GOS 1325010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092351556355
Annotathon code: GOS_1325010
Sample :
  • GPS :0°1'15s; 91°11'52w
  • Galapagos Islands: Cabo Marshall, Isabella Island - Ecuador
  • Coastal (-2.1m, 25.8°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : malufa
Annotated on : 2010-07-04 23:58:29
  • FábioAlexandreBastos a36796@ualg.pt
  • LuísAndréRoqueFortes a36803@ualg.pt
  • MariaGonçalvesFernandes a36805@ualg.pt

Synopsis

Genomic Sequence

>JCVI_READ_1092351556355 GOS_1325010 Genomic DNA
AAACTTTTCATGAAACTTTGTTTAGGTCAGCAATTATTTTTCTTTTGTTCGCAACAGTATATTCTAAGACTCTTTGTCTTATCTCCTTATATTTATTCTT
CAACTTATCCGACTTTACGGTCTTGATTCTTTTGTCAAATGACATATAAACATAAAGTAAAAACTGTTCGTATTTGTCCTTTCCTTTCTTAGCGTCTGGG
TGAAAGGACTGTATCAAGTCAGTTAGATTTTCCATATTATACTACGCTAGTTTACCATGTGGAGCAAATCGAGATCCAAATTGTGAAATGTTTCTTTTTA
AAGAGAGATACAGTAAGTCTGTCCAGAACTCTGCTTTTTTACCTTTAGCACTATTTAACGACTCATAAAAGAATTCTAACTGCATTAGTTTAGATTGAGC
AACAGCCATCTTCTTTTTATCACCAGATCGATACATTTCTTTTATCCTACCCTCAAACTCATCATAACTCCTACTTCCAGTAATAACTCTAGGTGCTAGA
AAATTATACATCTTTTTGTAATCTCTTCGGTCATTCAAAAATTCAACAGCAGTTGTAGGAAAGTCCTGGTGTTTGTTAACGAAAGATATTCCAGCACTCT
TCATCAAAGTTCCAACCAAATCTACTGGTGCTGCTCCACCTCTACCGCCACTTCCTTTAATACTACTCTCAAACTTCAAGTTACTAAAACTATTATTGGC
GGTGGGAGTTCTTATGATGTTAACGGTATAGGCATCAAATAAAGCATATCCACCCTGACTCATACCATCTTTAGTAACTTCAGTCTTTATCTCAAATTTA
ATATCCTTCATCTTGACTTCTTCAACCTTTGCAAACTCCATCCTCTTAGTATCTTTGTTTATATACTTAAAGTTTGCTTTTTCTTTTGGTTCAATTTTT

Translation

[2 - 655/899]   indirect strand
>GOS_1325010 Translation [2-655   indirect strand]
KIEPKEKANFKYINKDTKRMEFAKVEEVKMKDIKFEIKTEVTKDGMSQGGYALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMK
SAGISFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGSRSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQLEFFYESLNSAKGKKAEFWTDLLYLSL
KRNISQFGSRFAPHGKLA

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

The ORF sequence does contain over 60aa in lenght (218aa in totality). Like it is very long, it is likely that this ORF does indeed code for a protein. So, knowing that e-values are non-significants (E_0.048 on tBLASTx) over all the Blast research showing that there isn't credible homology sequences, this is an ORFan. So, to conclude, it's coding.


Due non-significant e-values the taxonomy, molecular weight and biological process can't be concluded.



ORF finding

PROTOCOL

a)foward strand

Sequence Manipulation Suite (SMS)/ Orf finder /'any codon' initiation / frames 1, 2 and 3 / forward strand / 60 codons / 'standart (1)' genetic code


b)reverse strand

Sequence Manipulation Suite (SMS)/ Orf finder /'any codon' initiation / frames 1, 2 and 3 / reverse strand / 60 codons / 'standart (1)' genetic code




RESULTS ANALYSIS


When doing research with SMS it was found four open reading frames (two on forward strand and other two on reverse strand). Was selected the longest one for all subsequent analyses which is ORF number 1 in reading frame 2 on the reverse strand. This ORF extends from base 2 to base 658.



