GOS 1325030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858528
Annotathon code: GOS_1325030
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : malufa
Annotated on : 2010-07-04 23:58:29
  • FábioAlexandreBastos a36796@ualg.pt
  • LuísAndréRoqueFortes a36803@ualg.pt
  • MariaGonçalvesFernandes a36805@ualg.pt

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1091118858528 GOS_1325030 Genomic DNA
GCTACTGAAGAGAGCTCTACGCCTAGATCTGAAACCCATGCTTTTGTTACTGGTGTCAGTATCCCACACCTTTCTTCACCAAAAGCCTTTGTTTCTTCAT
CTTCGGCAAAATATTCTAGATCCATCATTAGTTGGTTGTCATACATAAGATATCTCATCGCATCGACATAAGCTTTTATTGTCATAAGCATTCTTCTAAC
ATCAGCGTGGTCAATAATTGTTGAATTTTTAGCATCTTCTTTTGACATTCCAATAGGTCTTCCTTGAACTCTATCTCTTGCATATTGTGCCGCACCTTGT
AACGCACCATTTGCACATGCCAATCCCTGTCCTCCAACCCAGACCCTGGCTTCATTCATCATGGTAAACATATAATTTAAGCCTCTATTTTCTTCACCAA
TTAGATAACCAACAGATCCGTCATACTCCATAACACATGTTGGGCTTGCATGAATGCCCAATTTCTCCTCTATAGAGATACAGTTCACATTATTATTCTC
ACCTAATGAGCCATCGTCATTAATTTTTATTTTAGGGACAATGAACATAGAGATTCCCTTAGTTCCTTCTGGCGAACCAGGCACTTTTGCAAGAACAAGA
TGAATTATATTTTCAGTCATGTCATGCTCTCCAAAGGTAATCCAAACTTTAGTTCCTGTGATCTTATATGAACCATCACCTTGGTCCTCTGCCTTTGTAG
TTATCGTTCCTAAATCAGAGCCAGACTGAGGTTCGCTGAGATTCATAGTTCCTGTCCACTCACCAGACACTAATTTAGGTAGAAATTTTTGTTTTTGTTC
TTCGCTTCCATGAAAATTAATAGCAGAAATAGCACCAGCGCTGAGTCCTGGTGCAAGCCCAAATGCTAAGTTTGCAGTACTTAAAATTTCAAGAGTTCCC
CCAGAAAGCGTTATAGGCATACCTCCTCCGCCTATTTCAGATGGAGAGAGATTGACGCC

Translation

[1 - 957/959]   indirect strand
>GOS_1325030 Translation [1-957   indirect strand]
GVNLSPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKI
TGTKVWITFGEHDMTENIIHLVLAKVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLIGEENRGLNYMFTM
MNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGI
LTPVTKAWVSDLGVELSSV

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

This sequence is to much incomplete. That's the reason of a non filled MW. But it's coding because the analysis of the longest ORF shows homologs and conserved protein domains like you could see on field Protein Domain and Blast. And it's big (over 60aa in length), not so big like others.


Observing the raw results of Blast we have many sequences, significant sequences ( e-value 1e-139), that are acyl-CoA dehydrogenase. At the protein domain we have reached metabolic process or oxidation reduction for acyl-CoA dehydrogenase/oxidase. Searching we discovered that acyl-CoA dehydrogenase has a function to catalyze fatty acid and one of their reaction is the oxidation. So the biological process is lipid metabolic process. The molecular function is oxidoreductase activity. Since we can't go beyond, the molecular function is catalytic activity.


With regard to taxonomy, acording to lineage report and tree, the protein has as class: Alphaproteobacteria. We can't go beyond.


Search:

http://en.wikipedia.org/wiki/Acyl_CoA_dehydrogenase

ORF finding

PROTOCOL

a)foward strand

Sequence Manipulation Suite (SMS)/ Orf finder /'any codon' initiation / frames 1, 2 and 3 / forward strand / 60 codons / 'standart (1)' genetic code


b)reverse strand

Sequence Manipulation Suite (SMS)/ Orf finder /'any codon' initiation / frames 1, 2 and 3 / reverse strand / 60 codons / 'standart (1)' genetic code



RESULTS ANALYSIS


When doing research with SMS it was found one open reading frame on reverse strand. This was selected, since there is no choice, for all subsequent analyses. It's ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 957.

There are another Orfs with known homologies. You can check it on Blastx results.

RAW RESULTS

a) Forward Strands

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

------------------------------------------------------------------------------------------------------------------------

b) Reverse Strands

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 957.
GGCGTCAATCTCTCTCCATCTGAAATAGGCGGAGGAGGTATGCCTATAACGCTTTCTGGG
GGAACTCTTGAAATTTTAAGTACTGCAAACTTAGCATTTGGGCTTGCACCAGGACTCAGC
GCTGGTGCTATTTCTGCTATTAATTTTCATGGAAGCGAAGAACAAAAACAAAAATTTCTA
CCTAAATTAGTGTCTGGTGAGTGGACAGGAACTATGAATCTCAGCGAACCTCAGTCTGGC
TCTGATTTAGGAACGATAACTACAAAGGCAGAGGACCAAGGTGATGGTTCATATAAGATC
ACAGGAACTAAAGTTTGGATTACCTTTGGAGAGCATGACATGACTGAAAATATAATTCAT
CTTGTTCTTGCAAAAGTGCCTGGTTCGCCAGAAGGAACTAAGGGAATCTCTATGTTCATT
GTCCCTAAAATAAAAATTAATGACGATGGCTCATTAGGTGAGAATAATAATGTGAACTGT
ATCTCTATAGAGGAGAAATTGGGCATTCATGCAAGCCCAACATGTGTTATGGAGTATGAC
GGATCTGTTGGTTATCTAATTGGTGAAGAAAATAGAGGCTTAAATTATATGTTTACCATG
ATGAATGAAGCCAGGGTCTGGGTTGGAGGACAGGGATTGGCATGTGCAAATGGTGCGTTA
CAAGGTGCGGCACAATATGCAAGAGATAGAGTTCAAGGAAGACCTATTGGAATGTCAAAA
GAAGATGCTAAAAATTCAACAATTATTGACCACGCTGATGTTAGAAGAATGCTTATGACA
ATAAAAGCTTATGTCGATGCGATGAGATATCTTATGTATGACAACCAACTAATGATGGAT
CTAGAATATTTTGCCGAAGATGAAGAAACAAAGGCTTTTGGTGAAGAAAGGTGTGGGATA
CTGACACCAGTAACAAAAGCATGGGTTTCAGATCTAGGCGTAGAGCTCTCTTCAGTA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
GVNLSPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFL
PKLVSGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIH
LVLAKVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYD
GSVGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSK
EDAKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGI
LTPVTKAWVSDLGVELSSV

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

Phylogeny.fr / Gblocks


RESULTS ANALYSIS

There's two sequences that are the biggest ones, the others are all the same lenght except, and it's clearly seen, that the GOS_1325030 is to much incomplete. Then the field of molecular weight is not completed.


The coordinates given by interpro were [6-190] and [195-315]. By GBlocks were [138-309], [313-367], [383-420] and [426 453]; that the gaps are now discounting [8-179], [180-235], [257-294] and [290-327]. The coordinates of areas obtained by base InterPro data correspond to the areas most conserved in the multiple alignment. The functional domains and/or framework are the most important regions of the protein for its function. Therefore functional domains are the conserved zones. Wich means that the probability of being Acyl-CoA dehydrogenase/oxidase increases. As well as the probility of a biological process (metabolic process or oxidation reduction) and molecular function (oxidoreductase activity).

RAW RESULTS

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 26
Alignment assumed to be: Protein
New number of positions: 293 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+  
Janthi.marseille ----------------------------------------MSYVAPLKDMLFVMNELADL
Achromobacter    ----------------------------------------MTYHAPVKDMLFVLNHLAGL
Burkholderia.am  ----------------------------------------MSYNAPVKDMLFVLKELAGI
Burkholderia_okl ----------------------------------------MSYTAPVKDMLFVMKELAGI
Burkholderia_pse ----------------------------------------MSYTAPVKDMLFVMKELAGI
Hyphomonas.neptu ----------------------------------------MAYDAPVSDIEFALNAFARI
Parvibaculum.lav ----------------------------------------MTYRPPVRDMAFTLNEVAGL
GOS_1325030      ------------------------------------------------------------
Parvularcula.ber ---------------------------------------MPFYNAPTRDMQFLLHDVLDI
Stappia_aggregat ---------------------------------------MPSYTAPVDDTLFLLKDVFGY
Labrenzia_alex   -----------------MPKVTFTETSCKASDGKSGRISMPTYSAPVDDTLFLLKDVFGY
Aurantimonas.man MTSTCHPHATSWGSVAVDRPLTFTSKLAISRRRSRRRNRMPTYQAPTEDTLFVLNDLLGF
Rhizobium_sp     ---------------------------------------MPIYKAPVDDTLFILNDVLGL
Agrobact.tumefac ---------------------------------------MPVYKAPVKDTLFILNDVLGL
Agrobact.radioba ---------------------------------------MPVYKAPVTDTLFVLNDVLGL
Rhizobium_etli   ---------------------------------------MPVYKAPVNDTLFVLNDVLGL
Rhizobium.legumi ---------------------------------------MPVYKAPVNDTLFVLNDVLGL
Rhodopseud. Dx-1 ---------------------------------------MTIYKAPVEEVGFLLNDVFQF
Rhodopseud.TIE-1 ---------------------------------------MTIYKAPVEEVGFLLNDVFQF
Rhodopseud.CGA009---------------------------------------MTIYKAPVEEVGFLLNDVFQF
Methylobact.nodu ---------------------------------------MPSYKAPVEDVLFLLNDVFGF
Methylobact_radi ---------------------------------------MPQYRAPVEDTLFLLTDVLGF
Sphingomonas_sp  ---------------------------------------MPSYAAPIRDTRFVLNHVVGL
Novosphingobium  ---------------------------------------MPVYNAPTRDTRFVVNELLRL
Erythrobacter.sp ---------------------------------------MPTYTAPTRDTRFIINEVLDL
Erythrobacter.lit---------------------------------------MPIYNAPTRDTRFVINEMLDL
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille AAINALPGCEDATPETVEAVLEENARFCGEVIAPLNQAGDRHPSEWK-DGKVTTTPGFKE
Achromobacter    RQVAALPGFEEATPDTAQAVLEESATFAAEVLAPLNHPADREPSSWR-DGAVTTAPGFKQ
Burkholderia.am  DTVAQLPGFEEAGYDTAQAVLEESAKFCGEVLAPLNVEGDRNPSSWK-DGVVTATPGFGA
Burkholderia_okl DEVAKLPGYEDAGFDTAAAVLDESAKFCGEVLAPLNVEGDKNPSSWK-DGVVTATPGFKE
Burkholderia_pse DAVAKLPGYEDAGFDTAQAVLDESAKFCGEVLAPLNVEGDKNPSSWK-DGAVTATPGFKD
Hyphomonas.neptu GRLQGLPGHEAYDPDLVRPILEEAAKLARDVLAPLNPVGDAHGAVLK-DGGVVAPPGFGD
Parvibaculum.lav SDLLGKGAYEDVSADLVEAVMEEGAKLAADVLAPLNRSGDAEGAKLK-SGAVSVPSGFAE
GOS_1325030      ------------------------------------------GVNLS-------------
Parvularcula.ber QRYSNLPGFADATPDVIDAFLEEASKWHRDVLAPLNRVGDTEGCTRHDDGSVTTPTGFKD
Stappia_aggregat DRYSNLPGFADAPLDLVEAILREGGKFAEEVLQPLNQTGDNEGCTHNEDGSVTTPTGFLK
Labrenzia_alex   ERYSNLPGFSDAPLDLVEAILKEGAKFTEEVLQPINQSGDQEGCTRNDDGTVSVPKGFKE
Aurantimonas.man DRYNNLPGFADASPDVVEAILGEAGRIASEVLQPLNRVGDIEGCTRASDGSVTTPEGFKA
Rhizobium_sp     ERYHNLPGFADATPDMVAAILGEAARLAEEELFPINLSGDQEGCKRNDDGSVTTPAGFKQ
Agrobact.tumefac ERYNNLPGFEDATPDMIEAITGEAAKLAEERLFPLNLSGDQQGCKRADDGSVSVPDGFKA
Agrobact.radioba ERYNNLPGFAEASPDMIEAIVGEAAKLAEEVLFPLNYSGDQEGCVRHDDATVSTPKGFKQ
Rhizobium_etli   ERYNNLPGFADATPDMIEAILGEAAKVAEEVLFPVNYSGDQEGCRRQDDASVSTPKGFKE
Rhizobium.legumi ERYNNLPGFADATPDMIEAILGEAAKVAEEVLFPVNYSGDQEGCTRHDDASVSTPKGFQD
Rhodopseud. Dx-1 ERYNNLPGFADAAADVRDAIINEAARLSEEVLHPLNAVGDHEGCKRNDDGSVTTPKGFKD
Rhodopseud.TIE-1 DRYNNLPGFADAAADVRDAIINEAARLSEEVLHPLNAVGDHEGCTRHDDGSVATPKGFKD
Rhodopseud.CGA009DRYNNLPGFADAAADVRDAIINEAARLSEEVLHPLNGVGDHEGCTRHDDGSVATPKGFKD
Methylobact.nodu ERYSNLPGFSDATPDVVEAILTEGAKLCEEVLAPLNLPGDAEGCTRHPDGSVTTPKGFKA
Methylobact_radi HARDNLAGFADASPDVVEAVLREGAKLAEEVLAPLNRTGDVEGCRREADGTVRTPTGFKA
Sphingomonas_sp  DRYANLPSFAAASPDLVEAILTEGGKVAAEILFPLNASGDKEGCTRNSDGSVTTPAGFKD
Novosphingobium  ESFGNLPGFESATQDMTDAIIEEAGRFVSEVIAPLNLPGDREGCTRHPDGSVTTPAGFKD
Erythrobacter.sp ASYGNLPGFEMATDDVTDAVINEGGKFCAEVLAPLNRVGDEHGCVRNDDGSVTTPPGFKE
Erythrobacter.li ASYGNLPGFESATPDMIDTVVNEYGKFASEVLAPINQIGDQQGCTRHNDGSVTTPDGFKE
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille AFKAYAAAGWQGVQHPVDFGGQGLPKLVATPCMEMLNSASLSFALCPLLTDGAIEALMTA
Achromobacter    AFAQYTEAGWQGMSHPVEYGGQGLPGLIGSPCSEMLNAANLSFALCPLLTNGAIEALLTA
Burkholderia.am  AFRQFVEGGWQGLQHPTEYDGQGLPKLIATPCIEMLNASNLSFALCPLLTDGAIEALLTA
Burkholderia_okl AFRQFVEGGWQGLQHPTEYDGQGLPKLIATPCIEMLNASNLSFALCPLLTDGAIEALLTA
Burkholderia_pse AFRQFVEGGWQGLQHPTEYDGQGLPKLIATPCIEMLNASNLSFALCPLLTDGAIEALLTA
Hyphomonas.neptu AYKAFVEGGWMGLAAPEEWGGQGLPKALALGVMEMFHGANMAFGLCPMLSYGAVEALLAH
Parvibaculum.lav AYRRWVEGGWGSLAATTEYGGQGLPVALSVAMQEMWNAACLSFGLCPILSQGAIEALTAH
GOS_1325030      ---------------PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFH
Parvularcula.ber AYKQFSEAGFMSIAMDPEYGGQGLPLVLQYAVAEMTSSANQAFAMYPGLSGGAWRAIYMN
Stappia_aggregat AYKAFCENGWGTLSADPNYGGQGLPHTLTTIFNEFASSANMAFSMYPGLTAGAVAALTIH
Labrenzia_alex   AYDAFCEGGWATLAADADYGGQGLPHTLATIFNEFASSANMAFSMYPGLTAGAIAALTTH
Aurantimonas.man AYDTFREGGWGSLPFDPEYGGQGLPHTLATAVSEYMSSANMAFAMYPGLTAGAIAAISVH
Rhizobium_sp     AFDLYREGGWLGLAAPEEFGGQGLPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVH
Agrobact.tumefac AYDAYCEGGWIGLAVPSEFGGQGLPYTLHAAIGEYMSSANLSLMMYPGLTQGAIAAVLVH
Agrobact.radioba CYQAYCEGGWIGLAVPEEFGGQGLPYTLHAAVGEYTSAANMSLMMYPGLTQGAIAAILVH
Rhizobium_etli   AYNAYREGGWIGLAVPEEFGGQGLPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAAILVH
Rhizobium.legumi AYKAYRDGGWIGLAVPEEFGGQGLPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAAILVH
Rhodopseud. Dx-1 AYRQIAEGGWMGLSSPAEYGGQGLPITLTQTVQEFLNSANMAFAMYPGLTMGAAAALTVH
Rhodopseud.TIE-1 AYKQIAEGGWMGLSSPAEYGGQGLPITLTQTVQEFLNSANMAFAMYPGLTMGAAAALTVH
Rhodopseud.CGA009AYKQIAEGGWMGLSSPTEYGGQGLPITLTQTVQEFLNSANMAFAMYPGLTMGAAAALTVH
Methylobact.nodu AYAAYAGGGWTGLSMPAEYGGQGLPATINSAIQEFVSSANVAFGMYPGLTQGAMAALLVH
Methylobact_radi AYDTYASGGWMGLSVPEAYGGQGLPHTLNTAIQEFASGANLAFGMYPGLTQGAMAALLVH
Sphingomonas_sp  AYDQYVAGGWTTLHAPEEFGGQGLPMVVATALGEYMTSANQAFEMYFGLTTGAISALLAK
Novosphingobium  AYRQYVEGGWGTLSAPEEFGGQGLPHVMGFIMEKYLATANQAFAMYPGLANGAISAIRAK
Erythrobacter.sp AFDQFREAGWGTLAHDEEFGGQGMPHVLGFVMEEFISSANQAFGMYPGLTNGAISALLAK
Erythrobacter.litAFDQYRESGWGTISQPEEFGGQGMPHVLGFVIEEFTATANQAFGMYPGLTTGAISALIAK
                                  ###########################################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille   GSDQQKEKFLPNFIAGKWTGTMNLTEPQAGSDLALVRSRAVPQGDGTYKISGTKIFITYG
Achromobacter      GSPELKKRFIGPMISGQWTGTMNLTEPQAGSDLAMIRTRAQPVGDGTYRLSGTKIFITYG
Burkholderia.am    GTDEQKQRYVPKLISGEWTGTMNLTEPQAGSDLALVRSRAEPQGDGTYKVFGTKIFITWG
Burkholderia_okl   GTDEQKSRYVPKLISGEWTGTMNLTEPQAGSDLALVRSRAEPQGDGSYKVFGTKIFITWG
Burkholderia_pse   GTDEQKSRYVPKLISGEWTGTMNLTEPQAGSDLALVRSRAEPQPDGSYKVFGTKIFITWG
Hyphomonas.neptu   GTDVQRAAYLPKLVSGEWTGTMNLTEPQAGSDVGALKTKAEPCEDGSYSITGQKIYITWG
Parvibaculum.lav   GTEEQKNIYLARLISGEWTGTMNLTEPQAGSDLNALKTKAVPQGDGTYRISGTKIYITYG
GOS_1325030        GSEEQKQKFLPKLVSGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFG
Parvularcula.ber   GSDEQKEKYLPKMTSGEWTGTMNLTEPQCGTDLGLIRTKAEPQDDGTYKISGQKIWISAG
Stappia_aggregat   GTDEQKQTYLPNMIAGTWTGTMNLTEPHCGTDLGLIRTKAVPQADGSYKITGTKIFISAG
Labrenzia_alex     GTDEQKQTYLPNMISGKWTGTMNLTEPHCGTDLGLIRTKAVSQADGSYKISGTKIFISAG
Aurantimonas.man   GSNEQKQTYLPKMIDGSWTGTMNLTEPHCGTDLGLLRTKAVPQDDGSYRISGQKIFISAG
Rhizobium_sp       GSEEQKRAYLPKMVDGTWTGTMNLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAG
Agrobact.tumefac   GTQEQKETYLPKMVEGTWSGTMNLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAG
Agrobact.radioba   GSDEQKRTYLPKMVEGTWSGTMNLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAG
Rhizobium_etli     GTQEQKETYLPKMVDGSWSGTMNLTEPHCGTDLGMLRTRAVPQADGSYKISGQKIFISAG
Rhizobium.legumi   GSTEQKATYLPKMVDGAWTGTMNLTEPHCGTDLGMLRTKAVPQADGSYKIAGQKIFISAG
Rhodopseud. Dx-1   GSPEQKQTYLPKMVSGEWTGTMNLTEPQCGTDLGLLRTKAVKQADGSYKITGTKIFISAG
Rhodopseud.TIE-1   GSPEQKQTYLPKMVSGEWTGTMNLTEPQCGTDLGLLRTKAVKQADGSYKITGTKIFISAG
Rhodopseud.CGA009  GSPEQKQTYLPKMVSGEWTGTMNLTEPQCGTDLGLLRTKAVKQADGSYKITGTKIFISAG
Methylobact.nodu   GSAEQKRTFLPKMTEGVWTGTMNLTEPHCGTDLGLLKTRAVPNPDGSYSITGTKIFISAG
Methylobact_radi   GSEEQKALYLPKMVEGAWTGTMNLTEPHCGTDLGLLKTKAVPNGDGSYSITGTKIFISAG
Sphingomonas_sp    GSSEQQHRYIPKMVSGEWTGTMNLTEPHCGTDLGLIKTKAVPQGDGSYAITGTKIFISAG
Novosphingobium    GSPEQQAKYLPRMVTGEWLGTMNLTEPHCGTDLGMIRTRAEPQVDGSYAITGTKIFISAG
Erythrobacter.sp   GSDEQKAMYLPKMVSGEWTGTMNLTEPHCGTDLGMIRTKAEPLGDGSYAITGTKIFISAG
Erythrobacter.lit  GSPEQQEMYLPKMISGEWTGTMNLTEPHCGTDLGLIRTKAEPQADGSYAITGTKIFISAG
                 ############################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille EHDMAENIIHLVLARTPDAPEGVKGISLFLVPKFLVNEDGSLGERNDAFCVSIEHKLGIK
Achromobacter    DHDLTENILHLVLARLPDAPEGVKGISLFLVPKFLVNEDGSLGARNDVTCVSIEHKLGIK
Burkholderia.am  EHDMADNIVHLVLARTPNAPEGVKGISLFIVPKFMVNDDGSLGARNDVHCVSIEHKLGIK
Burkholderia_okl EHDMAGNIVHLVLARTPSAPEGVKGISLFIVPKFLVNDDGSLGARNDVHCVSIEHKLGIK
Burkholderia_pse EHDMADNIVHLVLARTPDAPEGVKGISLFIVPKFLVNDDGSLGARNDVHCVSIEHKLGIK
Hyphomonas.neptu DHDMAENIIHLVLARLPDAPAGSKGISLFLVPKFILDADGTPGERNGVRCIGLEKKMGIH
Parvibaculum.lav DHDMAENIVHLVLARLPDAPPGTKGISLFLVPKFLVNEDGSLGARNDAWCIGLEEKLGIH
GOS_1325030      EHDMTENIIHLVLAKVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIH
Parvularcula.ber EHDMSDNIIHLVLAKIPGGPDGVKGISLFIVPKFMVNEDGSLGERNNVVCGGLEEKMGIH
Stappia_aggregat QHDMAENIIHLVLARIEGAPEGTKGISLFVVPRNAIGDDGTVGDNNGVSCGSIEHKMGIH
Labrenzia_alex   EHEMSDNIIHLVLARIEGAPEGNKGISLFVVPRNEIAEDGTSGARNGVSCGSIEHKMGIH
Aurantimonas.man EHDMADNIVHLVLARIEGAPEGVKGISLFIVPKFVLDADGNPGERNGVVCGSLEEKMGIH
Rhizobium_sp     EHDMAENIIHLVLARIEGAPEGVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIH
Agrobact.tumefac EHSMTDNIVHLVIARIEGAPEGTKGISLFIVPKFLVKEDGTLGERNGVTCGAIEHKMGIH
Agrobact.radioba EHDMTDNIVHLVLARIEGAPEGTKGISLFIVPKFMVKEDGSLGARNPVSCGAIEHKMGIH
Rhizobium_etli   EHDLTDNIVHLVLARIEGAPEGTKGISLFIVPKFLVGKDGALGARNAVTCGAIEHKMGIH
Rhizobium.legumi EHDLADNIVHLVLARIEGAPEGTKGISLFIVPKFLVGKDGALGARNAVTCGAIEHKMGIH
Rhodopseud. Dx-1 EHDMADNIIHLVLARIEGAPAGIKGISLFVVPKFLVNPDGTVGTRNGVICGSIEHKMGIH
Rhodopseud.TIE-1 EHDMADNIIHLVLARIEGAPAGIKGISLFVVPKFLVNPDGTVGARNGVMCGSIEHKMGIH
Rhodopseud.CGA009EHDMADNIIHLVLARIEGAPAGIKGISLFVVPKFLVNPDGTVGARNGVMCGSIEHKMGIH
Methylobact.nodu EHDLSENIIHLVLARIEGAPAGTKGISLFVVPKLLVKADGSLAERNGVSCGSIEQKMGIH
Methylobact_radi EHDLAENIVHLVIARIEGAPAGTKGISLFVVPKFLVNADGSLGARNGVSCGSLEHKMGIH
Sphingomonas_sp  EHDLADNIIHLVLAKTPDAPEGSKGISLFVVPKIMVGDDGALSDRNAVSCGSIEHKMGIH
Novosphingobium  DHDLTENIIHLVLAKTPGAPESSKGISLFIVPKFIVNDDGSLGERNAVSVGAIEEKMGIH
Erythrobacter.sp EHDMSENIIHLVLAKTPGAPDSTKGISLFVVPKFLVNEDGTPGERNGVMCGSIEEKMGIH
Erythrobacter.litEHDMADNIIHLVLAKTPGAPDSTKGISLFVVPKFIVDEDGNPGERNGVTCGSIEHKMGIH
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille ASPTAVLQFGDHGGAIGTLIGQENRGLETMFIMMNAARFAVGIQGISVAERAYQKAVAYA
Achromobacter    ASPTATLQFGDAGGALGYLVGQENRGLDAMFIMMNAARYAVGVQGIAIADRAYQHALAYA
Burkholderia.am  ASPTAVLQYGDHGGAIGYLVGEENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAEFA
Burkholderia_okl ASPTAVLQYGDHGGAVGYLVGEENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAEFA
Burkholderia_pse ASPTAVLQYGDHGGAIGYLVGEENRGLEYMFIMMNAARFGVGMQGIGVAERAYQKAAEFA
Hyphomonas.neptu GSPTCVMEY---SGAKGWLIGEENRGLACMFTMMNSARLNVGLEGVAVGEAAFQTAFAYA
Parvibaculum.lav GSPTCVMSYGENGGAIGTLIGQENRGLACMFTMMNNARLLVGTQGVAIAEAAYQHALAYA
GOS_1325030      ASPTCVMEY---DGSVGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYA
Parvularcula.ber GNATCVMNY---DEATGYLVGEEHKGLRAMFIMMNEARLGVGLQGLSAAEVAYQNAAAFA
Stappia_aggregat GNATCVMNY---DDATGWLVGEENKGLRAMFTMMNEARLGVAVQGLSQSEVAYQNAVTYA
Labrenzia_alex   GNATCVMNY---DDATGWLVGEENKGLRAMFVMMNEARLGVAVQGLSQSEVAYQNAVTYA
Aurantimonas.man GNATCVMNY---DDATGYLIGEADKGLRAMFTMMNEARLGVGVQGLAISEVAYQNAVTYA
Rhizobium_sp     GNSTCVMNY---DEATGYLIGAENKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYA
Agrobact.tumefac GNATCVMNY---DDATGYLLGAENKGLSAMFVMMNEARLGVGLQGLSVGEIAYQNAVEYA
Agrobact.radioba GNATCVMNY---DEATGFLIGAENRGLNAMFVMMNEARLGVGLQGLSIAEIAYQNAAAYA
Rhizobium_etli   GNATCVMNY---DEATGFLIGAENRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAANYA
Rhizobium.legumi ANATCVMNY---DEATGFLIGAENRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAANYA
Rhodopseud. Dx-1 GNATCTMNY---DGATGWLVGEENKGMQGMFVMMNEARLGVAVQGLAQSEVAYQNAVEYA
Rhodopseud.TIE-1 GNATCTMNY---DGATGWLVGEENKGMQGMFVMMNEARLGVAVQGLAQSEVAYQNAVEYA
Rhodopseud.CGA009GNATCTMNY---DGATGWLVGEENKGMQGMFVMMNEARLGVAVQGLAQSEVAYQNAVEYA
Methylobact.nodu ANATCVMNY---DGARGWLLGEANRGLNAMFVMMNEARLAVGIQGLGLSEAAYQNAVAYA
Methylobact_radi GNATCVMNY---DGATGWLVGQENRGLNAMFVMMNEARLAVGVQGLGQSEVAYQNAAAYA
Sphingomonas_sp  GNATCVMNY---DGATGWMVGEENKGLAAMFIMMNAARLGVGLQGLGQAEVAFQNAVHYA
Novosphingobium  GNATCVMNY---DGAKGWMVGEENKGLAAMFIMMNAARLGVGMQGLAQAEVAYQNGLAYA
Erythrobacter.sp GNSTCVLNY---DGAKGWMVGEENKGLAAMFIMMNAARLGVGMQGLSQAEVAYQNAVAYA
Erythrobacter.litGNATCVMNY---DDAKGWMVGEENKGLAAMFIMMNAARLGVGIQGLGQAEVAYQNAVAYA
                 #########   ################################################


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille  KDRVQSKD--LEGSA----TAVSIIHQPDVRRMLMSMRAQIEAARALAYVGASAFDIAHH
Achromobacter     AERVQSRP--VDGSS---REAVTIIHHPDVRRMLGTMRALTEAGRALAYVTAGHADLAHA
Burkholderia.am   KERVQSRP--VDGSA---KQSVTIIHHPDVRRMLGTMRALTEGARALAYVAAAHSDIAHR
Burkholderia_okl  KERVQSRP--VDGSA---KQSVTIIHHPDVRRMLATMRALTEGARALSYVAAAHSDHAHR
Burkholderia_pse  KERVQSRP--VDGSA---KQSVTIIHHPDVRRMLATMRALTEGARALSYVAAAHSDHAHR
Hyphomonas.neptu  QERKQGAAAGVTGPA-------PILHHADVRRTLTTMRAKVAAARAICYACGVAADLAHS
Parvibaculum.lav  KDRKQGRP--L-GSTLAPGEMAPIIEHPDIRRMLLTMKSLTDASRAICYATAVAIDGAHA
GOS_1325030       RDRVQGRP--I-GMSKEDAKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYF
Parvularcula.ber  KDRLQMRS--ISGTKAPDQPADPIIVHPDVRRMLLDTRVFTEGARMLTYWAALHEDLAHK
Stappia_aggregat  KDRIQGRA--LTGPKAPDKPADPIIVHPDVRRTLMQIRSFNEAARALIIWTALHGDVSHR
Labrenzia_alex    KDRIQGRA--LTGPKSPDKAADPIIVHPDVRRTLMSIRAFNEAARALVIWTALHGDVSHR
Aurantimonas.man  RERIQGRS--LSGAKAPEKKADPIIVHPDIRRILMTIRSINEAGRALVLWTALKGDLSHR
Rhizobium_sp      RERLQGRS--LSGVKAPEQKADPIIVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHR
Agrobact.tumefac  RDRIQGRS--LSGAKFPDKKADPIIVHPDIRRTLMTIKAYNEAGRAFLLWTALQSDIAHR
Agrobact.radioba  RDRIQGRS--LSGPKAPDKKADPIIVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHR
Rhizobium_etli    RDRIQGRS--LSGVKAPDKKADPIIVHPDIRRSLMTIRAFNEAGRAFLLWTALKSDIAHR
Rhizobium.legumi  RDRIQGRS--LSGPKAPDKKADPIIVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHR
Rhodopseud. Dx-1  RERLQGRA--LSGPKATDKPADPIIVHPDIRRALLTMRAFNEAARALVLWTALKSDVAHR
Rhodopseud.TIE-1  RERLQGRA--LSGPKATDKPADPIIVHPDIRRALLTMRAFNEAARALVLWTALKSDVAHR
Rhodopseud.CGA009 RERLQGRA--LSGPKATDKPADPIIVHPDIRRALLTMRAFNEAARALVLWTALKSDVAHR
Methylobact.nodu  KDRLQGRA--LTGAQAPDQPADPIIVHPDVRRTLLSIRAFNEAARALVMWTALQADVAHR
Methylobact_radi  KDRLQGRA--LTGAKAPEKAADPIIVHPDVRRTLMQIRAFNEAARALMLWTALQADILHR
Sphingomonas_sp   QDRRQGRA--LTGPKEPEEKADTLFVHPDVRRMLMEAKALTEGLRALTLWTAVQVDLSHY
Novosphingobium   LDRRQGRA--LTGPADPQAKADPIIVHPDVRRMLMDGKTFVEGMRALCLWGALQVDLSHK
Erythrobacter.lit LDRRQGRA--LTGPAEPEAKADPIFVHPDVRRMLMDGKAFTEGMRALCLWGALLVDLTHK
                 #######               ######################################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille  HGDEKVRDAQQAFYEFLVPIIKGWSTEMSIDVASTGLQIHGGMGFIEETGAAQYYRDARI
Achromobacter     SPDADERKRHLAIQEFLVPIVKGWCTEMSIDVASLGVQVHGGMGFIEETGAAQYYRDARI
Burkholderia.am   HSDEATRARHQAIYEYLVPVVKGWSTEMVNDVASLGVQVHGGMGFIEETGAAQYYRDARI
Burkholderia_okl  AADEGVRAKHQAIYEYLVPVVKGWSTEMVNEVASLGIQVHGGMGFIEETGAAQYYRDARI
Burkholderia_pse  AADEGVRAKHQAIYEYLVPVVKGWSTEMVNEVASLGIQVHGGMGFIEETGAAQYYRDARI
Hyphomonas.neptu  SPDPDVRAAAKTREDLLTPIAKAWSTDIGVEVASLGVQVHGGMGFMNETLAAQLYRDARI
Parvibaculum.lav  G---DKREEAQARADLLTPIAKSFSTDIGVEVASIGVQIHGGMGFIEETGAAQFLRDARI
GOS_1325030       AEDEETKAFGEERCGILTPVTKAWVSDLGVELSSV-------------------------
Parvularcula.ber  SEDEATRQKAKDYMGLLTPIIKAFNTHKGFEGTCDSMQVFGGSGYVEEWGMSQFLRDTKI
Stappia_aggregat  SDDEKSKQFSDDMMGLMTPVLKGVLTDTGFANAVNAQQLYGGHGYISEWGMEQFVRDARI
Labrenzia_alex    SEDDKDKQFSDDMMGLMTPVLKGVLTDIGFENAVNAQQMYGGHGYIGEWGMEQFVRDARI
Aurantimonas.man  ADEEKDRQAADDWMGLMTPVIKGVLTDKGFDNAVMAQQVYGGHGYIGEWGMEQFVRDARI
Rhizobium_sp      SDNEAERQAADDILGLMTPILKGVLTDKGFDHTVVAQQLFGGHGYIEEHGMSQYVRDARI
Agrobact.tumefac  AADEKQRQAADDLLGLVTPILKGVLTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARI
Agrobact.radioba  SQDEKERQAADDILGLATPILKGVLTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARI
Rhizobium_etli    ATDEKERQTADDILGLVTPILKGVMTDRGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARI
Rhizobium.legumi  ATDDKERQTADDILGLVTPILKGVMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARI
Rhodopseud. Dx-1  SSDAKERQSADDHLGLMTPVLKGVLTDGGFANAVAAQQVYGGHGYIAANGVEQFVRDARI
Rhodopseud.TIE-1  SSDAKERQTADDHLGLMTPVLKGVLTDGGFANAVAAQQVYGGHGYIAANGVEQFVRDARI
Rhodopseud.CGA009 SSDAKERQTADDHLGLMTPVLKGVLTDGGFANAVAAQQVYGGHGYIAANGVEQFVRDARI
Methylobact.nodu  ATDPAERQAAEDHLGLMTPVVKGVLTDRGFANAVEAQQVFGGHGYIEESGMSQFVRDARI
Methylobact_radi  SEDAKERQAADDHLGLMTPVVKGVFTDRGFANAVEAQQLLGGHGYIEEWGMSQFVRDARI
Sphingomonas_sp   AETEEERQAADDLLQLLTPVVKGYGTDKGFDVAVSAQQVFGGHGYIWENGVEQYVRDARI
Novosphingobium   AATEEERQEADDLISLLTPVIKGYGTDMGYKVATDMQQVWGGHGYIAENGMEQFVRDARI
Erythrobacter.sp  AQTEEERAEADLLLGLMTPVIKGYGTDKGYEVATNMQQVFGGHGYIEEWGMSQFVRDARI
Erythrobacter.lit AQTEEERAEADALIGLMTPVIKGYGTDKGYAIATDMQQVFGGHGYIEEWGMSQYVRDARI
                      ############################                           


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille LTIYEGTTAIQANDLVGRKTVRDGGAVARGIIAAVRATESELARAATPDLKAIGAHLAAA
Achromobacter    LTIYEGTTAIQANDLIGRKTLRDGGAVAQGLLDAIRQTETELEARSEPAANLMLKPLRQA
Burkholderia.am  LAIYEGTTAIQANDLVGRKTLRDGGAVAKALIAEIGDTVAALGKLDGAAAASMKAQLEKG
Burkholderia_okl LAIYEGTTAIQANDLVGRKTVRDGGAVAKAIVGEIRQTVEALGAHDGPAFAAMKTQLANG
Burkholderia_pse LAIYEGTTAIQANDLVGRKTARDGGAVAKALIGEIRQTAEALGAHDGPAFTAMKTQLENG
Hyphomonas.neptu APIYEGTNGIQAIDLVGRKLSGTKGASMQAMIVEVEETVRQARATNDPQLVQIADRLKAG
Parvibaculum.lav LPIYEGTNGIQAIDLVSRKLPLGNGSVVKNFIAEMRETAQQARSSNNKLLGEIGGALDGA
GOS_1325030      ------------------------------------------------------------
Parvularcula.ber AMIYEGTNGIQALDLVGRKLMAEGGRLWQTFFKEVDEWAESHKG-QSDVLDGYIEKTLET
Stappia_aggregat AMIYEGANGIQALDLVGRKLPANGGRAVMSFFNEVNTFLKENK--DNEALAAFTAPLKKG
Labrenzia_alex   AMIYEGANGIQALDLVGRKLPANGGRAVMSFFNEVNTFLKENK--DNEDLTAFIGPLKKG
Aurantimonas.man AQIYEGANGIQALDLVGRKLGLNGGRAVQSFFAEVGQFCEENR--ADEAMAPLTKALKKG
Rhizobium_sp     AMIYEGANGIQALDLVGRKLAINGGRAVMALFKEIGDFCEENR--GDERLSAYTKALKKG
Agrobact.tumefac TMIYEGANGIQALDLVGRKLGMNGGRAVMALFKEIGDFCEENR--ADEKLSLYTKGLKKG
Agrobact.radioba TMIYEGANGIQALDLVGRKLALNGGRAVMALFKEIGDFCEENR--NDEQLGFFTKHLKKG
Rhizobium_etli   AMIYEGANGIQALDLVGRKLALNGGRAAMALFKEIGDFCEENR--SDEKLSFFTRHLKKG
Rhizobium.legumi AMIYEGANGIQALDLVGRKLALNGGRAAMALFKEIGDFCEENR--SDEKLSFFTKHLKKG
Rhodopseud. Dx-1 AMIYEGANGIQALDLVGRKLPRDGGRAVMAFFAEVGAFAKEHG--GDEAMKPFVAPLSTS
Rhodopseud.TIE-1 AMIYEGANGIQALDLVGRKLPRDGGRAVMAFFAEVGAFAKEHG--GDEAMKPFVAPLSTS
Rhodopseud.CGA009AMIYEGANGIQALDLVGRKLPRDGGRAVMAFFAEVGAFAKEHG--GDEAMKPFVAPLSTS
Methylobact.nodu AQIYEGANGIQAMDLVGRKLPRDGGRAMMRFLQEVETFCRENG--ADETLKGYVGPLAQA
Methylobact_radi AMIYEGANGIQAMDLIGRKLPKDGGRAMMTFLGEVQTFLKDHG--EDPAMAPFTKPLQAG
Sphingomonas_sp  AQIYEGTNGIQAMDLVGRKLPMHGGRALQAFLKLVNEEVAAAK--SDESIAPIAEALEKA
Novosphingobium  AMIYEGTNGVQAMDLAGRKLALNGGRAVQRFFALVDGECAEET--ADETVKLVAERLSKA
Erythrobacter.sp AQIYEGTNGVQAMDLCGRKLAQKGGAAVQAFFKHVGDEIAAGK--EIDELKDMAEALEKA
Erythrobacter.litAQIYEGTNGIQAMDLCGRKLAQNGGAAVQAFFRMIGEEIAEAK--GNETLAPMAEKLEKA
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
Janthi.marseille  STALDEVVAYVVANIQSDIKGVFAGSVPYLKLAGIVLCGWQMGRAALIAQAKLDAGSGDA
Achromobacter     RLALANVVDFVLANAASAPNAVFGSAVPYLLLAGTTLAGWQMARALLASLDHLNEDP---
Burkholderia.am   ARALSSVVDYVVANAKQDPNAVFAGSVPYLKLAGAVLCGWQMARALLAAHANRANDT---
Burkholderia_okl  ARALSAVVDFVVANVKDDPNAVFAGSVPYLKLAGVVLCGWQMARALLAAQHKRADDP---
Burkholderia_pse  ARALSAVVDFVVANVKGDPNAVFAGSVPYLKLAGVVLCGWQMARALLVAQQKRADDP---
Hyphomonas.neptu  AAALSEASEWMVKTLADEPEKGLAGATEYLALAGDVIGGHFLALGAIAARSGQDMDQRAR
Parvibaculum.lav  LDALDKATDYMLANLKSAPNDCLAGASPYLRLFGTAAGGHYLAQSALRD-----------
GOS_1325030       ------------------------------------------------------------
Parvularcula.ber  KKQVNEGIQWLAMNGMKNPDNAGAGSHDFLHLFAHFAMAYMWLMMVKAAEGKEEED----
Stappia_aggregat  MDDLQAATMWFMNNAMKNPDNAGAGSVDYMHLFGLVAMGYMWAKIAKTIQEKTAEGAGDK
Labrenzia_alex    VDDLQAATMWFMNNAMKNPDNAGAGSTDYMHLFGLVALGYMWAKIAKTAKETLKNGANGK
Aurantimonas.man  LNDLQQATMWLMQNAMAKPDNAGAASTDYMHLFGLVAMGYMWGRMAKVAQEKIAAGANGR
Rhizobium_sp      LNDLQAATMWFMQNAMAKPDNAGAGSTDYMHLFGLVVLGYMWAKIAKTAHDKLAAGETAQ
Agrobact.tumefac  LNDLQAATMWFMQNAMAKPDNAGAGSTDYMHLFGIVVLGYMQALMAKAASEALAAGSTSD
Agrobact.radioba  LNDAQAATMWFMQNAMAKPDNAGAGSTDYMHLFGLVVLGYMWAKMAKAAQDGLANGDTAR
Rhizobium_etli    LNDVQGATMWFMQNAMAKPDNAGAGSTDYMHLFGLVVLGYMWAKMAKAAEDGLASGDASR
Rhizobium.legumi  LNDVQAATMWFMQNAMAKPDNAGAGSTDYMHLFGLVVLGYMWAKMAKAAEDGLASGDGAR
Rhodopseud. Dx-1  LGHLQKATTWLMMNAMAQPDNAGAAATDYMHLFGLVAMGYMWAKMAKVAQDKIAAEGAT-
Rhodopseud.TIE-1  LGHLQKATTWLMMNAMAQPDNAGAAATDYMHLFGLVAMGYMWAKMAKVAQDKIAAEGAK-
Rhodopseud.CGA009 LGHLQKATTWLMMNAMAQPDNAGAAATDYMHLFGLVAMGYMWAKMAKVAQDKIAAEGAK-
Methylobact.nodu  LGDLQKATMWLMQNAMAKPDNAGAAATDYMHLMGLVALGYMWARIAKAAAARKAEGTSIG
Methylobact_radi  LNDLQGAVMWLMQNAFSKPDNAGAGATDFMHLFGLVALGYMWARIAKAAQAKHAEAPS--
Sphingomonas_sp   SGQLGAATMWLMQNAMKNPDNAGAGAHHYMHILGIVATGLMWLRMAKAASAQIAASEGDA
Novosphingobium   TGEMKAATMWFMQNAMANPNNLGAGAYAYMTLTGIVSLGLMWLRMAKVAAAAIADGAEDK
Erythrobacter.sp  LGQQQAATMWFMNNAMQNPNHLGAGAHHYMHIMGIVTLGLMWLKMAKVAASKLANAGDEK
Erythrobacter.lit LNEQQAATMWFMQNAMQNPNHLGAGAHHYMHIMGIVTLGLMWLRMAKVATEALAGSPEDA
                                                                             


                        610       620       630       640       650
                 =========+=========+=========+=========+=========+
Janthi.marseille  -KFYQAKIATARFFADYFLSQAGAYRSAITG--GSAGVLALDESQF----
Achromobacter     -EFHQAKIATAQTYALHKLTQAPGLAAVVLG--SRDYAVQP---------
Burkholderia.am   -AFHDAKIAIAQCYAEHVLVQAGALEASIVGAKGHESVLALTEDQF----
Burkholderia_okl  -KFYDAKIAIAQFYAEHILVQASAFEASIVGAKGGESVLALTEDQF----
Burkholderia_pse  -KFYDAKIALAQFYAEHILAQAGGLEASIVGAKGGQGVFALTEDQF----
Hyphomonas.neptu  ------QLALAGFFAETSLASAPGRVPAITE--GGARFLEGSKALFGV--
Parvibaculum.lav  -PAAKARLALAQFYAANVLPAVHGLLAPATA--GADSLFALTADDLA---
GOS_1325030       --------------------------------------------------
Parvularcula.ber  -PHYRAKLIGAKYFFERMLPTSTLHLTRLKT--GADTMMSMPEEAF----
Stappia_aggregat  ADWLETKLTFGRFFMERTLPETAAHLARISS--GSETMMSVAADAF----
Labrenzia_alex    EQWLSDKLAFGTFYMERTMPETAAHLARIST--GSDTMMSVSAEAF----
Aurantimonas.man  SEFMEKKLLTARFYMERVMPESAAHLARIST--GADSMMAMDADAF----
Rhizobium_sp      ADYLKNKLITANFFMERILPETALRKARIET--GADTLMALDAAAF----
Agrobact.tumefac  EDFLKTKLVTAKFYMERIMPETALRKARIET--GADTMMELAAEAF----
Agrobact.radioba  EDYLKNKLVTARFYMERIMPETALRKVRIEA--GADTMMELAAEAF----
Rhizobium_etli    EDYLKNKLITAKFFMERIMPETALRKARIEA--GADTMMALAAEAF----
Rhizobium.legumi  EDFLRNKLITAKFFMERIMPETALRKARIEA--GADTMMELAAEAF----
Rhodopseud. Dx-1  -PYLTRKLVTGRFFAERMLPETALRLTRIEA--GCNTLMELPAEAF----
Rhodopseud.TIE-1  -PFLTRKLVTGRFFAERMLPETALRLTRIEA--GCSTVMELPAEAF----
Rhodopseud.CGA009 -PFLTRKLVTGRFFAERMLPETALRLTRIEA--GCSTVMELPAEAF----
Methylobact.nodu  -ARMDAKLMTGRFYMERVLPETATRLARISA--GAEAVMAVPAEMF----
Methylobact_radi  -PRWESKLTSGRFFMERMLPETALRLGRIKA--GADSTMALEAEAF----
Sphingomonas_sp   -GFLEAKLVTARFFAERIMPDAGALRRKIEG--GADTLMALDPAQFLAA-
Novosphingobium   -AFYEAKLTCARHWATRYTTEAGALRRQVEA--GSDTIMALTPEQLAIA-
Erythrobacter.sp  -AFYEQKLATARYYMDRYLPDAGALRRKLEA--GSDSLMALGEDAFQTAA
Erythrobacter.lit -SFYETKLATARYYMDRFLPDAGALRHKLES--GADSTMALGEEAFATAA
                                                                   





Parameters used
Minimum Number Of Sequences For A Conserved Position: 14
Minimum Number Of Sequences For A Flanking Position: 22
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 4 selected block(s)
Flanks: [138  309]  [313  367]  [383  420]  [426  453]  

New number of positions in input.fasta-gb:  293  (45% of the original 650 positions)









Protein Domains

PROTOCOL

INTERPRO scan / raw output



RESULTS ANALYSIS

INTERPRO gave eight domains: Acyl-CoA oxidase/dehydrogenase, type 1 (IPR006090); Acyl-CoA oxidase/dehydrogenase, central domain (IPR006091); Acyl-CoA dehydrogenase, N-terminal (IPR006092); Acyl-CoA dehydrogenase/oxidase C-terminal (IPR009075); Acyl-CoA dehydrogenase/oxidase (IPR009100); Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal (IPR013764); Acyl-CoA dehydrogenase/oxidase, N-terminal (IPR013786); and unintegrated. The last one was ignored.


