVENIRRALVKYDPKNADIYNKNAQKYTQEIQRTITPIRNQINTIPVDKRWL  195

Query  182  VTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKP  241
            VTSEGAFSYLA +F LKE YLWP+N+D QGTP+Q++++ID + + +I  +FSEST+S KP
Sbjct  196  VTSEGAFSYLARDFGLKELYLWPINADAQGTPQQVRQLIDAVRQHQIHAVFSESTVSAKP  255

Query  242  ALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLS  288
            A QVARETGA Y GVLYVDSLS   G VPTY++LI  T   I +GLS
Sbjct  256  AQQVARETGANYAGVLYVDSLSAKNGPVPTYLELIEVTSRTIAKGLS  302


>ref|ZP_01233288.1| Iron transport protein, periplasmic-binding protein [Vibrio angustum 
S14]
 gb|EAS65743.1| Iron transport protein, periplasmic-binding protein [Vibrio angustum 
S14]
Length=303

 Score =  364 bits (935),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 167/270 (61%), Positives = 212/270 (78%), Gaps = 0/270 (0%)

Query  19   KLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDLRRARGVDLLIYNGLN  78
            K KV+TTFT+IAD+ KNVAGDAA VESITKPNAEIHNYQ TPGDL+RA+G DL++YNGLN
Sbjct  33   KFKVITTFTIIADMAKNVAGDAAIVESITKPNAEIHNYQVTPGDLKRAQGADLILYNGLN  92

Query  79   LEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMSPTNVMIYVDNVERAL  138
            LE+WF+KFF+NL DVPSV ++ NI  +SI QGPY  KPNPHAWMSP N +IYV+N+ +AL
Sbjct  93   LELWFNKFFKNLHDVPSVTVTENITPLSITQGPYNGKPNPHAWMSPENGIIYVENIRQAL  152

Query  139  AQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVTSEGAFSYLAAEFKLK  198
             +HDP NA +Y  NA  Y +K+++       + + +  +++WLVTSEGAFSYLA +F LK
Sbjct  153  VKHDPKNADIYNKNAQQYTQKIKQTIAPIRNQINTIPVDKRWLVTSEGAFSYLARDFGLK  212

Query  199  EAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPALQVARETGAAYGGVLY  258
            E YLWP+N+D QGTP+Q++++ID + + +I  +FSEST+S KPA QVARETGA Y GVLY
Sbjct  213  ELYLWPINADAQGTPQQVRQLIDAVRQHQIHAVFSESTVSAKPAQQVARETGANYAGVLY  272

Query  259  VDSLSDAKGRVPTYIKLISETLDRIYEGLS  288
            VDSLS   G VPTY++LI  T   I +GLS
Sbjct  273  VDSLSANNGPVPTYLELIKVTSQTIAKGLS  302


>ref|ZP_03499741.1| iron ABC transporter substrate binding protein [Rhizobium etli 
Kim 5]
Length=293

 Score =  360 bits (925),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 165/274 (60%), Positives = 212/274 (77%), Gaps = 0/274 (0%)

Query  17   EKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDLRRARGVDLLIYNG  76
            ++K K +TTFTVIAD+ KNVAGDAA VESITKP AEIH YQ TPGD+RRA+G  +L+ NG
Sbjct  17   QEKFKAVTTFTVIADMAKNVAGDAAIVESITKPGAEIHEYQPTPGDIRRAQGTRILLSNG  76

Query  77   LNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMSPTNVMIYVDNVER  136
            LNLE+WF KF+QNL DVP VV+S  ++ + I +GPY  KPNPHAWMSP N +IYVDN+  
Sbjct  77   LNLELWFQKFYQNLKDVPDVVVSTGVEPMGISEGPYSGKPNPHAWMSPKNAIIYVDNIRD  136

Query  137  ALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVTSEGAFSYLAAEFK  196
            A  ++DP NA VY++NA +YK+++        +K   + E+++WLV+SEGAFSYLA +F 
Sbjct  137  AFVKYDPKNAEVYKANAEAYKKEIEATIAPIREKLDTIPEDKRWLVSSEGAFSYLARDFG  196

Query  197  LKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPALQVARETGAAYGGV  256
            LKE YLWP+N+D QGTP+Q+++V+D +   KIP +FSEST+S KPA QVARETGA YGGV
Sbjct  197  LKELYLWPINADQQGTPQQVRKVVDAVRANKIPAVFSESTVSDKPARQVARETGARYGGV  256