RAW RESULTS

a)forward strand
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 500 to base 742.
AAAATTATACATCTTTTTGTAATCTCTTCGGTCATTCAAAAATTCAACAGCAGTTGTAGG
AAAGTCCTGGTGTTTGTTAACGAAAGATATTCCAGCACTCTTCATCAAAGTTCCAACCAA
ATCTACTGGTGCTGCTCCACCTCTACCGCCACTTCCTTTAATACTACTCTCAAACTTCAA
GTTACTAAAACTATTATTGGCGGTGGGAGTTCTTATGATGTTAACGGTATAGGCATCAAA
TAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
KIIHLFVISSVIQKFNSSCRKVLVFVNERYSSTLHQSSNQIYWCCSTSTATSFNTTLKLQ
VTKTIIGGGSSYDVNGIGIK*

>ORF number 1 in reading frame 3 on the direct strand extends from base 522 to base 731.
TCTCTTCGGTCATTCAAAAATTCAACAGCAGTTGTAGGAAAGTCCTGGTGTTTGTTAACG
AAAGATATTCCAGCACTCTTCATCAAAGTTCCAACCAAATCTACTGGTGCTGCTCCACCT
CTACCGCCACTTCCTTTAATACTACTCTCAAACTTCAAGTTACTAAAACTATTATTGGCG
GTGGGAGTTCTTATGATGTTAACGGTATAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
SLRSFKNSTAVVGKSWCLLTKDIPALFIKVPTKSTGAAPPLPPLPLILLSNFKLLKLLLA
VGVLMMLTV*

-------------------------------------------------------------------------------------------
b)reverse strand
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 658.
AAAATTGAACCAAAAGAAAAAGCAAACTTTAAGTATATAAACAAAGATACTAAGAGGATG
GAGTTTGCAAAGGTTGAAGAAGTCAAGATGAAGGATATTAAATTTGAGATAAAGACTGAA
GTTACTAAAGATGGTATGAGTCAGGGTGGATATGCTTTATTTGATGCCTATACCGTTAAC
ATCATAAGAACTCCCACCGCCAATAATAGTTTTAGTAACTTGAAGTTTGAGAGTAGTATT
AAAGGAAGTGGCGGTAGAGGTGGAGCAGCACCAGTAGATTTGGTTGGAACTTTGATGAAG
AGTGCTGGAATATCTTTCGTTAACAAACACCAGGACTTTCCTACAACTGCTGTTGAATTT
TTGAATGACCGAAGAGATTACAAAAAGATGTATAATTTTCTAGCACCTAGAGTTATTACT
GGAAGTAGGAGTTATGATGAGTTTGAGGGTAGGATAAAAGAAATGTATCGATCTGGTGAT
AAAAAGAAGATGGCTGTTGCTCAATCTAAACTAATGCAGTTAGAATTCTTTTATGAGTCG
TTAAATAGTGCTAAAGGTAAAAAAGCAGAGTTCTGGACAGACTTACTGTATCTCTCTTTA
AAAAGAAACATTTCACAATTTGGATCTCGATTTGCTCCACATGGTAAACTAGCGTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
KIEPKEKANFKYINKDTKRMEFAKVEEVKMKDIKFEIKTEVTKDGMSQGGYALFDAYTVN
IIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEF
LNDRRDYKKMYNFLAPRVITGSRSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQLEFFYES
LNSAKGKKAEFWTDLLYLSLKRNISQFGSRFAPHGKLA*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 659 to base 892.
TATAATATGGAAAATCTAACTGACTTGATACAGTCCTTTCACCCAGACGCTAAGAAAGGA
AAGGACAAATACGAACAGTTTTTACTTTATGTTTATATGTCATTTGACAAAAGAATCAAG
ACCGTAAAGTCGGATAAGTTGAAGAATAAATATAAGGAGATAAGACAAAGAGTCTTAGAA
TATACTGTTGCGAACAAAAGAAAAATAATTGCTGACCTAAACAAAGTTTCATGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
YNMENLTDLIQSFHPDAKKGKDKYEQFLLYVYMSFDKRIKTVKSDKLKNKYKEIRQRVLE
YTVANKRKIIADLNKVS*

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS

RAW RESULTS

Protein Domains

PROTOCOL

INTERPRO scan





RESULTS ANALYSIS

Until now there aren't homologous sequences on database used by INTERPRO to have results.

RAW RESULTS
No its reported.