Was selected: Acyl-CoA dehydrogenase/oxidase C-terminal (IPR009075) with E-value of 1.6e-50; and Acyl-CoA dehydrogenase/oxidase (IPR009100) with E-value of 2.3e-19, since the two are complementary and cover all other.


The first says: Biological Process: metabolic process (GO:0008152), Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114).


The second: Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114).


So a possible biological process is metabolic process or oxidation reduction. A possible molecular function is oxidoreductase activity.


About e-values the smallest are 1.5e-70 but it's for a unintegrated domain, like it was said this one is ignored. The e-values of the domains that we selected are 1.6e-50 and 2.3e-19, second and fourth smallest. The third (9.9e-20) has not been chosen because their domain is integrated in others, as well as e-values smaller that were not chosen.


Knowing this, the e-values are significants and show us homology.

RAW RESULTS

Sequence_1	1254F7E5AD695EE2	  319	HMMPanther	 PTHR10909:SF10	      ACYL-COA DEHYDROGENASE	                 26	315	1.5e-70	T	17-Mar-2010	NULL	                                                               NULL	
Sequence_1	1254F7E5AD695EE2	  319	HMMPanther	 PTHR10909	      ELECTRON TRANSPORT OXIDOREDUCTASE	        26	315	1.5e-70	T	17-Mar-2010	NULL	                                                               NULL	
Sequence_1	1254F7E5AD695EE2	  319	superfamily	 SSF56645	               Acyl-CoA dehydrogenase NM domain-like	         6	190	1.6e-50	T	17-Mar-2010	IPR009100	Acyl-CoA dehydrogenase/oxidase	                  Biological Process: metabolic process (GO:0008152), Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	superfamily	 SSF47203	               Acyl-CoA dehydrogenase C-terminal domain-like  195	315	2.3e-19	T	17-Mar-2010	IPR009075	Acyl-CoA dehydrogenase/oxidase C-terminal	         Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	HMMPfam	          PF02770	               Acyl-CoA_dh_M	                          74	126	7.3e-14	T	17-Mar-2010	IPR006091	Acyl-CoA oxidase/dehydrogenase, central domain	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	HMMPfam	          PF02771	               Acyl-CoA_dh_N	                           6	67	2.2e-09	T	17-Mar-2010	IPR006092	Acyl-CoA dehydrogenase, N-terminal	                  Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	HMMPfam	          PF00441	               Acyl-CoA_dh_1	                          191	274	6e-06	T	17-Mar-2010	IPR006090	Acyl-CoA oxidase/dehydrogenase, type 1	         Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	Gene3D	          G3DSA:1.10.540.10	      no description	                           6	69	1.1e-11	T	17-Mar-2010	IPR013786	Acyl-CoA dehydrogenase/oxidase, N-terminal	         Biological Process: metabolic process (GO:0008152), Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Molecular Function: FAD binding (GO:0050660), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	Gene3D	          G3DSA:2.40.110.10      no description	                          70	200	9.9e-20	T	17-Mar-2010	IPR006091	Acyl-CoA oxidase/dehydrogenase, central domain	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
Sequence_1	1254F7E5AD695EE2	  319	Gene3D	          G3DSA:1.20.140.10	      no description	                          201	315	5.1e-11	T	17-Mar-2010	IPR013764	Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal	Molecular Function: oxidoreductase activity (GO:0016491), Biological Process: oxidation reduction (GO:0055114)

Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method / bootstrap_100 / out group: b-proteobacteria

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / out group: b-proteobacteria



RESULTS ANALYSIS

The trees are concordant. Both are significant.


a) BioNj

In BioNj method the tree is rooted. There is a node with bootstrap_1 that encompasses all the in groups and the sequence GOS_1325030 and other node with bootstrap_1 that encompasses all the out groups. Every node that comes to the out groups are non-significant because the following has bootstrap_0.42. In the case of in groups, the node that originates the sequence GOS_1325020 and others in group (Parvularcula_bermudensis_HTCC2503 to Rhizobium_leguminosarum_bv._trifolii_WSM2304) has bootstrap_0.88. Throught this we can know the taxa.


b) PhyML

In BioNj method the tree is rooted. There is a node with bootstrap_1 that encompasses all the in groups and the sequence GOS_1325020 and other node with bootstrap_1 that encompasses all the out groups. Every node that comes to the out groups are non-significant because the following has bootstrap_0.41. In the case of in groups, the node that originates the sequence GOS_1325030 and others in group (Parvularcula_bermudensis_HTCC2503 to Rhizobium_leguminosarum_bv._trifolii_WSM2304) has bootstrap_0.84. Throught this we can know the taxa.


So searching the taxa of all the in groups that share the root with the sequence we can not go beyond the a-proteobacteria. So a possible taxa for this protein is a-proteobacteria.


RAW RESULTS

a) BioNJ 
                                                                                                   -------0.1------
 
               0.98     +---------------------------------Hyphomonas_neptunium_ATCC_15444_in                             (a-proteobacteria)
             +----------+
             |          +--------------------------Parvibaculum_lavamentivorans_DS-1_in                                  (a-proteobacteria)
             |
      1      |     +------------------------------------------------------GOS_1325030
 +-----------+     |
 |           |     |               +-------------------------------Parvularcula_bermudensis_HTCC2503_in                  (a-proteobacteria)
 |           |     |               | 
 |           |0.84 |               |            +--------------------Sphingomonas_sp._SKA58_in                           (a-proteobacteria)
 |           +-----+               |      1     |
 |                 |               | +----------+
 |                 |               | |          | 0.95 +--------------------Novosphingobium_aromaticivorans_DSM_12444_in (a-proteobacteria)
 |                 |      1        | |          +------+
 |                 +---------------+ |                 |  +---------Erythrobacter_sp._SD-21_in                           (a-proteobacteria)
 |                                 | |                 +--+
 |                                 | |                0.76+--------Erythrobacter_litoralis_HTCC2594_in                   (a-proteobacteria)
 |                                 | |
 |                                 | |                 1        +--------Stappia_aggregata_IAM_12614_in                  (a-proteobacteria)
 |                                 | |            +-------------+
 |                                 | |        0.68|             +------Labrenzia_alexandrii_DFL-11_in                    (a-proteobacteria)
 |                             0.73+-+          +-+
 |                                   |          | |                +Rhodopseudomonas_palustris_DX-1_in                   (a-proteobacteria)
 |                                   |          | |      1         |
 |                                   |          | +----------------+Rhodopseudomonas_palustris_TIE-1_in                  (a-proteobacteria)
 |                                   |     0.56 |                  |
 |                                   |         ++                  +Rhodopseudomonas_palustris_CGA009_in                 (a-proteobacteria)
 |                                   |         ||
 |                                   |         ||
 |                                   |     1   ||    1    +-------------Methylobacterium_nodulans_ORS_2060_in            (a-proteobacteria)
 |                                   +---------++---------+
 |                                             |          +--------Methylobacterium_radiotolerans_JCM_2831_in            (a-proteobacteria)
 |                                             |
 |                                             |  +----------------Aurantimonas_manganoxydans_SI85-9A1_in                (a-proteobacteria)
 |                                             |  |
 |                                             +--+        +------------Rhizobium_sp._NGR234_in                          (a-proteobacteria)
 |                                          0.67  |  1     |
 |                                                +--------+  +----------Agrobacterium_tumefaciens_str._C58_in           (a-proteobacteria)
 |                                                         |  |
 |                                                     0.78+--+ +-----Agrobacterium_radiobacter_K84_in                   (a-proteobacteria)
 |                                                            | |
 |                                                         0.7+-+  1  +---Rhizobium_etli_CFN_42_in                       (a-proteobacteria)
 |                                                              +-----+
 |                                                                    +--Rhizobium_leguminosarum_bv._trifolii_WSM2304_in (a-proteobacteria)
 |
 |
 |           +--------------------Janthinobacterium_sp._Marseille_out         (b-proteobacteria)
 |   1       |
 +-----------+------------------------Achromobacter_piechaudii_ATCC_43553_out (b-proteobacteria)
             |
             |      1        +---Burkholderia_ambifaria_IOP40-10_out          (b-proteobacteria)
             +---------------+
                             | +--Burkholderia_oklahomensis_EO147_out         (b-proteobacteria)
                         0.93+-+
                               +-Burkholderia_pseudomallei_K96243_out         (b-proteobacteria)


----------------------------------------------------------------------------------------------------------------------------------------------------
b) PyML
                                                                                                  --------0.2------
 
              0.96   +------------------------Hyphomonas_neptunium_ATCC_15444_in                                         (a-proteobacteria)
          +----------+
          |          +----------------Parvibaculum_lavamentivorans_DS-1_in                                               (a-proteobacteria)
          |
     1    |        +---------------------------------------GOS_1325030
 +--------+        |
 |        |        |              +--------------------Parvularcula_bermudensis_HTCC2503_in                              (a-proteobacteria)
 |        |  0.88  |              |
 |        +--------+              |           +--------------Sphingomonas_sp._SKA58_in                                   (a-proteobacteria)
 |                 |              |     0.99  |
 |                 |              |   +-------|
 |                 |              |   |       | 0.94+-----------Novosphingobium_aromaticivorans_DSM_12444_in             (a-proteobacteria)
 |                 |     0.99     |   |       +-----+
 |                 +--------------+   |             |   +-----Erythrobacter_sp._SD-21_in                                 (a-proteobacteria)
 |                                |   |         0.78+---+
 |                                |   |                 +-----Erythrobacter_litoralis_HTCC2594_in                        (a-proteobacteria)
 |                                |   |
 |                                |   |                1     +----Stappia_aggregata_IAM_12614_in                         (a-proteobacteria)
 |                                |   |           +----------+
 |                                +---+       0.88|          +---Labrenzia_alexandrii_DFL-11_in                          (a-proteobacteria)
 |                                    |        +--+
 |                                    |        |  |         +-Rhodopseudomonas_palustris_DX-1_in                         (a-proteobacteria)
 |                                    |        |  |   1     |
 |                                    |        |  +---------+Rhodopseudomonas_palustris_TIE-1_in                         (a-proteobacteria)
 |                                    |        |            |
 |                                    |        |            +Rhodopseudomonas_palustris_CGA009_in                        (a-proteobacteria)
 |                                    |        |
 |                                    | 0.99   |
 |                                    +--------+      +-----------Aurantimonas_manganoxydans_SI85-9A1_in                 (a-proteobacteria)
 |                                             | 0.98 |
 |                                             |------+      +-------Rhizobium_sp._NGR234_in                             (a-proteobacteria)
 |                                             |      | 0.98 |
 |                                             |      +------+  +-------Agrobacterium_tumefaciens_str._C58_in            (a-proteobacteria)
 |                                             |             |  |
 |                                             |         0.74+--++--Agrobacterium_radiobacter_K84_in                     (a-proteobacteria)
 |                                             |                ||
 |                                             |            0.12++0.99+-Rhizobium_etli_CFN_42_in                         (a-proteobacteria)
 |                                             |                 +----+
 |                                             |                      +--Rhizobium_leguminosarum_bv._trifolii_WSM2304_in (a-proteobacteria)
 |                                             |
 |                                             | 0.99  +--------Methylobacterium_nodulans_ORS_2060_in                    (a-proteobacteria)
 |                                             +-------+
 |                                                     +----Methylobacterium_radiotolerans_JCM_2831_in                   (a-proteobacteria)
 |
 |
 |                    0.95+-Burkholderia_oklahomensis_EO147_out                                                          (b-proteobacteria)
 |                1    +--+
 |           +--------+  +Burkholderia_pseudomallei_K96243_out                                                           (b-proteobacteria)
 |       0.42|        |
 |        +--+        +-Burkholderia_ambifaria_IOP40-10_out                                                              (b-proteobacteria)
 |  1     |  |
 +--------+  +----------------Achromobacter_piechaudii_ATCC_43553_out                                                    (b-proteobacteria)
          |
          +------------Janthinobacterium_sp._Marseille_out                                                               (b-proteobacteria)

Taxonomy report

PROTOCOL


a) BLASTp

BLASTp versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report

b) BLASTx

BLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report



RESULTS ANALYSIS

As we have a hight number of hits for acyl-CoA dehydrogenase, we have concluded that our protein might have that function. Since there was a-proteobacteria with significant e-value (1e-95) and according with the second example of FAQ, selecting twenty a-proteobacteria and five b-proteobacterias. At first the outgroup was consited by b-proteobacterias and g-proteobacterias. But after a few trees we've concluded that the g-proteobacterias were part of the ingroup. So the outgroup is only consisted by b-proteobacterias.


a) In group: a-proteobacteria

ref|YP_001412055.1| Parvibaculum.lav Parvibaculum lavamentivorans DS-1 1e-95 (a-proteobacteria)

ref|ZP_01017414.1| Parvularcula.ber Parvularcula bermudensis HTCC2503 1e-94 (a-proteobacteria)

ref|YP_760546.1| Hyphomonas.neptu Hyphomonas neptunium ATCC 15444 2e-93 (a-proteobacteria)

ref|ZP_01862814.1| Erythrobacter.sp Erythrobacter sp. SD-21 2e-92 (a-proteobacteria)

ref|YP_002824722.1| Rhizobium_etli Rhizobium sp. NGR234 3e-92 (a-proteobacteria)

ref|YP_002543346.1| Agrobact.radioba Agrobacterium radiobacter K84 4e-92 (a-proteobacteria)

ref|NP_353529.2| Agrobact.tumefac Agrobacterium tumefaciens str. C58 5e-92 (a-proteobacteria)

ref|YP_001989918.1| Rhodopseud.TIE-1 Rhodopseudomonas palustris TIE-1 8e-92 (a-proteobacteria)

ref|NP_946169.1| Rhodopseud.CGA009 Rhodopseudomonas palustris CGA009 1e-91 (a-proteobacteria)

ref|YP_002500387.1| Methylobact.nodu Methylobacterium nodulans ORS 2060 1e-91 (a-proteobacteria)

ref|ZP_01546756.1| Stappia_aggregat Stappia aggregata IAM 12614 1e-91 (a-proteobacteria)

ref|YP_001758385.1| Methylobact.nodu Methylobacterium radiotolerans JCM 2831 1e-91 (a-proteobacteria)

ref|ZP_06356599.1| Rhodopseud. Dx-1 Rhodopseudomonas palustris DX-1 2e-91 (a-proteobacteria)

ref|YP_468102.1| Rhizobium_etli Rhizobium etli CFN 42 2e-90 (a-proteobacteria)

ref|YP_497378.1| Novosphingobium Novosphingobium aromaticivorans DSM 12444 3e-90 (a-proteobacteria)

ref|YP_458068.1| Erythrobacter.lit Erythrobacter litoralis HTCC2594 4e-90 (a-proteobacteria)

ref|ZP_01303435.1| Sphingomonas_sp Sphingomonas sp. SKA58 4e-90 (a-proteobacteria)

ref|ZP_01226619.1| Aurantimonas.man Aurantimonas manganoxydans SI85-9A1 7e-90 (a-proteobacteria)

ref|ZP_05117417.1| Labrenzia_alex Labrenzia alexandrii DFL-11 7e-90 (a-proteobacteria)

ref|YP_002279739.1| Rhizobium.legumi Rhizobium leguminosarum bv. trifolii WSM2304 8e-90 (a-proteobacteria)




b) Out group: b-proteobacteria

ref|ZP_02356525.1| Burkholderia_okl Burkholderia oklahomensis EO147 1e-91 (b-proteobacteria)

ref|YP_109093.1| Burkholderia_pse Burkholderia pseudomallei K96243 7e-91 (b-proteobacteria)

ref|ZP_02893274.1| Burkholderia.am Burkholderia ambifaria IOP40-10 2e-90 (b-proteobacteria)

ref|YP_001352277.1| Janthi.marseille Janthinobacterium sp. Marseille 1e-86 (b-proteobacteria)

ref|ZP_06687177.1| Achromobacter Achromobacter piechaudii ATCC 43553 3e-85 (b-proteobacteria)

RAW RESULTS

a) Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Psychroflexus torquis ATCC 700755 -----------------------------  499  1 hit  [CFB group bacteria]  probable acyl-CoA dehydrogenase [Psychroflexus torquis ATCC
. . Parvibaculum lavamentivorans DS-1 .............................  353  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Parvibacu
. . Burkholderia sp. CCGE1002 .....................................  350  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Parvularcula bermudensis HTCC2503 .............................  350  4 hits [a-proteobacteria]    probable acyl-CoA dehydrogenase [Parvularcula bermudensis H
. . Neptuniibacter caesariensis ...................................  348  8 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Burkholderia sp. H160 .........................................  347  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. H16
. . Azoarcus sp. BH72 .............................................  346  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Azoarcus sp. BH72] >gi|119670406|em
. . Hyphomonas neptunium ATCC 15444 ...............................  346  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Hyphomonas neptunium
. . Ralstonia eutropha JMP134 .....................................  345 10 hits [b-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Erythrobacter sp. SD-21 .......................................  342  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Erythrobacter sp. 
. . Rhizobium sp. NGR234 ..........................................  342  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234] >gi|2
. . Agrobacterium radiobacter K84 .................................  342  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Agrobacterium radiobacter K
. . Agrobacterium tumefaciens str. C58 ............................  342  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Agrobacterium tumefaciens str. C58]
. . Rhodopseudomonas palustris TIE-1 ..............................  341  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodopseudomonas pal
. . Rhodopseudomonas palustris CGA009 .............................  340  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhodopseudomonas palustris
. . Burkholderia oklahomensis EO147 ...............................  340  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia oklahom
. . Methylobacterium nodulans ORS 2060 ............................  340  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium nod
. . Labrenzia aggregata IAM 12614 .................................  340  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Stappia aggregata IAM 12614] >gi|11
. . Burkholderia vietnamiensis G4 .................................  340  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Methylobacterium radiotolerans JCM 2831 .......................  340  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Rhodopseudomonas palustris DX-1 ...............................  340  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodopseudomonas pal
. . Burkholderia oklahomensis C6786 ...............................  339  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia oklahom
. . Burkholderia xenovorans LB400 .................................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia xenovorans LB
. . Burkholderia pseudomallei MSHR346 .............................  338  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia pseudomallei MSHR346] 
. . Burkholderia pseudomallei K96243 ..............................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 668 .................................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1106a ...............................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 305 .................................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei DM98 ................................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 91 ..................................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei B7210 ...............................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 7894 ................................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 112 .................................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei BCC215 ..............................  338  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1106b ...............................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei S13 .................................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 406e ................................  338  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1710b ...............................  338  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 14 ..................................  338  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 9 ...................................  338  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei NCTC 13177 ..........................  338  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 576 .................................  338  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei Pakistan 9 ..........................  338  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei Pasteur 52237 .......................  338  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 1710a ...............................  338  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Aromatoleum aromaticum EbN1 ...................................  337  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Aromatoleum aromaticum EbN1] >gi|56
. . Burkholderia thailandensis TXDOH ..............................  337  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia thailan
. . Burkholderia ambifaria IOP40-10 ...............................  337  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . Burkholderia thailandensis E264 ...............................  337  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia thailandensis Bt4 ................................  337  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Rhizobium etli CFN 42 .........................................  336  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium etli CFN 42] >gi|
. . Acidovorax sp. JS42 ...........................................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Acidovorax ebreus TPSY ........................................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Burkholderia cenocepacia J2315 ................................  336  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia cenocepacia J
. . Burkholderia ambifaria MEX-5 ..................................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . Burkholderia cenocepacia MC0-3 ................................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia cenocepacia AU 1054 ..............................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . Burkholderia cenocepacia HI2424 ...............................  336  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . Burkholderia cenocepacia PC184 ................................  335  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia cenocepacia PC184] >gi
. . Cupriavidus taiwanensis .......................................  335  4 hits [b-proteobacteria]    putative ACYL-COA DEHYDROGENASE OXIDOREDUCTASE [Cupriavidus
. . Novosphingobium aromaticivorans DSM 12444 .....................  335  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Novosphingobium aromaticivoran
. . Burkholderia pseudomallei 1655 ................................  335  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia pseudom
. . Burkholderia dolosa AUO158 ....................................  335  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia dolosa AUO158] >gi|124
. . Erythrobacter litoralis HTCC2594 ..............................  335  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Erythrobacter lito
. . Ralstonia eutropha H16 ........................................  335  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Ralstonia eutropha H16] >gi|1135256
. . Burkholderia sp. 383 ..........................................  335  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia sp. 383] >gi|77964537|
. . Sphingomonas sp. SKA58 ........................................  335  2 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Sphingomonas sp. S
. . Cupriavidus metallidurans CH34 ................................  335  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like protein [Cupriavidus metallidur
. . Aurantimonas manganoxydans SI85-9A1 ...........................  334  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Aurantimonas manganoxydans SI85-9A1
. . Labrenzia alexandrii DFL-11 ...................................  334  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Labrenzi
. . Rhizobium leguminosarum bv. trifolii WSM2304 ..................  334  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . Burkholderia ambifaria MC40-6 .................................  334  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Thauera sp. MZ1T ..............................................  334  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Thauera sp. MZ1T] >g
. . Methylobacterium extorquens AM1 ...............................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Methylobacterium extorquens AM1] >g
. . Methylobacterium extorquens DM4 ...............................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Methylobacterium extorquens DM4] >g
. . Hoeflea phototrophica DFL-43 ..................................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Hoeflea phototrophica DFL-43] >gi|1
. . Methylobacterium chloromethanicum CM4 .........................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium chl
. . Burkholderia ambifaria AMMD ...................................  333  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Pseudomonas stutzeri A1501 ....................................  333  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Pseudomonas stutzeri A1501] >gi|145
. . Rhizobium leguminosarum bv. viciae 3841 .......................  333  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhizobium leguminosarum bv
. . Rhizobium etli CIAT 652 .......................................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium etli CIAT 652] >g
. . Burkholderia phytofirmans PsJN ................................  333  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia phytofi
. . Methylobacterium sp. 4-46 .....................................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Methylobacterium extorquens PA1 ...............................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Delftia acidovorans SPH-1 .....................................  333  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Delftia a
. . Rhizobium leguminosarum bv. trifolii WSM1325 ..................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . alpha proteobacterium BAL199 ..................................  333  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [alpha proteobacterium BAL199] >gi|1
. . Marinobacter sp. ELB17 ........................................  332  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Marinobacter sp. ELB17] >gi|1266286
. . Oligotropha carboxidovorans OM5 ...............................  332  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Oligotropha carboxidovorans OM5] >g
. . Pseudovibrio sp. JE062 ........................................  332  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudovibrio sp. JE0
. . Methylobacterium populi BJ001 .................................  332  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium pop
. . Marinobacter aquaeolei VT8 ....................................  332  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Marinobac
. . Leptothrix cholodnii SP-6 .....................................  332  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Leptothri
. . Marinobacter algicola DG893 ...................................  332  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Marinobacter algicola DG893] >gi|14
. . Rhodopseudomonas palustris HaA2 ...............................  332  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris HaA
. . Comamonas testosteroni CNB-2 ..................................  331  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like protein [Comamonas testosteroni
. . Bradyrhizobium sp. ORS278 .....................................  331  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Bradyrhizobium sp. ORS278]
. . Burkholderia thailandensis MSMB43 .............................  331  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia thailan
. . Bermanella marisrubri .........................................  331  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Oceanobacter sp. RED65] >g
. . Pseudomonas fluorescens SBW25 .................................  331  6 hits [g-proteobacteria]    putative dehydrogenase [Pseudomonas fluorescens SBW25] >gi|
. . Burkholderia multivorans CGD2M ................................  331  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Burkholderia multivorans CGD2 .................................  331  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Ralstonia solanacearum MolK2 ..................................  330  4 hits [b-proteobacteria]    acyl-coa dehydrogenase protein [Ralstonia solanacearum MolK
. . Ralstonia solanacearum IPO1609 ................................  330  4 hits [b-proteobacteria]    acyl-coa dehydrogenase protein [Ralstonia solanacearum IPO1
. . Bradyrhizobium sp. BTAi1 ......................................  330  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Bradyrhizobium sp. BTAi1] 
. . Dinoroseobacter shibae DFL 12 .................................  330  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Dinoroseobacter shib
. . Hirschia baltica ATCC 49814 ...................................  330  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Hirschia baltica ATC
. . Burkholderia multivorans CGD1 .................................  330  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Sinorhizobium medicae WSM419 ..................................  330  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Sinorhizo
. . Rhodopseudomonas palustris BisB18 .............................  329  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . Laribacter hongkongensis HLHK9 ................................  329  2 hits [b-proteobacteria]    Probable acyl-CoA dehydrogenase [Laribacter hongkongensis H
. . Chromobacterium violaceum ATCC 12472 ..........................  329  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Chromobacterium violaceum ATCC 1247
. . Pseudomonas putida GB-1 .......................................  329  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Pseudomonas fluorescens .......................................  329  3 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas fluoresc
. . Pseudomonas putida KT2440 .....................................  329  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Pseudomonas putida F1 .........................................  329  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Pseudomonas aeruginosa UCBPP-PA14 .............................  329  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa UCB
. . Pseudomonas fluorescens Pf-5 ..................................  329  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas fluoresc
. . Pseudomonas aeruginosa PA7 ....................................  329  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PA7
. . Pseudomonas fluorescens Pf0-1 .................................  328  6 hits [g-proteobacteria]    Acyl-CoA dehydrogenase-like [Pseudomonas fluorescens Pf0-1]
. . Ralstonia solanacearum UW551 ..................................  328  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Ralstonia solanacearum UW551] >gi|8
. . Pseudomonas putida W619 .......................................  328  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Methylibium petroleiphilum PM1 ................................  328  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Met
. . Polaromonas sp. JS666 .........................................  328  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Polaromonas sp. JS666] >gi|916
. . Burkholderia multivorans ATCC 17616 ...........................  328  8 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Pseudomonas syringae pv. syringae B728a .......................  328  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Pseudomonas aeruginosa PAO1 ...................................  328  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Pseudomonas aeruginosa PACS2 ..................................  328  4 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Pseudomonas aeruginosa LESB58 .................................  328  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Ochrobactrum intermedium LMG 3301 .............................  328  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Ochrobact
. . Pseudomonas aeruginosa C3719 ..................................  328  6 hits [g-proteobacteria]    hypothetical protein PACG_03331 [Pseudomonas aeruginosa C37
. . Pseudomonas aeruginosa 2192 ...................................  328  8 hits [g-proteobacteria]    hypothetical protein PACG_03331 [Pseudomonas aeruginosa C37
. . Sinorhizobium meliloti 1021 ...................................  327  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Sinorhizobium meli
. . Ochrobactrum anthropi ATCC 49188 ..............................  327  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Ochrobact
. . Comamonas testosteroni KF-1 ...................................  327  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Comamonas testostero
. . Bradyrhizobium japonicum USDA 110 .............................  327  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Bradyrhizobium japonicum USDA 110] 
. . Polynucleobacter necessarius subsp. necessarius STIR1 .........  327  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Polynucleobacter nec
. . Dechloromonas aromatica RCB ...................................  327  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Silicibacter lacuscaerulensis ITI-1157 ........................  327  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Silicibacter lacusca
. . Hahella chejuensis KCTC 2396 ..................................  327  6 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Hahella chejuensis KCTC 2396] >gi|8
. . Burkholderia sp. CCGE1003 .....................................  327  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Pseudomonas syringae pv. aesculi str. NCPPB3681 ...............  327  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Colwellia psychrerythraea 34H .................................  327  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Colwellia psychreryt
. . Polaromonas naphthalenivorans CJ2 .............................  327  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Polaromon
. . Pseudomonas entomophila L48 ...................................  326  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Pseudomonas entomophila L48] >gi|95
. . Shewanella frigidimarina NCIMB 400 ............................  326  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . Hyphomicrobium denitrificans ATCC 51888 .......................  326  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Hyphomicrobium denit
. . Marinomonas sp. MED121 ........................................  326  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Marinomonas sp. MED121] >g
. . Ralstonia solanacearum GMI1000 ................................  326  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Ral
. . Sphingopyxis alaskensis RB2256 ................................  326  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like protein [Sphingopyxis alaskensi
. . Phaeobacter gallaeciensis BS107 ...............................  325  6 hits [a-proteobacteria]    enoyl-CoA hydratase [Phaeobacter gallaeciensis BS107] >gi|1
. . Agrobacterium vitis S4 ........................................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Agrobacterium vitis S4] >gi|2217344
. . Phaeobacter gallaeciensis 2.10 ................................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Phaeobacter gallaeci
. . Rhodopseudomonas palustris BisA53 .............................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodopseu
. . Erythrobacter sp. NAP1 ........................................  325  4 hits [a-proteobacteria]    putative acyl-coa dehydrogenase protein [Erythrobacter sp. 
. . Rhodospirillum centenum SW ....................................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase, putative [Rhodospirillum centenum S
. . Anaeromyxobacter sp. Fw109-5 ..................................  325  2 hits [d-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Anaeromyx
. . Pseudomonas mendocina ymp .....................................  325  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Acidovorax citrulli AAC00-1 ...................................  325  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Burkholderia phymatum STM815 ..................................  324  8 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Octadecabacter antarcticus 307 ................................  324  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Octadeca
. . Herminiimonas arsenicoxydans ..................................  324  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Herminiimonas arsenicoxyda
. . Rhodopseudomonas palustris BisB5 ..............................  324  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . Magnetospirillum gryphiswaldense MSR-1 ........................  324  1 hit  [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Magnetospirillum gry
. . Pseudomonas syringae pv. phaseolicola 1448A ...................  324  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Pseudomonas syringae pv. aesculi str. 2250 ....................  324  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Curvibacter putative symbiont of Hydra magnipapillata .........  324  1 hit  [b-proteobacteria]    hypothetical protein [Curvibacter putative symbiont of Hydr
. . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ......  324  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Candidatus Accumulib
. . Janthinobacterium sp. Marseille ...............................  324  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Janthinobacterium sp. Marseille] >g
. . Roseobacter denitrificans OCh 114 .............................  324  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter denitrif
. . Chelativorans sp. BNC1 ........................................  323  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Mesorhizobium sp. BNC1] >gi|11
. . Brucella sp. 83/13 ............................................  323  6 hits [a-proteobacteria]    hypothetical protein Bru83_11263 [Brucella sp. 83/13] >gi|2
. . Pseudomonas syringae pv. tabaci ATCC 11528 ....................  323  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Variovorax paradoxus S110 .....................................  323  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Variovorax paradoxus
. . Acidovorax avenae subsp. avenae ATCC 19860 ....................  323  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Acidovorax avenae su
. . Idiomarina baltica OS145 ......................................  323  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase family protein [Idiomarina baltica O
. . Burkholderia glumae BGR1 ......................................  323  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase-like protein [Burkholderia glumae BG
. . Pseudomonas syringae pv. syringae FF5 .........................  322  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Brucella ceti str. Cudo .......................................  322  2 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella ceti str. Cudo] >gi|225615
. . Brucella suis 1330 ............................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella ovis ATCC 25840 ......................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella canis ATCC 23365 .....................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella suis ATCC 23445 ......................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella suis bv. 5 str. 513 ..................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella pinnipedialis M163/99/10 .............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella pinnipedialis B2/94 ..................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella ceti M644/93/1 .......................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella ceti M13/05/1 ........................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella microti CCM 4915 .....................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella pinnipedialis M292/94/1 ..............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella neotomae 5K33 ........................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella ceti M490/95/1 .......................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella ceti B1/94 ...........................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella sp. F5/99 ............................................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella suis bv. 4 str. 40 ...................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Acinetobacter lwoffii SH145 ...................................  322  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter lwoffii SH145] >gi|26
. . Roseobacter litoralis Och 149 .................................  322  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter litorali
. . Brucella melitensis bv. 1 str. 16M ............................  322  8 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|179846
. . Brucella melitensis ATCC 23457 ................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brucella melitensis 
. . Brucella melitensis bv. 1 str. Rev.1 ..........................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brucella melitensis 
. . Brucella melitensis bv. 3 str. Ether ..........................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brucella melitensis 
. . Brucella melitensis bv. 2 str. 63/9 ...........................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brucella melitensis 
. . Acidovorax delafieldii 2AN ....................................  322  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Acidovorax delafield
. . Ralstonia pickettii 12J .......................................  322  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . Citreicella sp. SE45 ..........................................  322  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Citreicella sp. SE45
. . Burkholderia sp. CCGE1001 .....................................  322  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Brucella abortus bv. 1 str. 9-941 .............................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella melitensis biovar Abortus 2308 .......................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus S19 ..........................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus str. 2308 A ..................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 6 str. 870 ...............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 3 str. Tulya .............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 2 str. 86/8/59 ...........................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 4 str. 292 ...............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 9 str. C68 ...............................  322  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus NCTC 8038 ....................................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Beijerinckia indica subsp. indica ATCC 9039 ...................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Beijerinc
. . Roseobacter sp. CCS2 ..........................................  321  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. CCS2
. . Acinetobacter sp. ATCC 27244 ..................................  321  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. ATCC 27244] >gi|2
. . Rhodoferax ferrireducens T118 .................................  321  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodoferax ferrireducens T118]
. . Rhodobacterales bacterium Y4I .................................  321  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Roseovarius sp. TM1035 ........................................  321  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. TM10
. . Nitrobacter winogradskyi Nb-255 ...............................  321  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Nitrobacter winogradskyi Nb-255] >g
. . Octadecabacter antarcticus 238 ................................  321  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Octadecabacter antarcticus 238] >gi
. . Burkholderia graminis C4D1M ...................................  320  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia gramini
. . Pseudomonas syringae pv. tomato str. DC3000 ...................  320  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Pseudomonas syringae pv. tomato T1 ............................  320  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Brucella suis bv. 3 str. 686 ..................................  320  6 hits [a-proteobacteria]    hypothetical protein Bsuib36_04187 [Brucella suis bv. 3 str
. . Psychrobacter cryohalolentis K5 ...............................  320  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase-like [Psychrobacter cryohalolentis K
. . Ralstonia pickettii 12D .......................................  320  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . Lutiella nitroferrum 2002 .....................................  320  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Lutiella nitroferrum
. . Jannaschia sp. CCS1 ...........................................  320  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Jannaschia sp. CCS1] >gi|88865
. . Mesorhizobium loti MAFF303099 .................................  320  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Mesorhizobium loti MAFF303099] >gi|
. . Azotobacter vinelandii DJ .....................................  319  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Azotobacter vinelandii DJ] >gi|2267
. . Rhizobium etli GR56 ...........................................  319  1 hit  [a-proteobacteria]    probable acyl-CoA dehydrogenase protein [Rhizobium etli GR5
. . gamma proteobacterium NOR51-B .................................  319  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [gamma proteobacteriu
. . Achromobacter piechaudii ATCC 43553 ...........................  319  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase [Achromobacter piechaudii ATCC 43553]
. . Caulobacter segnis ATCC 21756 .................................  319  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Caulobacter segnis A
. . marine gamma proteobacterium HTCC2148 .........................  319  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [marine g
. . Acinetobacter junii SH205 .....................................  319  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter junii SH205] >gi|2623
. . Roseovarius sp. 217 ...........................................  318  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. 217]
. . Marinomonas sp. MWYL1 .........................................  318  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Marinomon
. . Sulfitobacter sp. NAS-14.1 ....................................  318  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sulfitobacter sp. NA
. . Idiomarina loihiensis L2TR ....................................  318  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase family protein [Idiomarina loihiensi
. . marine gamma proteobacterium HTCC2080 .........................  318  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [marine gamma proteobacterium HTCC20
. . Rhizobium etli IE4771 .........................................  317  1 hit  [a-proteobacteria]    probable acyl-CoA dehydrogenase protein [Rhizobium etli IE4
. . Saccharophagus degradans 2-40 .................................  317  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Saccharophagus degra
. . Phenylobacterium zucineum HLK1 ................................  317  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Phenylobacterium zuc
. . Nitrobacter hamburgensis X14 ..................................  317  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Nitrobacter hamburgensis X14] 
. . Psychrobacter arcticus 273-4 ..................................  317  2 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Psychrobacter arcticus 273
. . Sagittula stellata E-37 .......................................  317  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sagittula stellata E
. . Fulvimarina pelagi HTCC2506 ...................................  317  2 hits [a-proteobacteria]    probable acyl-CoA dehydrogenase [Fulvimarina pelagi HTCC250
. . Acinetobacter radioresistens SH164 ............................  317  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter radioresistens SH164]
. . Psychrobacter sp. PRwf-1 ......................................  317  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Psychroba
. . alpha proteobacterium IMCC1322 ................................  316  1 hit  [a-proteobacteria]    acyl-CoA dehydrogenase [alpha proteobacterium IMCC1322]
. . Rhodobacteraceae bacterium KLH11 ..............................  316  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacteraceae bac
. . Roseobacter sp. AzwK-3b .......................................  316  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. AzwK
. . Pseudomonas syringae pv. oryzae str. 1_6 ......................  316  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Sphingomonas wittichii RW1 ....................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Sphingomo
. . Brevundimonas subvibrioides ATCC 15264 ........................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brevundimonas subvib
. . Ruegeria pomeroyi DSS-3 .......................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Ruegeria pomeroyi DS
. . gamma proteobacterium NOR5-3 ..................................  316  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [gamma proteobacteriu
. . Acinetobacter radioresistens SK82 .............................  315  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter radioresistens SK82] 
. . Burkholderia mallei GB8 horse 4 ...............................  315  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . Burkholderia mallei SAVP1 .....................................  315  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . Burkholderia mallei NCTC 10229 ................................  315  3 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . Sulfitobacter sp. EE-36 .......................................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sulfitobacter sp. EE
. . Sphingobium japonicum UT26S ...................................  315  1 hit  [a-proteobacteria]    acyl-CoA dehydrogenase [Sphingobium japonicum UT26S]
. . Limnobacter sp. MED105 ........................................  315  4 hits [b-proteobacteria]    putative acyl-coa dehydrogenase oxidoreductase protein [Lim
. . Roseovarius sp. HTCC2601 ......................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. HTCC
. . Mesorhizobium opportunistum WSM2075 ...........................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Mesorhizobium opport
. . Oceanicola batsensis HTCC2597 .................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicola batsensis
. . Ruegeria sp. R11 ..............................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Ruegeria sp. R11] >g
. . Oceanibulbus indolifex HEL-45 .................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanibulbus indolif
. . Roseovarius nubinhibens ISM ...................................  314  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius nubinhib
. . Magnetospirillum magnetotacticum MS-1 .........................  314  2 hits [a-proteobacteria]    COG1960: Acyl-CoA dehydrogenases [Magnetospirillum magnetot
. . Nitrobacter sp. Nb-311A .......................................  314  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Nitrobacter sp. Nb-311A] >gi|856956
. . Rhodospirillum rubrum ATCC 11170 ..............................  314  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Rhodospirillum rubrum ATCC 11170] >
. . Oceanicaulis alexandrii HTCC2633 ..............................  314  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicaulis alexand
. . Azospirillum sp. B510 .........................................  313  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Azospirillum sp. B510] >gi|28890965
. . Rhodobacterales bacterium HTCC2654 ............................  313  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Caulobacter crescentus CB15 ...................................  313  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Caulobacter crescent
. . Caulobacter crescentus NA1000 .................................  313  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Caulobacter crescent
. . Acinetobacter johnsonii SH046 .................................  312  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter johnsonii SH046] >gi|
. . Verminephrobacter eiseniae EF01-2 .............................  312  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Vermineph
. . Congregibacter litoralis KT71 .................................  312  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Congregibacter litoralis KT71] >gi|
. . Magnetospirillum magneticum AMB-1 .............................  312  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Magnetospirillum magneticum AMB-1] 
. . Brevundimonas sp. BAL3 ........................................  311  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Brevundi
. . Alcanivorax borkumensis SK2 ...................................  311  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase, putative [Alcanivorax borkumensis S
. . Pseudoalteromonas atlantica T6c ...............................  311  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase-like [Pseudoalteromonas atlantica T6
. . Roseobacter sp. GAI101 ........................................  311  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Roseobacter sp. GAI101] >gi|2140436
. . Reinekea blandensis MED297 ....................................  310  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Reinekea sp. MED297] >gi|8
. . Silicibacter sp. TrichCH4B ....................................  310  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Silicibacter sp. Tri
. . Acinetobacter baumannii SDF ...................................  310  1 hit  [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii SDF] >gi|16
. . Acinetobacter baumannii .......................................  310  3 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii SDF] >gi|16
. . Acinetobacter baumannii AYE ...................................  310  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter baumannii AB0057 ................................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter baumannii AB307-0294 ............................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Alteromonas macleodii ATCC 27126 ..............................  310  1 hit  [g-proteobacteria]    Acyl-CoA dehydrogenase [Alteromonas macleodii ATCC 27126]
. . Acinetobacter baumannii ACICU .................................  310  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii AB900 .................................  310  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii ATCC 19606 ............................  310  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii ATCC 17978 ............................  310  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Enhydrobacter aerosaccus SK60 .................................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [Enhydrobacter aerosa
. . Rhodobacterales bacterium HTCC2083 ............................  309  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Loktanella vestfoldensis SKA53 ................................  309  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Loktanella vestfolde
. . Rhodobacter sphaeroides KD131 .................................  309  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase domain protein [Rhodobacter sphaeroi
. . Acinetobacter sp. ADP1 ........................................  309  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. ADP1] >gi|4952983
. . Halorhodospira halophila SL1 ..................................  308  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Halorhodo
. . Paracoccus denitrificans PD1222 ...............................  308  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Paracoccu
. . Acinetobacter sp. RUH2624 .....................................  308  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. RUH2624] >gi|2604
. . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .  308  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Polynucle
. . Acinetobacter sp. SH024 .......................................  308  3 hits [g-proteobacteria]    conserved hypothetical protein [Acinetobacter sp. SH024]
. . Acinetobacter calcoaceticus RUH2202 ...........................  307  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter calcoaceticus RUH2202
. . Rhodobacter sphaeroides ATCC 17029 ............................  307  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . Methylocella silvestris BL2 ...................................  307  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylocella silvest
. . Kingella oralis ATCC 51147 ....................................  307  2 hits [b-proteobacteria]    hypothetical protein GCWU000324_01417 [Kingella oralis ATCC
. . Acinetobacter haemolyticus ATCC 19194 .........................  307  1 hit  [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter haemolyticus ATCC 191
. . marine gamma proteobacterium HTCC2143 .........................  307  2 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [marine gamma proteobacteri
. . Rhodobacterales bacterium HTCC2255 ............................  306  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase-like protein [alpha proteobacterium 
. . Glaciecola sp. HTCC2999 .......................................  306  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase-like protein [alpha proteobacterium 
. . Rhodobacter sphaeroides 2.4.1 .................................  306  2 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhodobacter sphaeroides 2.
. . Oceanicola granulosus HTCC2516 ................................  306  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicola granulosu
. . Rhodomicrobium vannielii ATCC 17100 ...........................  306  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodomicrobium vanni
. . Alcanivorax sp. DG881 .........................................  306  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Alcanivo
. . Rhodobacter sp. SW2 ...........................................  306  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodobacter sp. SW2]
. . Neisseria sicca ATCC 29256 ....................................  306  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase family protein [Neisseria sicca ATCC
. . Caulobacter sp. K31 ...........................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Caulobact
. . Xanthobacter autotrophicus Py2 ................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Xanthobac
. . Alteromonas macleodii 'Deep ecotype' ..........................  305  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Alteromonas macleodii 'Deep ecotype
. . Ruegeria sp. TM1040 ...........................................  305  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Ruegeria sp. TM1040] >gi|99037
. . Asticcacaulis excentricus CB 48 ...............................  305  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Asticcacaulis excent
. . Rhodobacter sphaeroides ATCC 17025 ............................  305  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . Bordetella pertussis Tohama I .................................  305  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella pertussis Tohama I] >gi|
. . Bordetella bronchiseptica RB50 ................................  305  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella pertussis Tohama I] >gi|
. . Stenotrophomonas maltophilia K279a ............................  305  2 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Ste
. . Neisseria mucosa ATCC 25996 ...................................  305  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase family protein [Neisseria mucosa ATC
. . Bordetella petrii DSM 12804 ...................................  304  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella petrii DSM 12804] >gi|16
. . Bordetella petrii .............................................  304  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella petrii DSM 12804] >gi|16
. . Deinococcus radiodurans R1 ....................................  303  2 hits [bacteria]            acyl-CoA dehydrogenase, putative [Deinococcus radiodurans R
. . Bordetella avium 197N .........................................  303  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella avium 197N] >gi|11542245
. . Azorhizobium caulinodans ORS 571 ..............................  303  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Azorhizobium caulinodans ORS 571] >
. . Stenotrophomonas sp. SKA14 ....................................  303  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Stenotrophomonas sp. SKA14] >gi|219
. . Bordetella parapertussis 12822 ................................  303  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella parapertussis 12822] >gi
. . Bordetella parapertussis ......................................  303  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase [Bordetella parapertussis 12822] >gi
. . Acidiphilium cryptum JF-5 .....................................  303  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidiphil
. . Deinococcus geothermalis DSM 11300 ............................  303  2 hits [bacteria]            acyl-CoA dehydrogenase-like protein [Deinococcus geothermal
. . Burkholderia ubonensis Bu .....................................  303  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ubonens
. . Roseobacter sp. MED193 ........................................  303  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. MED1
. . Roseobacter sp. SK209-2-6 .....................................  302  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. SK20
. . Burkholderia mallei ATCC 23344 ................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei NCTC 10247 ................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei PRL-20 ....................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei ATCC 10399 ................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei FMH .......................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei JHU .......................................  302  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Stenotrophomonas maltophilia R551-3 ...........................  301  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [Stenotrophomonas mal
. . Maricaulis maris MCS10 ........................................  300  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Maricauli
. . Eikenella corrodens ATCC 23834 ................................  300  2 hits [b-proteobacteria]    hypothetical protein EIKCOROL_01746 [Eikenella corrodens AT
. . Azospirillum brasilense .......................................  300  1 hit  [a-proteobacteria]    acyl-CoA dehydrogenase [Azospirillum brasilense]
. Danio rerio (zebra fish) ----------------------------------------  311  1 hit  [bony fishes]         PREDICTED: similar to predicted protein [Danio rerio]
. Monosiga brevicollis MX1 ........................................  309  2 hits [choanoflagellates]   hypothetical protein [Monosiga brevicollis MX1] >gi|1637750