Query  257  LYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            LYVDSLS+A G  PTYI L+  T D + +GL+EG
Sbjct  257  LYVDSLSEADGPTPTYIDLLRVTSDTVVKGLAEG  290


>ref|NP_387132.1| putative IRON-binding periplasmic ABC transporter protein [Sinorhizobium 
meliloti 1021]
 emb|CAC47605.1| Manganese ABC transporter periplasmic substrate binding protein 
[Sinorhizobium meliloti 1021]
Length=301

 Score =  359 bits (921),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/272 (60%), Positives = 211/272 (77%), Gaps = 0/272 (0%)

Query  18   KKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDLRRARGVDLLIYNGL  77
            +KLK +TTFTVIAD+ +NVAGDAA VESITKP AEIHNYQ TP D+ +A   DL+++NGL
Sbjct  30   EKLKAVTTFTVIADMAQNVAGDAAVVESITKPGAEIHNYQPTPRDILKAHDADLILWNGL  89

Query  78   NLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMSPTNVMIYVDNVERA  137
            NLE+WF++FFQN D VP VV+S  ++ + I +GPY  KPNPHAWMSP+  +IYVDN+  A
Sbjct  90   NLELWFERFFQNFDGVPGVVVSEGVEPMGIAEGPYTGKPNPHAWMSPSAALIYVDNIRDA  149

Query  138  LAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVTSEGAFSYLAAEFKL  197
              QHDP NA VY++NA +YK+K+         +   +  ER+WLV+SEGAFSYLA +F +
Sbjct  150  FVQHDPPNAEVYKANAEAYKKKIEAAVAPIRTELERIPAERRWLVSSEGAFSYLARDFGM  209

Query  198  KEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPALQVARETGAAYGGVL  257
            KE YLWP+N+D QGTP+Q+++VID++   +IPV+FSESTISP PA QVARETGA YGGVL
Sbjct  210  KELYLWPINADQQGTPQQVRKVIDVVRANRIPVVFSESTISPDPAEQVARETGAKYGGVL  269

Query  258  YVDSLSDAKGRVPTYIKLISETLDRIYEGLSE  289
            YVDSLS+A G VPTYI L+  T + I +GLS+
Sbjct  270  YVDSLSEADGPVPTYIDLLRVTSETIAKGLSQ  301


>ref|YP_001416113.1| periplasmic solute binding protein [Xanthobacter autotrophicus 
Py2]
 gb|ABS66456.1| periplasmic solute binding protein [Xanthobacter autotrophicus 
Py2]
Length=324

 Score =  357 bits (916),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 166/273 (60%), Positives = 210/273 (76%), Gaps = 0/273 (0%)

Query  19   KLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDLRRARGVDLLIYNGLN  78
            KLKV+TTFT+IAD+ KNVAGDAA V+SITKP AEIHNYQ TPGDL +A+G +L+++NGLN
Sbjct  50   KLKVVTTFTIIADMAKNVAGDAAQVDSITKPGAEIHNYQPTPGDLIKAQGANLILWNGLN  109

Query  79   LEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMSPTNVMIYVDNVERAL  138
            LE+WF+KFF  L  VPSVV+S  ++ + I +GPY  KPNPHAWMSPT  ++YVDN+  AL
Sbjct  110  LELWFEKFFSRLKGVPSVVVSDGVEPMGITEGPYSGKPNPHAWMSPTAALVYVDNIRDAL  169

Query  139  AQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVTSEGAFSYLAAEFKLK  198
             ++DPANA  Y++NA +YK K+         +  ++  +++WLVTSEGAFSYLA +F LK
Sbjct  170  VKYDPANATTYKANAEAYKAKITATIAPIRAELDKVPADQRWLVTSEGAFSYLARDFGLK  229

Query  199  EAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPALQVARETGAAYGGVLY  258
              YLWP+N+D QGTP+Q++RV+D +   KIP IFSESTIS +PA QVARETGA YGGVLY
Sbjct  230  PLYLWPINADQQGTPQQVRRVVDRMRADKIPAIFSESTISAEPAKQVARETGARYGGVLY  289