Phylogeny

PROTOCOL




RESULTS ANALYSIS

RAW RESULTS

Taxonomy report

PROTOCOL


a) BLASTp

BLASTp versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report


b) BLASTx

BLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report


c) tBLASTn

tBLASTn versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report


d) tblastx

tBLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters / Taxonomy Reports / Lineage Report



RESULTS ANALYSIS

We have tried to found results, but all we've got aren't true, so the possible function of protein is unknown. Impossible to find something with significant e-values.

RAW RESULTS


a)Blastp


Lineage Report

cellular organisms
. Eukaryota              [eukaryotes]
. . Dikarya                [fungi]
. . . Ajellomyces capsulatus [ascomycetes]
. . . . Ajellomyces capsulatus G186AR -----------   39  1 hit  [ascomycetes]       midasin [Ajellomyces capsulatus G186AR]
. . . . Ajellomyces capsulatus H143 .............   35  1 hit  [ascomycetes]       midasin [Ajellomyces capsulatus H143]
. . . Coprinopsis cinerea okayama7#130 ----------   35  2 hits [basidiomycetes]    predicted protein [Coprinopsis cinerea okayama7#130] >gi|11
. . Oryza sativa Indica Group (Indian rice) -----   36  2 hits [monocots]          hypothetical protein OsI_09858 [Oryza sativa Indica Group]
. . Oryza sativa Japonica Group (Japanese rice) .   35 14 hits [monocots]          Os02g0718900 [Oryza sativa (japonica cultivar-group)] >gi|3
. . Zea mays (maize) ............................   35  1 hit  [monocots]          adenine nucleotide translocator [Zea mays]
. . Physcomitrella patens subsp. patens .........   35  2 hits [mosses]            predicted protein [Physcomitrella patens subsp. patens] >gi
. . Trichomonas vaginalis G3 ....................   34  2 hits [trichomonads]      Beige/BEACH domain containing protein [Trichomonas vaginali
. Maricaulis maris MCS10 ------------------------   37  2 hits [a-proteobacteria]  hypothetical protein Mmar10_0939 [Maricaulis maris MCS10] >
. Nitratiruptor sp. SB155-2 .....................   36  2 hits [e-proteobacteria]  hydrogenase expression/formation protein HypD [Nitratirupto
. Campylobacter gracilis RM3268 .................   35  2 hits [e-proteobacteria]  FAD dependent oxidoreductase [Campylobacter gracilis RM3268
. Desulfitobacterium hafniense Y51 ..............   35  2 hits [firmicutes]        hypothetical protein DSY3329 [Desulfitobacterium hafniense 
. Thermotoga lettingae TMO ......................   35  2 hits [thermotogales]     hypothetical protein Tlet_1229 [Thermotoga lettingae TMO] >
. Roseovarius sp. 217 ...........................   35  2 hits [a-proteobacteria]  hypothetical protein ROS217_01345 [Roseovarius sp. 217] >gi
. Sphingomonas sp. SKA58 ........................   34  2 hits [a-proteobacteria]  hypothetical protein SKA58_13763 [Sphingomonas sp. SKA58] >

--------------------------------------------------------------------------------

--------------------------------------------------------------------------------
--------------------------------------------------------------------------------
b)Blastx