------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------


b)Blastx
Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Psychroflexus torquis ATCC 700755 -----------------------------  488  1 hit  [CFB group bacteria]  probable acyl-CoA dehydrogenase [Psychroflexus torquis ATCC
. . Parvularcula bermudensis HTCC2503 .............................  343  4 hits [a-proteobacteria]    probable acyl-CoA dehydrogenase [Parvularcula bermudensis H
. . Parvibaculum lavamentivorans DS-1 .............................  343  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Parvibacu
. . Erythrobacter sp. SD-21 .......................................  338  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Erythrobacter sp. 
. . Burkholderia sp. CCGE1002 .....................................  337  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Agrobacterium tumefaciens str. C58 ............................  335  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Agrobacterium tumefaciens str. C58]
. . Azoarcus sp. BH72 .............................................  334  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Azoarcus sp. BH72] >gi|119670406|em
. . Labrenzia aggregata IAM 12614 .................................  334  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Stappia aggregata IAM 12614] >gi|11
. . Agrobacterium radiobacter K84 .................................  334  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Agrobacterium radiobacter K
. . Hyphomonas neptunium ATCC 15444 ...............................  334  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Hyphomonas neptunium
. . Rhizobium sp. NGR234 ..........................................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234] >gi|2
. . Neptuniibacter caesariensis ...................................  333  8 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Burkholderia sp. H160 .........................................  333  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. H16
. . Rhodopseudomonas palustris TIE-1 ..............................  333  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodopseudomonas pal
. . Rhodopseudomonas palustris CGA009 .............................  333  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhodopseudomonas palustris
. . Rhodopseudomonas palustris DX-1 ...............................  332  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodopseudomonas pal
. . Methylobacterium radiotolerans JCM 2831 .......................  332  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Ralstonia eutropha JMP134 .....................................  331 10 hits [b-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Methylobacterium nodulans ORS 2060 ............................  330  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium nod
. . Erythrobacter litoralis HTCC2594 ..............................  330  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Erythrobacter lito
. . Burkholderia cenocepacia J2315 ................................  330  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia cenocepacia J
. . Cupriavidus taiwanensis .......................................  330  4 hits [b-proteobacteria]    putative ACYL-COA DEHYDROGENASE OXIDOREDUCTASE [Cupriavidus
. . Burkholderia ambifaria IOP40-10 ...............................  330  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . Burkholderia ambifaria MEX-5 ..................................  329  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . Burkholderia cenocepacia MC0-3 ................................  329  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia cenocepacia AU 1054 ..............................  329  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . Burkholderia cenocepacia HI2424 ...............................  329  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . Aurantimonas manganoxydans SI85-9A1 ...........................  329  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Aurantimonas manganoxydans SI85-9A1
. . Burkholderia sp. 383 ..........................................  329  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia sp. 383] >gi|77964537|
. . Burkholderia cenocepacia PC184 ................................  329  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia cenocepacia PC184] >gi
. . Labrenzia alexandrii DFL-11 ...................................  328  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Labrenzi
. . Ralstonia eutropha H16 ........................................  328  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Ralstonia eutropha H16] >gi|1135256
. . Hoeflea phototrophica DFL-43 ..................................  328  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Hoeflea phototrophica DFL-43] >gi|1
. . Burkholderia dolosa AUO158 ....................................  328  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia dolosa AUO158] >gi|124
. . Pseudovibrio sp. JE062 ........................................  328  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudovibrio sp. JE0
. . Ralstonia solanacearum IPO1609 ................................  328  4 hits [b-proteobacteria]    acyl-coa dehydrogenase protein [Ralstonia solanacearum IPO1
. . Ralstonia solanacearum MolK2 ..................................  328  4 hits [b-proteobacteria]    acyl-coa dehydrogenase protein [Ralstonia solanacearum MolK
. . Ralstonia solanacearum UW551 ..................................  328  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Ralstonia solanacearum UW551] >gi|8
. . Cupriavidus metallidurans CH34 ................................  328  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like protein [Cupriavidus metallidur
. . Burkholderia ambifaria MC40-6 .................................  327  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Novosphingobium aromaticivorans DSM 12444 .....................  327  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Novosphingobium aromaticivoran
. . Burkholderia oklahomensis EO147 ...............................  327  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia oklahom
. . Methylobacterium sp. 4-46 .....................................  327  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Rhizobium etli CFN 42 .........................................  327  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium etli CFN 42] >gi|
. . Burkholderia ambifaria AMMD ...................................  327  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia vietnamiensis G4 .................................  327  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Sphingomonas sp. SKA58 ........................................  327  2 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Sphingomonas sp. S
. . Burkholderia oklahomensis C6786 ...............................  326  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia oklahom
. . Ralstonia pickettii 12J .......................................  326  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . Marinobacter algicola DG893 ...................................  326  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Marinobacter algicola DG893] >gi|14
. . Acidovorax sp. JS42 ...........................................  326  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Acidovorax ebreus TPSY ........................................  326  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Hirschia baltica ATCC 49814 ...................................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Hirschia baltica ATC
. . Rhizobium leguminosarum bv. trifolii WSM2304 ..................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . Methylobacterium populi BJ001 .................................  325  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium pop
. . Marinobacter sp. ELB17 ........................................  325  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Marinobacter sp. ELB17] >gi|1266286
. . Marinobacter aquaeolei VT8 ....................................  325  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Marinobac
. . Chelativorans sp. BNC1 ........................................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Mesorhizobium sp. BNC1] >gi|11
. . Methylobacterium extorquens DM4 ...............................  325  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Methylobacterium extorquens DM4] >g
. . Methylobacterium extorquens AM1 ...............................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Methylobacterium extorquens AM1] >g
. . Burkholderia multivorans CGD2M ................................  325  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Burkholderia multivorans CGD2 .................................  325  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Methylobacterium chloromethanicum CM4 .........................  325  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylobacterium chl
. . Ralstonia pickettii 12D .......................................  325  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . Burkholderia pseudomallei MSHR346 .............................  324  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia pseudomallei MSHR346] 
. . Thauera sp. MZ1T ..............................................  324  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Thauera sp. MZ1T] >g
. . Rhizobium leguminosarum bv. trifolii WSM1325 ..................  324  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . Methylobacterium extorquens PA1 ...............................  324  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . Rhizobium leguminosarum bv. viciae 3841 .......................  324  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhizobium leguminosarum bv
. . Dechloromonas aromatica RCB ...................................  324  6 hits [b-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Burkholderia pseudomallei 1710b ...............................  324  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 14 ..................................  324  1 hit  [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 9 ...................................  324  1 hit  [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei NCTC 13177 ..........................  324  1 hit  [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 576 .................................  324  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei Pakistan 9 ..........................  324  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei Pasteur 52237 .......................  324  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei 1710a ...............................  324  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Burkholderia pseudomallei 1710b] >g
. . Burkholderia pseudomallei K96243 ..............................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 668 .................................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1106a ...............................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 305 .................................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei DM98 ................................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 91 ..................................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei B7210 ...............................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 7894 ................................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 112 .................................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei BCC215 ..............................  324  1 hit  [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1106b ...............................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei S13 .................................  324  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 406e ................................  324  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia pseudomallei 
. . Caulobacter segnis ATCC 21756 .................................  324  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Caulobacter segnis A
. . Rhizobium etli CIAT 652 .......................................  324  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase protein [Rhizobium etli CIAT 652] >g
. . Burkholderia multivorans CGD1 .................................  323  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia multivo
. . Burkholderia thailandensis TXDOH ..............................  323  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia thailan
. . Burkholderia phymatum STM815 ..................................  323  8 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Rhodopseudomonas palustris HaA2 ...............................  323  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris HaA
. . Aromatoleum aromaticum EbN1 ...................................  323  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Aromatoleum aromaticum EbN1] >gi|56
. . Ralstonia solanacearum GMI1000 ................................  323  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Ral
. . Silicibacter lacuscaerulensis ITI-1157 ........................  323  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Silicibacter lacusca
. . Bradyrhizobium sp. ORS278 .....................................  323  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Bradyrhizobium sp. ORS278]
. . Burkholderia xenovorans LB400 .................................  323  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Burkholderia xenovorans LB
. . Burkholderia thailandensis E264 ...............................  323  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia thailandensis Bt4 ................................  323  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Oligotropha carboxidovorans OM5 ...............................  323  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Oligotropha carboxidovorans OM5] >g
. . Pseudomonas stutzeri A1501 ....................................  323  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Pseudomonas stutzeri A1501] >gi|145
. . Bradyrhizobium sp. BTAi1 ......................................  323  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Bradyrhizobium sp. BTAi1] 
. . Delftia acidovorans SPH-1 .....................................  322  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Delftia a
. . Hahella chejuensis KCTC 2396 ..................................  322  6 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Hahella chejuensis KCTC 2396] >gi|8
. . Rhodopseudomonas palustris BisB18 .............................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . Burkholderia pseudomallei 1655 ................................  322  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia pseudom
. . Burkholderia multivorans ATCC 17616 ...........................  322  8 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Bermanella marisrubri .........................................  322  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Oceanobacter sp. RED65] >g
. . Burkholderia sp. CCGE1001 .....................................  322  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Brevundimonas subvibrioides ATCC 15264 ........................  322  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Brevundimonas subvib
. . Dinoroseobacter shibae DFL 12 .................................  321  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Dinoroseobacter shib
. . Laribacter hongkongensis HLHK9 ................................  321  2 hits [b-proteobacteria]    Probable acyl-CoA dehydrogenase [Laribacter hongkongensis H
. . Burkholderia graminis C4D1M ...................................  321  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia gramini
. . Sinorhizobium meliloti 1021 ...................................  321  4 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase protein [Sinorhizobium meli
. . Polaromonas naphthalenivorans CJ2 .............................  321  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Polaromon
. . Rhodopseudomonas palustris BisA53 .............................  321  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodopseu
. . Colwellia psychrerythraea 34H .................................  320  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Colwellia psychreryt
. . Erythrobacter sp. NAP1 ........................................  320  4 hits [a-proteobacteria]    putative acyl-coa dehydrogenase protein [Erythrobacter sp. 
. . Pseudomonas aeruginosa UCBPP-PA14 .............................  320  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa UCB
. . Comamonas testosteroni CNB-2 ..................................  320  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like protein [Comamonas testosteroni
. . Pseudomonas fluorescens SBW25 .................................  320  4 hits [g-proteobacteria]    putative dehydrogenase [Pseudomonas fluorescens SBW25] >gi|
. . Pseudomonas aeruginosa PA7 ....................................  320  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PA7
. . Ochrobactrum intermedium LMG 3301 .............................  320  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Ochrobact
. . alpha proteobacterium BAL199 ..................................  320  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [alpha proteobacterium BAL199] >gi|1
. . Ochrobactrum anthropi ATCC 49188 ..............................  320  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Ochrobact
. . Rhodoferax ferrireducens T118 .................................  320  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodoferax ferrireducens T118]
. . Burkholderia glumae BGR1 ......................................  319  2 hits [b-proteobacteria]    Acyl-CoA dehydrogenase-like protein [Burkholderia glumae BG
. . Agrobacterium vitis S4 ........................................  319  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Agrobacterium vitis S4] >gi|2217344
. . Burkholderia phytofirmans PsJN ................................  319  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia phytofi
. . Sinorhizobium medicae WSM419 ..................................  319  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Sinorhizo
. . Pseudomonas aeruginosa PAO1 ...................................  319  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Pseudomonas aeruginosa PACS2 ..................................  319  4 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Pseudomonas aeruginosa LESB58 .................................  319  8 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Pseudomonas aeruginosa PAO
. . Pseudomonas aeruginosa C3719 ..................................  319  6 hits [g-proteobacteria]    hypothetical protein PACG_03331 [Pseudomonas aeruginosa C37
. . Pseudomonas aeruginosa 2192 ...................................  319  8 hits [g-proteobacteria]    hypothetical protein PACG_03331 [Pseudomonas aeruginosa C37
. . Pseudomonas putida W619 .......................................  319  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Bradyrhizobium japonicum USDA 110 .............................  319  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Bradyrhizobium japonicum USDA 110] 
. . Burkholderia thailandensis MSMB43 .............................  318  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia thailan
. . Pseudomonas putida GB-1 .......................................  318  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Caulobacter crescentus CB15 ...................................  318  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Caulobacter crescent
. . Caulobacter crescentus NA1000 .................................  318  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Caulobacter crescent
. . Pseudomonas putida KT2440 .....................................  318  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Pseudomonas putida F1 .........................................  318  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Shewanella frigidimarina NCIMB 400 ............................  318  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . Methylibium petroleiphilum PM1 ................................  318  2 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Met
. . Chromobacterium violaceum ATCC 12472 ..........................  318  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Chromobacterium violaceum ATCC 1247
. . Octadecabacter antarcticus 307 ................................  318  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Octadeca
. . Polynucleobacter necessarius subsp. necessarius STIR1 .........  318  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Polynucleobacter nec
. . Polaromonas sp. JS666 .........................................  318  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase-like [Polaromonas sp. JS666] >gi|916
. . Pseudomonas fluorescens Pf-5 ..................................  318  6 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas fluoresc
. . Rhodopseudomonas palustris BisB5 ..............................  318  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . Sphingopyxis alaskensis RB2256 ................................  318  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like protein [Sphingopyxis alaskensi
. . Brucella sp. 83/13 ............................................  317  6 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Brucella sp. 83/13] >gi|265983568|r
. . Pseudomonas fluorescens .......................................  317  3 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas fluoresc
. . Roseobacter denitrificans OCh 114 .............................  317  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter denitrif
. . Pseudomonas syringae pv. syringae B728a .......................  317  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . Pseudomonas fluorescens Pf0-1 .................................  317  6 hits [g-proteobacteria]    Acyl-CoA dehydrogenase-like [Pseudomonas fluorescens Pf0-1]
. . Acinetobacter lwoffii SH145 ...................................  317  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter lwoffii SH145] >gi|26
. . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ......  317  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Candidatus Accumulib
. . Acinetobacter sp. ATCC 27244 ..................................  317  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. ATCC 27244] >gi|2
. . Leptothrix cholodnii SP-6 .....................................  317  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Leptothri
. . Pseudomonas syringae pv. aesculi str. NCPPB3681 ...............  316  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Citreicella sp. SE45 ..........................................  316  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Citreicella sp. SE45
. . Rhodospirillum centenum SW ....................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase, putative [Rhodospirillum centenum S
. . Comamonas testosteroni KF-1 ...................................  316  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Comamonas testostero
. . Pseudomonas entomophila L48 ...................................  316  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Pseudomonas entomophila L48] >gi|95
. . Marinomonas sp. MED121 ........................................  316  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Marinomonas sp. MED121] >g
. . Idiomarina baltica OS145 ......................................  316  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase family protein [Idiomarina baltica O
. . Brucella ceti M490/95/1 .......................................  316  6 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Brucella ceti M490/95/1] >gi|256254
. . Brucella ceti B1/94 ...........................................  316  6 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Brucella ceti M490/95/1] >gi|256254
. . Brucella pinnipedialis M163/99/10 .............................  316  6 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Brucella pinnipedialis M163/99/10] 
. . Brucella suis bv. 5 str. 513 ..................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Brucella 
. . marine gamma proteobacterium HTCC2148 .........................  316  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [marine g
. . Brucella suis ATCC 23445 ......................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Brucella 
. . Roseovarius sp. TM1035 ........................................  316  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. TM10
. . Brucella ovis ATCC 25840 ......................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella ovis ATCC 2
. . Pseudomonas mendocina ymp .....................................  316  8 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Brucella suis 1330 ............................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella canis ATCC 23365 .....................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella suis bv. 3 str. 686 ..................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella suis bv. 4 str. 40 ...................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Brucella melitensis bv. 1 str. 16M ............................  316  8 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|225851
. . Brucella melitensis ATCC 23457 ................................  316  4 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|225851
. . Brucella melitensis bv. 1 str. Rev.1 ..........................  316  6 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|225851
. . Brucella melitensis bv. 3 str. Ether ..........................  316  6 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|225851
. . Brucella melitensis bv. 2 str. 63/9 ...........................  316  4 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella melitensis 16M] >gi|225851
. . Brucella abortus bv. 1 str. 9-941 .............................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella melitensis biovar Abortus 2308 .......................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus S19 ..........................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus str. 2308 A ..................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 6 str. 870 ...............................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 3 str. Tulya .............................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 2 str. 86/8/59 ...........................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella pinnipedialis B2/94 ..................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella ceti M644/93/1 .......................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella ceti M13/05/1 ........................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 4 str. 292 ...............................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella pinnipedialis M292/94/1 ..............................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus bv. 9 str. C68 ...............................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella microti CCM 4915 .....................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella sp. F5/99 ............................................  316  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella abortus NCTC 8038 ....................................  316  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella abortus bv.
. . Brucella sp. NVSL 07-0026 .....................................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Brucella sp. NVSL 07-0026] >gi|2948
. . Acidovorax avenae subsp. avenae ATCC 19860 ....................  315  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Acidovorax avenae su
. . Rhodobacterales bacterium Y4I .................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Caulobacter sp. K31 ...........................................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Caulobact
. . Oceanicaulis alexandrii HTCC2633 ..............................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicaulis alexand
. . Acidovorax citrulli AAC00-1 ...................................  315  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . Jannaschia sp. CCS1 ...........................................  315  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Jannaschia sp. CCS1] >gi|88865
. . Octadecabacter antarcticus 238 ................................  315  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Octadecabacter antarcticus 238] >gi
. . Variovorax paradoxus S110 .....................................  314  6 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Variovorax paradoxus
. . Roseobacter litoralis Och 149 .................................  314  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter litorali
. . Roseobacter sp. CCS2 ..........................................  314  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. CCS2
. . Mesorhizobium loti MAFF303099 .................................  314  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Mesorhizobium loti MAFF303099] >gi|
. . Brucella ceti str. Cudo .......................................  314  2 hits [a-proteobacteria]    acyl-COA dehydrogenase [Brucella ceti str. Cudo] >gi|225615
. . Phaeobacter gallaeciensis BS107 ...............................  314  6 hits [a-proteobacteria]    enoyl-CoA hydratase [Phaeobacter gallaeciensis BS107] >gi|1
. . Phaeobacter gallaeciensis 2.10 ................................  314  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Phaeobacter gallaeci
. . Pseudomonas syringae pv. phaseolicola 1448A ...................  314  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Brucella neotomae 5K33 ........................................  314  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Brucella suis 1330] 
. . Psychrobacter cryohalolentis K5 ...............................  314  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase-like [Psychrobacter cryohalolentis K
. . Pseudomonas syringae pv. aesculi str. 2250 ....................  313  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Curvibacter putative symbiont of Hydra magnipapillata .........  313  1 hit  [b-proteobacteria]    hypothetical protein [Curvibacter putative symbiont of Hydr
. . Pseudomonas syringae pv. tabaci ATCC 11528 ....................  313  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . gamma proteobacterium NOR5-3 ..................................  313  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [gamma proteobacteriu
. . Magnetospirillum gryphiswaldense MSR-1 ........................  313  1 hit  [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Magnetospirillum gry
. . Nitrobacter hamburgensis X14 ..................................  313  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Nitrobacter hamburgensis X14] 
. . Nitrobacter sp. Nb-311A .......................................  313  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Nitrobacter sp. Nb-311A] >gi|856956
. . Roseovarius sp. 217 ...........................................  313  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. 217]
. . Hyphomicrobium denitrificans ATCC 51888 .......................  313  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Hyphomicrobium denit
. . Acidovorax delafieldii 2AN ....................................  313  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Acidovorax delafield
. . Lutiella nitroferrum 2002 .....................................  313  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Lutiella nitroferrum
. . Burkholderia sp. CCGE1003 .....................................  313  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . Acinetobacter junii SH205 .....................................  313  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter junii SH205] >gi|2623
. . Marinomonas sp. MWYL1 .........................................  313  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Marinomon
. . Azotobacter vinelandii DJ .....................................  312  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Azotobacter vinelandii DJ] >gi|2267
. . Pseudomonas syringae pv. syringae FF5 .........................  311  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . Acinetobacter radioresistens SH164 ............................  311  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter radioresistens SH164]
. . Rhodobacteraceae bacterium KLH11 ..............................  311  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacteraceae bac
. . marine gamma proteobacterium HTCC2143 .........................  311  2 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [marine gamma proteobacteri
. . Sulfitobacter sp. NAS-14.1 ....................................  311  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sulfitobacter sp. NA
. . Beijerinckia indica subsp. indica ATCC 9039 ...................  311  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Beijerinc
. . Idiomarina loihiensis L2TR ....................................  311  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase family protein [Idiomarina loihiensi
. . Psychrobacter arcticus 273-4 ..................................  311  2 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Psychrobacter arcticus 273
. . Acinetobacter radioresistens SK82 .............................  311  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter radioresistens SK82] 
. . Ruegeria pomeroyi DSS-3 .......................................  311  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Ruegeria pomeroyi DS
. . Pseudomonas syringae pv. oryzae str. 1_6 ......................  310  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Anaeromyxobacter sp. Fw109-5 ..................................  310  2 hits [d-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Anaeromyx
. . Saccharophagus degradans 2-40 .................................  310  4 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase [Saccharophagus degradans 2
. . Mesorhizobium opportunistum WSM2075 ...........................  310  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Mesorhizobium opport
. . gamma proteobacterium NOR51-B .................................  310  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [gamma proteobacteriu
. . Sagittula stellata E-37 .......................................  310  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sagittula stellata E
. . Roseovarius sp. HTCC2601 ......................................  310  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius sp. HTCC
. . Psychrobacter sp. PRwf-1 ......................................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Psychroba
. . Congregibacter litoralis KT71 .................................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Congregibacter litoralis KT71] >gi|
. . Ruegeria sp. R11 ..............................................  310  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Ruegeria sp. R11] >g
. . Pseudomonas syringae pv. tomato T1 ............................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Roseobacter sp. AzwK-3b .......................................  310  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. AzwK
. . Pseudomonas syringae pv. tomato str. DC3000 ...................  310  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase family protein [Pseudomonas syringae
. . Sphingobium japonicum UT26S ...................................  309  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Sphingobium japonicum UT26S] >gi|29
. . Azospirillum sp. B510 .........................................  309  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Azospirillum sp. B510] >gi|28890965
. . Sulfitobacter sp. EE-36 .......................................  309  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Sulfitobacter sp. EE
. . Rhizobium etli GR56 ...........................................  309  1 hit  [a-proteobacteria]    probable acyl-CoA dehydrogenase protein [Rhizobium etli GR5
. . Nitrobacter winogradskyi Nb-255 ...............................  309  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Nitrobacter winogradskyi Nb-255] >g
. . Janthinobacterium sp. Marseille ...............................  308  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Janthinobacterium sp. Marseille] >g
. . Rhodospirillum rubrum ATCC 11170 ..............................  308  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Rhodospirillum rubrum ATCC 11170] >
. . Oceanibulbus indolifex HEL-45 .................................  308  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanibulbus indolif
. . marine gamma proteobacterium HTCC2080 .........................  308  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [marine gamma proteobacterium HTCC20
. . Alcanivorax borkumensis SK2 ...................................  308  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase, putative [Alcanivorax borkumensis S
. . Rhodobacterales bacterium HTCC2654 ............................  308  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Roseovarius nubinhibens ISM ...................................  308  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseovarius nubinhib
. . Herminiimonas arsenicoxydans ..................................  308  4 hits [b-proteobacteria]    putative acyl-CoA dehydrogenase [Herminiimonas arsenicoxyda
. . Oceanicola batsensis HTCC2597 .................................  308  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicola batsensis
. . Acinetobacter johnsonii SH046 .................................  307  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter johnsonii SH046] >gi|
. . Rhizobium etli IE4771 .........................................  307  1 hit  [a-proteobacteria]    probable acyl-CoA dehydrogenase protein [Rhizobium etli IE4
. . Burkholderia mallei GB8 horse 4 ...............................  307  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . Burkholderia mallei SAVP1 .....................................  307  4 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . Burkholderia mallei NCTC 10229 ................................  307  3 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Burkholderia mallei GB8 horse 4] >g
. . alpha proteobacterium IMCC1322 ................................  307  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [alpha proteobacterium IMCC1322] >gi
. . Achromobacter piechaudii ATCC 43553 ...........................  306  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase [Achromobacter piechaudii ATCC 43553
. . Brevundimonas sp. BAL3 ........................................  306  4 hits [a-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Brevundi
. . Sphingomonas wittichii RW1 ....................................  306  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Sphingomo
. . Deinococcus geothermalis DSM 11300 ............................  306  2 hits [bacteria]            acyl-CoA dehydrogenase-like protein [Deinococcus geothermal
. . Rhodomicrobium vannielii ATCC 17100 ...........................  306  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodomicrobium vanni
. . Fulvimarina pelagi HTCC2506 ...................................  306  2 hits [a-proteobacteria]    probable acyl-CoA dehydrogenase [Fulvimarina pelagi HTCC250
. . Oceanicola granulosus HTCC2516 ................................  306  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Oceanicola granulosu
. . Magnetospirillum magnetotacticum MS-1 .........................  306  2 hits [a-proteobacteria]    COG1960: Acyl-CoA dehydrogenases [Magnetospirillum magnetot
. . Eikenella corrodens ATCC 23834 ................................  306  2 hits [b-proteobacteria]    hypothetical protein EIKCOROL_01746 [Eikenella corrodens AT
. . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .  306  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Polynucle
. . Enhydrobacter aerosaccus SK60 .................................  305  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [Enhydrobacter aerosa
. . Phenylobacterium zucineum HLK1 ................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Phenylobacterium zuc
. . Maricaulis maris MCS10 ........................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Maricauli
. . Rhodobacter capsulatus SB1003 .................................  305  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . Silicibacter sp. TrichCH4B ....................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Silicibacter sp. Tri
. . Roseobacter sp. GAI101 ........................................  305  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Roseobacter sp. GAI101] >gi|2140436
. . Acinetobacter baumannii ACICU .................................  305  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii AB900 .................................  305  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii ATCC 19606 ............................  305  4 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter sp. 6014059 .....................................  305  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii ATCC 17978 ............................  305  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . Acinetobacter baumannii SDF ...................................  305  1 hit  [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii SDF] >gi|16
. . Acinetobacter baumannii .......................................  305  3 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii SDF] >gi|16
. . Acinetobacter baumannii AYE ...................................  305  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter baumannii AB0057 ................................  305  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter baumannii AB307-0294 ............................  305  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter sp. 6013113 .....................................  305  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Acinetobacter sp. 6013150 .....................................  305  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter baumannii AYE] >gi|21
. . Pseudoalteromonas atlantica T6c ...............................  304  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase-like [Pseudoalteromonas atlantica T6
. . Rhodobacter sphaeroides KD131 .................................  304  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase domain protein [Rhodobacter sphaeroi
. . Rhodobacterales bacterium HTCC2083 ............................  304  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Xanthobacter autotrophicus Py2 ................................  303  6 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Xanthobac
. . Deinococcus radiodurans R1 ....................................  303  2 hits [bacteria]            acyl-CoA dehydrogenase, putative [Deinococcus radiodurans R
. . Acinetobacter sp. ADP1 ........................................  303  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. ADP1] >gi|4952983
. . Acinetobacter sp. SH024 .......................................  303  6 hits [g-proteobacteria]    conserved hypothetical protein [Acinetobacter sp. SH024] >g
. . Acinetobacter sp. RUH2624 .....................................  303  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter sp. RUH2624] >gi|2604
. . Deinococcus deserti VCD115 ....................................  303  2 hits [bacteria]            putative acyl-CoA dehydrogenase [Deinococcus deserti VCD115
. . Alcanivorax sp. DG881 .........................................  303  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase, C-terminal domain protein [Alcanivo
. . Rhodobacter sphaeroides ATCC 17029 ............................  303  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . Acinetobacter haemolyticus ATCC 19194 .........................  302  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter haemolyticus ATCC 191
. . Limnobacter sp. MED105 ........................................  302  4 hits [b-proteobacteria]    Acyl-CoA dehydrogenase [Limnobacter sp. MED105] >gi|1498245
. . Paracoccus denitrificans PD1222 ...............................  302  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Paracoccu
. . Acinetobacter calcoaceticus RUH2202 ...........................  301  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Acinetobacter calcoaceticus RUH2202
. . Alteromonas macleodii ATCC 27126 ..............................  301  1 hit  [g-proteobacteria]    Acyl-CoA dehydrogenase [Alteromonas macleodii ATCC 27126]
. . Rhodobacter sphaeroides 2.4.1 .................................  301  2 hits [a-proteobacteria]    putative acyl-CoA dehydrogenase [Rhodobacter sphaeroides 2.
. . Loktanella vestfoldensis SKA53 ................................  301  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Loktanella vestfolde
. . Ruegeria sp. TM1040 ...........................................  301  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase-like [Ruegeria sp. TM1040] >gi|99037
. . Reinekea blandensis MED297 ....................................  301  4 hits [g-proteobacteria]    probable acyl-CoA dehydrogenase [Reinekea sp. MED297] >gi|8
. . Rhodobacter sphaeroides ATCC 17025 ............................  300  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . Thalassiobium sp. R2A62 .......................................  300  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Thalassiobium sp. R2
. . Neisseria sicca ATCC 29256 ....................................  299  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase family protein [Neisseria sicca ATCC
. . Shewanella halifaxensis HAW-EB4 ...............................  299  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . Verminephrobacter eiseniae EF01-2 .............................  299  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Vermineph
. . Stenotrophomonas maltophilia K279a ............................  299  2 hits [g-proteobacteria]    putative acyl-CoA dehydrogenase oxidoreductase protein [Ste
. . Magnetospirillum magneticum AMB-1 .............................  299  2 hits [a-proteobacteria]    Acyl-CoA dehydrogenase [Magnetospirillum magneticum AMB-1] 
. . Neisseria mucosa ATCC 25996 ...................................  298  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase family protein [Neisseria mucosa ATC
. . Halorhodospira halophila SL1 ..................................  298  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Halorhodo
. . Rhodobacterales bacterium HTCC2255 ............................  298  1 hit  [a-proteobacteria]    Acyl-CoA dehydrogenase-like protein [alpha proteobacterium 
. . Glaciecola sp. HTCC2999 .......................................  298  1 hit  [g-proteobacteria]    Acyl-CoA dehydrogenase-like protein [alpha proteobacterium 
. . Roseobacter sp. MED193 ........................................  298  4 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. MED1
. . Rhodobacter sp. SW2 ...........................................  297  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Rhodobacter sp. SW2]
. . Stenotrophomonas sp. SKA14 ....................................  297  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase [Stenotrophomonas sp. SKA14] >gi|219
. . Roseobacter sp. SK209-2-6 .....................................  297  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Roseobacter sp. SK20
. . Shewanella pealeana ATCC 700345 ...............................  297  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . Acidiphilium cryptum JF-5 .....................................  297  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Acidiphil
. . Alteromonas macleodii 'Deep ecotype' ..........................  296  2 hits [g-proteobacteria]    Acyl-CoA dehydrogenase [Alteromonas macleodii 'Deep ecotype
. . Methylocella silvestris BL2 ...................................  295  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase domain protein [Methylocella silvest
. . Burkholderia ubonensis Bu .....................................  295  1 hit  [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Burkholderia ubonens
. . Stenotrophomonas maltophilia R551-3 ...........................  295  2 hits [g-proteobacteria]    acyl-CoA dehydrogenase domain protein [Stenotrophomonas mal
. . Chromohalobacter salexigens DSM 3043 ..........................  295  4 hits [g-proteobacteria]    acyl-CoA dehydrogenase-like protein [Chromohalobacter salex
. . Burkholderia mallei ATCC 23344 ................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei NCTC 10247 ................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei PRL-20 ....................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei ATCC 10399 ................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei FMH .......................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Burkholderia mallei JHU .......................................  295  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . Azorhizobium caulinodans ORS 571 ..............................  295  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase [Azorhizobium caulinodans ORS 571] >
. . Thiomonas intermedia K12 ......................................  294  2 hits [b-proteobacteria]    acyl-CoA dehydrogenase domain protein [Thiomonas intermedia
. . Rhodobacterales bacterium HTCC2150 ............................  294  2 hits [a-proteobacteria]    acyl-CoA dehydrogenase family protein [Rhodobacterales bact
. . Desulfobacterium autotrophicum HRM2 ...........................  293  2 hits [d-proteobacteria]    Acd17 [Desulfobacterium autotrophicum HRM2] >gi|223694684|g
. Monosiga brevicollis MX1 ----------------------------------------  306  2 hits [choanoflagellates]   hypothetical protein [Monosiga brevicollis MX1] >gi|1637750

BLAST

PROTOCOL


a) BLASTp

BLASTp versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters


b) BLASTx

BLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters



RESULTS ANALYSIS

The e-values are all significants because all are E«10^(-2), that means there are known homologies. The minor E is 1e-139 for a score of 499. Being a probable acyl-CoA dehydrogenase with the lower E-value we concluded that this protein might have the same function. The homologies are found in 6-65aa of the orf, in the exterme amine.