Query  259  VDSLSDAKGRVPTYIKLISETLDRIYEGLSEGN  291
            VDSLSDA G VPTY+ L+  T   I EGL+ G 
Sbjct  290  VDSLSDAAGPVPTYLDLLRVTSTTIAEGLTGGT  322


>ref|YP_002527472.1| ABC transport system, periplasmic binding protein SitA [Escherichia 
coli]
 gb|ACJ63501.1| ABC transport system, periplasmic binding protein SitA [Escherichia 
coli]
Length=304

 Score =  356 bits (914),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/290 (55%), Positives = 217/290 (74%), Gaps = 0/290 (0%)

Query  1    LVFLILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATP  60
            L  L+LT  +    +  +K KV+TTFT+IAD+ KNVAGDAA V SITKP AEIH YQ TP
Sbjct  11   LGCLVLTCSIAFQASAAEKFKVITTFTIIADMAKNVAGDAAEVSSITKPGAEIHEYQPTP  70

Query  61   GDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHA  120
            GD++RA+G  L++ NG+NLE+WF +F+Q+L+ VP V++S  +  + I +GPY+ KPNPHA
Sbjct  71   GDIKRAQGAQLILANGMNLELWFQRFYQHLNGVPEVIVSSGVTPVGITEGPYEGKPNPHA  130

Query  121  WMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKW  180
            WMSP N +IYVDN+  AL ++DPANA+ Y+ NA++YK K+ +      ++ +EL E ++W
Sbjct  131  WMSPDNALIYVDNIRDALIKYDPANAQTYQRNADTYKAKITQTLAPLRKQIAELPENQRW  190

Query  181  LVTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPK  240
            +VTSEGAFSYLA +  LKE YLWP+N+D QGTP+Q+++V+D++ +  IP +FSESTIS K
Sbjct  191  MVTSEGAFSYLARDLGLKELYLWPINADQQGTPQQVRKVVDMVKKNHIPAVFSESTISDK  250

Query  241  PALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            PA QVARETGA YGGVLYVDSLS   G VPTYI L+  T   + +G+  G
Sbjct  251  PARQVARETGAHYGGVLYVDSLSTENGPVPTYIDLLKVTTSTLVQGIKAG  300


>ref|YP_989559.1| iron chelate ABC transporter, periplasmic iron chelate-binding 
protein [Bartonella bacilliformis KC583]
 gb|ABM45621.1| iron chelate ABC transporter, periplasmic iron chelate-binding 
protein [Bartonella bacilliformis KC583]
Length=302

 Score =  356 bits (913),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 215/289 (74%), Gaps = 0/289 (0%)

Query  2    VFLILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPG  61
            +FL   F++  L     K K +TTFT+IAD+ +NVAGD A VESITKP AEIH YQ TP 
Sbjct  10   IFLSTIFLIPGLALSANKFKAVTTFTIIADMARNVAGDIADVESITKPGAEIHEYQPTPH  69

Query  62   DLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAW  121
            DL RA+G +L+++NGL+LE+WF+KFFQN+++VPSVV+S+ +K I I +GPY  KPNPHAW
Sbjct  70   DLMRAQGANLILWNGLDLELWFEKFFQNIENVPSVVVSKGVKPIKIGEGPYNGKPNPHAW  129

Query  122  MSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWL  181
            MSP + +IY+DN+  A  ++DP NA +Y+ NA  YK+K+R   +    K   L + ++WL
Sbjct  130  MSPISALIYIDNIRDAFVKYDPKNAAIYKENAEIYKQKIRLSIDPIKTKLKTLPKGKRWL  189

Query  182  VTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKP  241
            VTSEGAFSYLA +F LKE YLWP+N+D QGTP+Q++RVID++ ++ I  +FSESTIS  P
Sbjct  190  VTSEGAFSYLARDFGLKELYLWPINADQQGTPQQVKRVIDMVRKYNIQAVFSESTISDAP  249

Query  242  ALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            A QVARET A YGGVLYVDSLS+  G VPTYI L+  T  RI   LSEG
Sbjct  250  AKQVARETKAKYGGVLYVDSLSEEDGEVPTYIDLLRVTSARIAHALSEG  298


>ref|YP_002397314.1| iron transport protein, periplasmic-binding protein [Escherichia 
coli ED1a]
 emb|CAR07497.1| iron transport protein, periplasmic-binding protein [Escherichia 
coli ED1a]
Length=304