Lineage Report

cellular organisms
. Eukaryota           [eukaryotes]
. . Fungi/Metazoa group [eukaryotes]
. . . Ajellomyces capsulatus G186AR -------------------   40 1 hit  [ascomycetes]       midasin [Ajellomyces capsulatus G186AR]
. . . Saccoglossus kowalevskii ........................   39 1 hit  [hemichordates]     PREDICTED: zonadhesin-like [Saccoglossus kowalevskii]
. . . Tribolium castaneum (rust-red flour beetle) .....   36 2 hits [beetles]           hypothetical protein TcasGA2_TC013292 [Tribolium castaneum]
. . Oryza sativa Indica Group (Indian rice) -----------   38 1 hit  [monocots]          hypothetical protein OsI_08713 [Oryza sativa Indica Group]
. . Oryza sativa Japonica Group (Japanese rice) .......   38 8 hits [monocots]          Os02g0718900 [Oryza sativa (japonica cultivar-group)] >gi|3
. . Plasmodium falciparum 3D7 .........................   36 2 hits [apicomplexans]     conserved Plasmodium protein [Plasmodium falciparum 3D7] >g
. . Entamoeba dispar SAW760 ...........................   36 2 hits [eukaryotes]        hypothetical protein [Entamoeba dispar SAW760] >gi|16589404
. . Paramecium tetraurelia strain d4-2 ................   35 1 hit  [ciliates]          hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Paramecium tetraurelia ............................   35 1 hit  [ciliates]          hypothetical protein [Paramecium tetraurelia strain d4-2] >
. Campylobacter gracilis RM3268 -----------------------   38 2 hits [e-proteobacteria]  FAD dependent oxidoreductase [Campylobacter gracilis RM3268
. Borrelia burgdorferi Bol26 ..........................   37 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi Bol26]
. Borrelia burgdorferi ZS7 ............................   37 2 hits [spirochetes]       hypothetical protein BbuZS7_0522 [Borrelia burgdorferi ZS7]
. Borrelia burgdorferi B31 ............................   37 2 hits [spirochetes]       hypothetical protein BB0512 [Borrelia burgdorferi B31] >gi|
. Bacillus pseudofirmus OF4 ...........................   36 2 hits [firmicutes]        DNA topoisomerase III [Bacillus pseudofirmus OF4] >gi|28854
. Maricaulis maris MCS10 ..............................   36 2 hits [a-proteobacteria]  hypothetical protein Mmar10_0939 [Maricaulis maris MCS10] >
. Desulfitobacterium hafniense Y51 ....................   36 2 hits [firmicutes]        hypothetical protein DSY3329 [Desulfitobacterium hafniense 
. Borrelia burgdorferi 64b ............................   36 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 64b] >
. Borrelia burgdorferi 80a ............................   36 1 hit  [spirochetes]       hypothetical protein Bbur8_02046 [Borrelia burgdorferi 80a]
. Borrelia burgdorferi 94a ............................   36 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 94a] >
. Borrelia burgdorferi 156a ...........................   36 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 156a] 
. Francisella tularensis subsp. tularensis MA00-2987 ..   35 3 hits [g-proteobacteria]  LOW QUALITY PROTEIN: pathogenicity determinant protein pdpA
. Borrelia burgdorferi CA-11.2a .......................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi CA-11.
. Borrelia burgdorferi WI91-23 ........................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi WI91-2
. Francisella tularensis subsp. mediasiatica FSC147 ...   35 4 hits [g-proteobacteria]  hypothetical protein FTM_1086 [Francisella tularensis subsp
. Borrelia burgdorferi 72a ............................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 72a] >
. Borrelia burgdorferi 118a ...........................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 118a] 
. Francisella tularensis subsp. holarctica FSC022 .....   35 2 hits [g-proteobacteria]  hypothetical protein FTAG_00751 [Francisella tularensis sub
. Francisella tularensis subsp. tularensis WY96-3418 ..   35 4 hits [g-proteobacteria]  pathogenicity deteminant protein pdpA1 [Francisella tularen
. Francisella tularensis subsp. holarctica ............   35 2 hits [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica OSU18 ......   35 4 hits [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica FTNF002-00 .   35 4 hits [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica FSC200 .....   35 1 hit  [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica 257 ........   35 2 hits [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica URFT1 ......   35 1 hit  [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. holarctica LVS ........   35 2 hits [g-proteobacteria]  hypothetical protein FTL_0126 [Francisella tularensis subsp
. Francisella tularensis subsp. tularensis SCHU S4 ....   35 4 hits [g-proteobacteria]  hypothetical protein FTT_1344 [Francisella tularensis subsp
. Francisella tularensis subsp. tularensis FSC198 .....   35 4 hits [g-proteobacteria]  hypothetical protein FTT_1344 [Francisella tularensis subsp
. Francisella tularensis subsp. tularensis FSC033 .....   35 2 hits [g-proteobacteria]  hypothetical protein FTT_1344 [Francisella tularensis subsp
. Francisella tularensis subsp. tularensis NE061598 ...   35 2 hits [g-proteobacteria]  hypothetical protein FTT_1344 [Francisella tularensis subsp
. Roseovarius sp. 217 .................................   35 2 hits [a-proteobacteria]  hypothetical protein ROS217_01345 [Roseovarius sp. 217] >gi
. Brachyspira murdochii DSM 12563 .....................   35 2 hits [spirochetes]       Protein of unknown function DUF262 [Brachyspira murdochii D
. Borrelia burgdorferi 29805 ..........................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia burgdorferi 29805]
. Borrelia valaisiana VS116 ...........................   35 2 hits [spirochetes]       conserved hypothetical protein [Borrelia valaisiana VS116] 