RAW RESULTS

a) blastp

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01256117.1|  probable acyl-CoA dehydrogenase [Psychrofl...   499    1e-139
ref|YP_001412055.1|  acyl-CoA dehydrogenase domain-containing ...   353    1e-95 
ref|ZP_06229014.1|  acyl-CoA dehydrogenase domain protein [Bur...   350    1e-94 
ref|ZP_01017414.1|  probable acyl-CoA dehydrogenase [Parvularc...   350    1e-94 
ref|ZP_01165298.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   348    5e-94 
ref|ZP_03270334.1|  acyl-CoA dehydrogenase domain protein [Bur...   347    1e-93 
ref|YP_933206.1|  acyl-CoA dehydrogenase [Azoarcus sp. BH72] >...   346    2e-93 
ref|YP_760546.1|  acyl-CoA dehydrogenase family protein [Hypho...   346    2e-93 
ref|YP_296348.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   345    4e-93 
ref|YP_293528.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   343    1e-92 
ref|ZP_01862814.1|  putative acyl-CoA dehydrogenase protein [E...   342    2e-92 
ref|YP_002824722.1|  acyl-CoA dehydrogenase protein [Rhizobium...   342    3e-92 
ref|YP_002543346.1|  acyl-CoA dehydrogenase protein [Agrobacte...   342    4e-92 
ref|NP_353529.2|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   342    5e-92 
ref|YP_001989918.1|  acyl-CoA dehydrogenase domain protein [Rh...   341    8e-92 
ref|NP_946169.1|  putative acyl-CoA dehydrogenase [Rhodopseudo...   340    1e-91 
ref|ZP_02356525.1|  acyl-CoA dehydrogenase domain protein [Bur...   340    1e-91 
ref|YP_002500387.1|  acyl-CoA dehydrogenase domain protein [Me...   340    1e-91 
ref|ZP_01546756.1|  acyl-CoA dehydrogenase [Stappia aggregata ...   340    1e-91 
ref|YP_001117004.1|  acyl-CoA dehydrogenase domain-containing ...   340    1e-91 
ref|YP_001758385.1|  acyl-CoA dehydrogenase domain-containing ...   340    1e-91 
ref|ZP_06356599.1|  acyl-CoA dehydrogenase domain protein [Rho...   340    2e-91 
ref|ZP_02363647.1|  acyl-CoA dehydrogenase domain protein [Bur...   339    2e-91 
ref|YP_296753.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   338    4e-91 
ref|YP_559999.1|  putative acyl-CoA dehydrogenase [Burkholderi...   338    5e-91 
ref|YP_002897729.1|  acyl-CoA dehydrogenase [Burkholderia pseu...   338    6e-91 
ref|YP_109093.1|  putative acyl-CoA dehydrogenase [Burkholderi...   338    7e-91 
ref|YP_334354.1|  Acyl-CoA dehydrogenase [Burkholderia pseudom...   338    7e-91 
ref|YP_160743.1|  acyl-CoA dehydrogenase [Aromatoleum aromatic...   337    8e-91 
ref|ZP_02373945.1|  acyl-CoA dehydrogenase domain protein [Bur...   337    1e-90 
ref|YP_554917.1|  putative acyl-CoA dehydrogenase [Burkholderi...   337    1e-90 
ref|ZP_02893274.1|  acyl-CoA dehydrogenase domain protein [Bur...   337    2e-90 
ref|YP_442192.1|  acyl-CoA dehydrogenase domain-containing pro...   337    2e-90 
ref|YP_468102.1|  acyl-CoA dehydrogenase protein [Rhizobium et...   336    2e-90 
ref|YP_987025.1|  acyl-CoA dehydrogenase domain-containing pro...   336    2e-90 
ref|ZP_03270255.1|  acyl-CoA dehydrogenase domain protein [Bur...   336    2e-90 
ref|YP_002153992.1|  putative acyl-CoA dehydrogenase [Burkhold...   336    2e-90 
ref|ZP_02907250.1|  acyl-CoA dehydrogenase domain protein [Bur...   336    2e-90 
ref|YP_001774374.1|  acyl-CoA dehydrogenase domain-containing ...   336    3e-90 
ref|YP_621433.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   336    3e-90 
ref|ZP_04944096.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   335    3e-90 
ref|YP_002004838.1|  putative ACYL-COA DEHYDROGENASE OXIDOREDU...   335    3e-90 
ref|YP_497378.1|  acyl-CoA dehydrogenase-like [Novosphingobium...   335    3e-90 
ref|ZP_04887704.1|  acyl-CoA dehydrogenase domain protein [Bur...   335    3e-90 
ref|ZP_04948959.1|  Acyl-CoA dehydrogenase [Burkholderia dolos...   335    4e-90 
ref|YP_458068.1|  putative acyl-CoA dehydrogenase protein [Ery...   335    4e-90 
ref|YP_725331.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   335    4e-90 
ref|YP_366562.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   335    4e-90 
ref|ZP_01303435.1|  putative acyl-CoA dehydrogenase protein [S...   335    4e-90 
ref|YP_582894.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   335    5e-90 
ref|YP_368418.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   335    5e-90 
ref|ZP_01226619.1|  acyl-CoA dehydrogenase [Aurantimonas manga...   334    6e-90 
ref|ZP_05117417.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   334    7e-90 
ref|YP_002279739.1|  acyl-CoA dehydrogenase domain protein [Rh...   334    8e-90 
ref|YP_001815529.1|  acyl-CoA dehydrogenase domain-containing ...   334    8e-90 
ref|YP_002355900.1|  acyl-CoA dehydrogenase domain protein [Th...   334    9e-90 
ref|YP_001411742.1|  acyl-CoA dehydrogenase domain-containing ...   334    1e-89 
ref|YP_002964470.1|  acyl-CoA dehydrogenase [Methylobacterium ...   333    1e-89 
ref|YP_003069515.1|  acyl-CoA dehydrogenase [Methylobacterium ...   333    1e-89 
ref|ZP_02168376.1|  acyl-CoA dehydrogenase [Hoeflea phototroph...   333    1e-89 
ref|YP_002422317.1|  acyl-CoA dehydrogenase domain protein [Me...   333    1e-89 
ref|YP_777654.1|  acyl-CoA dehydrogenase domain-containing pro...   333    1e-89 
ref|YP_001174323.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   333    1e-89 
ref|YP_766200.1|  putative acyl-CoA dehydrogenase [Rhizobium l...   333    1e-89 
ref|ZP_02168120.1|  probable acyl-CoA dehydrogenase [Hoeflea p...   333    1e-89 
ref|YP_001976799.1|  acyl-CoA dehydrogenase protein [Rhizobium...   333    1e-89 
ref|YP_001896601.1|  acyl-CoA dehydrogenase domain protein [Bu...   333    2e-89 
ref|YP_001770117.1|  acyl-CoA dehydrogenase domain-containing ...   333    2e-89 
ref|YP_001640703.1|  acyl-CoA dehydrogenase domain-containing ...   333    2e-89 
ref|ZP_06224622.1|  acyl-CoA dehydrogenase domain protein [Bur...   333    2e-89 
ref|YP_001563416.1|  acyl-CoA dehydrogenase domain-containing ...   333    2e-89 
ref|YP_002974091.1|  acyl-CoA dehydrogenase domain protein [Rh...   333    2e-89 
ref|ZP_02189776.1|  acyl-CoA dehydrogenase [alpha proteobacter...   333    2e-89 
ref|ZP_01737947.1|  Acyl-CoA dehydrogenase [Marinobacter sp. E...   332    2e-89 
ref|YP_002289865.1|  acyl-CoA dehydrogenase [Oligotropha carbo...   332    3e-89 
ref|ZP_05085339.1|  acyl-CoA dehydrogenase family protein [Pse...   332    3e-89 
ref|YP_001926127.1|  acyl-CoA dehydrogenase domain protein [Me...   332    3e-89 
ref|YP_960011.1|  acyl-CoA dehydrogenase domain-containing pro...   332    4e-89 
ref|YP_001791568.1|  acyl-CoA dehydrogenase domain-containing ...   332    4e-89 
ref|ZP_01895244.1|  Acyl-CoA dehydrogenase [Marinobacter algic...   332    5e-89 
ref|YP_488200.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   332    5e-89 
ref|YP_003278934.1|  acyl-CoA dehydrogenase-like protein [Coma...   331    6e-89 
ref|YP_001208541.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   331    6e-89 
ref|ZP_02467714.1|  acyl-CoA dehydrogenase domain protein [Bur...   331    6e-89 
ref|ZP_01308202.1|  probable acyl-CoA dehydrogenase [Oceanobac...   331    7e-89 
ref|YP_002875101.1|  putative dehydrogenase [Pseudomonas fluor...   331    8e-89 
ref|ZP_03571578.1|  acyl-CoA dehydrogenase domain protein [Bur...   331    8e-89 
ref|YP_002255748.1|  acyl-coa dehydrogenase protein [Ralstonia...   330    1e-88 
ref|YP_002260115.1|  acyl-coa dehydrogenase protein [Ralstonia...   330    1e-88 
ref|YP_001236983.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   330    1e-88 
ref|YP_001532185.1|  acyl-CoA dehydrogenase domain protein [Di...   330    1e-88 
ref|YP_003059320.1|  acyl-CoA dehydrogenase domain protein [Hi...   330    1e-88 
ref|ZP_03588669.1|  acyl-CoA dehydrogenase domain protein [Bur...   330    2e-88 
ref|YP_001326179.1|  acyl-CoA dehydrogenase domain-containing ...   330    2e-88 
ref|NP_946311.1|  putative acyl-CoA dehydrogenase [Rhodopseudo...   329    2e-88 
ref|YP_001114835.1|  acyl-CoA dehydrogenase domain-containing ...   329    2e-88 
ref|YP_530627.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   329    2e-88 
ref|YP_002796897.1|  Probable acyl-CoA dehydrogenase [Laribact...   329    2e-88 
ref|NP_903486.1|  acyl-CoA dehydrogenase [Chromobacterium viol...   329    2e-88 
ref|YP_001666647.1|  acyl-CoA dehydrogenase domain-containing ...   329    2e-88 
ref|YP_840852.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   329    2e-88 
gb|ACT32396.1|  acyl-CoA dehydrogenase family protein [Pseudom...   329    3e-88 
ref|NP_742537.1|  acyl-CoA dehydrogenase domain-containing pro...   329    3e-88 
ref|YP_001265753.1|  acyl-CoA dehydrogenase domain-containing ...   329    3e-88 
ref|YP_788678.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   329    3e-88 
ref|YP_262742.1|  acyl-CoA dehydrogenase family protein [Pseud...   329    3e-88 
ref|YP_001990060.1|  acyl-CoA dehydrogenase domain protein [Rh...   329    3e-88 
ref|YP_001346004.1|  putative acyl-CoA dehydrogenase [Pseudomo...   329    3e-88 
ref|ZP_01228041.1|  acyl-CoA dehydrogenase [Aurantimonas manga...   329    3e-88 
ref|YP_350894.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   328    4e-88 
ref|ZP_00942866.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   328    4e-88 
ref|YP_001751677.1|  acyl-CoA dehydrogenase domain-containing ...   328    4e-88 
ref|YP_001020495.1|  putative acyl-CoA dehydrogenase oxidoredu...   328    4e-88 
ref|YP_549953.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   328    5e-88 
ref|YP_001585325.1|  acyl-CoA dehydrogenase domain-containing ...   328    5e-88 
ref|YP_237742.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   328    5e-88 
ref|NP_249199.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   328    6e-88 
ref|ZP_04679614.1|  acyl-CoA dehydrogenase domain-containing p...   328    6e-88 
ref|ZP_04930590.1|  hypothetical protein PACG_03331 [Pseudomon...   328    6e-88 
ref|ZP_05085247.1|  acyl-CoA dehydrogenase [Pseudovibrio sp. J...   328    7e-88 
ref|NP_384640.1|  putative acyl-CoA dehydrogenase protein [Sin...   327    7e-88 
ref|YP_001372566.1|  acyl-CoA dehydrogenase domain-containing ...   327    8e-88 
ref|ZP_03542503.1|  acyl-CoA dehydrogenase domain protein [Com...   327    8e-88 
ref|NP_767798.1|  acyl-CoA dehydrogenase [Bradyrhizobium japon...   327    9e-88 
ref|YP_001798027.1|  acyl-CoA dehydrogenase domain protein [Po...   327    9e-88 
ref|YP_283456.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   327    1e-87 
ref|ZP_05787012.1|  acyl-CoA dehydrogenase family protein [Sil...   327    1e-87 
ref|YP_001325840.1|  acyl-CoA dehydrogenase domain-containing ...   327    1e-87 
ref|YP_436458.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   327    1e-87 
ref|ZP_06464907.1|  acyl-CoA dehydrogenase domain protein [Bur...   327    1e-87 
ref|ZP_06457729.1|  acyl-CoA dehydrogenase domain-containing p...   327    1e-87 
ref|YP_267920.1|  acyl-CoA dehydrogenase family protein [Colwe...   327    2e-87 
ref|YP_983504.1|  acyl-CoA dehydrogenase domain-containing pro...   327    2e-87 
ref|NP_384981.1|  putative acyl-CoA dehydrogenase protein [Sin...   326    2e-87 
ref|YP_459508.1|  acyl-CoA dehydrogenase family protein [Eryth...   326    2e-87 
ref|YP_610525.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   326    2e-87 
ref|YP_750723.1|  acyl-CoA dehydrogenase domain-containing pro...   326    2e-87 
ref|ZP_05376718.1|  acyl-CoA dehydrogenase domain protein [Hyp...   326    2e-87 
ref|ZP_01546683.1|  putative acyl-coa dehydrogenase protein [S...   326    2e-87 
ref|ZP_01078586.1|  probable acyl-CoA dehydrogenase [Marinomon...   326    2e-87 
ref|NP_519046.1|  putative acyl-CoA dehydrogenase oxidoreducta...   326    3e-87 
ref|YP_616583.1|  acyl-CoA dehydrogenase-like protein [Sphingo...   326    3e-87 
ref|ZP_02147349.1|  enoyl-CoA hydratase [Phaeobacter gallaecie...   325    3e-87 
ref|YP_002548430.1|  acyl-CoA dehydrogenase [Agrobacterium vit...   325    3e-87 
ref|ZP_02149838.1|  acyl-CoA dehydrogenase family protein [Pha...   325    3e-87 
ref|YP_779610.1|  acyl-CoA dehydrogenase domain-containing pro...   325    3e-87 
ref|ZP_01039672.1|  putative acyl-coa dehydrogenase protein [E...   325    3e-87 
ref|ZP_04682674.1|  acyl-CoA dehydrogenase domain-containing p...   325    3e-87 
ref|YP_002297847.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   325    4e-87 
ref|YP_001380348.1|  acyl-CoA dehydrogenase domain-containing ...   325    4e-87 
ref|YP_001189558.1|  acyl-CoA dehydrogenase domain-containing ...   325    5e-87 
ref|YP_970522.1|  acyl-CoA dehydrogenase domain-containing pro...   325    5e-87 
ref|YP_001204263.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   325    6e-87 
ref|YP_001860106.1|  acyl-CoA dehydrogenase domain-containing ...   324    7e-87 
ref|ZP_05051234.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   324    7e-87 
ref|YP_001098947.1|  putative acyl-CoA dehydrogenase [Herminii...   324    7e-87 
ref|YP_567943.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   324    8e-87 
emb|CAM76992.1|  acyl-CoA dehydrogenase family protein [Magnet...   324    8e-87 
ref|YP_276814.1|  acyl-CoA dehydrogenase family protein [Pseud...   324    8e-87 
ref|YP_001856999.1|  acyl-CoA dehydrogenase domain-containing ...   324    8e-87 
ref|ZP_06481992.1|  acyl-CoA dehydrogenase domain-containing p...   324    9e-87 
emb|CBA33057.1|  hypothetical protein [Curvibacter putative sy...   324    9e-87 
ref|YP_003167561.1|  acyl-CoA dehydrogenase domain protein [Ca...   324    9e-87 
ref|YP_001352277.1|  acyl-CoA dehydrogenase [Janthinobacterium...   324    1e-86 
ref|YP_684109.1|  acyl-CoA dehydrogenase family protein [Roseo...   324    1e-86 
ref|YP_673288.1|  acyl-CoA dehydrogenase-like [Mesorhizobium s...   323    1e-86 
ref|ZP_05181906.1|  hypothetical protein Bru83_11263 [Brucella...   323    1e-86 
ref|YP_001238565.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   323    1e-86 
ref|ZP_05637108.1|  acyl-CoA dehydrogenase family protein [Pse...   323    2e-86 
ref|YP_002945255.1|  acyl-CoA dehydrogenase domain protein [Va...   323    2e-86 
ref|ZP_06211580.1|  acyl-CoA dehydrogenase domain protein [Aci...   323    2e-86 
ref|ZP_01043879.1|  Acyl-CoA dehydrogenase family protein [Idi...   323    2e-86 
ref|YP_002910784.1|  Acyl-CoA dehydrogenase-like protein [Burk...   323    2e-86 
ref|YP_002946160.1|  acyl-CoA dehydrogenase domain protein [Va...   322    2e-86 
ref|ZP_06495234.1|  acyl-CoA dehydrogenase domain-containing p...   322    3e-86 
ref|ZP_03787300.1|  acyl-COA dehydrogenase [Brucella ceti str....   322    3e-86 
ref|NP_699969.1|  acyl-CoA dehydrogenase family protein [Bruce...   322    3e-86 
ref|ZP_01017594.1|  acyl-CoA dehydrogenase [Parvularcula bermu...   322    3e-86 
ref|ZP_06068128.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   322    3e-86 
ref|ZP_02141954.1|  acyl-CoA dehydrogenase family protein [Ros...   322    4e-86 
ref|NP_541473.1|  acyl-COA dehydrogenase [Brucella melitensis ...   322    4e-86 
ref|YP_002734534.1|  acyl-CoA dehydrogenase domain protein [Br...   322    4e-86 
ref|YP_468443.1|  acyl-CoA dehydrogenase protein [Rhizobium et...   322    4e-86 
ref|ZP_04763262.1|  acyl-CoA dehydrogenase domain protein [Aci...   322    4e-86 
ref|YP_001898378.1|  acyl-CoA dehydrogenase domain protein [Ra...   322    4e-86 
ref|ZP_05782146.1|  acyl-CoA dehydrogenase domain protein [Cit...   322    4e-86 
ref|ZP_01895245.1|  Acyl-CoA dehydrogenase [Marinobacter algic...   322    4e-86 
ref|YP_436457.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   322    4e-86 
ref|YP_495410.1|  acyl-CoA dehydrogenase-like [Novosphingobium...   322    5e-86 
ref|ZP_01863592.1|  acyl-CoA dehydrogenase family protein [Ery...   322    5e-86 
ref|ZP_06293458.1|  acyl-CoA dehydrogenase domain protein [Bur...   322    5e-86 
ref|YP_223222.1|  acyl-CoA dehydrogenase family protein [Bruce...   322    5e-86 
ref|YP_001834319.1|  acyl-CoA dehydrogenase domain-containing ...   322    5e-86 
ref|YP_759397.1|  acyl-CoA dehydrogenase family protein [Hypho...   321    6e-86 
ref|ZP_01748988.1|  acyl-CoA dehydrogenase family protein [Ros...   321    6e-86 
ref|NP_769297.1|  acyl-CoA dehydrogenase [Bradyrhizobium japon...   321    6e-86 
ref|ZP_06358681.1|  acyl-CoA dehydrogenase domain protein [Rho...   321    6e-86 
ref|ZP_03824896.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   321    6e-86 
ref|YP_766577.1|  putative Acyl-CoA dehydrogenase [Rhizobium l...   321    6e-86 
ref|YP_523521.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   321    7e-86 
ref|ZP_05078653.1|  acyl-CoA dehydrogenase family protein [Rho...   321    7e-86 
ref|ZP_01878299.1|  acyl-CoA dehydrogenase family protein [Ros...   321    7e-86 
ref|YP_317256.1|  acyl-CoA dehydrogenase [Nitrobacter winograd...   321    7e-86 
ref|ZP_05067731.1|  acyl-CoA dehydrogenase [Octadecabacter ant...   321    8e-86 
ref|ZP_02884895.1|  acyl-CoA dehydrogenase domain protein [Bur...   320    1e-85 
ref|NP_790354.1|  acyl-CoA dehydrogenase family protein [Pseud...   320    1e-85 
ref|ZP_03395873.1|  acyl-CoA dehydrogenase family protein [Pse...   320    1e-85 
ref|YP_002280078.1|  acyl-CoA dehydrogenase domain protein [Rh...   320    1e-85 
ref|YP_001189560.1|  acyl-CoA dehydrogenase domain-containing ...   320    1e-85 
ref|ZP_05164959.1|  hypothetical protein Bsuib36_04187 [Brucel...   320    1e-85 
ref|YP_580715.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   320    1e-85 
ref|YP_002980839.1|  acyl-CoA dehydrogenase domain protein [Ra...   320    1e-85 
ref|ZP_05637106.1|  acyl-CoA dehydrogenase family protein [Pse...   320    2e-85 
ref|ZP_03696966.1|  acyl-CoA dehydrogenase domain protein [Lut...   320    2e-85 
ref|YP_510912.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   320    2e-85 
ref|ZP_03698726.1|  acyl-CoA dehydrogenase domain protein [Lut...   320    2e-85 
ref|NP_106251.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   320    2e-85 
ref|YP_002801677.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   319    2e-85 
ref|ZP_03523533.1|  probable acyl-CoA dehydrogenase protein [R...   319    2e-85 
ref|YP_672593.1|  acyl-CoA dehydrogenase-like [Mesorhizobium s...   319    2e-85 
ref|ZP_04958063.1|  acyl-CoA dehydrogenase domain protein [gam...   319    3e-85 
gb|EFF75911.1|  acyl-CoA dehydrogenase [Achromobacter piechaud...   319    3e-85 
ref|ZP_06122213.1|  acyl-CoA dehydrogenase domain protein [Cau...   319    3e-85 
ref|ZP_05096170.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   319    3e-85 
ref|ZP_06064964.1|  acyl-CoA dehydrogenase [Acinetobacter juni...   319    3e-85 
ref|YP_001977160.1|  probable acyl-CoA dehydrogenase protein [...   318    4e-85 
ref|YP_531038.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   318    4e-85 
ref|YP_001860109.1|  acyl-CoA dehydrogenase domain-containing ...   318    4e-85 
ref|ZP_01037196.1|  acyl-CoA dehydrogenase family protein [Ros...   318    4e-85 
ref|YP_001340434.1|  acyl-CoA dehydrogenase domain-containing ...   318    5e-85 
ref|YP_237746.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   318    5e-85 
ref|ZP_00948297.1|  acyl-CoA dehydrogenase family protein [Sul...   318    5e-85 
ref|ZP_01074271.1|  acyl-CoA dehydrogenase, putative [Marinomo...   318    5e-85 
ref|ZP_02147320.1|  enoyl-CoA hydratase [Phaeobacter gallaecie...   318    5e-85 
ref|YP_156344.1|  Acyl-CoA dehydrogenase family protein [Idiom...   318    6e-85 
ref|YP_002825039.1|  acyl-CoA dehydrogenase domain protein [Rh...   318    7e-85 
ref|ZP_01627175.1|  acyl-CoA dehydrogenase [marine gamma prote...   318    8e-85 
ref|YP_276816.1|  acyl-CoA dehydrogenase family protein [Pseud...   317    8e-85 
ref|ZP_03519484.1|  probable acyl-CoA dehydrogenase protein [R...   317    8e-85 
ref|YP_528601.1|  acyl-CoA dehydrogenase family protein [Sacch...   317    8e-85 
ref|YP_002129401.1|  acyl-CoA dehydrogenase family protein [Ph...   317    8e-85 
ref|YP_576121.1|  acyl-CoA dehydrogenase-like [Nitrobacter ham...   317    9e-85 
ref|YP_264252.1|  putative acyl-CoA dehydrogenase [Psychrobact...   317    1e-84 
ref|YP_488048.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   317    1e-84 
ref|ZP_01747810.1|  acyl-CoA dehydrogenase family protein [Sag...   317    1e-84 
ref|YP_001369088.1|  acyl-CoA dehydrogenase domain-containing ...   317    1e-84 
ref|YP_284774.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   317    1e-84 
ref|ZP_01439801.1|  probable acyl-CoA dehydrogenase [Fulvimari...   317    1e-84 
ref|ZP_06495237.1|  acyl-CoA dehydrogenase domain-containing p...   317    1e-84 
ref|ZP_01308203.1|  Acyl-CoA dehydrogenase [Oceanobacter sp. R...   317    2e-84 
ref|ZP_06074015.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   317    2e-84 
ref|YP_001279812.1|  acyl-CoA dehydrogenase domain-containing ...   317    2e-84 
ref|YP_002974443.1|  acyl-CoA dehydrogenase domain protein [Rh...   317    2e-84 
gb|ADE39423.1|  acyl-CoA dehydrogenase [alpha proteobacterium ...   316    2e-84 
ref|ZP_05121771.1|  acyl-CoA dehydrogenase family protein [Rho...   316    2e-84 
ref|ZP_01904469.1|  acyl-CoA dehydrogenase family protein [Ros...   316    2e-84 
ref|ZP_02151332.1|  acyl-CoA dehydrogenase family protein [Pha...   316    2e-84 
ref|YP_981461.1|  acyl-CoA dehydrogenase domain-containing pro...   316    2e-84 
ref|ZP_04590882.1|  acyl-CoA dehydrogenase family protein [Pse...   316    2e-84 
ref|YP_001751679.1|  acyl-CoA dehydrogenase domain-containing ...   316    2e-84 
ref|YP_001264280.1|  acyl-CoA dehydrogenase domain-containing ...   316    2e-84 
ref|ZP_06173413.1|  acyl-CoA dehydrogenase domain protein [Bre...   316    2e-84 
ref|YP_284441.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   316    2e-84 
ref|YP_168123.1|  acyl-CoA dehydrogenase family protein [Ruege...   316    2e-84 
ref|YP_001666645.1|  acyl-CoA dehydrogenase domain-containing ...   316    2e-84 
ref|ZP_05128211.1|  acyl-CoA dehydrogenase domain protein [gam...   316    2e-84 
ref|ZP_04590885.1|  acyl-CoA dehydrogenase family protein [Pse...   316    2e-84 
ref|ZP_01737946.1|  acyl-CoA dehydrogenase family protein [Mar...   316    3e-84 
ref|YP_003058830.1|  acyl-CoA dehydrogenase domain protein [Hi...   316    3e-84 
ref|YP_001267983.1|  acyl-CoA dehydrogenase domain-containing ...   316    3e-84 
ref|YP_262745.1|  acyl-CoA dehydrogenase family protein [Pseud...   315    3e-84 
ref|ZP_05360616.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   315    3e-84 
ref|ZP_00441648.1|  acyl-CoA dehydrogenase [Burkholderia malle...   315    3e-84 
ref|ZP_00953752.1|  acyl-CoA dehydrogenase family protein [Sul...   315    3e-84 
dbj|BAI95803.1|  acyl-CoA dehydrogenase [Sphingobium japonicum...   315    4e-84 
ref|ZP_05180403.1|  Acyl-CoA dehydrogenase [Brucella sp. 83/13...   315    4e-84 
ref|YP_001346285.1|  putative acyl-CoA dehydrogenase [Pseudomo...   315    4e-84 
ref|ZP_01367634.1|  hypothetical protein PaerPA_01004787 [Pseu...   315    4e-84 
ref|ZP_01915344.1|  putative acyl-coa dehydrogenase oxidoreduc...   315    4e-84 
ref|ZP_04936202.1|  hypothetical protein PA2G_03650 [Pseudomon...   315    4e-84 
ref|NP_790349.1|  acyl-CoA dehydrogenase family protein [Pseud...   315    4e-84 
ref|ZP_01445402.1|  acyl-CoA dehydrogenase family protein [Ros...   315    4e-84 
ref|ZP_05810173.1|  acyl-CoA dehydrogenase domain protein [Mes...   315    4e-84 
ref|ZP_03395876.1|  acyl-CoA dehydrogenase family protein [Pse...   315    5e-84 
ref|NP_742535.1|  acyl-CoA dehydrogenase domain-containing pro...   315    5e-84 
ref|NP_252888.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   315    5e-84 
ref|ZP_00997794.1|  acyl-CoA dehydrogenase family protein [Oce...   315    5e-84 
ref|YP_571416.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   315    5e-84 
ref|YP_350898.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   315    5e-84 
ref|ZP_05089946.1|  acyl-CoA dehydrogenase family protein [Rue...   315    5e-84 
ref|YP_527357.1|  putative acyl-CoA dehydrogenase [Saccharopha...   315    5e-84 
ref|ZP_02153139.1|  acyl-CoA dehydrogenase family protein [Oce...   315    5e-84 
ref|YP_960012.1|  acyl-CoA dehydrogenase domain-containing pro...   315    6e-84 
ref|ZP_02143501.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   315    6e-84 
ref|ZP_00958569.1|  acyl-CoA dehydrogenase family protein [Ros...   314    8e-84 
ref|ZP_00051081.2|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   314    8e-84 
ref|ZP_01048481.1|  acyl-CoA dehydrogenase [Nitrobacter sp. Nb...   314    8e-84 
ref|YP_425527.1|  Acyl-CoA dehydrogenase [Rhodospirillum rubru...   314    8e-84 
ref|ZP_00948404.1|  acyl-CoA dehydrogenase family protein [Sul...   314    9e-84 
ref|YP_002498095.1|  acyl-CoA dehydrogenase domain protein [Me...   314    1e-83 
ref|ZP_00957741.1|  acyl-CoA dehydrogenase family protein [Oce...   314    1e-83 
ref|NP_697443.1|  acyl-CoA dehydrogenase family protein [Bruce...   314    1e-83 
ref|YP_001669038.1|  acyl-CoA dehydrogenase domain-containing ...   314    1e-83 
ref|NP_107765.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   314    1e-83 
ref|YP_221192.1|  acyl-CoA dehydrogenase family protein [Bruce...   314    1e-83 
ref|ZP_00953859.1|  acyl-CoA dehydrogenase family protein [Sul...   313    1e-83 
ref|YP_003447686.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   313    1e-83 
ref|ZP_01011706.1|  acyl-CoA dehydrogenase family protein [Rho...   313    1e-83 
ref|YP_002875104.1|  putative dehydrogenase [Pseudomonas fluor...   313    1e-83 
ref|NP_540438.1|  acyl-COA dehydrogenase [Brucella melitensis ...   313    1e-83 
ref|NP_353756.1|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   313    1e-83 
ref|ZP_05163047.1|  acyl-CoA dehydrogenase domain-containing p...   313    1e-83 
ref|YP_001627098.1|  acyl-CoA dehydrogenase domain-containing ...   313    1e-83 
ref|ZP_05456939.1|  Acyl-CoA dehydrogenase [Brucella ceti M490...   313    1e-83 
ref|NP_418899.1|  acyl-CoA dehydrogenase family protein [Caulo...   313    1e-83 
ref|YP_001258435.1|  acyl-CoA dehydrogenase family protein [Br...   313    1e-83 
ref|YP_610527.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   313    2e-83 
ref|YP_350895.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   313    2e-83 
ref|ZP_05169684.1|  Acyl-CoA dehydrogenase [Brucella pinnipedi...   313    2e-83 
ref|YP_002552051.1|  acyl-CoA dehydrogenase domain protein [Ac...   313    2e-83 
ref|ZP_06064371.1|  acyl-CoA dehydrogenase [Acinetobacter john...   312    3e-83 
ref|YP_996859.1|  acyl-CoA dehydrogenase domain-containing pro...   312    3e-83 
ref|ZP_01102887.1|  acyl-CoA dehydrogenase [Congregibacter lit...   312    3e-83 
ref|YP_001346001.1|  putative acyl-CoA dehydrogenase [Pseudomo...   312    4e-83 
ref|NP_249197.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   312    4e-83 
ref|YP_002438111.1|  putative acyl-CoA dehydrogenase [Pseudomo...   312    4e-83 
ref|YP_426396.1|  Acyl-CoA dehydrogenase [Rhodospirillum rubru...   312    4e-83 
ref|YP_421997.1|  Acyl-CoA dehydrogenase [Magnetospirillum mag...   312    4e-83 
ref|ZP_05808586.1|  acyl-CoA dehydrogenase domain protein [Mes...   311    4e-83 
ref|YP_780008.1|  acyl-CoA dehydrogenase domain-containing pro...   311    4e-83 
ref|ZP_05033264.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   311    5e-83 
ref|YP_001769262.1|  acyl-CoA dehydrogenase domain-containing ...   311    5e-83 
ref|XP_001921960.1|  PREDICTED: similar to predicted protein [...   311    6e-83 
ref|YP_693822.1|  acyl-CoA dehydrogenase, putative [Alcanivora...   311    6e-83 
ref|ZP_05450716.1|  Acyl-CoA dehydrogenase [Brucella neotomae ...   311    6e-83 
ref|YP_001174325.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   311    6e-83 
ref|YP_002548702.1|  acyl-CoA dehydrogenase [Agrobacterium vit...   311    6e-83 
ref|YP_984915.1|  acyl-CoA dehydrogenase domain-containing pro...   311    7e-83 
ref|ZP_01040855.1|  acyl-CoA dehydrogenase family protein [Ery...   311    7e-83 
ref|YP_262743.1|  acyl-CoA dehydrogenase family protein [Pseud...   311    7e-83 
ref|YP_661490.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   311    8e-83 
ref|ZP_05093505.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   311    8e-83 
ref|YP_002543620.1|  acyl-CoA dehydrogenase protein [Agrobacte...   311    9e-83 
ref|ZP_05099960.1|  acyl-CoA dehydrogenase [Roseobacter sp. GA...   311    9e-83 
ref|YP_003449788.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   310    1e-82 
ref|ZP_05098706.1|  acyl-CoA dehydrogenase family protein [Ros...   310    1e-82 
ref|ZP_06170995.1|  acyl-CoA dehydrogenase domain protein [Bre...   310    1e-82 
ref|ZP_01114450.1|  probable acyl-CoA dehydrogenase [Reinekea ...   310    1e-82 
ref|YP_001792615.1|  acyl-CoA dehydrogenase domain-containing ...   310    1e-82 
ref|ZP_05740441.1|  acyl-CoA dehydrogenase family protein [Sil...   310    1e-82 
ref|YP_001706189.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   310    2e-82 
ref|YP_001712567.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   310    2e-82 
ref|ZP_04714600.1|  Acyl-CoA dehydrogenase [Alteromonas macleo...   310    2e-82 
ref|YP_001847792.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   310    2e-82 
ref|ZP_05127280.1|  acyl-CoA dehydrogenase [gamma proteobacter...   310    2e-82 
ref|YP_294672.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   310    2e-82 
ref|YP_001085894.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   310    2e-82 
ref|YP_511836.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   310    2e-82 
ref|ZP_05620312.1|  acyl-CoA dehydrogenase domain protein [Enh...   310    2e-82 
ref|YP_001346002.1|  putative acyl-CoA dehydrogenase [Pseudomo...   310    2e-82 
ref|YP_002942729.1|  acyl-CoA dehydrogenase domain protein [Va...   310    2e-82 
ref|YP_523215.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   310    2e-82 
ref|YP_582540.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   309    2e-82 
ref|YP_002798926.1|  Acyl-CoA dehydrogenase [Azotobacter vinel...   309    2e-82 
ref|XP_001746745.1|  hypothetical protein [Monosiga brevicolli...   309    2e-82 
ref|ZP_05076742.1|  acyl-CoA dehydrogenase family protein [Rho...   309    3e-82 
ref|ZP_01914910.1|  Acyl-CoA dehydrogenase [Limnobacter sp. ME...   309    3e-82 
ref|YP_271124.1|  acyl-CoA dehydrogenase family protein [Colwe...   309    3e-82 
ref|ZP_01001773.1|  acyl-CoA dehydrogenase family protein [Lok...   309    3e-82 
ref|YP_002524876.1|  Acyl-CoA dehydrogenase domain protein [Rh...   309    3e-82 
ref|YP_045367.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   309    4e-82 
ref|ZP_00953065.1|  acyl-CoA dehydrogenase family protein [Oce...   308    4e-82 
gb|ACT32397.1|  acyl-CoA dehydrogenase family protein [Pseudom...   308    4e-82 
ref|YP_001003062.1|  acyl-CoA dehydrogenase domain-containing ...   308    4e-82 
ref|ZP_01165131.1|  acyl-CoA dehydrogenase [Oceanospirillum sp...   308    4e-82 
ref|YP_916648.1|  acyl-CoA dehydrogenase domain-containing pro...   308    4e-82 
ref|YP_001189299.1|  acyl-CoA dehydrogenase domain-containing ...   308    4e-82 
ref|YP_002298155.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   308    6e-82 
ref|ZP_05826026.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   308    6e-82 
ref|ZP_01101836.1|  acyl-CoA dehydrogenase [Congregibacter lit...   308    6e-82 
ref|ZP_03541155.1|  acyl-CoA dehydrogenase domain protein [Com...   308    6e-82 
ref|YP_001155298.1|  acyl-CoA dehydrogenase domain-containing ...   308    7e-82 
ref|NP_518594.1|  putative acyl-CoA dehydrogenase oxidoreducta...   308    7e-82 
gb|EFF85104.1|  conserved hypothetical protein [Acinetobacter ...   308    7e-82 
ref|ZP_05823033.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   308    8e-82 
ref|YP_168992.1|  acyl-CoA dehydrogenase family protein [Ruege...   307    9e-82 
ref|ZP_06058874.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   307    9e-82 
ref|YP_001042757.1|  acyl-CoA dehydrogenase domain-containing ...   307    9e-82 
ref|YP_002362049.1|  acyl-CoA dehydrogenase domain protein [Me...   307    1e-81 
ref|ZP_04601943.1|  hypothetical protein GCWU000324_01417 [Kin...   307    1e-81 
ref|YP_293249.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   307    1e-81 
gb|EFF81582.1|  acyl-CoA dehydrogenase [Acinetobacter haemolyt...   307    1e-81 
ref|ZP_01616720.1|  probable acyl-CoA dehydrogenase [marine ga...   307    1e-81 
ref|YP_001120653.1|  acyl-CoA dehydrogenase domain-containing ...   307    1e-81 
ref|ZP_04662955.1|  Acyl-CoA dehydrogenase [Acinetobacter baum...   307    1e-81 
ref|YP_001846062.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   307    1e-81 
ref|YP_001714135.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   307    1e-81 
ref|ZP_04761509.1|  acyl-CoA dehydrogenase domain protein [Aci...   306    1e-81 
ref|YP_001261971.1|  acyl-CoA dehydrogenase domain-containing ...   306    2e-81 
ref|YP_001795793.1|  putative ACYL-COA DEHYDROGENASE OXIDOREDU...   306    2e-81 
ref|ZP_01450172.1|  Acyl-CoA dehydrogenase-like protein [alpha...   306    2e-81 
ref|ZP_01114449.1|  acyl-CoA dehydrogenase, putative [Reinekea...   306    2e-81 
ref|YP_621983.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   306    2e-81 
ref|ZP_04940567.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   306    2e-81 
ref|NP_422187.1|  acyl-CoA dehydrogenase family protein [Caulo...   306    2e-81 
ref|YP_788677.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   306    2e-81 
ref|YP_352255.1|  putative acyl-CoA dehydrogenase [Rhodobacter...   306    2e-81 
ref|ZP_01156949.1|  acyl-CoA dehydrogenase family protein [Oce...   306    2e-81 
ref|ZP_06350780.1|  acyl-CoA dehydrogenase domain protein [Rho...   306    2e-81 
ref|ZP_06123153.1|  acyl-CoA dehydrogenase domain protein [Cau...   306    3e-81 
ref|ZP_05043584.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   306    3e-81 
gb|EFF87395.1|  conserved hypothetical protein [Acinetobacter ...   306    3e-81 
gb|AAP92447.1|  putative acyl-CoA dehydrogenase [Pseudomonas f...   306    3e-81 
ref|ZP_05842559.1|  acyl-CoA dehydrogenase domain protein [Rho...   306    3e-81 
ref|ZP_05317317.1|  acyl-CoA dehydrogenase family protein [Nei...   306    3e-81 
ref|ZP_04930591.1|  hypothetical protein PACG_03332 [Pseudomon...   306    3e-81 
ref|NP_249198.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   306    3e-81 
ref|ZP_05827632.1|  acyl-CoA dehydrogenase [Acinetobacter baum...   305    3e-81 
ref|YP_001681767.1|  acyl-CoA dehydrogenase domain-containing ...   305    3e-81 
ref|YP_001418152.1|  acyl-CoA dehydrogenase domain-containing ...   305    3e-81 
ref|YP_002126606.1|  Acyl-CoA dehydrogenase [Alteromonas macle...   305    3e-81 
ref|YP_002423176.1|  acyl-CoA dehydrogenase domain protein [Me...   305    4e-81 
ref|YP_724978.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   305    4e-81 
ref|YP_613552.1|  acyl-CoA dehydrogenase-like [Ruegeria sp. TM...   305    4e-81 
ref|ZP_04771849.1|  acyl-CoA dehydrogenase domain protein [Ast...   305    5e-81 
ref|YP_001641545.1|  acyl-CoA dehydrogenase domain-containing ...   305    5e-81 
ref|YP_432962.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   305    5e-81 
ref|YP_001168487.1|  acyl-CoA dehydrogenase domain-containing ...   305    5e-81 
ref|NP_879764.1|  acyl-CoA dehydrogenase [Bordetella pertussis...   305    5e-81 
ref|YP_002965402.1|  acyl-CoA dehydrogenase [Methylobacterium ...   305    5e-81 
ref|YP_002256310.1|  acyl-coa dehydrogenase protein [Ralstonia...   305    5e-81 
ref|YP_001973073.1|  putative acyl-CoA dehydrogenase oxidoredu...   305    6e-81 
ref|ZP_05977215.1|  acyl-CoA dehydrogenase family protein [Nei...   305    7e-81 
ref|ZP_00054520.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   305    7e-81 
ref|ZP_04944760.1|  Acyl-CoA dehydrogenase [Burkholderia dolos...   304    7e-81 
ref|YP_001578770.1|  acyl-CoA dehydrogenase domain-containing ...   304    7e-81 
ref|YP_550749.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   304    8e-81 
ref|YP_972404.1|  acyl-CoA dehydrogenase domain-containing pro...   304    8e-81 
ref|YP_002889467.1|  acyl-CoA dehydrogenase domain protein [Th...   304    8e-81 
ref|YP_001630510.1|  acyl-CoA dehydrogenase [Bordetella petrii...   304    9e-81 
ref|YP_002980341.1|  acyl-CoA dehydrogenase domain protein [Ra...   304    9e-81 
ref|ZP_05112296.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   304    1e-80 
ref|YP_001354781.1|  acyl-CoA dehydrogenase oxidoreductase pro...   304    1e-80 
ref|ZP_05620313.1|  acyl-CoA dehydrogenase domain protein [Enh...   304    1e-80 
ref|ZP_06211968.1|  acyl-CoA dehydrogenase domain protein [Aci...   304    1e-80 
ref|YP_001101073.1|  acyl-CoA dehydrogenase [Herminiimonas ars...   304    1e-80 
ref|YP_001341117.1|  acyl-CoA dehydrogenase domain-containing ...   304    1e-80 
ref|YP_001897938.1|  acyl-CoA dehydrogenase domain protein [Ra...   304    1e-80 
ref|YP_001809332.1|  acyl-CoA dehydrogenase domain-containing ...   303    1e-80 
ref|NP_296082.1|  acyl-CoA dehydrogenase, putative [Deinococcu...   303    1e-80 
ref|YP_785889.1|  acyl-CoA dehydrogenase [Bordetella avium 197...   303    1e-80 
ref|YP_001525890.1|  acyl-CoA dehydrogenase [Azorhizobium caul...   303    2e-80 
ref|ZP_00943677.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   303    2e-80 
ref|YP_370286.1|  Acyl-CoA dehydrogenase-like [Burkholderia sp...   303    2e-80 
ref|YP_001927218.1|  acyl-CoA dehydrogenase domain protein [Me...   303    2e-80 
ref|YP_001832873.1|  acyl-CoA dehydrogenase domain-containing ...   303    2e-80 
ref|ZP_05135777.1|  acyl-CoA dehydrogenase [Stenotrophomonas s...   303    2e-80 
ref|NP_885292.1|  acyl-CoA dehydrogenase [Bordetella parapertu...   303    2e-80 
ref|ZP_05361899.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   303    2e-80 
ref|YP_001233155.1|  acyl-CoA dehydrogenase domain-containing ...   303    2e-80 
ref|YP_603577.1|  acyl-CoA dehydrogenase-like protein [Deinoco...   303    2e-80 
ref|ZP_02377873.1|  acyl-CoA dehydrogenase domain protein [Bur...   303    2e-80 
ref|ZP_01055953.1|  acyl-CoA dehydrogenase family protein [Ros...   303    2e-80 
ref|ZP_02906522.1|  acyl-CoA dehydrogenase domain protein [Bur...   303    3e-80 
ref|ZP_01756420.1|  acyl-CoA dehydrogenase family protein [Ros...   302    3e-80 
ref|YP_045366.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   302    3e-80 
ref|YP_102032.1|  acyl-CoA dehydrogenase domain-containing pro...   302    3e-80 
ref|ZP_01166352.1|  probable acyl-CoA dehydrogenase [Oceanospi...   302    4e-80 
ref|NP_107374.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   302    4e-80 
ref|YP_002875102.1|  putative dehydrogenase [Pseudomonas fluor...   302    4e-80 
gb|EFF85501.1|  conserved hypothetical protein [Acinetobacter ...   301    4e-80 
ref|YP_003070526.1|  acyl-CoA dehydrogenase [Methylobacterium ...   301    5e-80 
ref|YP_003280248.1|  acyl-CoA dehydrogenase-like protein [Coma...   301    6e-80 
ref|ZP_06466574.1|  putative acyl-CoA dehydrogenase oxidoreduc...   301    6e-80 
ref|YP_001856624.1|  acyl-CoA dehydrogenase domain-containing ...   301    7e-80 
ref|YP_002029160.1|  acyl-CoA dehydrogenase domain protein [St...   301    7e-80 
ref|ZP_05360615.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   301    7e-80 
ref|ZP_01450104.1|  Acyl-CoA dehydrogenase [alpha proteobacter...   301    7e-80 
ref|YP_001686107.1|  acyl-CoA dehydrogenase domain-containing ...   301    7e-80 
ref|YP_001419323.1|  acyl-CoA dehydrogenase domain-containing ...   301    7e-80 
ref|ZP_02890241.1|  acyl-CoA dehydrogenase domain protein [Bur...   301    8e-80 
ref|ZP_01165099.1|  acyl-CoA dehydrogenase, putative [Oceanosp...   301    8e-80 
ref|YP_001894309.1|  acyl-CoA dehydrogenase domain protein [Bu...   301    9e-80 
ref|ZP_06074014.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   301    1e-79 
ref|ZP_01750389.1|  acyl-CoA dehydrogenase-like protein [Roseo...   300    1e-79 
ref|YP_003451886.1|  acyl-CoA dehydrogenase domain protein [Az...   300    1e-79 
ref|ZP_06296520.1|  acyl-CoA dehydrogenase domain protein [Bur...   300    1e-79 
ref|YP_441121.1|  acyl-CoA dehydrogenase domain-containing pro...   300    1e-79 
ref|YP_107277.1|  putative acyl-CoA dehydrogenase oxidoreducta...   300    1e-79 
ref|YP_756066.1|  acyl-CoA dehydrogenase domain-containing pro...   300    1e-79 
ref|ZP_03714050.1|  hypothetical protein EIKCOROL_01746 [Eiken...   300    1e-79 
ref|ZP_01054488.1|  probable acyl-CoA dehydrogenase [Roseobact...   300    1e-79 
ref|ZP_04963648.1|  acyl-CoA dehydrogenase domain protein [Bur...   300    1e-79 
ref|ZP_06223443.1|  putative acyl-CoA dehydrogenase oxidoreduc...   300    1e-79 
ref|NP_745691.1|  acyl-CoA dehydrogenase domain-containing pro...   300    1e-79 
gb|AAL03980.1|  acyl-CoA dehydrogenase [Azospirillum brasilense]    300    2e-79 
ref|ZP_03824897.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   300    2e-79 
ref|ZP_02386577.1|  acyl-CoA dehydrogenase domain protein [Bur...   300    2e-79 
ref|ZP_06056488.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   300    2e-79 
ref|ZP_01627384.1|  putative acyl-CoA dehydrogenase [marine ga...   300    2e-79 
ref|YP_001750207.1|  acyl-CoA dehydrogenase domain-containing ...   300    2e-79 
ref|YP_557013.1|  putative acyl-CoA dehydrogenase oxidoreducta...   300    2e-79 
ref|ZP_00052323.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   300    2e-79 
ref|YP_002912839.1|  Acyl-CoA dehydrogenase domain protein [Bu...   300    2e-79 
ref|ZP_01741033.1|  acyl-CoA dehydrogenase family protein [Rho...   300    2e-79 
ref|ZP_05342750.1|  acyl-CoA dehydrogenase family protein [Tha...   300    2e-79 
ref|YP_002606131.1|  Acd17 [Desulfobacterium autotrophicum HRM...   300    2e-79 
ref|ZP_06064963.1|  acyl-CoA dehydrogenase domain-containing p...   300    2e-79 
ref|YP_001562366.1|  acyl-CoA dehydrogenase domain-containing ...   300    2e-79 
ref|ZP_06351022.1|  acyl-CoA dehydrogenase domain protein [Rho...   299    2e-79 
ref|ZP_02354508.1|  acyl-CoA dehydrogenase domain protein [Bur...   299    2e-79 
ref|ZP_05500079.1|  acyl-CoA dehydrogenase domain protein [Thi...   299    2e-79 
ref|YP_001170859.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   299    2e-79 
ref|ZP_06064372.1|  acyl-CoA dehydrogenase domain-containing p...   299    2e-79 
ref|YP_983695.1|  acyl-CoA dehydrogenase domain-containing pro...   299    2e-79 
ref|YP_001019616.1|  putative acyl-CoA dehydrogenase oxidoredu...   299    2e-79 
ref|ZP_02882592.1|  acyl-CoA dehydrogenase domain protein [Bur...   299    2e-79 
ref|ZP_03267845.1|  acyl-CoA dehydrogenase domain protein [Bur...   299    2e-79 
ref|YP_001674651.1|  acyl-CoA dehydrogenase domain-containing ...   299    3e-79 
ref|YP_001185885.1|  acyl-CoA dehydrogenase domain-containing ...   299    3e-79 
ref|YP_001668604.1|  acyl-CoA dehydrogenase domain-containing ...   299    3e-79 
gb|EFF81583.1|  acyl-CoA dehydrogenase [Acinetobacter haemolyt...   299    4e-79 
ref|ZP_06066833.1|  acyl-CoA dehydrogenase domain-containing p...   298    4e-79 
ref|ZP_02462360.1|  acyl-CoA dehydrogenase domain protein [Bur...   298    4e-79 
ref|YP_957803.1|  acyl-CoA dehydrogenase domain-containing pro...   298    4e-79 
ref|YP_933998.1|  putative acyl-CoA dehydrogenase [Azoarcus sp...   298    4e-79 
ref|YP_001086110.1|  putative acyl-CoA dehydrogenase [Acinetob...   298    4e-79 
ref|YP_001712356.1|  putative acyl-CoA dehydrogenase [Acinetob...   298    4e-79 
ref|ZP_05824089.1|  acyl-CoA dehydrogenase domain-containing p...   298    5e-79 
ref|YP_001188587.1|  acyl-CoA dehydrogenase domain-containing ...   298    5e-79 
ref|ZP_06058873.1|  acyl-CoA dehydrogenase domain-containing p...   298    5e-79 
ref|YP_574477.1|  acyl-CoA dehydrogenase-like protein [Chromoh...   298    5e-79 
ref|YP_001501710.1|  acyl-CoA dehydrogenase domain-containing ...   298    6e-79 
ref|ZP_03698829.1|  acyl-CoA dehydrogenase domain protein [Lut...   298    6e-79 
ref|ZP_00998506.1|  acyl-CoA dehydrogenase family protein [Oce...   298    7e-79 
ref|YP_001279026.1|  acyl-CoA dehydrogenase domain-containing ...   298    7e-79 
ref|NP_642877.1|  acyl-CoA dehydrogenase [Xanthomonas axonopod...   298    8e-79 
ref|ZP_02153022.1|  acyl-CoA dehydrogenase-like protein [Ocean...   298    8e-79 
gb|EFF43652.1|  acyl-CoA dehydrogenase [Xanthomonas fuscans su...   298    8e-79 
ref|ZP_06069746.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   298    8e-79 
ref|ZP_01306518.1|  acyl-CoA dehydrogenase family protein [Oce...   298    8e-79 
ref|ZP_01736104.1|  Acyl-CoA dehydrogenase-like protein [Marin...   297    9e-79 
ref|ZP_04714920.1|  probable acyl-CoA dehydrogenase [Alteromon...   297    1e-78 
ref|ZP_05361051.1|  acyl-CoA dehydrogenase domain protein [Aci...   297    1e-78 
ref|YP_001712566.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   297    1e-78 
ref|ZP_06058040.1|  acyl-CoA dehydrogenase domain-containing p...   297    1e-78 
ref|ZP_05829354.1|  acyl-CoA dehydrogenase domain-containing p...   297    1e-78 
ref|YP_793659.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   297    1e-78 
ref|ZP_02242822.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae...   297    1e-78 
ref|YP_200658.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae p...   297    1e-78 
ref|YP_046365.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   297    1e-78 
ref|YP_917001.1|  acyl-CoA dehydrogenase domain-containing pro...   297    1e-78 
ref|YP_001085895.1|  acyl-CoA dehydrogenase A [Acinetobacter b...   297    1e-78 
ref|YP_268983.1|  acyl-CoA dehydrogenase family protein [Colwe...   297    1e-78 
ref|ZP_06068129.1|  acyl-CoA dehydrogenase A [Acinetobacter lw...   297    1e-78 
ref|YP_364493.1|  acyl-CoA dehydrogenase [Xanthomonas campestr...   297    1e-78 
ref|YP_450931.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae p...   297    1e-78 
ref|NP_253874.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   296    2e-78 
ref|YP_001706055.1|  putative acyl-CoA dehydrogenase [Acinetob...   296    2e-78 
ref|YP_001797763.1|  acyl-CoA dehydrogenase domain protein [Po...   296    2e-78 
ref|ZP_01901750.1|  acyl-CoA dehydrogenase-like protein [Roseo...   296    2e-78 
ref|YP_263445.1|  acyl-CoA dehydrogenase [Psychrobacter arctic...   296    2e-78 
ref|YP_047763.1|  putative acyl-CoA dehydrogenase [Acinetobact...   296    2e-78 
ref|NP_637785.1|  acyl-CoA dehydrogenase [Xanthomonas campestr...   296    2e-78 
ref|YP_002358000.1|  acyl-CoA dehydrogenase domain protein [Sh...   296    2e-78 
ref|YP_683595.1|  putative acyl-CoA dehydrogenase family prote...   296    2e-78 
gb|EFF81353.1|  acyl-CoA dehydrogenase [Acinetobacter haemolyt...   296    2e-78 
ref|YP_001267543.1|  acyl-CoA dehydrogenase domain-containing ...   296    2e-78 
dbj|BAJ02052.1|  acyl-CoA dehydrogenase family protein [Shewan...   296    2e-78 
ref|ZP_03824295.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   296    3e-78 
ref|ZP_01368207.1|  hypothetical protein PaerPA_01005363 [Pseu...   296    3e-78 
ref|ZP_05034629.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   296    3e-78 
ref|YP_734062.1|  acyl-CoA dehydrogenase domain-containing pro...   296    3e-78 
ref|ZP_04931439.1|  hypothetical protein PACG_04232 [Pseudomon...   296    3e-78 
ref|YP_001674274.1|  acyl-CoA dehydrogenase domain-containing ...   296    3e-78 
ref|YP_002443159.1|  putative acyl-CoA dehydrogenase [Pseudomo...   296    3e-78 
ref|YP_001351247.1|  putative acyl-CoA dehydrogenase [Pseudomo...   295    3e-78 
ref|YP_001183555.1|  acyl-CoA dehydrogenase domain-containing ...   295    3e-78 
ref|ZP_01707774.1|  acyl-CoA dehydrogenase-like [Shewanella pu...   295    4e-78 
ref|YP_963366.1|  acyl-CoA dehydrogenase domain-containing pro...   295    4e-78 
ref|YP_003072146.1|  acyl-CoA dehydrogenase family protein [Te...   295    4e-78 
ref|YP_996012.1|  acyl-CoA dehydrogenase domain-containing pro...   295    4e-78 
ref|YP_961146.1|  acyl-CoA dehydrogenase domain-containing pro...   295    4e-78 
ref|YP_002799680.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   295    4e-78 
ref|YP_001903140.1|  acyl-CoA dehydrogenase [Xanthomonas campe...   295    4e-78 
ref|YP_574690.1|  acyl-CoA dehydrogenase-like protein [Chromoh...   295    4e-78 
ref|YP_001501936.1|  acyl-CoA dehydrogenase domain-containing ...   295    5e-78 
ref|YP_002798830.1|  Acyl-CoA dehydrogenase [Azotobacter vinel...   295    5e-78 
ref|YP_002126040.1|  probable acyl-CoA dehydrogenase [Alteromo...   295    6e-78 
ref|ZP_05823032.1|  acyl-CoA dehydrogenase domain-containing p...   295    6e-78 
ref|YP_738092.1|  acyl-CoA dehydrogenase domain-containing pro...   295    6e-78 
ref|YP_259268.1|  acyl-CoA dehydrogenase family protein [Pseud...   295    6e-78 
ref|YP_001366473.1|  acyl-CoA dehydrogenase domain-containing ...   295    6e-78 
ref|YP_001554817.1|  acyl-CoA dehydrogenase domain-containing ...   295    7e-78 
ref|YP_003167659.1|  acyl-CoA dehydrogenase domain protein [Ca...   295    7e-78 
ref|YP_001900196.1|  acyl-CoA dehydrogenase domain protein [Ra...   294    7e-78 
gb|EFF85105.1|  conserved hypothetical protein [Acinetobacter ...   294    8e-78 
ref|YP_001050447.1|  acyl-CoA dehydrogenase domain-containing ...   294    8e-78 
ref|YP_001706188.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   294    9e-78 
ref|YP_002132192.1|  acyl-CoA dehydrogenase [Phenylobacterium ...   294    1e-77 
ref|ZP_02139785.1|  putative acyl-CoA dehydrogenase family pro...   294    1e-77 
ref|YP_001793051.1|  acyl-CoA dehydrogenase domain-containing ...   294    1e-77 
ref|YP_660987.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   294    1e-77 
ref|ZP_05500170.1|  acyl-CoA dehydrogenase domain protein [Thi...   294    1e-77 
ref|YP_002762057.1|  putative acyl-CoA dehydrogenase [Gemmatim...   293    1e-77 
ref|YP_580716.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   293    2e-77 
dbj|BAC02934.1|  acyl-CoA dehydrogenase A [Acinetobacter sp. M-1]   293    2e-77 
ref|ZP_06489755.1|  acyl-CoA dehydrogenase [Xanthomonas campes...   293    2e-77 
ref|YP_579416.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   293    2e-77 
ref|YP_002787075.1|  putative acyl-CoA dehydrogenase [Deinococ...   293    2e-77 
ref|YP_001094289.1|  acyl-CoA dehydrogenase domain-containing ...   293    2e-77 
ref|YP_264251.1|  putative acyl-CoA dehydrogenase [Psychrobact...   293    2e-77 
ref|ZP_06070566.1|  acyl-CoA dehydrogenase domain-containing p...   293    3e-77 
dbj|BAI96708.1|  acyl-CoA dehydrogenase [Sphingobium japonicum...   292    3e-77 
ref|ZP_06483308.1|  acyl-CoA dehydrogenase [Xanthomonas campes...   292    3e-77 
ref|YP_002311830.1|  Acyl-CoA dehydrogenase [Shewanella piezot...   292    3e-77 
ref|YP_755769.1|  acyl-CoA dehydrogenase domain-containing pro...   292    3e-77 
ref|YP_869621.1|  acyl-CoA dehydrogenase domain-containing pro...   292    4e-77 
ref|ZP_02156198.1|  acyl-CoA dehydrogenase family protein [She...   292    4e-77 
ref|YP_693818.1|  acyl-CoA dehydrogenase [Alcanivorax borkumen...   292    4e-77 
ref|ZP_01003175.1|  acyl-CoA dehydrogenase family protein [Lok...   292    5e-77 
ref|ZP_05043166.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   291    5e-77 
ref|YP_002312289.1|  Acyl-CoA dehydrogenase [Shewanella piezot...   291    6e-77 
ref|YP_002430208.1|  acyl-CoA dehydrogenase domain protein [De...   291    7e-77 
ref|NP_249975.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   291    8e-77 
ref|ZP_06063935.1|  conserved hypothetical protein [Acinetobac...   291    8e-77 
ref|YP_751423.1|  acyl-CoA dehydrogenase domain-containing pro...   291    9e-77 
gb|EFF76490.1|  acyl-CoA dehydrogenase [Achromobacter piechaud...   290    1e-76 
ref|ZP_01364653.1|  hypothetical protein PaerPA_01001762 [Pseu...   290    1e-76 
ref|ZP_04927728.1|  hypothetical protein PACG_00254 [Pseudomon...   290    1e-76 
ref|YP_791961.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   290    1e-76 
ref|ZP_05620920.1|  acyl-CoA dehydrogenase domain protein [Enh...   290    2e-76 
ref|ZP_01893415.1|  putative acyl-CoA dehydrogenase [Marinobac...   290    2e-76 
ref|YP_001415533.1|  acyl-CoA dehydrogenase domain-containing ...   290    2e-76 
ref|ZP_00961162.1|  acyl-CoA dehydrogenase family protein [Ros...   289    2e-76 
ref|NP_717985.1|  acyl-CoA dehydrogenase family protein [Shewa...   289    3e-76 
ref|ZP_01741898.1|  acyl-CoA dehydrogenase family protein [Rho...   289    3e-76 
ref|YP_001756487.1|  acyl-CoA dehydrogenase domain-containing ...   289    3e-76 
ref|YP_002796257.1|  Probable acyl-CoA dehydrogenase [Laribact...   289    3e-76 
ref|YP_001530045.1|  acyl-CoA dehydrogenase domain-containing ...   289    3e-76 
ref|YP_694459.1|  acyl-CoA dehydrogenase [Alcanivorax borkumen...   289    4e-76 
ref|YP_002604360.1|  Acd10 [Desulfobacterium autotrophicum HRM...   288    4e-76 
ref|YP_001349460.1|  putative acyl-CoA dehydrogenase [Pseudomo...   288    4e-76 
ref|YP_003451158.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   288    4e-76 
ref|ZP_01224615.1|  acyl-CoA dehydrogenase family protein [mar...   288    6e-76 
ref|YP_003375588.1|  hypothetical acyl-coa dehydrogenase prote...   288    6e-76 
ref|NP_718349.1|  acyl-CoA dehydrogenase family protein [Shewa...   288    7e-76 
ref|YP_001760697.1|  acyl-CoA dehydrogenase domain-containing ...   288    8e-76 
ref|ZP_01012310.1|  acyl-CoA dehydrogenase family protein [Rho...   288    8e-76 
ref|YP_001474431.1|  acyl-CoA dehydrogenase domain-containing ...   288    8e-76 
ref|YP_001676696.1|  acyl-CoA dehydrogenase domain-containing ...   287    9e-76 
ref|ZP_06069673.1|  acyl-CoA dehydrogenase domain-containing p...   287    1e-75 
ref|ZP_02149267.1|  acyl-CoA dehydrogenase family protein [Pha...   287    1e-75 
ref|ZP_02146290.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   287    1e-75 
ref|YP_001474029.1|  acyl-CoA dehydrogenase domain-containing ...   287    1e-75 
ref|YP_001750007.1|  acyl-CoA dehydrogenase domain-containing ...   287    1e-75 
ref|YP_001094086.1|  acyl-CoA dehydrogenase domain-containing ...   286    2e-75 
ref|YP_001279811.1|  acyl-CoA dehydrogenase domain-containing ...   286    2e-75 
ref|YP_001530247.1|  acyl-CoA dehydrogenase domain-containing ...   286    3e-75 
ref|YP_611295.1|  acyl-CoA dehydrogenase-like [Ruegeria sp. TM...   286    3e-75 
ref|YP_001760295.1|  acyl-CoA dehydrogenase domain-containing ...   286    3e-75 
ref|ZP_01447931.1|  acyl-CoA dehydrogenase [alpha proteobacter...   285    4e-75 
ref|ZP_05074228.1|  acyl-CoA dehydrogenase family protein [Rho...   285    4e-75 
ref|ZP_04772349.1|  acyl-CoA dehydrogenase domain protein [Ast...   285    4e-75 
ref|YP_660239.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   285    5e-75 
ref|ZP_01057612.1|  acyl-CoA dehydrogenase family protein [Ros...   285    5e-75 
ref|YP_927618.1|  acyl-CoA dehydrogenase family protein [Shewa...   285    6e-75 
ref|YP_734515.1|  acyl-CoA dehydrogenase domain-containing pro...   285    6e-75 
ref|YP_003073386.1|  acyl-CoA dehydrogenase domain protein [Te...   285    7e-75 
ref|YP_870185.1|  acyl-CoA dehydrogenase domain-containing pro...   284    9e-75 
ref|YP_265674.1|  acyl-CoA dehydrogenase [Candidatus Pelagibac...   284    9e-75 
ref|ZP_01034568.1|  acyl-CoA dehydrogenase family protein [Ros...   284    1e-74 
ref|ZP_05739147.1|  acyl-CoA dehydrogenase family protein [Sil...   284    1e-74 
ref|ZP_05040717.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   283    1e-74 
ref|YP_003146588.1|  acyl-CoA dehydrogenase domain protein [Ka...   283    1e-74 
ref|YP_160051.1|  acyl-CoA dehydrogenase [Aromatoleum aromatic...   283    2e-74 
ref|YP_002602163.1|  Acd2 [Desulfobacterium autotrophicum HRM2...   283    2e-74 
gb|ABZ10350.1|  putative acyl-CoA dehydrogenase, C-terminal do...   283    2e-74 
ref|ZP_05785560.1|  acyl-CoA dehydrogenase family protein [Sil...   283    3e-74 
ref|YP_002432478.1|  acyl-CoA dehydrogenase domain protein [De...   283    3e-74 
ref|ZP_01881182.1|  acyl-CoA dehydrogenase-like protein [Roseo...   282    3e-74 
ref|NP_901455.1|  acyl-CoA dehydrogenase [Chromobacterium viol...   282    3e-74 
dbj|BAJ02610.1|  acyl-CoA dehydrogenase family protein [Shewan...   282    3e-74 
ref|ZP_01744115.1|  acyl-CoA dehydrogenase family protein [Sag...   282    4e-74 
ref|ZP_05063337.1|  acyl-CoA dehydrogenase family protein [Oct...   282    4e-74 
ref|YP_750799.1|  acyl-CoA dehydrogenase domain-containing pro...   281    5e-74 
ref|YP_002429384.1|  acyl-CoA dehydrogenase domain protein [De...   281    9e-74 
ref|ZP_01224015.1|  acyl-CoA dehydrogenase [marine gamma prote...   281    9e-74 
ref|YP_738501.1|  acyl-CoA dehydrogenase domain-containing pro...   281    1e-73 
dbj|BAI98535.1|  acyl-CoA dehydrogenase [Sphingobium japonicum...   280    2e-73 
ref|YP_001269001.1|  acyl-CoA dehydrogenase domain-containing ...   279    3e-73 
ref|ZP_02159372.1|  acyl-CoA dehydrogenase family protein [She...   279    3e-73 
ref|NP_744198.1|  acyl-CoA dehydrogenase, putative [Pseudomona...   279    4e-73 
ref|ZP_01707718.1|  acyl-CoA dehydrogenase-like [Shewanella pu...   278    4e-73 
ref|YP_524755.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   278    5e-73 
ref|ZP_05068948.1|  acyl-CoA dehydrogenase [Candidatus Pelagib...   278    5e-73 
ref|YP_963811.1|  acyl-CoA dehydrogenase domain-containing pro...   278    6e-73 
ref|NP_887672.1|  acyl-CoA dehydrogenase [Bordetella bronchise...   278    8e-73 
ref|ZP_05343859.1|  acyl-CoA dehydrogenase family protein [Tha...   278    8e-73 
ref|ZP_01157530.1|  probable acyl-CoA dehydrogenase [Oceanicol...   278    8e-73 
dbj|BAC02933.1|  acyl-CoA dehydrogenase B [Acinetobacter sp. M-1]   277    1e-72 
ref|ZP_05783504.1|  acyl-CoA dehydrogenase family protein [Cit...   277    1e-72 
ref|YP_562768.1|  acyl-CoA dehydrogenase-like protein [Shewane...   276    2e-72 
ref|YP_001050104.1|  acyl-CoA dehydrogenase domain-containing ...   276    3e-72 
ref|ZP_05123197.1|  acyl-CoA dehydrogenase family protein [Rho...   276    3e-72 
ref|ZP_05050120.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   275    4e-72 
ref|YP_002358480.1|  acyl-CoA dehydrogenase domain protein [Sh...   275    5e-72 
ref|ZP_05079033.1|  acyl-CoA dehydrogenase family protein [Rho...   275    5e-72 
ref|YP_616816.1|  acyl-CoA dehydrogenase-like protein [Sphingo...   275    6e-72 
ref|ZP_01304996.1|  Acyl-CoA dehydrogenase [Sphingomonas sp. S...   275    6e-72 
ref|NP_883241.1|  acyl-CoA dehydrogenase [Bordetella parapertu...   275    6e-72 
ref|YP_001183113.1|  acyl-CoA dehydrogenase domain-containing ...   275    6e-72 
ref|YP_001554197.1|  acyl-CoA dehydrogenase domain-containing ...   275    6e-72 
ref|ZP_04026357.1|  acyl-CoA dehydrogenase [Tsukamurella pauro...   274    8e-72 
ref|ZP_02886143.1|  acyl-CoA dehydrogenase domain protein [Bur...   273    1e-71 
ref|YP_002429233.1|  acyl-CoA dehydrogenase domain protein [De...   273    2e-71 
ref|YP_001534419.1|  putative acyl-CoA dehydrogenase family pr...   273    2e-71 
ref|ZP_01446370.1|  acyl-CoA dehydrogenase family protein [Ros...   273    3e-71 
ref|ZP_01304509.1|  Acyl-CoA dehydrogenase [Sphingomonas sp. S...   272    4e-71 
ref|YP_001365929.1|  acyl-CoA dehydrogenase domain-containing ...   271    6e-71 
ref|YP_002433993.1|  acyl-CoA dehydrogenase domain protein [De...   271    8e-71 
ref|YP_001341864.1|  acyl-CoA dehydrogenase domain-containing ...   271    1e-70 
ref|YP_914244.1|  acyl-CoA dehydrogenase domain-containing pro...   270    1e-70 
ref|ZP_05844248.1|  acyl-CoA dehydrogenase domain protein [Rho...   270    2e-70 
ref|YP_521552.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   270    2e-70 
ref|XP_001684536.1|  acyl-coa dehydrogenase [Leishmania major ...   270    2e-70 
ref|XP_001566297.1|  acyl-coa dehydrogenase [Leishmania brazil...   270    2e-70 
ref|YP_981046.1|  acyl-CoA dehydrogenase domain-containing pro...   268    6e-70 
ref|XP_001470295.1|  acyl-coa dehydrogenase [Leishmania infant...   268    6e-70 
ref|YP_002432538.1|  acyl-CoA dehydrogenase domain protein [De...   268    6e-70 
ref|XP_814739.1|  acyl-CoA dehydrogenase [Trypanosoma cruzi st...   268    9e-70 
ref|YP_002602051.1|  Acd1 [Desulfobacterium autotrophicum HRM2...   267    1e-69 
ref|YP_002947224.1|  acyl-CoA dehydrogenase domain protein [Va...   267    1e-69 
ref|ZP_05090353.1|  acyl-CoA dehydrogenase family protein [Rue...   267    2e-69 
ref|ZP_01756258.1|  acyl-CoA dehydrogenase family protein [Ros...   266    2e-69 
ref|YP_001632393.1|  acyl-CoA dehydrogenase [Bordetella petrii...   265    4e-69 
ref|YP_001529188.1|  acyl-CoA dehydrogenase domain-containing ...   264    9e-69 
ref|YP_165561.1|  acyl-CoA dehydrogenase family protein [Ruege...   264    1e-68 
ref|YP_002429284.1|  acyl-CoA dehydrogenase domain protein [De...   262    3e-68 
ref|YP_632837.1|  acyl-CoA dehydrogenase [Myxococcus xanthus D...   261    9e-68 
ref|YP_002602798.1|  Acd5 [Desulfobacterium autotrophicum HRM2...   260    1e-67 
ref|YP_001614215.1|  butyryl-CoA dehydrogenase [Sorangium cell...   259    2e-67 
ref|ZP_01225125.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   259    2e-67 
ref|YP_549930.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   259    3e-67 
ref|YP_520954.1|  hypothetical protein DSY4721 [Desulfitobacte...   259    4e-67 
ref|YP_003280176.1|  acyl-CoA dehydrogenase-like protein [Coma...   258    5e-67 
ref|ZP_01461976.1|  acyl-CoA dehydrogenase [Stigmatella aurant...   258    7e-67 
ref|ZP_04930397.1|  hypothetical protein PACG_03111 [Pseudomon...   257    1e-66 
ref|YP_001168655.1|  acyl-CoA dehydrogenase domain-containing ...   257    1e-66 
ref|YP_353821.1|  acyl-CoA dehydrogenase [Rhodobacter sphaeroi...   257    1e-66 
ref|YP_002526462.1|  Acyl-CoA dehydrogenase domain protein [Rh...   257    2e-66 
ref|YP_385221.1|  Acyl-CoA dehydrogenase-like [Geobacter metal...   256    2e-66 
ref|YP_001044272.1|  acyl-CoA dehydrogenase domain-containing ...   256    3e-66 
ref|YP_002430635.1|  acyl-CoA dehydrogenase domain protein [De...   253    3e-65 
ref|YP_845528.1|  acyl-CoA dehydrogenase domain-containing pro...   252    4e-65 
ref|YP_385163.1|  Acyl-CoA dehydrogenase-like [Geobacter metal...   251    5e-65 
ref|YP_003269441.1|  acyl-CoA dehydrogenase domain protein [Ha...   251    6e-65 
ref|YP_002946283.1|  acyl-CoA dehydrogenase domain protein [Va...   249    2e-64 
ref|ZP_06497193.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   248    6e-64 
ref|ZP_03541224.1|  acyl-CoA dehydrogenase domain protein [Com...   248    8e-64 
ref|YP_001174343.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   248    1e-63 
ref|ZP_05096285.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   247    1e-63 
ref|ZP_06238498.1|  acyl-CoA dehydrogenase domain protein [Fra...   247    1e-63 
ref|YP_002602878.1|  Acd6 [Desulfobacterium autotrophicum HRM2...   247    1e-63 
ref|ZP_03528272.1|  acyl-CoA dehydrogenase domain protein [Rhi...   246    2e-63 
ref|YP_003298848.1|  acyl-CoA dehydrogenase domain protein [Th...   245    4e-63 
ref|YP_702699.1|  acyl CoA dehydrogenase [Rhodococcus jostii R...   245    6e-63 
ref|YP_001094993.1|  acyl-CoA dehydrogenase domain-containing ...   244    6e-63 
ref|YP_001116292.1|  acyl-CoA dehydrogenase domain-containing ...   244    1e-62 
ref|ZP_01016437.1|  probable acyl-CoA dehydrogenase [Parvularc...   244    1e-62 
ref|ZP_04586667.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   244    1e-62 
ref|ZP_01736762.1|  acyl-CoA dehydrogenase family protein [Mar...   243    2e-62 
ref|YP_793489.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   242    3e-62 
ref|YP_002431802.1|  acyl-CoA dehydrogenase domain protein [De...   242    4e-62 
ref|ZP_03263932.1|  acyl-CoA dehydrogenase domain protein [Bur...   241    7e-62 
ref|ZP_01000644.1|  probable acyl-CoA dehydrogenase [Oceanicol...   241    7e-62 
ref|NP_253707.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   241    8e-62 
ref|ZP_03399611.1|  acyl-CoA dehydrogenase family protein [Pse...   241    8e-62 
ref|ZP_01077667.1|  acyl-CoA dehydrogenase family protein [Mar...   241    9e-62 
gb|EFF89223.1|  acyl-CoA dehydrogenase [Streptomyces sp. e14]       241    1e-61 
ref|YP_003508488.1|  acyl-CoA dehydrogenase domain-containing ...   240    1e-61 
ref|NP_794753.1|  acyl-CoA dehydrogenase family protein [Pseud...   240    2e-61 
ref|YP_233613.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   239    2e-61 
ref|YP_001351076.1|  putative acyl-CoA dehydrogenase [Pseudomo...   239    3e-61 
ref|ZP_06457086.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   239    4e-61 
ref|YP_257638.1|  acyl-CoA dehydrogenase family protein [Pseud...   239    4e-61 
ref|YP_002798618.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   238    5e-61 
ref|ZP_06478937.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   238    5e-61 
ref|ZP_05636526.1|  acyl-CoA dehydrogenase family protein [Pse...   238    8e-61 
ref|YP_003411594.1|  acyl-CoA dehydrogenase domain protein [Ge...   238    9e-61 
ref|YP_001234698.1|  acyl-CoA dehydrogenase domain-containing ...   237    1e-60 
ref|ZP_01615137.1|  putative acyl-CoA dehydrogenase protein [m...   237    1e-60 
ref|YP_272797.1|  acyl-CoA dehydrogenase family protein [Pseud...   237    2e-60 
ref|ZP_06219262.1|  acyl-CoA dehydrogenase domain protein [Mic...   236    2e-60 
ref|ZP_06226977.1|  acyl-CoA dehydrogenase domain-containing p...   236    3e-60 
ref|YP_118658.1|  putative acyl-CoA dehydrogenase [Nocardia fa...   236    3e-60 
ref|ZP_06397006.1|  acyl-CoA dehydrogenase domain protein [Mic...   236    4e-60 
ref|ZP_04332276.1|  acyl-CoA dehydrogenase [Nocardiopsis dasso...   236    4e-60 
ref|YP_001563784.1|  acyl-CoA dehydrogenase domain-containing ...   235    5e-60 
ref|ZP_05489911.1|  putative acyl-CoA dehydrogenase [Streptomy...   235    6e-60 
ref|YP_346184.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   234    8e-60 
gb|AAR37963.1|  acyl-CoA dehydrogenase family protein [uncultu...   234    1e-59 
ref|YP_002870126.1|  putative acyl-CoA dehydrogenase [Pseudomo...   234    1e-59 
ref|YP_002432431.1|  acyl-CoA dehydrogenase domain protein [De...   234    1e-59 
ref|YP_002298342.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   233    2e-59 
ref|YP_002872867.1|  putative acyl-CoA dehydrogenase oxidoredu...   233    2e-59 
ref|ZP_01626091.1|  Acyl-CoA dehydrogenase [marine gamma prote...   233    2e-59 
ref|YP_001068404.1|  acyl-CoA dehydrogenase domain-containing ...   233    3e-59 
ref|YP_002430467.1|  acyl-CoA dehydrogenase domain protein [De...   233    3e-59 
ref|YP_637287.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   233    3e-59 
ref|YP_001186063.1|  acyl-CoA dehydrogenase domain-containing ...   230    1e-58 
ref|YP_001279904.1|  acyl-CoA dehydrogenase domain-containing ...   230    2e-58 
ref|YP_003274652.1|  acyl-CoA dehydrogenase domain protein [Go...   230    2e-58 
ref|ZP_06069783.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   229    3e-58 
ref|ZP_01894903.1|  acyl-CoA dehydrogenase family protein [Mar...   229    3e-58 
ref|ZP_01459366.1|  acyl-CoA dehydrogenase family protein [Sti...   229    3e-58 
ref|YP_593913.1|  acyl-CoA dehydrogenase-like [Deinococcus geo...   229    4e-58 
ref|ZP_03268926.1|  acyl-CoA dehydrogenase domain protein [Bur...   229    4e-58 
ref|YP_661713.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   229    4e-58 
ref|ZP_01910458.1|  Acyl-CoA dehydrogenase-like protein [Plesi...   229    5e-58 
ref|YP_750750.1|  acyl-CoA dehydrogenase domain-containing pro...   229    5e-58 
ref|YP_001270125.1|  acyl-CoA dehydrogenase domain-containing ...   228    9e-58 
ref|YP_002125313.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-C...   227    1e-57 
ref|YP_003269024.1|  acyl-CoA dehydrogenase domain protein [Ha...   227    1e-57 
ref|ZP_01307316.1|  Acyl-CoA dehydrogenase [Oceanobacter sp. R...   227    2e-57 
ref|YP_001790023.1|  acyl-CoA dehydrogenase domain-containing ...   226    2e-57 
emb|CAD60270.1|  putative feruloyl-CoA dehydrogenase [Pseudomo...   226    3e-57 
ref|YP_960107.1|  acyl-CoA dehydrogenase domain-containing pro...   226    3e-57 
ref|YP_001671217.1|  acyl-CoA dehydrogenase domain-containing ...   224    8e-57 
ref|ZP_01449841.1|  probable acyl-CoA dehydrogenase [alpha pro...   224    9e-57 
ref|YP_001899017.1|  acyl-CoA dehydrogenase domain protein [Ra...   224    1e-56 
ref|YP_610422.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   223    2e-56 
ref|YP_001888766.1|  acyl-CoA dehydrogenase domain protein [Bu...   223    2e-56 
dbj|BAI94979.1|  butyryl-CoA dehydrogenase [Sphingobium japoni...   223    2e-56 
ref|YP_001748920.1|  acyl-CoA dehydrogenase domain-containing ...   223    3e-56 
ref|NP_747051.1|  acyl-CoA dehydrogenase domain-containing pro...   223    3e-56 
ref|YP_002981444.1|  acyl-CoA dehydrogenase domain protein [Ra...   221    6e-56 
ref|YP_368713.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   221    7e-56 
ref|ZP_04959174.1|  acyl-CoA dehydrogenase domain protein [gam...   220    2e-55 
ref|NP_285573.1|  acyl-CoA dehydrogenase, putative [Deinococcu...   219    3e-55 
ref|YP_001747391.1|  acyl-CoA dehydrogenase domain-containing ...   219    3e-55 
ref|YP_003061222.1|  acyl-CoA dehydrogenase domain protein [Hi...   219    5e-55 
ref|YP_584000.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   218    7e-55 
ref|ZP_01694097.1|  acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   218    1e-54 
ref|YP_001764617.1|  acyl-CoA dehydrogenase domain-containing ...   217    1e-54 
ref|ZP_04939037.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   217    1e-54 
ref|NP_519883.1|  acyl-CoA dehydrogenase oxidoreductase protei...   217    1e-54 
ref|YP_754601.1|  hypothetical protein Swol_1933 [Syntrophomon...   217    2e-54 
ref|YP_629060.1|  acyl-CoA dehydrogenase family protein [Myxoc...   216    2e-54 
ref|YP_580126.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   216    3e-54 
ref|YP_002787980.1|  putative acyl-CoA dehydrogenase [Deinococ...   216    4e-54 
ref|YP_002253945.1|  acyl-coa dehydrogenase protein [Ralstonia...   215    4e-54 
ref|ZP_03513690.1|  probable acyl-CoA dehydrogenase protein [R...   214    8e-54 
ref|ZP_00945623.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   214    1e-53 
ref|YP_002005487.1|  putative ACYL-COA DEHYDROGENASE [Cupriavi...   213    2e-53 
ref|YP_295622.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   213    3e-53 
ref|ZP_02893523.1|  acyl-CoA dehydrogenase domain protein [Bur...   212    4e-53 
ref|YP_001412955.1|  acyl-CoA dehydrogenase domain-containing ...   212    4e-53 
ref|YP_001267727.1|  acyl-CoA dehydrogenase domain-containing ...   212    5e-53 
ref|ZP_03501344.1|  acyl-CoA dehydrogenase protein [Rhizobium ...   212    5e-53 
ref|YP_001807965.1|  acyl-CoA dehydrogenase domain-containing ...   211    1e-52 
ref|ZP_05040896.1|  Acyl-CoA dehydrogenase, middle domain prot...   209    2e-52 
ref|ZP_04334235.1|  acyl-CoA dehydrogenase [Nocardiopsis dasso...   209    3e-52 
ref|ZP_01906960.1|  acyl-CoA dehydrogenase family protein [Ple...   209    3e-52 
ref|YP_726030.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   209    3e-52 
ref|YP_002230463.1|  putative Acyl-CoA dehydrogenase [Burkhold...   208    5e-52 
ref|ZP_00054042.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   208    6e-52 
ref|YP_773125.1|  acyl-CoA dehydrogenase domain-containing pro...   208    6e-52 
ref|YP_753093.1|  hypothetical protein Swol_0384 [Syntrophomon...   208    8e-52 
ref|YP_692553.1|  acyl-CoA dehydrogenase family protein [Alcan...   207    9e-52 
ref|YP_620742.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   207    1e-51 
ref|NP_745494.1|  acyl-CoA dehydrogenase, ferrulic acid biotra...   207    1e-51 
gb|EFF86939.1|  conserved hypothetical protein [Acinetobacter ...   207    1e-51 
ref|YP_001084846.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   207    1e-51 
gb|ABO12244.2|  Acyl-CoA dehydrogenase [Acinetobacter baumanni...   207    2e-51 
ref|ZP_05823763.1|  LOW QUALITY PROTEIN: acyl-CoA dehydrogenas...   207    2e-51 
ref|YP_754717.1|  hypothetical protein Swol_2052 [Syntrophomon...   207    2e-51 
ref|ZP_06056971.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   206    2e-51 
ref|YP_923051.1|  acyl-CoA dehydrogenase domain-containing pro...   206    3e-51 
ref|ZP_05827127.1|  acyl-CoA dehydrogenase [Acinetobacter baum...   206    3e-51 
ref|YP_002432494.1|  acyl-CoA dehydrogenase domain protein [De...   206    4e-51 
ref|YP_003278994.1|  acyl-CoA dehydrogenase-like protein [Coma...   206    4e-51 
ref|YP_628693.1|  acyl-CoA dehydrogenase [Myxococcus xanthus D...   205    6e-51 
ref|ZP_05033255.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   205    6e-51 
emb|CBA26307.1|  hypothetical protein [Curvibacter putative sy...   204    8e-51 
ref|YP_003385926.1|  acyl-CoA dehydrogenase domain protein [Sp...   203    2e-50 
ref|ZP_03542422.1|  acyl-CoA dehydrogenase domain protein [Com...   203    2e-50 
ref|YP_003119481.1|  acyl-CoA dehydrogenase domain protein [Ca...   203    2e-50 
ref|YP_421387.1|  Acyl-CoA dehydrogenase [Magnetospirillum mag...   203    2e-50 
ref|YP_002944808.1|  acyl-CoA dehydrogenase domain protein [Va...   202    3e-50 
ref|ZP_02188381.1|  acyl-CoA dehydrogenase family protein [alp...   202    3e-50 
ref|ZP_01461285.1|  acyl-coA-dehydrogenase [Stigmatella aurant...   202    4e-50 
ref|YP_001020971.1|  putative acyl-CoA dehydrogenase [Methylib...   202    4e-50 
ref|ZP_01053127.1|  acyl-CoA dehydrogenase [Polaribacter sp. M...   201    1e-49 
ref|ZP_03265568.1|  acyl-CoA dehydrogenase domain protein [Bur...   200    2e-49 
ref|YP_288271.1|  putative acyl-CoA dehydrogenase [Thermobifid...   200    2e-49 
ref|YP_367246.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   200    2e-49 
ref|YP_001564338.1|  acyl-CoA dehydrogenase domain-containing ...   199    5e-49 
ref|ZP_01055677.1|  acyl-CoA dehydrogenase, ferrulic acid biot...   197    9e-49 
ref|ZP_01442893.1|  Acyl-CoA dehydrogenase [Roseovarius sp. HT...   197    2e-48 
ref|ZP_01737862.1|  Acyl-CoA dehydrogenase [Marinobacter sp. E...   196    4e-48 
ref|YP_002553473.1|  acyl-CoA dehydrogenase domain protein [Ac...   194    1e-47 
ref|YP_001825297.1|  putative acyl-CoA dehydrogenase [Streptom...   194    2e-47 
ref|ZP_06282785.1|  acyl-CoA dehydrogenase domain protein [Str...   194    2e-47 
ref|YP_996562.1|  acyl-CoA dehydrogenase domain-containing pro...   193    2e-47 
ref|YP_971219.1|  acyl-CoA dehydrogenase domain-containing pro...   193    2e-47 
ref|ZP_04991582.1|  acyl-CoA dehydrogenase [Streptomyces sp. S...   193    3e-47 
ref|YP_985954.1|  acyl-CoA dehydrogenase domain-containing pro...   192    4e-47 
ref|YP_001205471.1|  putative acyl-CoA dehydrogenase. [Bradyrh...   192    4e-47 
ref|ZP_04694520.1|  putative acyl-CoA dehydrogenase [Streptomy...   192    5e-47 
ref|ZP_05620320.1|  acyl-CoA dehydrogenase [Enhydrobacter aero...   192    6e-47 
ref|YP_003411739.1|  acyl-CoA dehydrogenase domain protein [Ge...   191    8e-47 
ref|ZP_06209324.1|  acyl-CoA dehydrogenase domain protein [Aci...   191    1e-46 
ref|ZP_05488366.1|  acyl-CoA dehydrogenase [Streptomyces sp. S...   191    1e-46 
ref|ZP_05801601.1|  acyl-CoA dehydrogenase domain protein [Str...   191    1e-46 
ref|ZP_06272928.1|  acyl-CoA dehydrogenase domain protein [Str...   191    1e-46 
ref|NP_733617.1|  acyl-CoA dehydrogenase [Streptomyces coelico...   190    1e-46 
ref|ZP_06295172.1|  acyl-CoA dehydrogenase domain protein [Bur...   189    4e-46 
ref|YP_523632.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   189    4e-46 
ref|ZP_01078017.1|  Acyl-CoA dehydrogenase [Marinomonas sp. ME...   189    5e-46 
ref|ZP_05005575.1|  acyl-CoA dehydrogenase [Streptomyces clavu...   189    5e-46 
gb|EFF92096.1|  acyl-CoA dehydrogenase [Streptomyces sp. e14]       188    5e-46 
ref|NP_825567.1|  acyl-CoA dehydrogenase [Streptomyces avermit...   188    6e-46 
ref|ZP_04717108.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   188    7e-46 
ref|ZP_04998731.1|  acyl-CoA dehydrogenase [Streptomyces sp. M...   187    1e-45 
ref|YP_003297913.1|  acyl-CoA dehydrogenase domain protein [Th...   187    1e-45 
ref|ZP_01549086.1|  Acyl-CoA dehydrogenase [Stappia aggregata ...   187    1e-45 
ref|ZP_05532850.1|  acyl-CoA dehydrogenase [Streptomyces virid...   187    1e-45 
ref|ZP_05011818.1|  acyl-CoA dehydrogenase [Streptomyces prist...   187    2e-45 
ref|YP_549384.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   187    2e-45 
ref|YP_003490114.1|  putative acyl-CoA dehydrogenase [Streptom...   186    2e-45 
ref|YP_001615925.1|  butyryl-CoA dehydrogenase [Sorangium cell...   186    2e-45 
ref|NP_354421.2|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   186    3e-45 
ref|ZP_05783253.1|  acyl-CoA dehydrogenase [Citreicella sp. SE...   186    3e-45 
ref|ZP_04687053.1|  acyl-CoA dehydrogenase [Streptomyces ghana...   186    4e-45 
ref|ZP_04703232.1|  acyl-CoA dehydrogenase [Streptomyces albus...   186    4e-45 
ref|YP_002601592.1|  acyl-CoA dehydrogenase family protein [De...   185    5e-45 
ref|ZP_04761941.1|  acyl-CoA dehydrogenase domain protein [Aci...   185    5e-45 
ref|ZP_05507613.1|  putative acyl-CoA dehydrogenase [Streptomy...   185    6e-45 
ref|ZP_05540061.1|  acyl-CoA dehydrogenase [Streptomyces grise...   185    6e-45 
ref|ZP_05500578.1|  acyl-CoA dehydrogenase domain protein [Thi...   185    7e-45 
ref|ZP_01004368.1|  acyl-CoA dehydrogenase family protein [Lok...   185    8e-45 
ref|ZP_05017633.1|  acyl-CoA dehydrogenase [Streptomyces svice...   184    1e-44 
ref|ZP_05516226.1|  putative acyl-CoA dehydrogenase [Streptomy...   181    9e-44 
ref|ZP_01012918.1|  putative acyl-coa dehydrogenase protein [R...   181    1e-43 
ref|ZP_06240514.1|  acyl-CoA dehydrogenase domain protein [Fra...   181    1e-43 
ref|ZP_06414277.1|  acyl-CoA dehydrogenase domain protein [Fra...   179    3e-43 
ref|ZP_06473370.1|  acyl-CoA dehydrogenase domain protein [Fra...   179    5e-43 
ref|YP_003344334.1|  acyl-CoA dehydrogenase [Streptosporangium...   179    5e-43 
ref|ZP_01106238.1|  probable acyl-CoA dehydrogenase [Flavobact...   178    7e-43 
ref|YP_003204550.1|  acyl-CoA dehydrogenase domain protein [Na...   177    1e-42 
ref|YP_003135645.1|  acyl-CoA dehydrogenase [Saccharomonospora...   177    2e-42 
ref|YP_479176.1|  acyl-CoA dehydrogenase-like [Frankia sp. CcI...   175    6e-42 
ref|YP_003514638.1|  acyl-CoA dehydrogenase domain-containing ...   175    7e-42 
ref|YP_905218.1|  acyl-CoA dehydrogenase FadE5 [Mycobacterium ...   175    8e-42 
ref|YP_003384623.1|  acyl-CoA dehydrogenase domain protein [Kr...   174    1e-41 
ref|YP_710365.1|  acyl-CoA dehydrogenase [Frankia alni ACN14a]...   173    3e-41 
ref|YP_003275453.1|  acyl-CoA dehydrogenase domain protein [Go...   172    4e-41 
ref|ZP_05484142.1|  acyl-CoA dehydrogenase domain protein [Str...   172    5e-41 
ref|YP_001848824.1|  acyl-CoA dehydrogenase FadE5 [Mycobacteri...   172    6e-41 
ref|ZP_01746355.1|  acyl-CoA dehydrogenase [Sagittula stellata...   171    9e-41 
ref|YP_882491.1|  putative acyl-CoA dehydrogenase [Mycobacteri...   171    1e-40 
ref|ZP_06218665.1|  acyl-CoA dehydrogenase domain protein [Mic...   170    2e-40 
ref|ZP_05224540.1|  FadE15 [Mycobacterium intracellulare ATCC ...   170    2e-40 
ref|ZP_06400364.1|  acyl-CoA dehydrogenase domain protein [Mic...   170    2e-40 
ref|NP_960129.1|  FadE15 [Mycobacterium avium subsp. paratuber...   170    3e-40 
ref|ZP_04026086.1|  acyl-CoA dehydrogenase [Tsukamurella pauro...   169    5e-40 
ref|ZP_06607003.1|  acyl-CoA dehydrogenase [Aeromicrobium mari...   169    5e-40 
ref|ZP_04747127.1|  acyl-CoA dehydrogenase FadE5 [Mycobacteriu...   168    6e-40 
ref|ZP_00994549.1|  putative acyl-CoA dehydrogenase [Janibacte...   168    6e-40 
ref|YP_001131691.1|  acyl-CoA dehydrogenase domain-containing ...   168    9e-40 
ref|ZP_05225428.1|  putative acyl-CoA dehydrogenase [Mycobacte...   168    1e-39 
ref|YP_637419.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   167    1e-39 
ref|ZP_04606714.1|  acyl-CoA dehydrogenase [Micromonospora sp....   167    1e-39 
ref|YP_884819.1|  acyl-CoA-dehydrogenase [Mycobacterium smegma...   167    1e-39 
ref|YP_001507340.1|  acyl-CoA dehydrogenase domain-containing ...   167    1e-39 
ref|YP_001511496.1|  acyl-CoA dehydrogenase domain-containing ...   167    1e-39 
ref|YP_705142.1|  butyryl-CoA dehydrogenase [Rhodococcus josti...   166    3e-39 
ref|NP_853915.1|  acyl-CoA dehydrogenase FADE5 [Mycobacterium ...   166    3e-39 
ref|YP_638675.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   166    3e-39 
ref|YP_001068536.1|  acyl-CoA dehydrogenase domain-containing ...   166    3e-39 
ref|NP_214758.1|  acyl-CoA dehydrogenase FADE5 [Mycobacterium ...   166    3e-39 
ref|YP_976380.1|  putative acyl-CoA dehydrogenase fadE5 [Mycob...   166    3e-39 
ref|YP_003030169.1|  acyl-CoA dehydrogenase fadE5 [Mycobacteri...   166    3e-39 
ref|NP_962628.1|  FadE5 [Mycobacterium avium subsp. paratuberc...   166    4e-39 
ref|YP_951120.1|  acyl-CoA dehydrogenase domain-containing pro...   165    5e-39 
ref|NP_302639.1|  acyl-CoA dehydrogenase [Mycobacterium leprae...   165    7e-39 
ref|ZP_04750043.1|  acyl-CoA dehydrogenase FadE15 [Mycobacteri...   165    8e-39 
ref|YP_001705161.1|  acyl-CoA dehydrogenase FadE [Mycobacteriu...   165    8e-39 
ref|YP_003150365.1|  acyl-CoA dehydrogenase [Kytococcus sedent...   164    9e-39 
ref|YP_001109325.1|  acyl-CoA dehydrogenase [Saccharopolyspora...   164    1e-38 
ref|YP_001069798.1|  acyl-CoA dehydrogenase domain-containing ...   164    1e-38 
ref|ZP_06515688.1|  LOW QUALITY PROTEIN: acyl-CoA dehydrogenas...   164    2e-38 
ref|YP_003104604.1|  acyl-CoA dehydrogenase domain protein [Ac...   164    2e-38 
ref|YP_001131712.1|  acyl-CoA dehydrogenase domain-containing ...   163    2e-38 
gb|EEF07177.1|  predicted protein [Populus trichocarpa]             163    2e-38 
ref|YP_951093.1|  acyl-CoA dehydrogenase domain-containing pro...   162    3e-38 
emb|CAJ77661.1|  acyl-CoA dehydrogenase [Mycobacterium chelonae]    162    6e-38 
ref|NP_215983.1|  acyl-CoA dehydrogenase FADE15 [Mycobacterium...   161    7e-38 
ref|ZP_03419932.1|  acyl-CoA dehydrogenase fadE15 [Mycobacteri...   161    8e-38 