 Score =  355 bits (912),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 216/287 (75%), Gaps = 0/287 (0%)

Query  4    LILTFIVIPLQADEKKLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATPGDL  63
            L LT  +    +  +K KV+TTFT+IAD+ KNVAGDAA V SITKP AEIH YQ TPGD+
Sbjct  14   LALTCSIAFQASATEKFKVITTFTIIADMAKNVAGDAAEVSSITKPGAEIHEYQPTPGDI  73

Query  64   RRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHAWMS  123
            +RA+G  L++ NG+NLE+WF +F+Q+L+ VP V++S  +  + I +GPY+ KPNPHAWMS
Sbjct  74   KRAQGAQLILANGMNLELWFQRFYQHLNGVPEVIVSSGVTPVGITEGPYEGKPNPHAWMS  133

Query  124  PTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKWLVT  183
            P N +IYVDN+  AL ++DPANA+ Y+ NA++YK K+ + F    ++ +EL E ++W+VT
Sbjct  134  PDNALIYVDNIRDALIKYDPANAQTYQRNADTYKAKITQTFAPLRKQITELPENQRWMVT  193

Query  184  SEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPKPAL  243
            SEGAFSYLA +  LKE YLWP+N+D QGTP+Q+++V+D++ +  IP +FSESTIS KPA 
Sbjct  194  SEGAFSYLARDLGLKELYLWPINADQQGTPQQVRKVVDIVKKNHIPAVFSESTISDKPAR  253

Query  244  QVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSEG  290
            QVARETGA YGGVLYVDSLS   G VPTYI L+  T   + +G+  G
Sbjct  254  QVARETGAHYGGVLYVDSLSTENGPVPTYIDLLKVTTSTLVQGIKAG  300


>ref|ZP_01795897.1| putative periplasmic chelated iron binding protein [Haemophilus 
influenzae R3021]
 gb|EDK14761.1| putative periplasmic chelated iron binding protein [Haemophilus 
influenzae 22.4-21]
Length=293

 Score =  355 bits (911),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 225/289 (77%), Gaps = 2/289 (0%)

Query  3    FLILTFIVIPLQADEK--KLKVMTTFTVIADIVKNVAGDAASVESITKPNAEIHNYQATP  60
            F I+T + + L A +   K KV+TTFTVI DI +NVAG+AA+VESITKP AEIH Y+ TP
Sbjct  5    FKIMTALALGLFAMQANAKFKVVTTFTVIQDIAQNVAGNAATVESITKPGAEIHEYEPTP  64

Query  61   GDLRRARGVDLLIYNGLNLEVWFDKFFQNLDDVPSVVISRNIKQISIRQGPYKDKPNPHA  120
             D+ +A+  DL+++NGLNLE WF++FFQN+ D P+VV++  I+ +SI +GPYKD PNPHA
Sbjct  65   KDIVKAQSADLILWNGLNLERWFERFFQNVKDKPAVVVTEGIQPLSIYEGPYKDAPNPHA  124

Query  121  WMSPTNVMIYVDNVERALAQHDPANARVYESNANSYKEKLRRLFENYHQKFSELAEERKW  180
            WMSP+N +IY++N++ AL ++DP NA VYE NA  Y +K+++L E    K +++ EE++W
Sbjct  125  WMSPSNALIYIENIKNALVKYDPQNAAVYEKNAADYAQKIKQLDEPLRAKLAQIPEEQRW  184

Query  181  LVTSEGAFSYLAAEFKLKEAYLWPMNSDGQGTPRQIQRVIDLINEFKIPVIFSESTISPK  240
            LVTSEGAFSYLA ++ LKE YLWP+N++ QGTP+Q+++VIDL+ +  IPV+FSESTIS K
Sbjct  185  LVTSEGAFSYLAKDYNLKEGYLWPINAEQQGTPQQVRKVIDLVRKNNIPVVFSESTISAK  244

Query  241  PALQVARETGAAYGGVLYVDSLSDAKGRVPTYIKLISETLDRIYEGLSE  289
            PA QVA+E+GA YGGVLYVDSLS   G VPTYI L++ T+  I +G  +
Sbjct  245  PAQQVAKESGAKYGGVLYVDSLSAKNGPVPTYIDLLNVTVSTIVKGFGK  293