--------------------------------------------------------------------------------




_________________________________________________________________

c) TBlastn

Lineage Report

cellular organisms
. Eukaryota          [eukaryotes]
. . Mus musculus (mouse) ------------------------   42 1 hit  [rodents]           Mouse DNA sequence from clone RP23-348N2 on chromosome 11 C
. . Oryza sativa Japonica Group (Japanese rice) .   38 2 hits [monocots]          Oryza sativa Japonica Group cDNA clone:J023011P12, full ins
. Maricaulis maris MCS10 ------------------------   36 1 hit  [a-proteobacteria]  Maricaulis maris MCS10, complete genome

--------------------------------------------------------------------------------


d) TBLASTx

Lineage Report

root
. cellular organisms
. . Eukaryota          [eukaryotes]
. . . Coelomata          [animals]
. . . . Euteleostomi       [vertebrates]
. . . . . Eutheria           [placentals]
. . . . . . Euarchontoglires   [placentals]
. . . . . . . Murinae            [rodents]
. . . . . . . . Mus musculus (mouse) --------------------       7 hits [rodents]               Mouse DNA sequence from clone RP23-348N2 on chromosome 11 C
. . . . . . . . Rattus norvegicus (brown rat) ...........       1 hit  [rodents]               Rattus norvegicus 1 BAC CH230-266M16 (Children's Hospital O
. . . . . . . Homo sapiens (man) ------------------------       6 hits [primates]              Homo sapiens BAC clone RP11-229G4 from 4, complete sequence
. . . . . . . Macaca mulatta (rhesus macaque) ...........       3 hits [primates]              Macaca mulatta Y BAC CH250-204D1 (Children's Hospital Oakla
. . . . . . . Pongo abelii (Orang-utan) .................       1 hit  [primates]              Pongo abelii BAC clone CH276-289G9 from chromosome unknown,
. . . . . . Sus scrofa (wild boar) ----------------------       2 hits [even-toed ungulates]   Pig DNA sequence from clone CH242-222L13 on chromosome X, c
. . . . . Danio rerio (zebra fish) ----------------------       2 hits [bony fishes]           Zebrafish DNA sequence from clone CH211-266K8 in linkage gr
. . . . Glyptapanteles indiensis ------------------------       1 hit  [wasps &c.]             Glyptapanteles indiensis clone BAC 1H21, complete sequence
. . . Medicago truncatula -------------------------------      10 hits [eudicots]              Medicago truncatula clone mth2-15e9, complete sequence
. . . Cyanidioschyzon merolae strain 10D ................       1 hit  [red algae]             Cyanidioschyzon merolae DNA, chromosome 15, complete genome
. . . Plasmodium knowlesi strain H ......................       2 hits [apicomplexans]         Plasmodium knowlesi strain H chromosome 14, complete genome
. . . Dictyostelium discoideum AX4 ......................       1 hit  [cellular slime molds]  Dictyostelium discoideum AX4 hypothetical protein (DDB_G027
. . . Solanum lycopersicum (tomato) .....................       1 hit  [eudicots]              S.lycopersicum DNA sequence from clone SL_MboI-143K21 on ch
. . Clostridium novyi NT --------------------------------       1 hit  [firmicutes]            Clostridium novyi NT, complete genome
. . Fusobacterium nucleatum subsp. nucleatum ATCC 25586 .       1 hit  [fusobacteria]          Fusobacterium nucleatum subsp. nucleatum ATCC 25586, comple
. Anguillid herpesvirus 1 -------------------------------       1 hit  [viruses]               Anguillid herpesvirus 1 strain 500138, complete genome
. Tomato leaf curl Patna virus satellite DNA beta .......       1 hit  [viruses]               Tomato leaf curl Patna virus satellite DNA beta, complete s

BLAST

PROTOCOL


a) BLASTp

BLASTp versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters


b) BLASTx

BLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters


c) tBLASTn

tBLASTn versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters


d) tblastx

tBLASTx versus Non-redundant protein sequence(NR), NCBI default parameters apart from "Max Target Sequence_1000" on Algorithm Parameters



RESULTS ANALYSIS


The e-values on Blastp, Blastx, tBlastn and tBastx aren't significants, with E_0.28, E_0.35, E_0.12 and E_0.048 (smallest number) respectively. It happens because until now there aren't homologous sequences on database used by NCBI to have credible results.