ALIGNMENTS
>ref|ZP_01256117.1| probable acyl-CoA dehydrogenase [Psychroflexus torquis ATCC 700755]
Length=441

 Score =  499 bits (1286),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/314 (75%), Positives = 269/314 (85%), Gaps = 1/314 (0%)

Query  6    PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  65
            PS+IGGGG+P  LS   LEIL TAN+AF L PGLS GAIS INFH ++ QK  +LP LVS
Sbjct  97   PSDIGGGGLPYGLSAAILEILCTANMAFVLGPGLSIGAISGINFHANQGQKDMYLPDLVS  156

Query  66   GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  125
            G WTGTMNLSEPQSGSDL  I+TKA  Q DG+Y+ITGTK+WI  GEHD++ENIIHLVLAK
Sbjct  157  GNWTGTMNLSEPQSGSDLSNISTKAIKQDDGTYRITGTKIWIGSGEHDLSENIIHLVLAK  216

Query  126  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGY  185
            VPGSPEGTKGISMFIVPK  +NDD SLG +N VNCISIEEKLGIH SPTCVMEYD SVGY
Sbjct  217  VPGSPEGTKGISMFIVPKFVVNDDSSLGRHNKVNCISIEEKLGIHGSPTCVMEYDDSVGY  276

Query  186  LIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAKN  245
            LIGEEN GLNYMFT +NEAR+  GG GLAC +GALQGA+QYARDRVQGRP+GMSKE+AK+
Sbjct  277  LIGEENMGLNYMFTTINEARIRAGGHGLACTSGALQGASQYARDRVQGRPVGMSKEEAKD  336

Query  246  STIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVT  305
            S+IIDHADVRR LMTIK+Y+DAMRY+ YDN LM+DLEYFAE  E K FG+ERCGILTP+T
Sbjct  337  SSIIDHADVRRTLMTIKSYLDAMRYMNYDNHLMLDLEYFAEG-ELKDFGKERCGILTPIT  395

Query  306  KAWVSDLGVELSSV  319
            KAW+SD  VEL+S+
Sbjct  396  KAWISDSSVELTSM  409


>ref|YP_001412055.1| acyl-CoA dehydrogenase domain-containing protein [Parvibaculum 
lavamentivorans DS-1]
 gb|ABS62398.1| acyl-CoA dehydrogenase domain protein [Parvibaculum lavamentivorans 
DS-1]
Length=586

 Score =  353 bits (907),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 229/316 (72%), Gaps = 6/316 (1%)

Query  7    SEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSG  66
            +E GG G+P+ LS    E+ + A L+FGL P LS GAI A+  HG+EEQK  +L +L+SG
Sbjct  96   TEYGGQGLPVALSVAMQEMWNAACLSFGLCPILSQGAIEALTAHGTEEQKNIYLARLISG  155

Query  67   EWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKV  126
            EWTGTMNL+EPQ+GSDL  + TKA  QGDG+Y+I+GTK++IT+G+HDM ENI+HLVLA++
Sbjct  156  EWTGTMNLTEPQAGSDLNALKTKAVPQGDGTYRISGTKIYITYGDHDMAENIVHLVLARL  215

Query  127  PGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSV  183
            P +P GTKGIS+F+VPK  +N+DGSLG  N+  CI +EEKLGIH SPTCVM Y    G++
Sbjct  216  PDAPPGTKGISLFLVPKFLVNEDGSLGARNDAWCIGLEEKLGIHGSPTCVMSYGENGGAI  275

Query  184  GYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDA  243
            G LIG+ENRGL  MFTMMN AR+ VG QG+A A  A Q A  YA+DR QGRP+G +    
Sbjct  276  GTLIGQENRGLACMFTMMNNARLLVGTQGVAIAEAAYQHALAYAKDRKQGRPLGSTLAPG  335

Query  244  KNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTP  303
            + + II+H D+RRML+T+K+  DA R + Y   + +D  +  +  E     + R  +LTP
Sbjct  336  EMAPIIEHPDIRRMLLTMKSLTDASRAICYATAVAIDGAHAGDKREE---AQARADLLTP  392

Query  304  VTKAWVSDLGVELSSV  319
            + K++ +D+GVE++S+
Sbjct  393  IAKSFSTDIGVEVASI  408


>ref|ZP_06229014.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCGE1002]
 gb|EFA51953.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCGE1002]
Length=645

 Score =  350 bits (899),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 230/317 (72%), Gaps = 5/317 (1%)

Query  6    PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  65
            PSE GG  +P  LS   +E+L+ ANL+ GL P L+ GAI A+   GSEE KQ+++PK++S
Sbjct  140  PSEYGGQDLPKLLSTPCIEMLNAANLSLGLCPLLTDGAIEALLTAGSEELKQRYVPKMIS  199

Query  66   GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  125
            GEWTGTMNL+EPQ+GSDL  + T+AE QGDGSY+I+GTK++IT+GEHDMTENI+HLVLA+
Sbjct  200  GEWTGTMNLTEPQAGSDLSLVRTRAEPQGDGSYRISGTKIFITWGEHDMTENIVHLVLAR  259

Query  126  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGS  182
             P +PEG KGIS+F+VPK  +N+DGSLGE N+V+C+SIE KLGI ASPT V+++    G+
Sbjct  260  TPSAPEGVKGISLFVVPKFLVNEDGSLGERNDVHCVSIEHKLGIKASPTAVLQFGDHGGA  319

Query  183  VGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKED  242
            +G L+GEENRGL YMF MMN AR  VG QG+A ++ A Q A  YA++RVQGRP+  S + 
Sbjct  320  IGQLVGEENRGLEYMFIMMNAARFAVGVQGVAISDRAYQQAVAYAKERVQGRPVDGSAK-  378

Query  243  AKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILT  302
             ++  II H DVRRML T++A  +  R L Y +    DL +   D  T+A  +     L 
Sbjct  379  -QSVAIIQHPDVRRMLSTMRALTEGARALAYVSASHCDLAHRHPDRATRANHQAIYEYLV  437

Query  303  PVTKAWVSDLGVELSSV  319
            P+ K W +++ +E++S+
Sbjct  438  PIVKGWSTEMSLEVTSL  454


>ref|ZP_01017414.1| probable acyl-CoA dehydrogenase [Parvularcula bermudensis HTCC2503]
 gb|EAQ15861.1| probable acyl-CoA dehydrogenase [Parvularcula bermudensis HTCC2503]
Length=594

 Score =  350 bits (899),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/309 (55%), Positives = 220/309 (71%), Gaps = 1/309 (0%)

Query  8    EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  67
            E GG G+P+ L     E+ S+AN AF + PGLS GA  AI  +GS+EQK+K+LPK+ SGE
Sbjct  99   EYGGQGLPLVLQYAVAEMTSSANQAFAMYPGLSGGAWRAIYMNGSDEQKEKYLPKMTSGE  158

Query  68   WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  127
            WTGTMNL+EPQ G+DLG I TKAE Q DG+YKI+G K+WI+ GEHDM++NIIHLVLAK+P
Sbjct  159  WTGTMNLTEPQCGTDLGLIRTKAEPQDDGTYKISGQKIWISAGEHDMSDNIIHLVLAKIP  218

Query  128  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLI  187
            G P+G KGIS+FIVPK  +N+DGSLGE NNV C  +EEK+GIH + TCVM YD + GYL+
Sbjct  219  GGPDGVKGISLFIVPKFMVNEDGSLGERNNVVCGGLEEKMGIHGNATCVMNYDEATGYLV  278

Query  188  GEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAKNS  246
            GEE++GL  MF MMNEAR+ VG QGL+ A  A Q AA +A+DR+Q R I G    D    
Sbjct  279  GEEHKGLRAMFIMMNEARLGVGLQGLSAAEVAYQNAAAFAKDRLQMRSISGTKAPDQPAD  338