RAW RESULTS

a)Blastp

                                                                   Score    E
Sequences producing significant alignments:                       (Bits)  Value

gb|EEH11643.1|  midasin [Ajellomyces capsulatus G186AR]            39.3    0.28 
ref|YP_756170.1|  hypothetical protein Mmar10_0939 [Maricaulis...  37.4    1.2  
gb|EEC74450.1|  hypothetical protein OsI_09858 [Oryza sativa I...  37.0    1.3  
ref|YP_001356443.1|  hydrogenase expression/formation protein ...  36.6    2.0  
ref|ZP_05624047.1|  FAD dependent oxidoreductase [Campylobacte...  35.8    3.6  
gb|EEC73899.1|  hypothetical protein OsI_08713 [Oryza sativa I...  35.8    3.7  
ref|NP_001047941.1|  Os02g0718900 [Oryza sativa (japonica cult...  35.8    3.7  
gb|EER39472.1|  midasin [Ajellomyces capsulatus H143]              35.4    4.0  
emb|CAA33743.1|  adenine nucleotide translocator [Zea mays]        35.4    4.6  
ref|NP_001048862.1|  Os03g0131300 [Oryza sativa (japonica cult...  35.4    4.6  
ref|XP_001833897.1|  predicted protein [Coprinopsis cinerea ok...  35.4    4.7  
gb|ABF93814.1|  Ubiquitin family protein, expressed [Oryza sat...  35.0    5.0  
ref|YP_519562.1|  hypothetical protein DSY3329 [Desulfitobacte...  35.0    5.4  
ref|XP_001782951.1|  predicted protein [Physcomitrella patens ...  35.0    5.5  
ref|YP_001470853.1|  hypothetical protein Tlet_1229 [Thermotog...  35.0    5.7  
ref|ZP_01036523.1|  hypothetical protein ROS217_01345 [Roseova...  35.0    6.3  
ref|XP_001330708.1|  Beige/BEACH domain containing protein [Tr...  34.3    9.3  
ref|ZP_01303845.1|  hypothetical protein SKA58_13763 [Sphingom...  34.3    9.9  

ALIGNMENTS
>gb|EEH11643.1| midasin [Ajellomyces capsulatus G186AR]
Length=4866

 Score = 39.3 bits (90),  Expect = 0.28, Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 27/174 (15%)

Query  1     KIEPKEKANFKYINKDTKRMEFAKVEEVKMKDIK--FEIKTEVTKDGMSQGGYALFDAYT  58
             ++E  +  +++  N    R  F   +EV+  ++   F      T+D +  G  A FD  T
Sbjct  3126  QLEDDQNKHYEKSNLYRYRGSFEDDQEVEAAEVSQLFPTFDGTTEDDLEIGTLAQFDVKT  3185

Query  59    VNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTT--  116
             +++  +   NN FS+L  ES++K            L+    K  GI+      D PT   
Sbjct  3186  ISLRLSHILNNLFSDLDKESTVK-----------RLLLDSTKLLGINMAKSSTDIPTMDP  3234

Query  117   ------AVEFLNDRRDYKK--MYNFL-APRVITGSRSYDEFEG---RIKEMYRS  158
                   A+ FL+D +  K+   YNF  +P ++   +  D  E    R KE+  S
Sbjct  3235  KSHLLGAILFLDDVKSIKQPTSYNFYSSPNLVEVKKLADLVETISVRFKELQNS  3288


>ref|YP_756170.1| hypothetical protein Mmar10_0939 [Maricaulis maris MCS10]
 gb|ABI65232.1| protein of unknown function DUF938 [Maricaulis maris MCS10]
Length=218

 Score = 37.4 bits (85),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 8/92 (8%)

Query  36   EIKTEVTKDGMSQGGY-ALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDL  94
            E    + +D +  GG+  L+  Y +     P      SNL F++S+K      G  P+D 
Sbjct  132  EALASLAQDRLRPGGHLVLYGPYLLGDETAP------SNLAFDASLKSRNPEWGVRPLDA  185

Query  95   VGTLMKSAGISFVNKHQDFPTTAVEFLNDRRD  126
            V TL+ S G+  V +  D P   +  +  RR+
Sbjct  186  VTTLLASHGLVLVER-VDMPANNLMLIFQRRE  216


>gb|EEC74450.1| hypothetical protein OsI_09858 [Oryza sativa Indica Group]
Length=534