Query  247  TIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVTK  306
             II H DVRRML+  + + +  R L Y   L  DL + +EDE T+   ++  G+LTP+ K
Sbjct  339  PIIVHPDVRRMLLDTRVFTEGARMLTYWAALHEDLAHKSEDEATRQKAKDYMGLLTPIIK  398

Query  307  AWVSDLGVE  315
            A+ +  G E
Sbjct  399  AFNTHKGFE  407


>ref|ZP_01165298.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Oceanospirillum sp. MED92]
 gb|EAR62650.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Oceanospirillum sp. MED92]
Length=598

 Score =  348 bits (893),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 172/315 (54%), Positives = 224/315 (71%), Gaps = 8/315 (2%)

Query  8    EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  67
            E GG G+P  LS   +E+  +AN+A+GL P LS GA+ AI  +GS+E K K+LP+LVSGE
Sbjct  98   EFGGQGLPYALSIPVMEMWQSANMAWGLCPLLSQGAVEAIFHNGSDELKAKYLPQLVSGE  157

Query  68   WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  127
            WTGTMNL+EPQ+GSDL  I + A+  GD  Y+I G K++IT+GEHDM ENIIHLVLA++P
Sbjct  158  WTGTMNLTEPQAGSDLAAIRSTAKPVGD-HYRIKGQKIFITWGEHDMAENIIHLVLARLP  216

Query  128  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSVG  184
             +P G KGIS+F+VPK  +NDDGSLGE N+  C+S+E KLGIHASPTCVM +   +G++G
Sbjct  217  DAPPGVKGISLFVVPKFLVNDDGSLGERNDAKCVSLEHKLGIHASPTCVMAFGDDEGAIG  276

Query  185  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  244
            YL+GEENRGL  MFTMMN AR+ VG QG+A +  A Q A +YA DRVQ  P+G S+E A 
Sbjct  277  YLVGEENRGLACMFTMMNNARLAVGLQGVAISERAYQHALEYAHDRVQSPPVG-SREAAP  335

Query  245  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  304
               II HADVRRML+T+K   +A R L YD    +D  + +ED   +A    R   LTP+
Sbjct  336  ---IIQHADVRRMLLTMKTMTEAGRALAYDACASLDFAHHSEDPAIRAKESARAAYLTPI  392

Query  305  TKAWVSDLGVELSSV  319
             K W ++   E++S+
Sbjct  393  VKGWCTEFAQEVTSL  407


>ref|ZP_03270334.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. H160]
 gb|EDZ98079.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. H160]
Length=600

 Score =  347 bits (889),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 168/317 (52%), Positives = 229/317 (72%), Gaps = 5/317 (1%)

Query  6    PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  65
            PSE GG  +P  LS   +E+L+ ANL+ GL P L+ GAI A+   GSEE KQ+++PK++S
Sbjct  95   PSEYGGQDLPKLLSTPCIEMLNAANLSLGLCPLLTDGAIEALLTAGSEELKQRYVPKMIS  154

Query  66   GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  125
            G WTGTMNL+EPQ+GSDL  + ++AE QGDGSY+I GTK++IT+GEHDMTENI+HLVLA+
Sbjct  155  GVWTGTMNLTEPQAGSDLSLVRSRAEPQGDGSYRIFGTKIFITWGEHDMTENIVHLVLAR  214

Query  126  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGS  182
             P +PEG KGIS+F+VPK  +N+DGSLGE N+V+C+SIE KLGI ASPT V+++    G+
Sbjct  215  TPSAPEGVKGISLFVVPKFLVNEDGSLGERNDVHCVSIEHKLGIKASPTAVLQFGDHGGA  274

Query  183  VGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKED  242
            +G L+GEENRGL YMF MMN AR  VG QG+A ++ A Q A  YA++RVQ RP+  S + 
Sbjct  275  IGQLVGEENRGLEYMFIMMNAARFAVGVQGVAISDRAYQQAVAYAKERVQSRPVDGSAK-  333

Query  243  AKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILT  302
             ++ TII H DVRRML T++A  +  R L Y +    DL +   DE T+A  +     L 
Sbjct  334  -QSVTIIQHPDVRRMLSTMRALTEGARALAYVSAAHCDLAHRHPDELTRANHQAIYEYLV  392

Query  303  PVTKAWVSDLGVELSSV  319
            P+ K W +++ +E++S+
Sbjct  393  PIVKGWSTEMSLEVTSL  409


>ref|YP_933206.1| acyl-CoA dehydrogenase [Azoarcus sp. BH72]
 emb|CAL94319.1| probable acyl-CoA dehydrogenase [Azoarcus sp. BH72]
Length=599

 Score =  346 bits (887),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 221/314 (70%), Gaps = 5/314 (1%)

Query  8    EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  67
            E GG G+P  +S   +E+  +AN+AF L P L+ GAI A+   G++EQK  +LPK+VSGE
Sbjct  99   EFGGQGLPKLISTAVMEMWKSANMAFSLCPMLTTGAIEALLLRGNDEQKAMYLPKMVSGE  158

Query  68   WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  127
            WTGTMNL+EPQ+GSDL  + T+AE QGDG+Y+I G K++IT+GEHD+T+NIIHLVLA++P
Sbjct  159  WTGTMNLTEPQAGSDLAAVRTRAEPQGDGTYRIFGQKIFITYGEHDLTDNIIHLVLARLP  218

Query  128  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSVG  184
             +PEG KGIS+F+VPK  +N DGSLG  N+V C+SIE KLGIHASPTCV+ +    G++G
Sbjct  219  DAPEGVKGISLFVVPKFMVNADGSLGARNDVECVSIEHKLGIHASPTCVLAFGDKGGAIG  278

Query  185  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  244
             L+GE NRGL YMF MMNEAR  VG +GLA +  A Q A  YA+DRVQG   G+      
Sbjct  279  TLVGEANRGLEYMFIMMNEARFAVGMEGLALSERAYQHALAYAKDRVQGTEAGV--RGGP  336

Query  245  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  304
              +II HADVRRMLM++K+  +AMR L Y      DL +   DE  +A  +    ++ PV
Sbjct  337  KVSIIHHADVRRMLMSMKSQTEAMRALAYVVGAATDLAHHHADEAVRASNQAFVDLMIPV  396

Query  305  TKAWVSDLGVELSS  318
             K W ++  +E++S
Sbjct  397  VKGWCTENSIEIAS  410


>ref|YP_760546.1| acyl-CoA dehydrogenase family protein [Hyphomonas neptunium ATCC 
15444]
 gb|ABI75376.1| acyl-CoA dehydrogenase family protein [Hyphomonas neptunium ATCC 
15444]
Length=589

 Score =  346 bits (887),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 226/315 (71%), Gaps = 4/315 (1%)

Query  5    SPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLV  64
            +P E GG G+P  L+ G +E+   AN+AFGL P LS GA+ A+  HG++ Q+  +LPKLV
Sbjct  94   APEEWGGQGLPKALALGVMEMFHGANMAFGLCPMLSYGAVEALLAHGTDVQRAAYLPKLV  153

Query  65   SGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLA  124
            SGEWTGTMNL+EPQ+GSD+G + TKAE   DGSY ITG K++IT+G+HDM ENIIHLVLA
Sbjct  154  SGEWTGTMNLTEPQAGSDVGALKTKAEPCEDGSYSITGQKIYITWGDHDMAENIIHLVLA  213

Query  125  KVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVG  184
            ++P +P G+KGIS+F+VPK  ++ DG+ GE N V CI +E+K+GIH SPTCVMEY G+ G
Sbjct  214  RLPDAPAGSKGISLFLVPKFILDADGTPGERNGVRCIGLEKKMGIHGSPTCVMEYSGAKG  273

Query  185  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  244
            +LIGEENRGL  MFTMMN AR+ VG +G+A    A Q A  YA++R QG   G++     
Sbjct  274  WLIGEENRGLACMFTMMNSARLNVGLEGVAVGEAAFQTAFAYAQERKQGAAAGVTGP---  330

Query  245  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  304
             + I+ HADVRR L T++A V A R + Y   +  DL + + D + +A  + R  +LTP+
Sbjct  331  -APILHHADVRRTLTTMRAKVAAARAICYACGVAADLAHSSPDPDVRAAAKTREDLLTPI  389

Query  305  TKAWVSDLGVELSSV  319
             KAW +D+GVE++S+
Sbjct  390  AKAWSTDIGVEVASL  404


>ref|YP_296348.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Ralstonia eutropha JMP134]
 gb|AAZ61504.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Ralstonia eutropha JMP134]
Length=600

 Score =  345 bits (885),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 165/319 (51%), Positives = 228/319 (71%), Gaps = 5/319 (1%)

Query  4    LSPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKL  63
            + P+E GG G+P  ++   +E+++ AN++F L P L+ GAI A+   GS+E KQ++LP+L
Sbjct  93   VHPAEFGGQGLPKLVATPCIEMMNAANMSFALCPLLTDGAIEALLTAGSDELKQRYLPRL  152

Query  64   VSGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVL  123
            ++GEWTGTMNL+EPQ+GSDL  + ++AE Q DGSYK++GTK++IT+GEHDM ENI+HLVL
Sbjct  153  IAGEWTGTMNLTEPQAGSDLALVRSRAERQADGSYKVSGTKIFITYGEHDMAENIVHLVL  212

Query  124  AKVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---D  180
            A+ P +PEG KGIS+F+VPK  +NDDGSLG  N+V C+SIE KLGI ASPT V+++    
Sbjct  213  ARTPDAPEGVKGISLFLVPKFLVNDDGSLGARNDVECVSIEHKLGIKASPTAVLQFGDNG  272

Query  181  GSVGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSK  240
            G++GYLIGEENRGL YMF MMN AR  VG QG+A ++ A Q A  YA++RVQ RP+  S 
Sbjct  273  GAIGYLIGEENRGLEYMFVMMNAARFGVGVQGIAISDRAYQQAVAYAKERVQSRPVDGSS  332

Query  241  EDAKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGI  300
            +DA   TII H DVRRML+ ++A  +  R L        DL + + D ET+A        
Sbjct  333  KDA--VTIIQHPDVRRMLIEMRALTEGARALALVAAGYSDLAHQSPDAETRAHYGAAYEY  390

Query  301  LTPVTKAWVSDLGVELSSV  319
            L PV K W +++ +E++S+
Sbjct  391  LVPVIKGWSTEMSLEVTSL  409


>ref|YP_293528.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Ralstonia eutropha JMP134]
 gb|AAZ65671.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Ralstonia eutropha JMP134]
Length=594

 Score =  343 bits (881),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 222/319 (69%), Gaps = 5/319 (1%)

Query  4    LSPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKL  63
            + P E  G G+P  ++   +E+L +ANL+F L P L+ GAI A+   GS+EQK  FLP+L
Sbjct  93   MHPQEFDGQGLPRLIAAACIEMLHSANLSFALCPMLTDGAIEALLTAGSDEQKATFLPRL  152

Query  64   VSGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVL  123
            +SGEWTGTMNL+EPQ+GSDL  + T+AE QGDG+YK+ GTK++IT+GEHDM +NI+HLVL
Sbjct  153  ISGEWTGTMNLTEPQAGSDLAAVRTRAEPQGDGTYKVFGTKIFITYGEHDMADNIVHLVL  212

Query  124  AKVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---D  180
            A+ P +PEG KGIS+FIVPK  +N DGSLG  N+V+C+SIE KLGI ASPT V+++    
Sbjct  213  ARTPNAPEGVKGISLFIVPKFLVNADGSLGARNDVHCVSIEHKLGIKASPTAVLQFGDHG  272

Query  181  GSVGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSK  240
            G++G L+GEENRGL YMF MMN AR  VG QG+A +  A Q A  YAR+RVQ RP+  S 
Sbjct  273  GAIGTLVGEENRGLEYMFIMMNSARFAVGMQGIAVSERAYQQAVAYARERVQSRPVDGSA  332

Query  241  EDAKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGI  300
             +A   TII H DV+RMLMT++  V+  R + Y    + D+ +   D   +   +     
Sbjct  333  REA--VTIIHHPDVKRMLMTMRGLVEGARSVAYVAAAICDVAHNHPDAAVRKESQAVYEF  390

Query  301  LTPVTKAWVSDLGVELSSV  319
            L PV K W ++L ++++S+
Sbjct  391  LVPVVKGWSTELSIDVTSL  409


>ref|ZP_01862814.1| putative acyl-CoA dehydrogenase protein [Erythrobacter sp. SD-21]
 gb|EDL50249.1| putative acyl-CoA dehydrogenase protein [Erythrobacter sp. SD-21]
Length=601

 Score =  342 bits (878),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 174/312 (55%), Positives = 225/312 (72%), Gaps = 1/312 (0%)

Query  8    EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  67
            E GG GMP  L     E +S+AN AFG+ PGL+ GAISA+   GS+EQK  +LPK+VSGE
Sbjct  99   EFGGQGMPHVLGFVMEEFISSANQAFGMYPGLTNGAISALLAKGSDEQKAMYLPKMVSGE  158

Query  68   WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  127
            WTGTMNL+EP  G+DLG I TKAE  GDGSY ITGTK++I+ GEHDM+ENIIHLVLAK P
Sbjct  159  WTGTMNLTEPHCGTDLGMIRTKAEPLGDGSYAITGTKIFISAGEHDMSENIIHLVLAKTP  218

Query  128  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLI  187
            G+P+ TKGIS+F+VPK  +N+DG+ GE N V C SIEEK+GIH + TCV+ YDG+ G+++
Sbjct  219  GAPDSTKGISLFVVPKFLVNEDGTPGERNGVMCGSIEEKMGIHGNSTCVLNYDGAKGWMV  278

Query  188  GEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAKNS  246
            GEEN+GL  MF MMN AR+ VG QGL+ A  A Q A  YA DR QGR + G ++ +A+  
Sbjct  279  GEENKGLAAMFIMMNAARLGVGMQGLSQAEVAYQNAVAYALDRRQGRALTGPAEPEAQAD  338

Query  247  TIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVTK  306
             I  H DVRRMLM  KA+ +AMR L     L++DL + A+ EE +A  +   G++TPV K
Sbjct  339  PIFVHPDVRRMLMDAKAFTEAMRALALWGGLLVDLTHKAQTEEERAEADLLLGLMTPVIK  398

Query  307  AWVSDLGVELSS  318
             + +D G E+++
Sbjct  399  GYGTDKGYEVAT  410


>ref|YP_002824722.1| acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234]
 gb|ACP23969.1| acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234]
Length=598

 Score =  342 bits (877),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 221/316 (69%), Gaps = 1/316 (0%)

Query  5    SPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLV  64
            +P E GG G+P TL     E LS AN++  + PGL+ GAI+AI  HGSEEQK+ +LPK+V
Sbjct  96   APEEFGGQGLPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMV  155

Query  65   SGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLA  124
             G WTGTMNL+EP  G+DLG + TKA   GDGSY+I+G K++I+ GEHDM ENIIHLVLA
Sbjct  156  DGTWTGTMNLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAGEHDMAENIIHLVLA  215

Query  125  KVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVG  184
            ++ G+PEG KGIS+FIVPK K+NDDG  G  N V+C +IE K+GIH + TCVM YD + G
Sbjct  216  RIEGAPEGVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIHGNSTCVMNYDEATG  275

Query  185  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDA  243
            YLIG EN+GLN MF MMNEAR+ VG QGLA A  A Q AA YAR+R+QGR + G+   + 
Sbjct  276  YLIGAENKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGVKAPEQ  335

Query  244  KNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTP  303
            K   II H DVRR LMTIKA+ +A R       L  D+ + +++E  +   ++  G++TP
Sbjct  336  KADPIIVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGLMTP  395

Query  304  VTKAWVSDLGVELSSV  319
            + K  ++D G + + V
Sbjct  396  ILKGVLTDKGFDHTVV  411

----------------------------------------------------------------------------------------------------------------------
b)Blastx

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01256117.1|  probable acyl-CoA dehydrogenase [Psychrofl...   488    3e-136
ref|ZP_01017414.1|  probable acyl-CoA dehydrogenase [Parvularc...   343    2e-92 
ref|YP_001412055.1|  acyl-CoA dehydrogenase domain-containing ...   343    2e-92 
ref|ZP_01862814.1|  putative acyl-CoA dehydrogenase protein [E...   338    5e-91 
ref|ZP_06229014.1|  acyl-CoA dehydrogenase domain protein [Bur...   337    1e-90 
ref|NP_353529.2|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   335    6e-90 
ref|YP_933206.1|  acyl-CoA dehydrogenase [Azoarcus sp. BH72] >...   334    8e-90 
ref|ZP_01546756.1|  acyl-CoA dehydrogenase [Stappia aggregata ...   334    8e-90 
ref|YP_002543346.1|  acyl-CoA dehydrogenase protein [Agrobacte...   334    1e-89 
ref|YP_760546.1|  acyl-CoA dehydrogenase family protein [Hypho...   334    1e-89 
ref|YP_002824722.1|  acyl-CoA dehydrogenase protein [Rhizobium...   333    2e-89 
ref|ZP_01165298.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   333    2e-89 
ref|ZP_03270334.1|  acyl-CoA dehydrogenase domain protein [Bur...   333    2e-89 
ref|YP_001989918.1|  acyl-CoA dehydrogenase domain protein [Rh...   333    2e-89 
ref|NP_946169.1|  putative acyl-CoA dehydrogenase [Rhodopseudo...   333    2e-89 
ref|ZP_06356599.1|  acyl-CoA dehydrogenase domain protein [Rho...   332    3e-89 
ref|YP_001758385.1|  acyl-CoA dehydrogenase domain-containing ...   332    3e-89 
ref|YP_296348.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   331    7e-89 
ref|YP_002500387.1|  acyl-CoA dehydrogenase domain protein [Me...   330    1e-88 
ref|YP_458068.1|  putative acyl-CoA dehydrogenase protein [Ery...   330    1e-88 
ref|YP_002153992.1|  putative acyl-CoA dehydrogenase [Burkhold...   330    2e-88 
ref|YP_002004838.1|  putative ACYL-COA DEHYDROGENASE OXIDOREDU...   330    2e-88 
ref|ZP_02893274.1|  acyl-CoA dehydrogenase domain protein [Bur...   330    2e-88 
ref|YP_001411742.1|  acyl-CoA dehydrogenase domain-containing ...   330    2e-88 
ref|ZP_02907250.1|  acyl-CoA dehydrogenase domain protein [Bur...   329    2e-88 
ref|YP_001774374.1|  acyl-CoA dehydrogenase domain-containing ...   329    2e-88 
ref|YP_621433.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   329    2e-88 
ref|ZP_01226619.1|  acyl-CoA dehydrogenase [Aurantimonas manga...   329    3e-88 
ref|YP_366562.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   329    3e-88 
ref|YP_368418.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   329    3e-88 
ref|ZP_04944096.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   329    3e-88 
ref|ZP_05117417.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   328    4e-88 
ref|YP_725331.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   328    4e-88 
ref|ZP_02168376.1|  acyl-CoA dehydrogenase [Hoeflea phototroph...   328    6e-88 
ref|ZP_04948959.1|  Acyl-CoA dehydrogenase [Burkholderia dolos...   328    6e-88 
ref|ZP_05085339.1|  acyl-CoA dehydrogenase family protein [Pse...   328    7e-88 
ref|YP_002260115.1|  acyl-coa dehydrogenase protein [Ralstonia...   328    7e-88 
ref|YP_002255748.1|  acyl-coa dehydrogenase protein [Ralstonia...   328    7e-88 
ref|ZP_00942866.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   328    7e-88 
ref|YP_582894.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   328    7e-88 
ref|YP_001815529.1|  acyl-CoA dehydrogenase domain-containing ...   327    9e-88 
ref|YP_497378.1|  acyl-CoA dehydrogenase-like [Novosphingobium...   327    9e-88 
ref|YP_293528.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   327    9e-88 
ref|ZP_02356525.1|  acyl-CoA dehydrogenase domain protein [Bur...   327    1e-87 
ref|YP_001770117.1|  acyl-CoA dehydrogenase domain-containing ...   327    1e-87 
ref|YP_468102.1|  acyl-CoA dehydrogenase protein [Rhizobium et...   327    1e-87 
ref|YP_777654.1|  acyl-CoA dehydrogenase domain-containing pro...   327    1e-87 
ref|YP_001117004.1|  acyl-CoA dehydrogenase domain-containing ...   327    1e-87 
ref|ZP_01303435.1|  putative acyl-CoA dehydrogenase protein [S...   327    2e-87 
ref|ZP_02363647.1|  acyl-CoA dehydrogenase domain protein [Bur...   326    2e-87 
ref|YP_001898378.1|  acyl-CoA dehydrogenase domain protein [Ra...   326    2e-87 
ref|ZP_01895244.1|  Acyl-CoA dehydrogenase [Marinobacter algic...   326    3e-87 
ref|YP_987025.1|  acyl-CoA dehydrogenase domain-containing pro...   326    3e-87 
ref|YP_003059320.1|  acyl-CoA dehydrogenase domain protein [Hi...   325    5e-87 
ref|YP_002279739.1|  acyl-CoA dehydrogenase domain protein [Rh...   325    5e-87 
ref|YP_001926127.1|  acyl-CoA dehydrogenase domain protein [Me...   325    5e-87 
ref|ZP_01737947.1|  Acyl-CoA dehydrogenase [Marinobacter sp. E...   325    5e-87 
ref|YP_960011.1|  acyl-CoA dehydrogenase domain-containing pro...   325    5e-87 
ref|YP_672593.1|  acyl-CoA dehydrogenase-like [Mesorhizobium s...   325    5e-87 
ref|YP_003069515.1|  acyl-CoA dehydrogenase [Methylobacterium ...   325    6e-87 
ref|YP_002964470.1|  acyl-CoA dehydrogenase [Methylobacterium ...   325    6e-87 
ref|ZP_03571578.1|  acyl-CoA dehydrogenase domain protein [Bur...   325    6e-87 
ref|YP_002422317.1|  acyl-CoA dehydrogenase domain protein [Me...   325    6e-87 
ref|YP_002980839.1|  acyl-CoA dehydrogenase domain protein [Ra...   325    6e-87 
ref|YP_002897729.1|  acyl-CoA dehydrogenase [Burkholderia pseu...   324    8e-87 
ref|YP_002355900.1|  acyl-CoA dehydrogenase domain protein [Th...   324    8e-87 
ref|YP_002974091.1|  acyl-CoA dehydrogenase domain protein [Rh...   324    8e-87 
ref|YP_001640703.1|  acyl-CoA dehydrogenase domain-containing ...   324    8e-87 
ref|YP_766200.1|  putative acyl-CoA dehydrogenase [Rhizobium l...   324    8e-87 
ref|YP_283456.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   324    8e-87 
ref|YP_334354.1|  Acyl-CoA dehydrogenase [Burkholderia pseudom...   324    8e-87 
ref|YP_109093.1|  putative acyl-CoA dehydrogenase [Burkholderi...   324    8e-87 
ref|ZP_06122213.1|  acyl-CoA dehydrogenase domain protein [Cau...   324    1e-86 
ref|YP_001976799.1|  acyl-CoA dehydrogenase protein [Rhizobium...   324    1e-86 
ref|YP_296753.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   324    1e-86 
ref|ZP_03588669.1|  acyl-CoA dehydrogenase domain protein [Bur...   323    1e-86 
ref|ZP_02373945.1|  acyl-CoA dehydrogenase domain protein [Bur...   323    1e-86 
ref|ZP_02168120.1|  probable acyl-CoA dehydrogenase [Hoeflea p...   323    1e-86 
ref|YP_001856999.1|  acyl-CoA dehydrogenase domain-containing ...   323    1e-86 
ref|YP_488200.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   323    1e-86 
ref|YP_160743.1|  acyl-CoA dehydrogenase [Aromatoleum aromatic...   323    1e-86 
ref|NP_519046.1|  putative acyl-CoA dehydrogenase oxidoreducta...   323    1e-86 
ref|ZP_05787012.1|  acyl-CoA dehydrogenase family protein [Sil...   323    2e-86 
ref|ZP_03270255.1|  acyl-CoA dehydrogenase domain protein [Bur...   323    2e-86 
ref|YP_001208541.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   323    2e-86 
ref|YP_001860106.1|  acyl-CoA dehydrogenase domain-containing ...   323    2e-86 
ref|YP_559999.1|  putative acyl-CoA dehydrogenase [Burkholderi...   323    2e-86 
ref|YP_442192.1|  acyl-CoA dehydrogenase domain-containing pro...   323    2e-86 
ref|YP_001114835.1|  acyl-CoA dehydrogenase domain-containing ...   323    2e-86 
ref|YP_002289865.1|  acyl-CoA dehydrogenase [Oligotropha carbo...   323    2e-86 
ref|YP_001174323.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   323    2e-86 
ref|YP_001236983.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   323    2e-86 
ref|YP_001563416.1|  acyl-CoA dehydrogenase domain-containing ...   322    3e-86 
ref|YP_436458.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   322    3e-86 
ref|YP_530627.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   322    3e-86 
ref|ZP_04887704.1|  acyl-CoA dehydrogenase domain protein [Bur...   322    3e-86 
ref|YP_001585325.1|  acyl-CoA dehydrogenase domain-containing ...   322    4e-86 
ref|YP_840852.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   322    4e-86 
ref|ZP_01308202.1|  probable acyl-CoA dehydrogenase [Oceanobac...   322    4e-86 
ref|ZP_06293458.1|  acyl-CoA dehydrogenase domain protein [Bur...   322    5e-86 
ref|ZP_06173413.1|  acyl-CoA dehydrogenase domain protein [Bre...   322    5e-86 
ref|YP_554917.1|  putative acyl-CoA dehydrogenase [Burkholderi...   322    5e-86 
ref|YP_001532185.1|  acyl-CoA dehydrogenase domain protein [Di...   321    7e-86 
ref|YP_002796897.1|  Probable acyl-CoA dehydrogenase [Laribact...   321    9e-86 
ref|ZP_02884895.1|  acyl-CoA dehydrogenase domain protein [Bur...   321    9e-86 
ref|NP_384640.1|  putative acyl-CoA dehydrogenase protein [Sin...   321    9e-86 
ref|YP_983504.1|  acyl-CoA dehydrogenase domain-containing pro...   321    9e-86 
ref|YP_779610.1|  acyl-CoA dehydrogenase domain-containing pro...   321    9e-86 
ref|YP_267920.1|  acyl-CoA dehydrogenase family protein [Colwe...   320    1e-85 
ref|ZP_01039672.1|  putative acyl-coa dehydrogenase protein [E...   320    1e-85 
ref|YP_788678.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   320    1e-85 
ref|ZP_06224622.1|  acyl-CoA dehydrogenase domain protein [Bur...   320    2e-85 
ref|YP_003278934.1|  acyl-CoA dehydrogenase-like protein [Coma...   320    2e-85 
ref|YP_002875101.1|  putative dehydrogenase [Pseudomonas fluor...   320    2e-85 
ref|YP_001346004.1|  putative acyl-CoA dehydrogenase [Pseudomo...   320    2e-85 
ref|ZP_04679614.1|  acyl-CoA dehydrogenase domain-containing p...   320    2e-85 
ref|ZP_02189776.1|  acyl-CoA dehydrogenase [alpha proteobacter...   320    2e-85 
ref|YP_001369088.1|  acyl-CoA dehydrogenase domain-containing ...   320    2e-85 
ref|YP_523521.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   320    2e-85 
ref|YP_002910784.1|  Acyl-CoA dehydrogenase-like protein [Burk...   319    3e-85 
ref|YP_002548430.1|  acyl-CoA dehydrogenase [Agrobacterium vit...   319    3e-85 
ref|ZP_05085247.1|  acyl-CoA dehydrogenase [Pseudovibrio sp. J...   319    3e-85 
ref|YP_001896601.1|  acyl-CoA dehydrogenase domain protein [Bu...   319    3e-85 
ref|YP_001325840.1|  acyl-CoA dehydrogenase domain-containing ...   319    3e-85 
ref|NP_249199.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   319    3e-85 
ref|ZP_04930590.1|  hypothetical protein PACG_03331 [Pseudomon...   319    3e-85 
ref|YP_001372566.1|  acyl-CoA dehydrogenase domain-containing ...   319    3e-85 
ref|ZP_01895245.1|  Acyl-CoA dehydrogenase [Marinobacter algic...   319    3e-85 
ref|YP_001751677.1|  acyl-CoA dehydrogenase domain-containing ...   319    3e-85 
ref|YP_001326179.1|  acyl-CoA dehydrogenase domain-containing ...   319    3e-85 
ref|NP_946311.1|  putative acyl-CoA dehydrogenase [Rhodopseudo...   319    3e-85 
ref|NP_767798.1|  acyl-CoA dehydrogenase [Bradyrhizobium japon...   319    3e-85 
ref|ZP_02467714.1|  acyl-CoA dehydrogenase domain protein [Bur...   318    4e-85 
ref|YP_001990060.1|  acyl-CoA dehydrogenase domain protein [Rh...   318    4e-85 
ref|YP_001666647.1|  acyl-CoA dehydrogenase domain-containing ...   318    4e-85 
ref|NP_418899.1|  acyl-CoA dehydrogenase family protein [Caulo...   318    4e-85 
ref|NP_742537.1|  acyl-CoA dehydrogenase domain-containing pro...   318    4e-85 
ref|YP_001265753.1|  acyl-CoA dehydrogenase domain-containing ...   318    4e-85 
ref|YP_750723.1|  acyl-CoA dehydrogenase domain-containing pro...   318    4e-85 
ref|YP_001020495.1|  putative acyl-CoA dehydrogenase oxidoredu...   318    4e-85 
ref|NP_903486.1|  acyl-CoA dehydrogenase [Chromobacterium viol...   318    6e-85 
ref|NP_769297.1|  acyl-CoA dehydrogenase [Bradyrhizobium japon...   318    6e-85 
ref|ZP_04682674.1|  acyl-CoA dehydrogenase domain-containing p...   318    8e-85 
ref|ZP_05051234.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   318    8e-85 
ref|YP_001798027.1|  acyl-CoA dehydrogenase domain protein [Po...   318    8e-85 
ref|YP_549953.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   318    8e-85 
ref|YP_262742.1|  acyl-CoA dehydrogenase family protein [Pseud...   318    8e-85 
ref|YP_567943.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   318    8e-85 
ref|YP_616583.1|  acyl-CoA dehydrogenase-like protein [Sphingo...   318    8e-85 
ref|ZP_05180403.1|  Acyl-CoA dehydrogenase [Brucella sp. 83/13...   317    1e-84 
gb|ACT32396.1|  acyl-CoA dehydrogenase family protein [Pseudom...   317    1e-84 
ref|ZP_01546683.1|  putative acyl-coa dehydrogenase protein [S...   317    1e-84 
ref|YP_684109.1|  acyl-CoA dehydrogenase family protein [Roseo...   317    1e-84 
ref|ZP_01228041.1|  acyl-CoA dehydrogenase [Aurantimonas manga...   317    1e-84 
ref|YP_237742.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   317    1e-84 
ref|YP_350894.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   317    1e-84 
ref|YP_759397.1|  acyl-CoA dehydrogenase family protein [Hypho...   317    1e-84 
ref|NP_384981.1|  putative acyl-CoA dehydrogenase protein [Sin...   317    1e-84 
ref|ZP_06068128.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   317    2e-84 
ref|YP_003167561.1|  acyl-CoA dehydrogenase domain protein [Ca...   317    2e-84 
ref|ZP_03824896.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   317    2e-84 
ref|YP_001791568.1|  acyl-CoA dehydrogenase domain-containing ...   317    2e-84 
ref|ZP_06457729.1|  acyl-CoA dehydrogenase domain-containing p...   316    2e-84 
ref|ZP_05782146.1|  acyl-CoA dehydrogenase domain protein [Cit...   316    2e-84 
ref|YP_002297847.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   316    2e-84 
ref|ZP_03542503.1|  acyl-CoA dehydrogenase domain protein [Com...   316    2e-84 
ref|YP_610525.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   316    2e-84 
ref|ZP_01078586.1|  probable acyl-CoA dehydrogenase [Marinomon...   316    2e-84 
ref|ZP_01043879.1|  Acyl-CoA dehydrogenase family protein [Idi...   316    2e-84 
ref|YP_531038.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   316    2e-84 
ref|ZP_05456939.1|  Acyl-CoA dehydrogenase [Brucella ceti M490...   316    3e-84 
ref|ZP_05169684.1|  Acyl-CoA dehydrogenase [Brucella pinnipedi...   316    3e-84 
ref|ZP_05163047.1|  acyl-CoA dehydrogenase domain-containing p...   316    3e-84 
ref|ZP_05096170.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   316    3e-84 
ref|YP_001627098.1|  acyl-CoA dehydrogenase domain-containing ...   316    3e-84 
ref|ZP_01878299.1|  acyl-CoA dehydrogenase family protein [Ros...   316    3e-84 
ref|YP_001258435.1|  acyl-CoA dehydrogenase family protein [Br...   316    3e-84 
ref|YP_001189558.1|  acyl-CoA dehydrogenase domain-containing ...   316    3e-84 
ref|YP_459508.1|  acyl-CoA dehydrogenase family protein [Eryth...   316    3e-84 
ref|NP_697443.1|  acyl-CoA dehydrogenase family protein [Bruce...   316    3e-84 
ref|NP_540438.1|  acyl-COA dehydrogenase [Brucella melitensis ...   316    3e-84 
ref|YP_221192.1|  acyl-CoA dehydrogenase family protein [Bruce...   316    3e-84 
ref|ZP_06792465.1|  acyl-CoA dehydrogenase [Brucella sp. NVSL ...   315    4e-84 
ref|ZP_06211580.1|  acyl-CoA dehydrogenase domain protein [Aci...   315    4e-84 
ref|ZP_05078653.1|  acyl-CoA dehydrogenase family protein [Rho...   315    4e-84 
ref|YP_001681767.1|  acyl-CoA dehydrogenase domain-containing ...   315    4e-84 
ref|ZP_00953065.1|  acyl-CoA dehydrogenase family protein [Oce...   315    4e-84 
ref|YP_001189560.1|  acyl-CoA dehydrogenase domain-containing ...   315    5e-84 
ref|YP_970522.1|  acyl-CoA dehydrogenase domain-containing pro...   315    5e-84 
ref|YP_510912.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   315    5e-84 
ref|ZP_05181906.1|  hypothetical protein Bru83_11263 [Brucella...   315    6e-84 
ref|ZP_05067731.1|  acyl-CoA dehydrogenase [Octadecabacter ant...   315    6e-84 
ref|YP_002945255.1|  acyl-CoA dehydrogenase domain protein [Va...   314    8e-84 
ref|YP_002946160.1|  acyl-CoA dehydrogenase domain protein [Va...   314    8e-84 
ref|ZP_02141954.1|  acyl-CoA dehydrogenase family protein [Ros...   314    8e-84 
ref|YP_001204263.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   314    8e-84 
ref|ZP_01748988.1|  acyl-CoA dehydrogenase family protein [Ros...   314    8e-84 
ref|ZP_01737946.1|  acyl-CoA dehydrogenase family protein [Mar...   314    8e-84 
ref|YP_488048.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   314    8e-84 
ref|NP_106251.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   314    8e-84 
ref|ZP_06358681.1|  acyl-CoA dehydrogenase domain protein [Rho...   314    1e-83 
ref|ZP_03787300.1|  acyl-COA dehydrogenase [Brucella ceti str....   314    1e-83 
ref|ZP_02147349.1|  enoyl-CoA hydratase [Phaeobacter gallaecie...   314    1e-83 
ref|ZP_02149838.1|  acyl-CoA dehydrogenase family protein [Pha...   314    1e-83 
ref|YP_276814.1|  acyl-CoA dehydrogenase family protein [Pseud...   314    1e-83 
ref|NP_699969.1|  acyl-CoA dehydrogenase family protein [Bruce...   314    1e-83 
ref|YP_580715.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   314    1e-83 
ref|ZP_06481992.1|  acyl-CoA dehydrogenase domain-containing p...   313    1e-83 
emb|CBA33057.1|  hypothetical protein [Curvibacter putative sy...   313    1e-83 
ref|ZP_05637106.1|  acyl-CoA dehydrogenase family protein [Pse...   313    1e-83 
ref|ZP_05450716.1|  Acyl-CoA dehydrogenase [Brucella neotomae ...   313    1e-83 
ref|YP_003058830.1|  acyl-CoA dehydrogenase domain protein [Hi...   313    1e-83 
ref|YP_002734534.1|  acyl-CoA dehydrogenase domain protein [Br...   313    1e-83 
ref|ZP_05128211.1|  acyl-CoA dehydrogenase domain protein [gam...   313    1e-83 
emb|CAM76992.1|  acyl-CoA dehydrogenase family protein [Magnet...   313    1e-83 
ref|YP_576121.1|  acyl-CoA dehydrogenase-like [Nitrobacter ham...   313    1e-83 
ref|NP_541473.1|  acyl-COA dehydrogenase [Brucella melitensis ...   313    1e-83 
ref|ZP_01074271.1|  acyl-CoA dehydrogenase, putative [Marinomo...   313    1e-83 
ref|ZP_01048481.1|  acyl-CoA dehydrogenase [Nitrobacter sp. Nb...   313    1e-83 
ref|ZP_01037196.1|  acyl-CoA dehydrogenase family protein [Ros...   313    1e-83 
ref|YP_001238565.1|  putative acyl-CoA dehydrogenase [Bradyrhi...   313    1e-83 
ref|ZP_05637108.1|  acyl-CoA dehydrogenase family protein [Pse...   313    2e-83 
ref|ZP_05376718.1|  acyl-CoA dehydrogenase domain protein [Hyp...   313    2e-83 
ref|ZP_04763262.1|  acyl-CoA dehydrogenase domain protein [Aci...   313    2e-83 
ref|ZP_03696966.1|  acyl-CoA dehydrogenase domain protein [Lut...   313    2e-83 
ref|ZP_01863592.1|  acyl-CoA dehydrogenase family protein [Ery...   313    2e-83 
ref|YP_436457.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   313    2e-83 
ref|YP_223222.1|  acyl-CoA dehydrogenase family protein [Bruce...   313    2e-83 
ref|ZP_06464907.1|  acyl-CoA dehydrogenase domain protein [Bur...   313    2e-83 
ref|ZP_06064964.1|  acyl-CoA dehydrogenase [Acinetobacter juni...   313    2e-83 
ref|YP_001340434.1|  acyl-CoA dehydrogenase domain-containing ...   313    2e-83 
ref|ZP_01308203.1|  Acyl-CoA dehydrogenase [Oceanobacter sp. R...   313    2e-83 
ref|YP_960012.1|  acyl-CoA dehydrogenase domain-containing pro...   313    2e-83 
ref|YP_002801677.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   312    3e-83 
ref|YP_237746.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   312    4e-83 
ref|ZP_06794103.1|  acyl-CoA dehydrogenase [Brucella sp. NVSL ...   311    5e-83 
ref|ZP_06495234.1|  acyl-CoA dehydrogenase domain-containing p...   311    5e-83 
ref|ZP_06074015.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   311    5e-83 
ref|ZP_05121771.1|  acyl-CoA dehydrogenase family protein [Rho...   311    5e-83 
ref|ZP_01616720.1|  probable acyl-CoA dehydrogenase [marine ga...   311    5e-83 
ref|YP_766577.1|  putative Acyl-CoA dehydrogenase [Rhizobium l...   311    5e-83 
ref|ZP_01017594.1|  acyl-CoA dehydrogenase [Parvularcula bermu...   311    5e-83 
ref|ZP_00948297.1|  acyl-CoA dehydrogenase family protein [Sul...   311    5e-83 
ref|ZP_05164959.1|  hypothetical protein Bsuib36_04187 [Brucel...   311    7e-83 
ref|YP_001834319.1|  acyl-CoA dehydrogenase domain-containing ...   311    7e-83 
ref|ZP_02151332.1|  acyl-CoA dehydrogenase family protein [Pha...   311    7e-83 
ref|YP_495410.1|  acyl-CoA dehydrogenase-like [Novosphingobium...   311    7e-83 
ref|YP_468443.1|  acyl-CoA dehydrogenase protein [Rhizobium et...   311    7e-83 
ref|YP_276816.1|  acyl-CoA dehydrogenase family protein [Pseud...   311    7e-83 
ref|YP_156344.1|  Acyl-CoA dehydrogenase family protein [Idiom...   311    7e-83 
ref|YP_264252.1|  putative acyl-CoA dehydrogenase [Psychrobact...   311    7e-83 
ref|YP_571416.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   311    7e-83 
ref|YP_673288.1|  acyl-CoA dehydrogenase-like [Mesorhizobium s...   311    7e-83 
ref|ZP_05360616.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   311    9e-83 
ref|YP_168123.1|  acyl-CoA dehydrogenase family protein [Ruege...   311    9e-83 
ref|ZP_06495237.1|  acyl-CoA dehydrogenase domain-containing p...   310    1e-82 
ref|ZP_04590882.1|  acyl-CoA dehydrogenase family protein [Pse...   310    1e-82 
ref|YP_001666645.1|  acyl-CoA dehydrogenase domain-containing ...   310    1e-82 
ref|YP_001380348.1|  acyl-CoA dehydrogenase domain-containing ...   310    1e-82 
ref|YP_527357.1|  putative acyl-CoA dehydrogenase [Saccharopha...   310    1e-82 
ref|ZP_05810173.1|  acyl-CoA dehydrogenase domain protein [Mes...   310    2e-82 
ref|ZP_04958063.1|  acyl-CoA dehydrogenase domain protein [gam...   310    2e-82 
ref|ZP_01747810.1|  acyl-CoA dehydrogenase family protein [Sag...   310    2e-82 
ref|YP_001751679.1|  acyl-CoA dehydrogenase domain-containing ...   310    2e-82 
ref|ZP_01445402.1|  acyl-CoA dehydrogenase family protein [Ros...   310    2e-82 
ref|YP_001279812.1|  acyl-CoA dehydrogenase domain-containing ...   310    2e-82 
ref|ZP_01102887.1|  acyl-CoA dehydrogenase [Congregibacter lit...   310    2e-82 
ref|YP_780008.1|  acyl-CoA dehydrogenase domain-containing pro...   310    2e-82 
ref|ZP_05089946.1|  acyl-CoA dehydrogenase family protein [Rue...   310    2e-82 
ref|ZP_03395876.1|  acyl-CoA dehydrogenase family protein [Pse...   310    2e-82 
ref|YP_001792615.1|  acyl-CoA dehydrogenase domain-containing ...   310    2e-82 
ref|YP_002280078.1|  acyl-CoA dehydrogenase domain protein [Rh...   310    2e-82 
ref|ZP_01904469.1|  acyl-CoA dehydrogenase family protein [Ros...   310    2e-82 
ref|NP_790349.1|  acyl-CoA dehydrogenase family protein [Pseud...   310    2e-82 
ref|YP_262745.1|  acyl-CoA dehydrogenase family protein [Pseud...   310    2e-82 
ref|YP_003544415.1|  acyl-CoA dehydrogenase [Sphingobium japon...   309    3e-82 
ref|YP_003447686.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   309    3e-82 
ref|ZP_03395873.1|  acyl-CoA dehydrogenase family protein [Pse...   309    3e-82 
ref|ZP_02143501.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   309    3e-82 
ref|NP_790354.1|  acyl-CoA dehydrogenase family protein [Pseud...   309    3e-82 
ref|ZP_00953752.1|  acyl-CoA dehydrogenase family protein [Sul...   309    3e-82 
ref|NP_742535.1|  acyl-CoA dehydrogenase domain-containing pro...   309    3e-82 
ref|ZP_03523533.1|  probable acyl-CoA dehydrogenase protein [R...   309    3e-82 
ref|YP_528601.1|  acyl-CoA dehydrogenase family protein [Sacch...   309    3e-82 
ref|YP_317256.1|  acyl-CoA dehydrogenase [Nitrobacter winograd...   309    3e-82 
ref|YP_001352277.1|  acyl-CoA dehydrogenase [Janthinobacterium...   308    5e-82 
ref|YP_425527.1|  Acyl-CoA dehydrogenase [Rhodospirillum rubru...   308    5e-82 
ref|YP_350898.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   308    5e-82 
ref|ZP_00948404.1|  acyl-CoA dehydrogenase family protein [Sul...   308    5e-82 
ref|YP_001977160.1|  probable acyl-CoA dehydrogenase protein [...   308    6e-82 
ref|ZP_02153139.1|  acyl-CoA dehydrogenase family protein [Oce...   308    6e-82 
ref|ZP_01627175.1|  acyl-CoA dehydrogenase [marine gamma prote...   308    6e-82 
ref|YP_693822.1|  acyl-CoA dehydrogenase, putative [Alcanivora...   308    6e-82 
ref|ZP_01011706.1|  acyl-CoA dehydrogenase family protein [Rho...   308    6e-82 
ref|ZP_00953859.1|  acyl-CoA dehydrogenase family protein [Sul...   308    6e-82 
ref|ZP_00958569.1|  acyl-CoA dehydrogenase family protein [Ros...   308    6e-82 
ref|YP_003449788.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   308    8e-82 
ref|YP_001098947.1|  putative acyl-CoA dehydrogenase [Herminii...   308    8e-82 
ref|YP_610527.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   308    8e-82 
ref|YP_432962.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   308    8e-82 
ref|ZP_00997794.1|  acyl-CoA dehydrogenase family protein [Oce...   308    8e-82 
ref|ZP_06064371.1|  acyl-CoA dehydrogenase [Acinetobacter john...   307    1e-81 
ref|YP_002875104.1|  putative dehydrogenase [Pseudomonas fluor...   307    1e-81 
ref|ZP_03519484.1|  probable acyl-CoA dehydrogenase protein [R...   307    1e-81 
ref|YP_284774.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   307    1e-81 
ref|ZP_00441648.1|  acyl-CoA dehydrogenase [Burkholderia malle...   307    1e-81 
ref|YP_003551507.1|  acyl-CoA dehydrogenase [alpha proteobacte...   307    1e-81 
ref|ZP_06123153.1|  acyl-CoA dehydrogenase domain protein [Cau...   307    1e-81 
ref|YP_284441.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   307    1e-81 
ref|ZP_06687177.1|  acyl-CoA dehydrogenase [Achromobacter piec...   306    2e-81 
ref|ZP_05034629.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   306    2e-81 
ref|YP_002974443.1|  acyl-CoA dehydrogenase domain protein [Rh...   306    2e-81 
ref|XP_001746745.1|  hypothetical protein [Monosiga brevicolli...   306    2e-81 
ref|YP_001264280.1|  acyl-CoA dehydrogenase domain-containing ...   306    2e-81 
ref|YP_603577.1|  acyl-CoA dehydrogenase-like protein [Deinoco...   306    2e-81 
ref|ZP_06350780.1|  acyl-CoA dehydrogenase domain protein [Rho...   306    2e-81 
ref|ZP_01439801.1|  probable acyl-CoA dehydrogenase [Fulvimari...   306    2e-81 
ref|ZP_01156949.1|  acyl-CoA dehydrogenase family protein [Oce...   306    2e-81 
ref|ZP_00957741.1|  acyl-CoA dehydrogenase family protein [Oce...   306    2e-81 
ref|ZP_00051081.2|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   306    2e-81 
ref|ZP_03714050.1|  hypothetical protein EIKCOROL_01746 [Eiken...   306    3e-81 
ref|YP_001174325.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   306    3e-81 
ref|YP_001860109.1|  acyl-CoA dehydrogenase domain-containing ...   306    3e-81 
ref|YP_001155298.1|  acyl-CoA dehydrogenase domain-containing ...   306    3e-81 
ref|YP_981461.1|  acyl-CoA dehydrogenase domain-containing pro...   306    3e-81 
ref|ZP_05620312.1|  acyl-CoA dehydrogenase domain protein [Enh...   305    4e-81 
ref|YP_002825039.1|  acyl-CoA dehydrogenase domain protein [Rh...   305    4e-81 
ref|YP_002438111.1|  putative acyl-CoA dehydrogenase [Pseudomo...   305    4e-81 
ref|YP_002129401.1|  acyl-CoA dehydrogenase family protein [Ph...   305    4e-81 
ref|ZP_02147320.1|  enoyl-CoA hydratase [Phaeobacter gallaecie...   305    4e-81 
ref|YP_001267983.1|  acyl-CoA dehydrogenase domain-containing ...   305    4e-81 
ref|YP_756066.1|  acyl-CoA dehydrogenase domain-containing pro...   305    4e-81 
ref|YP_001346001.1|  putative acyl-CoA dehydrogenase [Pseudomo...   305    4e-81 
ref|YP_350895.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   305    4e-81 
ref|NP_249197.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   305    4e-81 
ref|YP_003576647.1|  acyl-CoA dehydrogenase domain-containing ...   305    5e-81 
ref|ZP_05740441.1|  acyl-CoA dehydrogenase family protein [Sil...   305    5e-81 
ref|ZP_04590885.1|  acyl-CoA dehydrogenase family protein [Pse...   305    5e-81 
ref|ZP_05099960.1|  acyl-CoA dehydrogenase [Roseobacter sp. GA...   305    5e-81 
ref|NP_422187.1|  acyl-CoA dehydrogenase family protein [Caulo...   305    5e-81 
ref|YP_002552051.1|  acyl-CoA dehydrogenase domain protein [Ac...   305    7e-81 
ref|ZP_05098706.1|  acyl-CoA dehydrogenase family protein [Ros...   305    7e-81 
ref|YP_001847792.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   305    7e-81 
ref|YP_001706189.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   305    7e-81 
ref|YP_001712567.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   305    7e-81 
ref|YP_001085894.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   305    7e-81 
ref|ZP_01040855.1|  acyl-CoA dehydrogenase family protein [Ery...   305    7e-81 
ref|YP_984915.1|  acyl-CoA dehydrogenase domain-containing pro...   304    9e-81 
ref|YP_426396.1|  Acyl-CoA dehydrogenase [Rhodospirillum rubru...   304    9e-81 
ref|NP_353756.1|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   304    9e-81 
ref|YP_661490.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   304    9e-81 
ref|ZP_03698726.1|  acyl-CoA dehydrogenase domain protein [Lut...   304    1e-80 
ref|YP_002524876.1|  Acyl-CoA dehydrogenase domain protein [Rh...   304    1e-80 
ref|ZP_05076742.1|  acyl-CoA dehydrogenase family protein [Rho...   304    1e-80 
ref|YP_002132192.1|  acyl-CoA dehydrogenase [Phenylobacterium ...   304    1e-80 
ref|YP_002498095.1|  acyl-CoA dehydrogenase domain protein [Me...   304    1e-80 
ref|YP_523215.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   304    1e-80 
ref|NP_107765.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   304    1e-80 
ref|YP_001419323.1|  acyl-CoA dehydrogenase domain-containing ...   303    1e-80 
ref|NP_296082.1|  acyl-CoA dehydrogenase, putative [Deinococcu...   303    1e-80 
ref|YP_045367.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   303    1e-80 
ref|YP_001346285.1|  putative acyl-CoA dehydrogenase [Pseudomo...   303    2e-80 
ref|ZP_06693385.1|  conserved hypothetical protein [Acinetobac...   303    3e-80 
ref|ZP_05823033.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   303    3e-80 
ref|ZP_05808586.1|  acyl-CoA dehydrogenase domain protein [Mes...   303    3e-80 
ref|YP_002787075.1|  putative acyl-CoA dehydrogenase [Deinococ...   303    3e-80 
ref|ZP_05093505.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   303    3e-80 
ref|ZP_05043584.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   303    3e-80 
ref|YP_755769.1|  acyl-CoA dehydrogenase domain-containing pro...   303    3e-80 
ref|YP_262743.1|  acyl-CoA dehydrogenase family protein [Pseud...   303    3e-80 
ref|NP_252888.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   303    3e-80 
ref|ZP_04936202.1|  hypothetical protein PA2G_03650 [Pseudomon...   303    3e-80 
ref|YP_001042757.1|  acyl-CoA dehydrogenase domain-containing ...   303    3e-80 
ref|ZP_01367634.1|  hypothetical protein PaerPA_01004787 [Pseu...   303    3e-80 
ref|YP_002942729.1|  acyl-CoA dehydrogenase domain protein [Va...   302    3e-80 
ref|ZP_05127280.1|  acyl-CoA dehydrogenase [gamma proteobacter...   302    3e-80 
ref|ZP_06728761.1|  acyl-CoA dehydrogenase [Acinetobacter haem...   302    4e-80 
ref|ZP_01914910.1|  Acyl-CoA dehydrogenase [Limnobacter sp. ME...   302    4e-80 
ref|YP_001669038.1|  acyl-CoA dehydrogenase domain-containing ...   302    4e-80 
ref|YP_916648.1|  acyl-CoA dehydrogenase domain-containing pro...   302    4e-80 
ref|ZP_03541155.1|  acyl-CoA dehydrogenase domain protein [Com...   302    4e-80 
ref|YP_582540.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   302    4e-80 
ref|ZP_06058874.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   301    6e-80 
ref|ZP_04714600.1|  Acyl-CoA dehydrogenase [Alteromonas macleo...   301    6e-80 
ref|YP_002548702.1|  acyl-CoA dehydrogenase [Agrobacterium vit...   301    6e-80 
ref|YP_002543620.1|  acyl-CoA dehydrogenase protein [Agrobacte...   301    6e-80 
ref|ZP_05033264.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   301    6e-80 
ref|ZP_01915344.1|  putative acyl-coa dehydrogenase oxidoreduc...   301    6e-80 
ref|YP_352255.1|  putative acyl-CoA dehydrogenase [Rhodobacter...   301    6e-80 
ref|ZP_01101836.1|  acyl-CoA dehydrogenase [Congregibacter lit...   301    6e-80 
ref|ZP_01001773.1|  acyl-CoA dehydrogenase family protein [Lok...   301    6e-80 
ref|YP_294672.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   301    7e-80 
ref|YP_613552.1|  acyl-CoA dehydrogenase-like [Ruegeria sp. TM...   301    7e-80 
ref|ZP_06170995.1|  acyl-CoA dehydrogenase domain protein [Bre...   301    1e-79 
gb|ACT32397.1|  acyl-CoA dehydrogenase family protein [Pseudom...   301    1e-79 
ref|YP_001769262.1|  acyl-CoA dehydrogenase domain-containing ...   301    1e-79 
ref|YP_001346002.1|  putative acyl-CoA dehydrogenase [Pseudomo...   301    1e-79 
ref|YP_511836.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   301    1e-79 
ref|ZP_01114450.1|  probable acyl-CoA dehydrogenase [Reinekea ...   301    1e-79 
ref|ZP_04761509.1|  acyl-CoA dehydrogenase domain protein [Aci...   300    1e-79 
ref|ZP_01165131.1|  acyl-CoA dehydrogenase [Oceanospirillum sp...   300    1e-79 
ref|YP_001168487.1|  acyl-CoA dehydrogenase domain-containing ...   300    1e-79 
ref|YP_001120653.1|  acyl-CoA dehydrogenase domain-containing ...   300    1e-79 
ref|ZP_05342750.1|  acyl-CoA dehydrogenase family protein [Tha...   300    2e-79 
ref|YP_002298155.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   300    2e-79 
ref|YP_271124.1|  acyl-CoA dehydrogenase family protein [Colwe...   300    2e-79 
ref|YP_001418152.1|  acyl-CoA dehydrogenase domain-containing ...   300    2e-79 
ref|ZP_05317317.1|  acyl-CoA dehydrogenase family protein [Nei...   299    3e-79 
ref|YP_001674651.1|  acyl-CoA dehydrogenase domain-containing ...   299    3e-79 
ref|YP_996859.1|  acyl-CoA dehydrogenase domain-containing pro...   299    3e-79 
ref|ZP_01114449.1|  acyl-CoA dehydrogenase, putative [Reinekea...   299    3e-79 
ref|ZP_05826026.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   299    4e-79 
ref|YP_001973073.1|  putative acyl-CoA dehydrogenase oxidoredu...   299    4e-79 
ref|YP_421997.1|  Acyl-CoA dehydrogenase [Magnetospirillum mag...   299    4e-79 
ref|NP_518594.1|  putative acyl-CoA dehydrogenase oxidoreducta...   299    4e-79 
ref|ZP_04940567.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   299    4e-79 
ref|YP_621983.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   299    4e-79 
ref|ZP_05977215.1|  acyl-CoA dehydrogenase family protein [Nei...   298    5e-79 
ref|YP_001714135.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   298    5e-79 
ref|YP_001003062.1|  acyl-CoA dehydrogenase domain-containing ...   298    5e-79 
ref|ZP_04662955.1|  Acyl-CoA dehydrogenase [Acinetobacter baum...   298    6e-79 
ref|YP_001846062.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   298    6e-79 
ref|YP_001189299.1|  acyl-CoA dehydrogenase domain-containing ...   298    6e-79 
ref|ZP_01450172.1|  Acyl-CoA dehydrogenase-like protein [alpha...   298    6e-79 
ref|YP_168992.1|  acyl-CoA dehydrogenase family protein [Ruege...   298    6e-79 
ref|YP_002798926.1|  Acyl-CoA dehydrogenase [Azotobacter vinel...   298    6e-79 
ref|YP_002980341.1|  acyl-CoA dehydrogenase domain protein [Ra...   298    8e-79 
ref|YP_001578770.1|  acyl-CoA dehydrogenase domain-containing ...   298    8e-79 
ref|YP_550749.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   298    8e-79 
ref|ZP_01055953.1|  acyl-CoA dehydrogenase family protein [Ros...   298    8e-79 
ref|ZP_05842559.1|  acyl-CoA dehydrogenase domain protein [Rho...   297    1e-78 
ref|ZP_05135777.1|  acyl-CoA dehydrogenase [Stenotrophomonas s...   297    1e-78 
ref|YP_002256310.1|  acyl-coa dehydrogenase protein [Ralstonia...   297    1e-78 
ref|ZP_01756420.1|  acyl-CoA dehydrogenase family protein [Ros...   297    1e-78 
ref|ZP_01627384.1|  putative acyl-CoA dehydrogenase [marine ga...   297    1e-78 
ref|YP_724978.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   297    1e-78 
ref|ZP_04944760.1|  Acyl-CoA dehydrogenase [Burkholderia dolos...   297    1e-78 
ref|YP_788677.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   297    1e-78 
ref|YP_001795793.1|  putative ACYL-COA DEHYDROGENASE OXIDOREDU...   297    1e-78 
ref|YP_001261971.1|  acyl-CoA dehydrogenase domain-containing ...   297    1e-78 
ref|YP_001501710.1|  acyl-CoA dehydrogenase domain-containing ...   297    1e-78 
ref|YP_001809332.1|  acyl-CoA dehydrogenase domain-containing ...   297    1e-78 
ref|YP_972404.1|  acyl-CoA dehydrogenase domain-containing pro...   297    1e-78 
ref|YP_001233155.1|  acyl-CoA dehydrogenase domain-containing ...   297    1e-78 
ref|ZP_04930591.1|  hypothetical protein PACG_03332 [Pseudomon...   297    1e-78 
ref|NP_249198.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   297    1e-78 
ref|ZP_06690763.1|  conserved hypothetical protein [Acinetobac...   296    2e-78 
ref|ZP_06211968.1|  acyl-CoA dehydrogenase domain protein [Aci...   296    2e-78 
ref|ZP_05827632.1|  acyl-CoA dehydrogenase [Acinetobacter baum...   296    2e-78 
ref|ZP_05112296.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   296    2e-78 
ref|YP_002126606.1|  Acyl-CoA dehydrogenase [Alteromonas macle...   296    2e-78 
ref|YP_001897938.1|  acyl-CoA dehydrogenase domain protein [Ra...   296    2e-78 
ref|ZP_02906522.1|  acyl-CoA dehydrogenase domain protein [Bur...   296    2e-78 
ref|YP_001354781.1|  acyl-CoA dehydrogenase oxidoreductase pro...   296    2e-78 
ref|YP_003280248.1|  acyl-CoA dehydrogenase-like protein [Coma...   296    3e-78 
ref|ZP_05739147.1|  acyl-CoA dehydrogenase family protein [Sil...   296    3e-78 
ref|ZP_06693092.1|  conserved hypothetical protein [Acinetobac...   295    4e-78 
ref|ZP_05620313.1|  acyl-CoA dehydrogenase domain protein [Enh...   295    4e-78 
ref|YP_002362049.1|  acyl-CoA dehydrogenase domain protein [Me...   295    4e-78 
ref|ZP_02377873.1|  acyl-CoA dehydrogenase domain protein [Bur...   295    4e-78 
ref|YP_002029160.1|  acyl-CoA dehydrogenase domain protein [St...   295    4e-78 
ref|YP_370286.1|  Acyl-CoA dehydrogenase-like [Burkholderia sp...   295    4e-78 
ref|ZP_01165099.1|  acyl-CoA dehydrogenase, putative [Oceanosp...   295    4e-78 
ref|ZP_00943677.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   295    4e-78 
ref|ZP_05361899.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   295    5e-78 
ref|YP_001101073.1|  acyl-CoA dehydrogenase [Herminiimonas ars...   295    5e-78 
ref|YP_574690.1|  acyl-CoA dehydrogenase-like protein [Chromoh...   295    5e-78 
ref|YP_102032.1|  acyl-CoA dehydrogenase domain-containing pro...   295    5e-78 
ref|ZP_02890241.1|  acyl-CoA dehydrogenase domain protein [Bur...   295    7e-78 
ref|YP_001525890.1|  acyl-CoA dehydrogenase [Azorhizobium caul...   295    7e-78 
ref|ZP_01901750.1|  acyl-CoA dehydrogenase-like protein [Roseo...   295    7e-78 
ref|YP_611295.1|  acyl-CoA dehydrogenase-like [Ruegeria sp. TM...   295    7e-78 
ref|YP_002965402.1|  acyl-CoA dehydrogenase [Methylobacterium ...   294    9e-78 
ref|YP_001641545.1|  acyl-CoA dehydrogenase domain-containing ...   294    9e-78 
ref|ZP_01750389.1|  acyl-CoA dehydrogenase-like protein [Roseo...   294    9e-78 
gb|AAP92447.1|  putative acyl-CoA dehydrogenase [Pseudomonas f...   294    9e-78 
ref|YP_293249.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   294    9e-78 
ref|YP_001415533.1|  acyl-CoA dehydrogenase domain-containing ...   294    9e-78 
ref|ZP_06296520.1|  acyl-CoA dehydrogenase domain protein [Bur...   294    1e-77 
ref|ZP_06223443.1|  putative acyl-CoA dehydrogenase oxidoreduc...   294    1e-77 
ref|ZP_05500079.1|  acyl-CoA dehydrogenase domain protein [Thi...   294    1e-77 
ref|ZP_02153022.1|  acyl-CoA dehydrogenase-like protein [Ocean...   294    1e-77 
ref|YP_002423176.1|  acyl-CoA dehydrogenase domain protein [Me...   294    1e-77 
ref|ZP_01741033.1|  acyl-CoA dehydrogenase family protein [Rho...   294    1e-77 
ref|YP_268983.1|  acyl-CoA dehydrogenase family protein [Colwe...   294    1e-77 
ref|ZP_01166352.1|  probable acyl-CoA dehydrogenase [Oceanospi...   294    1e-77 
ref|YP_983695.1|  acyl-CoA dehydrogenase domain-containing pro...   294    1e-77 
ref|ZP_06466574.1|  putative acyl-CoA dehydrogenase oxidoreduc...   293    2e-77 
ref|YP_002606131.1|  Acd17 [Desulfobacterium autotrophicum HRM...   293    2e-77 
ref|YP_001185885.1|  acyl-CoA dehydrogenase domain-containing ...   293    2e-77 
ref|YP_001856624.1|  acyl-CoA dehydrogenase domain-containing ...   293    2e-77 
ref|YP_001686107.1|  acyl-CoA dehydrogenase domain-containing ...   293    2e-77 
ref|YP_441121.1|  acyl-CoA dehydrogenase domain-containing pro...   293    2e-77 
ref|ZP_01057612.1|  acyl-CoA dehydrogenase family protein [Ros...   293    2e-77 
ref|ZP_00054520.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   293    2e-77 
ref|ZP_02386577.1|  acyl-CoA dehydrogenase domain protein [Bur...   293    2e-77 
ref|ZP_04963648.1|  acyl-CoA dehydrogenase domain protein [Bur...   293    2e-77 
ref|YP_001894309.1|  acyl-CoA dehydrogenase domain protein [Bu...   293    2e-77 
ref|YP_001279026.1|  acyl-CoA dehydrogenase domain-containing ...   293    2e-77 
ref|YP_574477.1|  acyl-CoA dehydrogenase-like protein [Chromoh...   293    2e-77 
ref|YP_107277.1|  putative acyl-CoA dehydrogenase oxidoreducta...   293    2e-77 
ref|ZP_05500170.1|  acyl-CoA dehydrogenase domain protein [Thi...   293    3e-77 
ref|ZP_04714920.1|  probable acyl-CoA dehydrogenase [Alteromon...   293    3e-77 
ref|YP_002912839.1|  Acyl-CoA dehydrogenase domain protein [Bu...   293    3e-77 
ref|YP_002875102.1|  putative dehydrogenase [Pseudomonas fluor...   293    3e-77 
ref|YP_002889467.1|  acyl-CoA dehydrogenase domain protein [Th...   293    3e-77 
ref|YP_001832873.1|  acyl-CoA dehydrogenase domain-containing ...   293    3e-77 
ref|YP_957803.1|  acyl-CoA dehydrogenase domain-containing pro...   293    3e-77 
ref|ZP_06066833.1|  acyl-CoA dehydrogenase domain-containing p...   292    3e-77 
ref|ZP_05824089.1|  acyl-CoA dehydrogenase domain-containing p...   292    3e-77 
ref|ZP_04601943.1|  hypothetical protein GCWU000324_01417 [Kin...   292    3e-77 
ref|ZP_03698829.1|  acyl-CoA dehydrogenase domain protein [Lut...   292    3e-77 
ref|ZP_03267845.1|  acyl-CoA dehydrogenase domain protein [Bur...   292    3e-77 
ref|ZP_02882592.1|  acyl-CoA dehydrogenase domain protein [Bur...   292    3e-77 
ref|YP_001712356.1|  putative acyl-CoA dehydrogenase [Acinetob...   292    3e-77 
ref|YP_001086110.1|  putative acyl-CoA dehydrogenase [Acinetob...   292    3e-77 
ref|YP_001341117.1|  acyl-CoA dehydrogenase domain-containing ...   292    3e-77 
ref|ZP_01450104.1|  Acyl-CoA dehydrogenase [alpha proteobacter...   292    3e-77 
ref|YP_557013.1|  putative acyl-CoA dehydrogenase oxidoreducta...   292    3e-77 
ref|YP_263445.1|  acyl-CoA dehydrogenase [Psychrobacter arctic...   292    3e-77 
ref|ZP_06351022.1|  acyl-CoA dehydrogenase domain protein [Rho...   292    4e-77 
ref|ZP_05785560.1|  acyl-CoA dehydrogenase family protein [Sil...   292    4e-77 
ref|YP_003070526.1|  acyl-CoA dehydrogenase [Methylobacterium ...   292    4e-77 
ref|YP_001927218.1|  acyl-CoA dehydrogenase domain protein [Me...   292    4e-77 
ref|ZP_02462360.1|  acyl-CoA dehydrogenase domain protein [Bur...   292    4e-77 
ref|ZP_02354508.1|  acyl-CoA dehydrogenase domain protein [Bur...   292    4e-77 
gb|AAL03980.1|  acyl-CoA dehydrogenase [Azospirillum brasilense]    292    4e-77 
ref|YP_045366.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   292    4e-77 
ref|ZP_00998506.1|  acyl-CoA dehydrogenase family protein [Oce...   292    4e-77 
ref|ZP_06056488.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   291    6e-77 
ref|YP_001674274.1|  acyl-CoA dehydrogenase domain-containing ...   291    6e-77 
ref|YP_001630510.1|  acyl-CoA dehydrogenase [Bordetella petrii...   291    6e-77 
ref|ZP_01736104.1|  Acyl-CoA dehydrogenase-like protein [Marin...   291    6e-77 
ref|YP_001562366.1|  acyl-CoA dehydrogenase domain-containing ...   291    6e-77 
ref|ZP_01306518.1|  acyl-CoA dehydrogenase family protein [Oce...   291    6e-77 
ref|NP_879764.1|  acyl-CoA dehydrogenase [Bordetella pertussis...   291    6e-77 
ref|YP_003451886.1|  acyl-CoA dehydrogenase domain protein [Az...   291    8e-77 
ref|ZP_05360615.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   291    1e-76 
ref|ZP_05361051.1|  acyl-CoA dehydrogenase domain protein [Aci...   291    1e-76 
ref|YP_001706055.1|  putative acyl-CoA dehydrogenase [Acinetob...   291    1e-76 
ref|ZP_02242822.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae...   291    1e-76 
ref|YP_200658.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae p...   291    1e-76 
ref|NP_642877.1|  acyl-CoA dehydrogenase [Xanthomonas axonopod...   291    1e-76 
ref|YP_450931.1|  acyl-CoA dehydrogenase [Xanthomonas oryzae p...   291    1e-76 
ref|NP_107374.1|  acyl-CoA dehydrogenase [Mesorhizobium loti M...   291    1e-76 
ref|YP_793659.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   291    1e-76 
ref|YP_003556830.1|  acyl-CoA dehydrogenase family protein [Sh...   290    1e-76 
ref|ZP_06704775.1|  acyl-CoA dehydrogenase [Xanthomonas fuscan...   290    1e-76 
ref|ZP_06074014.1|  acyl-CoA dehydrogenase [Acinetobacter radi...   290    1e-76 
ref|ZP_06058040.1|  acyl-CoA dehydrogenase domain-containing p...   290    1e-76 
ref|YP_001501936.1|  acyl-CoA dehydrogenase domain-containing ...   290    1e-76 
ref|NP_253874.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   290    1e-76 
ref|YP_364493.1|  acyl-CoA dehydrogenase [Xanthomonas campestr...   290    1e-76 
ref|ZP_00052323.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   290    1e-76 
ref|ZP_06728977.1|  acyl-CoA dehydrogenase [Acinetobacter haem...   290    2e-76 
ref|ZP_06064963.1|  acyl-CoA dehydrogenase domain-containing p...   290    2e-76 
ref|ZP_03824295.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   290    2e-76 
ref|ZP_03824897.1|  acyl-CoA dehydrogenase [Acinetobacter sp. ...   290    2e-76 
ref|YP_002443159.1|  putative acyl-CoA dehydrogenase [Pseudomo...   290    2e-76 
ref|YP_001188587.1|  acyl-CoA dehydrogenase domain-containing ...   290    2e-76 
ref|YP_047763.1|  putative acyl-CoA dehydrogenase [Acinetobact...   290    2e-76 
ref|NP_885292.1|  acyl-CoA dehydrogenase [Bordetella parapertu...   290    2e-76 
ref|ZP_01368207.1|  hypothetical protein PaerPA_01005363 [Pseu...   290    2e-76 
ref|ZP_04931439.1|  hypothetical protein PACG_04232 [Pseudomon...   290    2e-76 
emb|CAZ89609.1|  Acyl-CoA dehydrogenase [Thiomonas sp.]             290    2e-76 
emb|CAZ88356.1|  acyl-CoA dehydrogenase [Thiomonas sp.]             290    2e-76 
ref|ZP_06058873.1|  acyl-CoA dehydrogenase domain-containing p...   290    2e-76 
ref|ZP_04771849.1|  acyl-CoA dehydrogenase domain protein [Ast...   290    2e-76 
ref|ZP_01707774.1|  acyl-CoA dehydrogenase-like [Shewanella pu...   290    2e-76 
ref|YP_963366.1|  acyl-CoA dehydrogenase domain-containing pro...   290    2e-76 
ref|YP_001183555.1|  acyl-CoA dehydrogenase domain-containing ...   290    2e-76 
ref|ZP_06728762.1|  acyl-CoA dehydrogenase [Acinetobacter haem...   289    3e-76 
ref|YP_002798830.1|  Acyl-CoA dehydrogenase [Azotobacter vinel...   289    3e-76 
ref|YP_001351247.1|  putative acyl-CoA dehydrogenase [Pseudomo...   289    3e-76 
ref|NP_637785.1|  acyl-CoA dehydrogenase [Xanthomonas campestr...   289    3e-76 
ref|YP_002126040.1|  probable acyl-CoA dehydrogenase [Alteromo...   289    3e-76 
ref|ZP_01054488.1|  probable acyl-CoA dehydrogenase [Roseobact...   289    3e-76 
ref|YP_001094289.1|  acyl-CoA dehydrogenase domain-containing ...   289    3e-76 
ref|YP_660987.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   289    3e-76 
ref|YP_580716.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   289    3e-76 
ref|YP_579416.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   289    3e-76 
ref|YP_003375588.1|  hypothetical acyl-coa dehydrogenase prote...   289    4e-76 
ref|ZP_06064372.1|  acyl-CoA dehydrogenase domain-containing p...   289    4e-76 
ref|ZP_05829354.1|  acyl-CoA dehydrogenase domain-containing p...   289    4e-76 
ref|YP_001712566.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   289    4e-76 
ref|YP_001170859.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   289    4e-76 
ref|YP_001085895.1|  acyl-CoA dehydrogenase A [Acinetobacter b...   289    4e-76 
ref|YP_001750207.1|  acyl-CoA dehydrogenase domain-containing ...   289    4e-76 
ref|YP_264251.1|  putative acyl-CoA dehydrogenase [Psychrobact...   289    4e-76 
ref|YP_961146.1|  acyl-CoA dehydrogenase domain-containing pro...   289    4e-76 
ref|YP_001019616.1|  putative acyl-CoA dehydrogenase oxidoredu...   289    4e-76 
ref|ZP_06069746.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   288    5e-76 
ref|ZP_05123197.1|  acyl-CoA dehydrogenase family protein [Rho...   288    5e-76 
ref|YP_001903140.1|  acyl-CoA dehydrogenase [Xanthomonas campe...   288    5e-76 
ref|YP_002358000.1|  acyl-CoA dehydrogenase domain protein [Sh...   288    5e-76 
ref|YP_785889.1|  acyl-CoA dehydrogenase [Bordetella avium 197...   288    5e-76 
ref|YP_734062.1|  acyl-CoA dehydrogenase domain-containing pro...   288    5e-76 
ref|YP_002311830.1|  Acyl-CoA dehydrogenase [Shewanella piezot...   288    6e-76 
ref|YP_001797763.1|  acyl-CoA dehydrogenase domain protein [Po...   288    6e-76 
ref|YP_917001.1|  acyl-CoA dehydrogenase domain-containing pro...   288    6e-76 
ref|YP_683595.1|  putative acyl-CoA dehydrogenase family prote...   288    8e-76 
ref|NP_745691.1|  acyl-CoA dehydrogenase domain-containing pro...   288    8e-76 
ref|YP_003167659.1|  acyl-CoA dehydrogenase domain protein [Ca...   287    1e-75 
ref|ZP_05079033.1|  acyl-CoA dehydrogenase family protein [Rho...   287    1e-75 
ref|YP_933998.1|  putative acyl-CoA dehydrogenase [Azoarcus sp...   287    1e-75 
ref|ZP_01224615.1|  acyl-CoA dehydrogenase family protein [mar...   287    1e-75 
ref|YP_738092.1|  acyl-CoA dehydrogenase domain-containing pro...   287    1e-75 
ref|ZP_06489755.1|  acyl-CoA dehydrogenase [Xanthomonas campes...   287    1e-75 
ref|ZP_06068129.1|  acyl-CoA dehydrogenase A [Acinetobacter lw...   287    1e-75 
ref|ZP_06070566.1|  acyl-CoA dehydrogenase domain-containing p...   287    1e-75 
ref|YP_001366473.1|  acyl-CoA dehydrogenase domain-containing ...   287    1e-75 
ref|YP_001050447.1|  acyl-CoA dehydrogenase domain-containing ...   287    1e-75 
ref|ZP_06483308.1|  acyl-CoA dehydrogenase [Xanthomonas campes...   286    2e-75 
ref|ZP_05783504.1|  acyl-CoA dehydrogenase family protein [Cit...   286    2e-75 
ref|ZP_05823032.1|  acyl-CoA dehydrogenase domain-containing p...   286    2e-75 
ref|YP_002762057.1|  putative acyl-CoA dehydrogenase [Gemmatim...   286    2e-75 
ref|YP_001554817.1|  acyl-CoA dehydrogenase domain-containing ...   286    2e-75 
ref|ZP_01224015.1|  acyl-CoA dehydrogenase [marine gamma prote...   286    2e-75 
ref|YP_046365.1|  acyl-CoA dehydrogenase [Acinetobacter sp. AD...   286    2e-75 
ref|YP_002312289.1|  Acyl-CoA dehydrogenase [Shewanella piezot...   286    2e-75 
ref|YP_001793051.1|  acyl-CoA dehydrogenase domain-containing ...   286    2e-75 
ref|ZP_02156198.1|  acyl-CoA dehydrogenase family protein [She...   286    2e-75 
ref|YP_694459.1|  acyl-CoA dehydrogenase [Alcanivorax borkumen...   286    2e-75 
ref|YP_996012.1|  acyl-CoA dehydrogenase domain-containing pro...   286    2e-75 
ref|ZP_06693386.1|  conserved hypothetical protein [Acinetobac...   286    3e-75 
ref|YP_002796257.1|  Probable acyl-CoA dehydrogenase [Laribact...   286    3e-75 
ref|YP_001706188.1|  acyl-CoA dehydrogenase [Acinetobacter bau...   286    3e-75 
ref|YP_001668604.1|  acyl-CoA dehydrogenase domain-containing ...   286    3e-75 
ref|ZP_02139785.1|  putative acyl-CoA dehydrogenase family pro...   285    4e-75 
ref|ZP_01893415.1|  putative acyl-CoA dehydrogenase [Marinobac...   285    4e-75 
ref|NP_249975.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   285    4e-75 
ref|ZP_01364653.1|  hypothetical protein PaerPA_01001762 [Pseu...   285    5e-75 
ref|ZP_04927728.1|  hypothetical protein PACG_00254 [Pseudomon...   285    5e-75 
ref|YP_869621.1|  acyl-CoA dehydrogenase domain-containing pro...   285    5e-75 
ref|YP_791961.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   285    5e-75 
ref|YP_003557388.1|  acyl-CoA dehydrogenase family protein [Sh...   285    7e-75 
ref|ZP_06063935.1|  conserved hypothetical protein [Acinetobac...   285    7e-75 
ref|YP_003072146.1|  acyl-CoA dehydrogenase family protein [Te...   285    7e-75 
ref|YP_002430208.1|  acyl-CoA dehydrogenase domain protein [De...   285    7e-75 
ref|ZP_01012310.1|  acyl-CoA dehydrogenase family protein [Rho...   285    7e-75 
ref|ZP_01003175.1|  acyl-CoA dehydrogenase family protein [Lok...   285    7e-75 
ref|YP_002604360.1|  Acd10 [Desulfobacterium autotrophicum HRM...   284    9e-75 
ref|YP_001474431.1|  acyl-CoA dehydrogenase domain-containing ...   284    9e-75 
ref|YP_001750007.1|  acyl-CoA dehydrogenase domain-containing ...   284    9e-75 
ref|ZP_05043166.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   284    1e-74 
ref|YP_001760697.1|  acyl-CoA dehydrogenase domain-containing ...   284    1e-74 
ref|YP_001474029.1|  acyl-CoA dehydrogenase domain-containing ...   284    1e-74 
ref|ZP_00961162.1|  acyl-CoA dehydrogenase family protein [Ros...   284    1e-74 
ref|ZP_01446370.1|  acyl-CoA dehydrogenase family protein [Ros...   283    2e-74 
ref|YP_693818.1|  acyl-CoA dehydrogenase [Alcanivorax borkumen...   283    2e-74 
dbj|BAC02934.1|  acyl-CoA dehydrogenase A [Acinetobacter sp. M-1]   283    2e-74 
ref|YP_001267543.1|  acyl-CoA dehydrogenase domain-containing ...   283    2e-74 
ref|YP_751423.1|  acyl-CoA dehydrogenase domain-containing pro...   283    2e-74 
ref|ZP_01034568.1|  acyl-CoA dehydrogenase family protein [Ros...   283    2e-74 
ref|YP_003545320.1|  acyl-CoA dehydrogenase [Sphingobium japon...   283    3e-74 
ref|ZP_05620920.1|  acyl-CoA dehydrogenase domain protein [Enh...   283    3e-74 
ref|YP_001900196.1|  acyl-CoA dehydrogenase domain protein [Ra...   283    3e-74 
ref|YP_001349460.1|  putative acyl-CoA dehydrogenase [Pseudomo...   283    3e-74 
ref|YP_001279811.1|  acyl-CoA dehydrogenase domain-containing ...   283    3e-74 
ref|NP_717985.1|  acyl-CoA dehydrogenase family protein [Shewa...   283    3e-74 
ref|ZP_06069673.1|  acyl-CoA dehydrogenase domain-containing p...   282    3e-74 
ref|ZP_05074228.1|  acyl-CoA dehydrogenase family protein [Rho...   282    3e-74 
ref|YP_001760295.1|  acyl-CoA dehydrogenase domain-containing ...   282    3e-74 
ref|YP_002799680.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   282    3e-74 
ref|ZP_02146290.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   282    5e-74 
ref|ZP_02149267.1|  acyl-CoA dehydrogenase family protein [Pha...   282    5e-74 
ref|ZP_01741898.1|  acyl-CoA dehydrogenase family protein [Rho...   282    5e-74 
ref|ZP_01881182.1|  acyl-CoA dehydrogenase-like protein [Roseo...   281    6e-74 
ref|YP_259268.1|  acyl-CoA dehydrogenase family protein [Pseud...   281    6e-74 
ref|NP_901455.1|  acyl-CoA dehydrogenase [Chromobacterium viol...   281    6e-74 
ref|NP_718349.1|  acyl-CoA dehydrogenase family protein [Shewa...   281    6e-74 
ref|ZP_05343859.1|  acyl-CoA dehydrogenase family protein [Tha...   281    8e-74 
ref|ZP_02159372.1|  acyl-CoA dehydrogenase family protein [She...   281    8e-74 
ref|YP_001094086.1|  acyl-CoA dehydrogenase domain-containing ...   281    8e-74 
ref|YP_001530045.1|  acyl-CoA dehydrogenase domain-containing ...   281    1e-73 
ref|YP_265674.1|  acyl-CoA dehydrogenase [Candidatus Pelagibac...   281    1e-73 
ref|ZP_04772349.1|  acyl-CoA dehydrogenase domain protein [Ast...   280    1e-73 
ref|YP_003073386.1|  acyl-CoA dehydrogenase domain protein [Te...   280    1e-73 
ref|ZP_05040717.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   280    1e-73 
ref|YP_001530247.1|  acyl-CoA dehydrogenase domain-containing ...   280    1e-73 
ref|YP_165561.1|  acyl-CoA dehydrogenase family protein [Ruege...   280    2e-73 
ref|ZP_05090353.1|  acyl-CoA dehydrogenase family protein [Rue...   280    2e-73 
gb|ABZ10350.1|  putative acyl-CoA dehydrogenase, C-terminal do...   279    3e-73 
ref|ZP_01744115.1|  acyl-CoA dehydrogenase family protein [Sag...   279    3e-73 
ref|YP_750799.1|  acyl-CoA dehydrogenase domain-containing pro...   279    4e-73 
ref|ZP_06686600.1|  acyl-CoA dehydrogenase [Achromobacter piec...   278    5e-73 
ref|YP_002432478.1|  acyl-CoA dehydrogenase domain protein [De...   278    5e-73 
ref|YP_734515.1|  acyl-CoA dehydrogenase domain-containing pro...   278    5e-73 
ref|YP_870185.1|  acyl-CoA dehydrogenase domain-containing pro...   278    5e-73 
ref|YP_002602163.1|  Acd2 [Desulfobacterium autotrophicum HRM2...   278    7e-73 
ref|ZP_05063337.1|  acyl-CoA dehydrogenase family protein [Oct...   278    7e-73 
ref|YP_660239.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   278    7e-73 
ref|YP_927618.1|  acyl-CoA dehydrogenase family protein [Shewa...   278    7e-73 
ref|YP_003146588.1|  acyl-CoA dehydrogenase domain protein [Ka...   277    1e-72 
ref|ZP_01447931.1|  acyl-CoA dehydrogenase [alpha proteobacter...   277    1e-72 
ref|ZP_01304996.1|  Acyl-CoA dehydrogenase [Sphingomonas sp. S...   277    1e-72 
ref|YP_001756487.1|  acyl-CoA dehydrogenase domain-containing ...   277    1e-72 
ref|ZP_01304509.1|  Acyl-CoA dehydrogenase [Sphingomonas sp. S...   276    2e-72 
ref|YP_001676696.1|  acyl-CoA dehydrogenase domain-containing ...   276    3e-72 
ref|YP_003559267.1|  acyl-CoA dehydrogenase [Sphingobium japon...   276    3e-72 
ref|YP_003451158.1|  acyl-CoA dehydrogenase [Azospirillum sp. ...   276    3e-72 
ref|YP_002429384.1|  acyl-CoA dehydrogenase domain protein [De...   275    4e-72 
ref|NP_744198.1|  acyl-CoA dehydrogenase, putative [Pseudomona...   275    6e-72 
ref|YP_001269001.1|  acyl-CoA dehydrogenase domain-containing ...   275    6e-72 
ref|YP_738501.1|  acyl-CoA dehydrogenase domain-containing pro...   275    7e-72 
ref|ZP_05068948.1|  acyl-CoA dehydrogenase [Candidatus Pelagib...   274    1e-71 
ref|ZP_01756258.1|  acyl-CoA dehydrogenase family protein [Ros...   274    1e-71 
ref|ZP_01707718.1|  acyl-CoA dehydrogenase-like [Shewanella pu...   274    1e-71 
ref|YP_963811.1|  acyl-CoA dehydrogenase domain-containing pro...   274    1e-71 
ref|YP_524755.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   273    2e-71 
ref|YP_914244.1|  acyl-CoA dehydrogenase domain-containing pro...   273    2e-71 
dbj|BAC02933.1|  acyl-CoA dehydrogenase B [Acinetobacter sp. M-1]   272    5e-71 
ref|YP_353821.1|  acyl-CoA dehydrogenase [Rhodobacter sphaeroi...   272    5e-71 
ref|YP_002526462.1|  Acyl-CoA dehydrogenase domain protein [Rh...   271    6e-71 
ref|YP_160051.1|  acyl-CoA dehydrogenase [Aromatoleum aromatic...   271    6e-71 
ref|YP_001044272.1|  acyl-CoA dehydrogenase domain-containing ...   271    8e-71 
ref|YP_001050104.1|  acyl-CoA dehydrogenase domain-containing ...   271    8e-71 
ref|YP_002358480.1|  acyl-CoA dehydrogenase domain protein [Sh...   271    1e-70 
ref|ZP_05050120.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   271    1e-70 
ref|YP_001554197.1|  acyl-CoA dehydrogenase domain-containing ...   271    1e-70 
ref|XP_001566297.1|  acyl-coa dehydrogenase [Leishmania brazil...   270    1e-70 
ref|YP_001183113.1|  acyl-CoA dehydrogenase domain-containing ...   270    1e-70 
ref|XP_001470295.1|  acyl-coa dehydrogenase [Leishmania infant...   270    2e-70 
ref|XP_001684536.1|  acyl-coa dehydrogenase [Leishmania major ...   270    2e-70 
ref|YP_616816.1|  acyl-CoA dehydrogenase-like protein [Sphingo...   269    4e-70 
ref|ZP_04026357.1|  acyl-CoA dehydrogenase [Tsukamurella pauro...   268    5e-70 
ref|YP_002947224.1|  acyl-CoA dehydrogenase domain protein [Va...   268    5e-70 
ref|ZP_01157530.1|  probable acyl-CoA dehydrogenase [Oceanicol...   268    5e-70 
ref|YP_562768.1|  acyl-CoA dehydrogenase-like protein [Shewane...   268    7e-70 
ref|YP_002433993.1|  acyl-CoA dehydrogenase domain protein [De...   268    9e-70 
ref|YP_001365929.1|  acyl-CoA dehydrogenase domain-containing ...   268    9e-70 
ref|ZP_02886143.1|  acyl-CoA dehydrogenase domain protein [Bur...   267    1e-69 
ref|XP_814739.1|  acyl-CoA dehydrogenase [Trypanosoma cruzi st...   267    1e-69 
ref|NP_887672.1|  acyl-CoA dehydrogenase [Bordetella bronchise...   266    3e-69 
ref|YP_002429233.1|  acyl-CoA dehydrogenase domain protein [De...   266    3e-69 
ref|YP_003576577.1|  acyl-CoA dehydrogenase domain-containing ...   265    4e-69 
ref|YP_001534419.1|  putative acyl-CoA dehydrogenase family pr...   265    4e-69 
ref|NP_883241.1|  acyl-CoA dehydrogenase [Bordetella parapertu...   263    2e-68 
ref|YP_002432538.1|  acyl-CoA dehydrogenase domain protein [De...   263    2e-68 
ref|YP_001341864.1|  acyl-CoA dehydrogenase domain-containing ...   263    3e-68 
ref|YP_001168655.1|  acyl-CoA dehydrogenase domain-containing ...   262    4e-68 
ref|YP_002429284.1|  acyl-CoA dehydrogenase domain protein [De...   262    5e-68 
ref|ZP_05844248.1|  acyl-CoA dehydrogenase domain protein [Rho...   260    2e-67 
ref|YP_002602051.1|  Acd1 [Desulfobacterium autotrophicum HRM2...   260    2e-67 
ref|YP_001529188.1|  acyl-CoA dehydrogenase domain-containing ...   260    2e-67 
ref|YP_521552.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   259    2e-67 
ref|ZP_01225125.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   259    3e-67 
ref|YP_002602798.1|  Acd5 [Desulfobacterium autotrophicum HRM2...   257    2e-66 
ref|YP_632837.1|  acyl-CoA dehydrogenase [Myxococcus xanthus D...   256    4e-66 
ref|YP_385221.1|  Acyl-CoA dehydrogenase-like [Geobacter metal...   255    5e-66 
ref|YP_001632393.1|  acyl-CoA dehydrogenase [Bordetella petrii...   254    1e-65 
ref|YP_001614215.1|  butyryl-CoA dehydrogenase [Sorangium cell...   254    1e-65 
ref|YP_981046.1|  acyl-CoA dehydrogenase domain-containing pro...   254    1e-65 
ref|ZP_04930397.1|  hypothetical protein PACG_03111 [Pseudomon...   253    3e-65 
ref|YP_520954.1|  hypothetical protein DSY4721 [Desulfitobacte...   253    3e-65 
ref|ZP_01461976.1|  acyl-CoA dehydrogenase [Stigmatella aurant...   252    5e-65 
ref|YP_845528.1|  acyl-CoA dehydrogenase domain-containing pro...   251    7e-65 
ref|YP_549930.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   249    3e-64 
ref|YP_002430635.1|  acyl-CoA dehydrogenase domain protein [De...   249    3e-64 
ref|YP_003280176.1|  acyl-CoA dehydrogenase-like protein [Coma...   248    1e-63 
ref|ZP_05096285.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   248    1e-63 
ref|YP_003269441.1|  acyl-CoA dehydrogenase domain protein [Ha...   246    3e-63 
ref|ZP_04332276.1|  acyl-CoA dehydrogenase [Nocardiopsis dasso...   245    6e-63 
ref|YP_385163.1|  Acyl-CoA dehydrogenase-like [Geobacter metal...   245    6e-63 
ref|YP_002602878.1|  Acd6 [Desulfobacterium autotrophicum HRM2...   244    1e-62 
ref|YP_003411594.1|  acyl-CoA dehydrogenase domain protein [Ge...   244    1e-62 
ref|YP_001174343.1|  acyl-CoA dehydrogenase [Pseudomonas stutz...   243    3e-62 
ref|YP_702699.1|  acyl CoA dehydrogenase [Rhodococcus jostii R...   242    4e-62 
ref|ZP_06238498.1|  acyl-CoA dehydrogenase domain protein [Fra...   242    5e-62 
ref|ZP_06497193.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   241    7e-62 
ref|ZP_01016437.1|  probable acyl-CoA dehydrogenase [Parvularc...   241    7e-62 
ref|ZP_03528272.1|  acyl-CoA dehydrogenase domain protein [Rhi...   241    1e-61 
ref|YP_001094993.1|  acyl-CoA dehydrogenase domain-containing ...   241    1e-61 
ref|YP_002431802.1|  acyl-CoA dehydrogenase domain protein [De...   239    3e-61 
ref|YP_003298848.1|  acyl-CoA dehydrogenase domain protein [Th...   238    6e-61 
ref|ZP_04586667.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   238    8e-61 
ref|ZP_01736762.1|  acyl-CoA dehydrogenase family protein [Mar...   237    1e-60 
ref|YP_001234698.1|  acyl-CoA dehydrogenase domain-containing ...   237    1e-60 
ref|ZP_01077667.1|  acyl-CoA dehydrogenase family protein [Mar...   237    1e-60 
ref|YP_002946283.1|  acyl-CoA dehydrogenase domain protein [Va...   237    2e-60 
ref|ZP_03541224.1|  acyl-CoA dehydrogenase domain protein [Com...   237    2e-60 
ref|YP_003508488.1|  acyl-CoA dehydrogenase domain-containing ...   236    2e-60 
ref|ZP_06711651.1|  acyl-CoA dehydrogenase [Streptomyces sp. e...   236    4e-60 
ref|ZP_06397006.1|  acyl-CoA dehydrogenase domain protein [Mic...   235    5e-60 
ref|ZP_06219262.1|  acyl-CoA dehydrogenase domain protein [Mic...   235    5e-60 
ref|ZP_01615137.1|  putative acyl-CoA dehydrogenase protein [m...   235    5e-60 
ref|ZP_03399611.1|  acyl-CoA dehydrogenase family protein [Pse...   234    8e-60 
ref|YP_793489.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   234    1e-59 
ref|YP_233613.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   234    1e-59 
ref|YP_580126.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   234    1e-59 
ref|YP_002798618.1|  acyl-CoA dehydrogenase [Azotobacter vinel...   234    1e-59 
ref|NP_794753.1|  acyl-CoA dehydrogenase family protein [Pseud...   233    2e-59 
ref|YP_118658.1|  putative acyl-CoA dehydrogenase [Nocardia fa...   233    2e-59 
ref|NP_253707.1|  putative acyl-CoA dehydrogenase [Pseudomonas...   233    2e-59 
ref|ZP_06478937.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   233    3e-59 
ref|ZP_06457086.1|  butyryl-CoA dehydrogenase [Pseudomonas syr...   233    3e-59 
ref|ZP_03263932.1|  acyl-CoA dehydrogenase domain protein [Bur...   233    3e-59 
ref|ZP_01000644.1|  probable acyl-CoA dehydrogenase [Oceanicol...   233    3e-59 
ref|YP_001116292.1|  acyl-CoA dehydrogenase domain-containing ...   233    3e-59 
ref|ZP_05636526.1|  acyl-CoA dehydrogenase family protein [Pse...   232    5e-59 
ref|ZP_06226977.1|  acyl-CoA dehydrogenase domain-containing p...   231    7e-59 
ref|ZP_05489911.1|  putative acyl-CoA dehydrogenase [Streptomy...   231    7e-59 
ref|YP_272797.1|  acyl-CoA dehydrogenase family protein [Pseud...   231    9e-59 
ref|YP_257638.1|  acyl-CoA dehydrogenase family protein [Pseud...   231    9e-59 
gb|AAR37963.1|  acyl-CoA dehydrogenase family protein [uncultu...   231    1e-58 
ref|YP_001351076.1|  putative acyl-CoA dehydrogenase [Pseudomo...   230    2e-58 
ref|YP_002432431.1|  acyl-CoA dehydrogenase domain protein [De...   230    2e-58 
ref|ZP_01626091.1|  Acyl-CoA dehydrogenase [marine gamma prote...   229    3e-58 
ref|YP_750750.1|  acyl-CoA dehydrogenase domain-containing pro...   229    4e-58 
ref|YP_001068404.1|  acyl-CoA dehydrogenase domain-containing ...   228    6e-58 
ref|YP_637287.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   228    6e-58 
ref|ZP_01307316.1|  Acyl-CoA dehydrogenase [Oceanobacter sp. R...   228    8e-58 
ref|YP_346184.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   228    8e-58 
ref|YP_002430467.1|  acyl-CoA dehydrogenase domain protein [De...   228    1e-57 
ref|ZP_01894903.1|  acyl-CoA dehydrogenase family protein [Mar...   228    1e-57 
ref|YP_002870126.1|  putative acyl-CoA dehydrogenase [Pseudomo...   227    1e-57 
ref|YP_003274652.1|  acyl-CoA dehydrogenase domain protein [Go...   227    2e-57 
ref|ZP_01910458.1|  Acyl-CoA dehydrogenase-like protein [Plesi...   226    2e-57 
ref|ZP_03268926.1|  acyl-CoA dehydrogenase domain protein [Bur...   226    4e-57 
ref|YP_960107.1|  acyl-CoA dehydrogenase domain-containing pro...   225    5e-57 
ref|YP_661713.1|  acyl-CoA dehydrogenase-like [Pseudoalteromon...   225    5e-57 
ref|ZP_01694097.1|  acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   225    7e-57 
ref|YP_001186063.1|  acyl-CoA dehydrogenase domain-containing ...   224    9e-57 
ref|YP_002125313.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-C...   224    1e-56 
ref|ZP_06069783.1|  acyl-CoA dehydrogenase [Acinetobacter lwof...   224    1e-56 
ref|ZP_01459366.1|  acyl-CoA dehydrogenase family protein [Sti...   224    1e-56 
ref|YP_001279904.1|  acyl-CoA dehydrogenase domain-containing ...   224    1e-56 
ref|NP_285573.1|  acyl-CoA dehydrogenase, putative [Deinococcu...   224    1e-56 
ref|YP_593913.1|  acyl-CoA dehydrogenase-like [Deinococcus geo...   223    2e-56 
ref|YP_002298342.1|  acyl-CoA dehydrogenase, putative [Rhodosp...   223    3e-56 
ref|YP_001563784.1|  acyl-CoA dehydrogenase domain-containing ...   223    3e-56 
ref|YP_001270125.1|  acyl-CoA dehydrogenase domain-containing ...   223    3e-56 
ref|YP_003269024.1|  acyl-CoA dehydrogenase domain protein [Ha...   222    4e-56 
ref|ZP_01449841.1|  probable acyl-CoA dehydrogenase [alpha pro...   221    1e-55 
ref|YP_002872867.1|  putative acyl-CoA dehydrogenase oxidoredu...   221    1e-55 
ref|YP_001412955.1|  acyl-CoA dehydrogenase domain-containing ...   221    1e-55 
ref|YP_001671217.1|  acyl-CoA dehydrogenase domain-containing ...   220    2e-55 
ref|YP_001899017.1|  acyl-CoA dehydrogenase domain protein [Ra...   220    2e-55 
ref|YP_002005487.1|  putative ACYL-COA DEHYDROGENASE [Cupriavi...   219    3e-55 
ref|YP_610422.1|  acyl-CoA dehydrogenase [Pseudomonas entomoph...   219    3e-55 
ref|YP_584000.1|  acyl-CoA dehydrogenase-like protein [Cupriav...   219    3e-55 
ref|YP_001888766.1|  acyl-CoA dehydrogenase domain protein [Bu...   219    4e-55 
ref|YP_003061222.1|  acyl-CoA dehydrogenase domain protein [Hi...   219    5e-55 
ref|YP_001790023.1|  acyl-CoA dehydrogenase domain-containing ...   218    6e-55 
ref|NP_747051.1|  acyl-CoA dehydrogenase domain-containing pro...   218    8e-55 
ref|YP_002787980.1|  putative acyl-CoA dehydrogenase [Deinococ...   218    1e-54 
ref|YP_003543591.1|  butyryl-CoA dehydrogenase [Sphingobium ja...   217    1e-54 
ref|YP_002981444.1|  acyl-CoA dehydrogenase domain protein [Ra...   217    1e-54 
ref|YP_001748920.1|  acyl-CoA dehydrogenase domain-containing ...   216    3e-54 
emb|CAD60270.1|  putative feruloyl-CoA dehydrogenase [Pseudomo...   216    4e-54 
ref|YP_368713.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   216    4e-54 
ref|ZP_05040896.1|  Acyl-CoA dehydrogenase, middle domain prot...   215    5e-54 
ref|YP_726030.1|  Acyl-CoA dehydrogenase [Ralstonia eutropha H...   215    5e-54 
ref|YP_001747391.1|  acyl-CoA dehydrogenase domain-containing ...   215    7e-54 
ref|ZP_04959174.1|  acyl-CoA dehydrogenase domain protein [gam...   214    1e-53 
ref|YP_002432494.1|  acyl-CoA dehydrogenase domain protein [De...   214    1e-53 
ref|NP_519883.1|  acyl-CoA dehydrogenase oxidoreductase protei...   213    2e-53 
ref|ZP_05033255.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   213    3e-53 
ref|YP_629060.1|  acyl-CoA dehydrogenase family protein [Myxoc...   212    4e-53 
ref|YP_754601.1|  hypothetical protein Swol_1933 [Syntrophomon...   212    4e-53 
ref|YP_002253945.1|  acyl-coa dehydrogenase protein [Ralstonia...   212    6e-53 
ref|YP_001764617.1|  acyl-CoA dehydrogenase domain-containing ...   211    8e-53 
ref|YP_295622.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   211    8e-53 
ref|ZP_04939037.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   211    8e-53 
ref|YP_003278994.1|  acyl-CoA dehydrogenase-like protein [Coma...   210    2e-52 
ref|ZP_03513690.1|  probable acyl-CoA dehydrogenase protein [R...   210    2e-52 
ref|ZP_00945623.1|  Acyl-CoA dehydrogenase [Ralstonia solanace...   210    2e-52 
ref|YP_003385926.1|  acyl-CoA dehydrogenase domain protein [Sp...   210    2e-52 
ref|YP_002230463.1|  putative Acyl-CoA dehydrogenase [Burkhold...   209    3e-52 
ref|ZP_04334235.1|  acyl-CoA dehydrogenase [Nocardiopsis dasso...   209    4e-52 
ref|YP_620742.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   209    4e-52 
ref|ZP_03542422.1|  acyl-CoA dehydrogenase domain protein [Com...   208    8e-52 
ref|NP_745494.1|  acyl-CoA dehydrogenase, ferrulic acid biotra...   208    8e-52 
emb|CBA26307.1|  hypothetical protein [Curvibacter putative sy...   207    2e-51 
ref|YP_692553.1|  acyl-CoA dehydrogenase family protein [Alcan...   207    2e-51 
ref|ZP_01053127.1|  acyl-CoA dehydrogenase [Polaribacter sp. M...   207    2e-51 
ref|ZP_01906960.1|  acyl-CoA dehydrogenase family protein [Ple...   206    3e-51 
ref|YP_754717.1|  hypothetical protein Swol_2052 [Syntrophomon...   206    3e-51 
ref|ZP_05823763.1|  LOW QUALITY PROTEIN: acyl-CoA dehydrogenas...   205    5e-51 
ref|ZP_03501344.1|  acyl-CoA dehydrogenase protein [Rhizobium ...   205    5e-51 
ref|ZP_02893523.1|  acyl-CoA dehydrogenase domain protein [Bur...   205    7e-51 
ref|YP_001267727.1|  acyl-CoA dehydrogenase domain-containing ...   205    7e-51 
ref|ZP_06690307.1|  conserved hypothetical protein [Acinetobac...   204    1e-50 
ref|ZP_06056971.1|  acyl-CoA dehydrogenase [Acinetobacter calc...   204    1e-50 
gb|ABO12244.2|  Acyl-CoA dehydrogenase [Acinetobacter baumanni...   204    1e-50 
ref|YP_001084846.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   204    1e-50 
ref|ZP_05827127.1|  acyl-CoA dehydrogenase [Acinetobacter baum...   203    2e-50 
ref|YP_003119481.1|  acyl-CoA dehydrogenase domain protein [Ca...   203    2e-50 
ref|YP_001807965.1|  acyl-CoA dehydrogenase domain-containing ...   203    2e-50 
ref|YP_753093.1|  hypothetical protein Swol_0384 [Syntrophomon...   203    2e-50 
ref|YP_002944808.1|  acyl-CoA dehydrogenase domain protein [Va...   203    3e-50 
ref|YP_001615925.1|  butyryl-CoA dehydrogenase [Sorangium cell...   203    3e-50 
ref|YP_001564338.1|  acyl-CoA dehydrogenase domain-containing ...   203    3e-50 
ref|YP_923051.1|  acyl-CoA dehydrogenase domain-containing pro...   203    3e-50 
gb|EFG46513.1|  acyl-CoA dehydrogenase [Brevibacterium mcbrell...   202    4e-50 
ref|YP_001020971.1|  putative acyl-CoA dehydrogenase [Methylib...   202    6e-50 
ref|YP_773125.1|  acyl-CoA dehydrogenase domain-containing pro...   201    1e-49 
ref|YP_628693.1|  acyl-CoA dehydrogenase [Myxococcus xanthus D...   200    2e-49 
ref|ZP_00054042.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   200    2e-49 
ref|YP_288271.1|  putative acyl-CoA dehydrogenase [Thermobifid...   199    3e-49 
ref|ZP_01461285.1|  acyl-coA-dehydrogenase [Stigmatella aurant...   199    5e-49 
ref|ZP_01442893.1|  Acyl-CoA dehydrogenase [Roseovarius sp. HT...   197    1e-48 
ref|YP_002601592.1|  acyl-CoA dehydrogenase family protein [De...   197    1e-48 
ref|ZP_02188381.1|  acyl-CoA dehydrogenase family protein [alp...   197    1e-48 
ref|YP_001205471.1|  putative acyl-CoA dehydrogenase. [Bradyrh...   197    1e-48 
ref|ZP_06282785.1|  acyl-CoA dehydrogenase domain protein [Str...   197    2e-48 
ref|ZP_03265568.1|  acyl-CoA dehydrogenase domain protein [Bur...   197    2e-48 
ref|YP_001825297.1|  putative acyl-CoA dehydrogenase [Streptom...   197    2e-48 
ref|YP_367246.1|  Acyl-CoA dehydrogenase [Burkholderia sp. 383...   196    4e-48 
ref|ZP_04694520.1|  putative acyl-CoA dehydrogenase [Streptomy...   195    6e-48 
ref|YP_421387.1|  Acyl-CoA dehydrogenase [Magnetospirillum mag...   195    6e-48 
ref|ZP_01737862.1|  Acyl-CoA dehydrogenase [Marinobacter sp. E...   195    7e-48 
ref|YP_523632.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   194    1e-47 
ref|ZP_05801601.1|  acyl-CoA dehydrogenase domain protein [Str...   194    2e-47 
ref|ZP_04991582.1|  acyl-CoA dehydrogenase [Streptomyces sp. S...   193    3e-47 
ref|ZP_06272928.1|  acyl-CoA dehydrogenase domain protein [Str...   192    4e-47 
ref|YP_971219.1|  acyl-CoA dehydrogenase domain-containing pro...   192    5e-47 
ref|NP_733617.1|  acyl-CoA dehydrogenase [Streptomyces coelico...   192    6e-47 
ref|ZP_06209324.1|  acyl-CoA dehydrogenase domain protein [Aci...   191    8e-47 
ref|YP_002553473.1|  acyl-CoA dehydrogenase domain protein [Ac...   191    8e-47 
ref|ZP_06295172.1|  acyl-CoA dehydrogenase domain protein [Bur...   191    1e-46 
ref|ZP_05620320.1|  acyl-CoA dehydrogenase [Enhydrobacter aero...   191    1e-46 
ref|ZP_05488366.1|  acyl-CoA dehydrogenase [Streptomyces sp. S...   191    1e-46 
ref|YP_549384.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   191    1e-46 
ref|ZP_05783253.1|  acyl-CoA dehydrogenase [Citreicella sp. SE...   191    1e-46 
ref|ZP_01055677.1|  acyl-CoA dehydrogenase, ferrulic acid biot...   191    1e-46 
ref|ZP_06708974.1|  acyl-CoA dehydrogenase [Streptomyces sp. e...   190    2e-46 
ref|YP_985954.1|  acyl-CoA dehydrogenase domain-containing pro...   190    2e-46 
ref|YP_996562.1|  acyl-CoA dehydrogenase domain-containing pro...   190    2e-46 
ref|NP_825567.1|  acyl-CoA dehydrogenase [Streptomyces avermit...   189    3e-46 
ref|ZP_05532850.1|  acyl-CoA dehydrogenase [Streptomyces virid...   189    4e-46 
ref|ZP_05005575.1|  acyl-CoA dehydrogenase [Streptomyces clavu...   189    4e-46 
ref|ZP_01549086.1|  Acyl-CoA dehydrogenase [Stappia aggregata ...   189    4e-46 
ref|YP_003490114.1|  putative acyl-CoA dehydrogenase [Streptom...   189    5e-46 
ref|ZP_04703232.1|  acyl-CoA dehydrogenase [Streptomyces albus...   189    5e-46 
ref|ZP_05011818.1|  acyl-CoA dehydrogenase [Streptomyces prist...   189    5e-46 
ref|ZP_05500578.1|  acyl-CoA dehydrogenase domain protein [Thi...   188    9e-46 
ref|ZP_04998731.1|  acyl-CoA dehydrogenase [Streptomyces sp. M...   187    1e-45 
ref|ZP_05540061.1|  acyl-CoA dehydrogenase [Streptomyces grise...   187    2e-45 
ref|ZP_04687053.1|  acyl-CoA dehydrogenase [Streptomyces ghana...   187    2e-45 
ref|YP_003297913.1|  acyl-CoA dehydrogenase domain protein [Th...   187    2e-45 
ref|YP_003411739.1|  acyl-CoA dehydrogenase domain protein [Ge...   187    2e-45 
ref|ZP_04761941.1|  acyl-CoA dehydrogenase domain protein [Aci...   186    3e-45 
ref|ZP_05017633.1|  acyl-CoA dehydrogenase [Streptomyces svice...   186    3e-45 
ref|ZP_01004368.1|  acyl-CoA dehydrogenase family protein [Lok...   186    3e-45 
ref|ZP_05507613.1|  putative acyl-CoA dehydrogenase [Streptomy...   186    4e-45 
ref|ZP_01106238.1|  probable acyl-CoA dehydrogenase [Flavobact...   185    6e-45 
ref|ZP_05516226.1|  putative acyl-CoA dehydrogenase [Streptomy...   184    1e-44 
ref|ZP_04717108.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   184    1e-44 
ref|ZP_01078017.1|  Acyl-CoA dehydrogenase [Marinomonas sp. ME...   184    2e-44 
ref|NP_354421.2|  acyl-CoA dehydrogenase [Agrobacterium tumefa...   180    2e-43 
ref|YP_003344334.1|  acyl-CoA dehydrogenase [Streptosporangium...   179    4e-43 
ref|ZP_06414277.1|  acyl-CoA dehydrogenase domain protein [Fra...   179    5e-43 
ref|ZP_06240514.1|  acyl-CoA dehydrogenase domain protein [Fra...   179    5e-43 
ref|YP_003514638.1|  acyl-CoA dehydrogenase domain-containing ...   178    9e-43 
ref|ZP_01012918.1|  putative acyl-coa dehydrogenase protein [R...   178    9e-43 
ref|ZP_06473370.1|  acyl-CoA dehydrogenase domain protein [Fra...   175    6e-42 
ref|YP_003135645.1|  acyl-CoA dehydrogenase [Saccharomonospora...   175    8e-42 
ref|YP_905218.1|  acyl-CoA dehydrogenase FadE5 [Mycobacterium ...   174    1e-41 
ref|YP_003204550.1|  acyl-CoA dehydrogenase domain protein [Na...   174    1e-41 
ref|ZP_06400364.1|  acyl-CoA dehydrogenase domain protein [Mic...   174    2e-41 
ref|ZP_06218665.1|  acyl-CoA dehydrogenase domain protein [Mic...   174    2e-41 
ref|ZP_06607003.1|  acyl-CoA dehydrogenase [Aeromicrobium mari...   173    3e-41 
ref|YP_003384623.1|  acyl-CoA dehydrogenase domain protein [Kr...   173    3e-41 
ref|YP_479176.1|  acyl-CoA dehydrogenase-like [Frankia sp. CcI...   173    3e-41 
ref|ZP_05484142.1|  acyl-CoA dehydrogenase domain protein [Str...   172    4e-41 
ref|YP_638675.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   172    5e-41 
ref|YP_001848824.1|  acyl-CoA dehydrogenase FadE5 [Mycobacteri...   171    9e-41 
ref|YP_003275453.1|  acyl-CoA dehydrogenase domain protein [Go...   171    1e-40 
ref|YP_710365.1|  acyl-CoA dehydrogenase [Frankia alni ACN14a]...   171    1e-40 
ref|ZP_04606714.1|  acyl-CoA dehydrogenase [Micromonospora sp....   170    2e-40 
ref|YP_001069798.1|  acyl-CoA dehydrogenase domain-containing ...   169    3e-40 
ref|ZP_00994549.1|  putative acyl-CoA dehydrogenase [Janibacte...   169    3e-40 
ref|ZP_04747127.1|  acyl-CoA dehydrogenase FadE5 [Mycobacteriu...   168    1e-39 
ref|YP_637419.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   168    1e-39 
ref|ZP_05225428.1|  putative acyl-CoA dehydrogenase [Mycobacte...   167    1e-39 
ref|ZP_04026086.1|  acyl-CoA dehydrogenase [Tsukamurella pauro...   167    1e-39 
ref|ZP_01746355.1|  acyl-CoA dehydrogenase [Sagittula stellata...   167    1e-39 
ref|YP_884819.1|  acyl-CoA-dehydrogenase [Mycobacterium smegma...   167    1e-39 
ref|ZP_05224540.1|  FadE15 [Mycobacterium intracellulare ATCC ...   167    2e-39 
ref|YP_882491.1|  putative acyl-CoA dehydrogenase [Mycobacteri...   167    2e-39 
ref|YP_001068536.1|  acyl-CoA dehydrogenase domain-containing ...   167    2e-39 
ref|YP_001131691.1|  acyl-CoA dehydrogenase domain-containing ...   167    2e-39 
ref|YP_003030169.1|  acyl-CoA dehydrogenase fadE5 [Mycobacteri...   166    3e-39 
ref|YP_976380.1|  putative acyl-CoA dehydrogenase fadE5 [Mycob...   166    3e-39 
ref|NP_962628.1|  FadE5 [Mycobacterium avium subsp. paratuberc...   166    3e-39 
ref|NP_853915.1|  acyl-CoA dehydrogenase FADE5 [Mycobacterium ...   166    3e-39 
ref|NP_214758.1|  acyl-CoA dehydrogenase FADE5 [Mycobacterium ...   166    3e-39 
ref|YP_001109325.1|  acyl-CoA dehydrogenase [Saccharopolyspora...   166    4e-39 
ref|NP_960129.1|  FadE15 [Mycobacterium avium subsp. paratuber...   166    4e-39 
ref|YP_001507340.1|  acyl-CoA dehydrogenase domain-containing ...   166    5e-39 
ref|YP_001511496.1|  acyl-CoA dehydrogenase domain-containing ...   166    5e-39 
ref|ZP_04750043.1|  acyl-CoA dehydrogenase FadE15 [Mycobacteri...   165    8e-39 
ref|YP_001156952.1|  acyl-CoA dehydrogenase domain-containing ...   165    8e-39 
ref|YP_705142.1|  butyryl-CoA dehydrogenase [Rhodococcus josti...   165    8e-39 
ref|YP_951120.1|  acyl-CoA dehydrogenase domain-containing pro...   165    8e-39 
ref|NP_302639.1|  acyl-CoA dehydrogenase [Mycobacterium leprae...   164    1e-38 
ref|YP_003104604.1|  acyl-CoA dehydrogenase domain protein [Ac...   164    1e-38 
ref|YP_001705161.1|  acyl-CoA dehydrogenase FadE [Mycobacteriu...   164    1e-38 
ref|ZP_06515688.1|  LOW QUALITY PROTEIN: acyl-CoA dehydrogenas...   163    3e-38 

ALIGNMENTS
>ref|ZP_01256117.1| probable acyl-CoA dehydrogenase [Psychroflexus torquis ATCC 700755]
Length=441

 Score =  488 bits (1257),  Expect = 3e-136
 Identities = 238/314 (75%), Positives = 269/314 (85%), Gaps = 1/314 (0%)
 Frame = -1

Query  944  PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  765
            PS+IGGGG+P  LS   LEIL TAN+AF L PGLS GAIS INFH ++ QK  +LP LVS
Sbjct  97   PSDIGGGGLPYGLSAAILEILCTANMAFVLGPGLSIGAISGINFHANQGQKDMYLPDLVS  156

Query  764  GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  585
            G WTGTMNLSEPQSGSDL  I+TKA  Q DG+Y+ITGTK+WI  GEHD++ENIIHLVLAK
Sbjct  157  GNWTGTMNLSEPQSGSDLSNISTKAIKQDDGTYRITGTKIWIGSGEHDLSENIIHLVLAK  216

Query  584  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGY  405
            VPGSPEGTKGISMFIVPK  +NDD SLG +N VNCISIEEKLGIH SPTCVMEYD SVGY
Sbjct  217  VPGSPEGTKGISMFIVPKFVVNDDSSLGRHNKVNCISIEEKLGIHGSPTCVMEYDDSVGY  276

Query  404  LIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAKN  225
            LIGEEN GLNYMFT +NEAR+  GG GLAC +GALQGA+QYARDRVQGRP+GMSKE+AK+
Sbjct  277  LIGEENMGLNYMFTTINEARIRAGGHGLACTSGALQGASQYARDRVQGRPVGMSKEEAKD  336

Query  224  STIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVT  45
            S+IIDHADVRR LMTIK+Y+DAMRY+ YDN LM+DLEYFAE  E K FG+ERCGILTP+T
Sbjct  337  SSIIDHADVRRTLMTIKSYLDAMRYMNYDNHLMLDLEYFAEG-ELKDFGKERCGILTPIT  395

Query  44   KAWVSDLGVELSSV  3
            KAW+SD  VEL+S+
Sbjct  396  KAWISDSSVELTSM  409


>ref|ZP_01017414.1| probable acyl-CoA dehydrogenase [Parvularcula bermudensis HTCC2503]
 gb|EAQ15861.1| probable acyl-CoA dehydrogenase [Parvularcula bermudensis HTCC2503]
Length=594

 Score =  343 bits (880),  Expect = 2e-92
 Identities = 172/309 (55%), Positives = 220/309 (71%), Gaps = 1/309 (0%)
 Frame = -1

Query  938  EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  759
            E GG G+P+ L     E+ S+AN AF + PGLS GA  AI  +GS+EQK+K+LPK+ SGE
Sbjct  99   EYGGQGLPLVLQYAVAEMTSSANQAFAMYPGLSGGAWRAIYMNGSDEQKEKYLPKMTSGE  158

Query  758  WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  579
            WTGTMNL+EPQ G+DLG I TKAE Q DG+YKI+G K+WI+ GEHDM++NIIHLVLAK+P
Sbjct  159  WTGTMNLTEPQCGTDLGLIRTKAEPQDDGTYKISGQKIWISAGEHDMSDNIIHLVLAKIP  218

Query  578  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLI  399
            G P+G KGIS+FIVPK  +N+DGSLGE NNV C  +EEK+GIH + TCVM YD + GYL+
Sbjct  219  GGPDGVKGISLFIVPKFMVNEDGSLGERNNVVCGGLEEKMGIHGNATCVMNYDEATGYLV  278

Query  398  GEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAKNS  222
            GEE++GL  MF MMNEAR+ VG QGL+ A  A Q AA +A+DR+Q R I G    D    
Sbjct  279  GEEHKGLRAMFIMMNEARLGVGLQGLSAAEVAYQNAAAFAKDRLQMRSISGTKAPDQPAD  338

Query  221  TIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVTK  42
             II H DVRRML+  + + +  R L Y   L  DL + +EDE T+   ++  G+LTP+ K
Sbjct  339  PIIVHPDVRRMLLDTRVFTEGARMLTYWAALHEDLAHKSEDEATRQKAKDYMGLLTPIIK  398

Query  41   AWVSDLGVE  15
            A+ +  G E
Sbjct  399  AFNTHKGFE  407


>ref|YP_001412055.1| acyl-CoA dehydrogenase domain-containing protein [Parvibaculum 
lavamentivorans DS-1]
 gb|ABS62398.1| acyl-CoA dehydrogenase domain protein [Parvibaculum lavamentivorans 
DS-1]
Length=586

 Score =  343 bits (879),  Expect = 2e-92
 Identities = 168/316 (53%), Positives = 229/316 (72%), Gaps = 6/316 (1%)
 Frame = -1

Query  941  SEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSG  762
            +E GG G+P+ LS    E+ + A L+FGL P LS GAI A+  HG+EEQK  +L +L+SG
Sbjct  96   TEYGGQGLPVALSVAMQEMWNAACLSFGLCPILSQGAIEALTAHGTEEQKNIYLARLISG  155

Query  761  EWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKV  582
            EWTGTMNL+EPQ+GSDL  + TKA  QGDG+Y+I+GTK++IT+G+HDM ENI+HLVLA++
Sbjct  156  EWTGTMNLTEPQAGSDLNALKTKAVPQGDGTYRISGTKIYITYGDHDMAENIVHLVLARL  215

Query  581  PGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSV  411
            P +P GTKGIS+F+VPK  +N+DGSLG  N+  CI +EEKLGIH SPTCVM Y    G++
Sbjct  216  PDAPPGTKGISLFLVPKFLVNEDGSLGARNDAWCIGLEEKLGIHGSPTCVMSYGENGGAI  275

Query  410  GYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDA  231
            G LIG+ENRGL  MFTMMN AR+ VG QG+A A  A Q A  YA+DR QGRP+G +    
Sbjct  276  GTLIGQENRGLACMFTMMNNARLLVGTQGVAIAEAAYQHALAYAKDRKQGRPLGSTLAPG  335

Query  230  KNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTP  51
            + + II+H D+RRML+T+K+  DA R + Y   + +D  +  +  E     + R  +LTP
Sbjct  336  EMAPIIEHPDIRRMLLTMKSLTDASRAICYATAVAIDGAHAGDKREE---AQARADLLTP  392

Query  50   VTKAWVSDLGVELSSV  3
            + K++ +D+GVE++S+
Sbjct  393  IAKSFSTDIGVEVASI  408


>ref|ZP_01862814.1| putative acyl-CoA dehydrogenase protein [Erythrobacter sp. SD-21]
 gb|EDL50249.1| putative acyl-CoA dehydrogenase protein [Erythrobacter sp. SD-21]
Length=601

 Score =  338 bits (867),  Expect = 5e-91
 Identities = 174/312 (55%), Positives = 225/312 (72%), Gaps = 1/312 (0%)
 Frame = -1

Query  938  EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  759
            E GG GMP  L     E +S+AN AFG+ PGL+ GAISA+   GS+EQK  +LPK+VSGE
Sbjct  99   EFGGQGMPHVLGFVMEEFISSANQAFGMYPGLTNGAISALLAKGSDEQKAMYLPKMVSGE  158

Query  758  WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  579
            WTGTMNL+EP  G+DLG I TKAE  GDGSY ITGTK++I+ GEHDM+ENIIHLVLAK P
Sbjct  159  WTGTMNLTEPHCGTDLGMIRTKAEPLGDGSYAITGTKIFISAGEHDMSENIIHLVLAKTP  218

Query  578  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLI  399
            G+P+ TKGIS+F+VPK  +N+DG+ GE N V C SIEEK+GIH + TCV+ YDG+ G+++
Sbjct  219  GAPDSTKGISLFVVPKFLVNEDGTPGERNGVMCGSIEEKMGIHGNSTCVLNYDGAKGWMV  278

Query  398  GEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAKNS  222
            GEEN+GL  MF MMN AR+ VG QGL+ A  A Q A  YA DR QGR + G ++ +A+  
Sbjct  279  GEENKGLAAMFIMMNAARLGVGMQGLSQAEVAYQNAVAYALDRRQGRALTGPAEPEAQAD  338

Query  221  TIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVTK  42
             I  H DVRRMLM  KA+ +AMR L     L++DL + A+ EE +A  +   G++TPV K
Sbjct  339  PIFVHPDVRRMLMDAKAFTEAMRALALWGGLLVDLTHKAQTEEERAEADLLLGLMTPVIK  398

Query  41   AWVSDLGVELSS  6
             + +D G E+++
Sbjct  399  GYGTDKGYEVAT  410


>ref|ZP_06229014.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCGE1002]
 gb|EFA51953.1| acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCGE1002]
Length=645

 Score =  337 bits (864),  Expect = 1e-90
 Identities = 169/317 (53%), Positives = 230/317 (72%), Gaps = 5/317 (1%)
 Frame = -1

Query  944  PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  765
            PSE GG  +P  LS   +E+L+ ANL+ GL P L+ GAI A+   GSEE KQ+++PK++S
Sbjct  140  PSEYGGQDLPKLLSTPCIEMLNAANLSLGLCPLLTDGAIEALLTAGSEELKQRYVPKMIS  199

Query  764  GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  585
            GEWTGTMNL+EPQ+GSDL  + T+AE QGDGSY+I+GTK++IT+GEHDMTENI+HLVLA+
Sbjct  200  GEWTGTMNLTEPQAGSDLSLVRTRAEPQGDGSYRISGTKIFITWGEHDMTENIVHLVLAR  259

Query  584  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGS  414
             P +PEG KGIS+F+VPK  +N+DGSLGE N+V+C+SIE KLGI ASPT V+++    G+
Sbjct  260  TPSAPEGVKGISLFVVPKFLVNEDGSLGERNDVHCVSIEHKLGIKASPTAVLQFGDHGGA  319

Query  413  VGYLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKED  234
            +G L+GEENRGL YMF MMN AR  VG QG+A ++ A Q A  YA++RVQGRP+  S + 
Sbjct  320  IGQLVGEENRGLEYMFIMMNAARFAVGVQGVAISDRAYQQAVAYAKERVQGRPVDGSAK-  378

Query  233  AKNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILT  54
             ++  II H DVRRML T++A  +  R L Y +    DL +   D  T+A  +     L 
Sbjct  379  -QSVAIIQHPDVRRMLSTMRALTEGARALAYVSASHCDLAHRHPDRATRANHQAIYEYLV  437

Query  53   PVTKAWVSDLGVELSSV  3
            P+ K W +++ +E++S+
Sbjct  438  PIVKGWSTEMSLEVTSL  454


>ref|NP_353529.2| acyl-CoA dehydrogenase [Agrobacterium tumefaciens str. C58]
 gb|AAK86314.2| acyl-CoA dehydrogenase [Agrobacterium tumefaciens str. C58]
Length=598

 Score =  335 bits (858),  Expect = 6e-90
 Identities = 163/311 (52%), Positives = 222/311 (71%), Gaps = 1/311 (0%)
 Frame = -1

Query  944  PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  765
            PSE GG G+P TL     E +S+ANL+  + PGL+ GAI+A+  HG++EQK+ +LPK+V 
Sbjct  97   PSEFGGQGLPYTLHAAIGEYMSSANLSLMMYPGLTQGAIAAVLVHGTQEQKETYLPKMVE  156

Query  764  GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  585
            G W+GTMNL+EP  G+DLG + TKA  QGDGSYKI+G K++I+ GEH MT+NI+HLV+A+
Sbjct  157  GTWSGTMNLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAGEHSMTDNIVHLVIAR  216

Query  584  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGY  405
            + G+PEGTKGIS+FIVPK  + +DG+LGE N V C +IE K+GIH + TCVM YD + GY
Sbjct  217  IEGAPEGTKGISLFIVPKFLVKEDGTLGERNGVTCGAIEHKMGIHGNATCVMNYDDATGY  276

Query  404  LIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSK-EDAK  228
            L+G EN+GL+ MF MMNEAR+ VG QGL+    A Q A +YARDR+QGR +  +K  D K
Sbjct  277  LLGAENKGLSAMFVMMNEARLGVGLQGLSVGEIAYQNAVEYARDRIQGRSLSGAKFPDKK  336

Query  227  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  48
               II H D+RR LMTIKAY +A R  +    L  D+ + A DE+ +   ++  G++TP+
Sbjct  337  ADPIIVHPDIRRTLMTIKAYNEAGRAFLLWTALQSDIAHRAADEKQRQAADDLLGLVTPI  396

Query  47   TKAWVSDLGVE  15
             K  ++D G +
Sbjct  397  LKGVLTDKGFD  407


>ref|YP_933206.1| acyl-CoA dehydrogenase [Azoarcus sp. BH72]
 emb|CAL94319.1| probable acyl-CoA dehydrogenase [Azoarcus sp. BH72]
Length=599

 Score =  334 bits (857),  Expect = 8e-90
 Identities = 166/314 (52%), Positives = 221/314 (70%), Gaps = 5/314 (1%)
 Frame = -1

Query  938  EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  759
            E GG G+P  +S   +E+  +AN+AF L P L+ GAI A+   G++EQK  +LPK+VSGE
Sbjct  99   EFGGQGLPKLISTAVMEMWKSANMAFSLCPMLTTGAIEALLLRGNDEQKAMYLPKMVSGE  158

Query  758  WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  579
            WTGTMNL+EPQ+GSDL  + T+AE QGDG+Y+I G K++IT+GEHD+T+NIIHLVLA++P
Sbjct  159  WTGTMNLTEPQAGSDLAAVRTRAEPQGDGTYRIFGQKIFITYGEHDLTDNIIHLVLARLP  218

Query  578  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSVG  408
             +PEG KGIS+F+VPK  +N DGSLG  N+V C+SIE KLGIHASPTCV+ +    G++G
Sbjct  219  DAPEGVKGISLFVVPKFMVNADGSLGARNDVECVSIEHKLGIHASPTCVLAFGDKGGAIG  278

Query  407  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  228
             L+GE NRGL YMF MMNEAR  VG +GLA +  A Q A  YA+DRVQG   G+      
Sbjct  279  TLVGEANRGLEYMFIMMNEARFAVGMEGLALSERAYQHALAYAKDRVQGTEAGV--RGGP  336

Query  227  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  48
              +II HADVRRMLM++K+  +AMR L Y      DL +   DE  +A  +    ++ PV
Sbjct  337  KVSIIHHADVRRMLMSMKSQTEAMRALAYVVGAATDLAHHHADEAVRASNQAFVDLMIPV  396

Query  47   TKAWVSDLGVELSS  6
             K W ++  +E++S
Sbjct  397  VKGWCTENSIEIAS  410


>ref|ZP_01546756.1| acyl-CoA dehydrogenase [Stappia aggregata IAM 12614]
 gb|EAV44685.1| acyl-CoA dehydrogenase [Stappia aggregata IAM 12614]
Length=598

 Score =  334 bits (857),  Expect = 8e-90
 Identities = 163/305 (53%), Positives = 223/305 (73%), Gaps = 1/305 (0%)
 Frame = -1

Query  932  GGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGEWT  753
            GG G+P TL+    E  S+AN+AF + PGL+AGA++A+  HG++EQKQ +LP +++G WT
Sbjct  101  GGQGLPHTLTTIFNEFASSANMAFSMYPGLTAGAVAALTIHGTDEQKQTYLPNMIAGTWT  160

Query  752  GTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVPGS  573
            GTMNL+EP  G+DLG I TKA  Q DGSYKITGTK++I+ G+HDM ENIIHLVLA++ G+
Sbjct  161  GTMNLTEPHCGTDLGLIRTKAVPQADGSYKITGTKIFISAGQHDMAENIIHLVLARIEGA  220

Query  572  PEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGYLIGE  393
            PEGTKGIS+F+VP+  I DDG++G+NN V+C SIE K+GIH + TCVM YD + G+L+GE
Sbjct  221  PEGTKGISLFVVPRNAIGDDGTVGDNNGVSCGSIEHKMGIHGNATCVMNYDDATGWLVGE  280

Query  392  ENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAKNSTI  216
            EN+GL  MFTMMNEAR+ V  QGL+ +  A Q A  YA+DR+QGR + G    D     I
Sbjct  281  ENKGLRAMFTMMNEARLGVAVQGLSQSEVAYQNAVTYAKDRIQGRALTGPKAPDKPADPI  340

Query  215  IDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPVTKAW  36
            I H DVRR LM I+++ +A R L+    L  D+ + ++DE++K F ++  G++TPV K  
Sbjct  341  IVHPDVRRTLMQIRSFNEAARALIIWTALHGDVSHRSDDEKSKQFSDDMMGLMTPVLKGV  400

Query  35   VSDLG  21
            ++D G
Sbjct  401  LTDTG  405


>ref|YP_002543346.1| acyl-CoA dehydrogenase protein [Agrobacterium radiobacter K84]
 gb|ACM25421.1| acyl-CoA dehydrogenase protein [Agrobacterium radiobacter K84]
Length=598

 Score =  334 bits (856),  Expect = 1e-89
 Identities = 166/311 (53%), Positives = 220/311 (70%), Gaps = 1/311 (0%)
 Frame = -1

Query  944  PSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVS  765
            P E GG G+P TL     E  S AN++  + PGL+ GAI+AI  HGS+EQK+ +LPK+V 
Sbjct  97   PEEFGGQGLPYTLHAAVGEYTSAANMSLMMYPGLTQGAIAAILVHGSDEQKRTYLPKMVE  156

Query  764  GEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAK  585
            G W+GTMNL+EP  G+DLG + TKA  QGDGSYKI+G K++I+ GEHDMT+NI+HLVLA+
Sbjct  157  GTWSGTMNLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAGEHDMTDNIVHLVLAR  216

Query  584  VPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVGY  405
            + G+PEGTKGIS+FIVPK  + +DGSLG  N V+C +IE K+GIH + TCVM YD + G+
Sbjct  217  IEGAPEGTKGISLFIVPKFMVKEDGSLGARNPVSCGAIEHKMGIHGNATCVMNYDEATGF  276

Query  404  LIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDAK  228
            LIG ENRGLN MF MMNEAR+ VG QGL+ A  A Q AA YARDR+QGR + G    D K
Sbjct  277  LIGAENRGLNAMFVMMNEARLGVGLQGLSIAEIAYQNAAAYARDRIQGRSLSGPKAPDKK  336

Query  227  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  48
               II H D+RR LMTI+A+ +A R  +    L  D+ + ++DE+ +   ++  G+ TP+
Sbjct  337  ADPIIVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRSQDEKERQAADDILGLATPI  396

Query  47   TKAWVSDLGVE  15
             K  ++D G +
Sbjct  397  LKGVLTDKGFD  407


>ref|YP_760546.1| acyl-CoA dehydrogenase family protein [Hyphomonas neptunium ATCC 
15444]
 gb|ABI75376.1| acyl-CoA dehydrogenase family protein [Hyphomonas neptunium ATCC 
15444]
Length=589

 Score =  334 bits (856),  Expect = 1e-89
 Identities = 167/315 (53%), Positives = 226/315 (71%), Gaps = 4/315 (1%)
 Frame = -1

Query  947  SPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLV  768
            +P E GG G+P  L+ G +E+   AN+AFGL P LS GA+ A+  HG++ Q+  +LPKLV
Sbjct  94   APEEWGGQGLPKALALGVMEMFHGANMAFGLCPMLSYGAVEALLAHGTDVQRAAYLPKLV  153

Query  767  SGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLA  588
            SGEWTGTMNL+EPQ+GSD+G + TKAE   DGSY ITG K++IT+G+HDM ENIIHLVLA
Sbjct  154  SGEWTGTMNLTEPQAGSDVGALKTKAEPCEDGSYSITGQKIYITWGDHDMAENIIHLVLA  213

Query  587  KVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVG  408
            ++P +P G+KGIS+F+VPK  ++ DG+ GE N V CI +E+K+GIH SPTCVMEY G+ G
Sbjct  214  RLPDAPAGSKGISLFLVPKFILDADGTPGERNGVRCIGLEKKMGIHGSPTCVMEYSGAKG  273

Query  407  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  228
            +LIGEENRGL  MFTMMN AR+ VG +G+A    A Q A  YA++R QG   G++     
Sbjct  274  WLIGEENRGLACMFTMMNSARLNVGLEGVAVGEAAFQTAFAYAQERKQGAAAGVTGP---  330

Query  227  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  48
             + I+ HADVRR L T++A V A R + Y   +  DL + + D + +A  + R  +LTP+
Sbjct  331  -APILHHADVRRTLTTMRAKVAAARAICYACGVAADLAHSSPDPDVRAAAKTREDLLTPI  389

Query  47   TKAWVSDLGVELSSV  3
             KAW +D+GVE++S+
Sbjct  390  AKAWSTDIGVEVASL  404


>ref|YP_002824722.1| acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234]
 gb|ACP23969.1| acyl-CoA dehydrogenase protein [Rhizobium sp. NGR234]
Length=598

 Score =  333 bits (854),  Expect = 2e-89
 Identities = 168/312 (53%), Positives = 219/312 (70%), Gaps = 1/312 (0%)
 Frame = -1

Query  947  SPSEIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLV  768
            +P E GG G+P TL     E LS AN++  + PGL+ GAI+AI  HGSEEQK+ +LPK+V
Sbjct  96   APEEFGGQGLPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMV  155

Query  767  SGEWTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLA  588
             G WTGTMNL+EP  G+DLG + TKA   GDGSY+I+G K++I+ GEHDM ENIIHLVLA
Sbjct  156  DGTWTGTMNLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAGEHDMAENIIHLVLA  215

Query  587  KVPGSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEYDGSVG  408
            ++ G+PEG KGIS+FIVPK K+NDDG  G  N V+C +IE K+GIH + TCVM YD + G
Sbjct  216  RIEGAPEGVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIHGNSTCVMNYDEATG  275

Query  407  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPI-GMSKEDA  231
            YLIG EN+GLN MF MMNEAR+ VG QGLA A  A Q AA YAR+R+QGR + G+   + 
Sbjct  276  YLIGAENKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGVKAPEQ  335

Query  230  KNSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTP  51
            K   II H DVRR LMTIKA+ +A R       L  D+ + +++E  +   ++  G++TP
Sbjct  336  KADPIIVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGLMTP  395

Query  50   VTKAWVSDLGVE  15
            + K  ++D G +
Sbjct  396  ILKGVLTDKGFD  407


>ref|ZP_01165298.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Oceanospirillum sp. MED92]
 gb|EAR62650.1| Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central 
region [Oceanospirillum sp. MED92]
Length=598

 Score =  333 bits (854),  Expect = 2e-89
 Identities = 172/315 (54%), Positives = 224/315 (71%), Gaps = 8/315 (2%)
 Frame = -1

Query  938  EIGGGGMPITLSGGTLEILSTANLAFGLAPGLSAGAISAINFHGSEEQKQKFLPKLVSGE  759
            E GG G+P  LS   +E+  +AN+A+GL P LS GA+ AI  +GS+E K K+LP+LVSGE
Sbjct  98   EFGGQGLPYALSIPVMEMWQSANMAWGLCPLLSQGAVEAIFHNGSDELKAKYLPQLVSGE  157

Query  758  WTGTMNLSEPQSGSDLGTITTKAEDQGDGSYKITGTKVWITFGEHDMTENIIHLVLAKVP  579
            WTGTMNL+EPQ+GSDL  I + A+  GD  Y+I G K++IT+GEHDM ENIIHLVLA++P
Sbjct  158  WTGTMNLTEPQAGSDLAAIRSTAKPVGD-HYRIKGQKIFITWGEHDMAENIIHLVLARLP  216

Query  578  GSPEGTKGISMFIVPKIKINDDGSLGENNNVNCISIEEKLGIHASPTCVMEY---DGSVG  408
             +P G KGIS+F+VPK  +NDDGSLGE N+  C+S+E KLGIHASPTCVM +   +G++G
Sbjct  217  DAPPGVKGISLFVVPKFLVNDDGSLGERNDAKCVSLEHKLGIHASPTCVMAFGDDEGAIG  276

Query  407  YLIGEENRGLNYMFTMMNEARVWVGGQGLACANGALQGAAQYARDRVQGRPIGMSKEDAK  228
            YL+GEENRGL  MFTMMN AR+ VG QG+A +  A Q A +YA DRVQ  P+G S+E A 
Sbjct  277  YLVGEENRGLACMFTMMNNARLAVGLQGVAISERAYQHALEYAHDRVQSPPVG-SREAA-  334

Query  227  NSTIIDHADVRRMLMTIKAYVDAMRYLMYDNQLMMDLEYFAEDEETKAFGEERCGILTPV  48
               II HADVRRML+T+K   +A R L YD    +D  + +ED   +A    R   LTP+
Sbjct  335  --PIIQHADVRRMLLTMKTMTEAGRALAYDACASLDFAHHSEDPAIRAKESARAAYLTPI  392

Query  47   TKAWVSDLGVELSSV  3
             K W ++   E++S+
Sbjct  393  VKGWCTEFAQEVTSL  407