 Score = 37.0 bits (84),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query  83   SGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            +GG GG +  DL G L   +  SF+++    PT      N   + + M  FL   +    
Sbjct  342  AGGLGGLSSTDLGGMLGGGSDTSFLSQVLQNPTMMQMMQNIMSNPQSMNQFL--NINPNV  399

Query  143  RSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQLEFFYESLNSAKGKK  188
            R+  E   +++EM+++ +  +   +   L QL  F +SL S  G++
Sbjct  400  RNMMESNTQLREMFQNPEFVRQLTSPETLQQLISFQQSLMSQLGQQ  445


>ref|YP_001356443.1| hydrogenase expression/formation protein HypD [Nitratiruptor 
sp. SB155-2]
 dbj|BAF70086.1| hydrogenase expression/formation protein HypD [Nitratiruptor 
sp. SB155-2]
Length=380

 Score = 36.6 bits (83),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 79/196 (40%), Gaps = 34/196 (17%)

Query  2    IEPKEKANFKYINKDTKRMEFAKVEEVKMKDIKFEIKTEVTK----DGMSQGGYALFDAY  57
            I PKE+ +  YI         A  E+V +  +   IK   ++    D  S+G    F   
Sbjct  72   IMPKERIDHAYI--------LAMQEDVILCTLGDMIKVPGSQGSLQDARSKGADVRFVYS  123

Query  58   TVNIIRT----PTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKS--AGISFVNKHQ  111
             +++++     PT    F  + FE++   +          L+   MK   + I +   H 
Sbjct  124  PLDVMKIAKENPTKKVIFFAIGFETTTPMTAA--------LIENAMKQKISNILYHINHV  175

Query  112  DFPTTAVEFLNDRRDYKKMYN-----FLAPR---VITGSRSYDEFEGRIKEMYRSGDKKK  163
              P    E ++ R ++   YN     FL P    VITGS+ Y+EF  + K        + 
Sbjct  176  TVPEVMRELIDSRDEHIDSYNNQIDAFLGPSHVSVITGSKIYEEFPTKYKRPVVVAGFEP  235

Query  164  MAVAQSKLMQLEFFYE  179
            + V ++ LM +  F E
Sbjct  236  VDVMEAVLMVVRQFLE  251


>ref|ZP_05624047.1| FAD dependent oxidoreductase [Campylobacter gracilis RM3268]
 gb|EEV18754.1| FAD dependent oxidoreductase [Campylobacter gracilis RM3268]
Length=381

 Score = 35.8 bits (81),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  6    EKANFKYINKDTKRMEFAKVEEVKMKDIKFEIKTEVTKDGMSQGGYALF  54
            +K+NFKY+  D KR     +E+V  KD  FE+KT + K+ M+ G   LF
Sbjct  286  KKSNFKYMINDAKRY-IPMLEDVIYKDSIFEVKTVLVKNEMNDGRPILF  333


>gb|EEC73899.1| hypothetical protein OsI_08713 [Oryza sativa Indica Group]
Length=382

 Score = 35.8 bits (81),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 9/90 (10%)

Query  53   LFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQD  112
            LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI+    ++ 
Sbjct  202  LFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGIA--GLYRG  252

Query  113  FPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            F  + V  +  R  Y  MY+ L P V+TGS
Sbjct  253  FNISCVGIIVYRGLYFGMYDSLKPVVLTGS  282


>ref|NP_001047941.1| Os02g0718900 [Oryza sativa (japonica cultivar-group)]
 sp|P31691.1|ADT_ORYSJ RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor
 dbj|BAA02161.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAD12908.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAF09855.1| Os02g0718900 [Oryza sativa Japonica Group]
 gb|ABL74578.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|EAZ24408.1| hypothetical protein OsJ_08162 [Oryza sativa Japonica Group]
 dbj|BAG93461.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 35.8 bits (81),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 9/90 (10%)

Query  53   LFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQD  112
            LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI+    ++ 
Sbjct  202  LFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGIA--GLYRG  252

Query  113  FPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            F  + V  +  R  Y  MY+ L P V+TGS
Sbjct  253  FNISCVGIIVYRGLYFGMYDSLKPVVLTGS  282


>gb|EER39472.1| midasin [Ajellomyces capsulatus H143]
Length=4664

 Score = 35.4 bits (80),  Expect = 4.0, Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 27/174 (15%)

Query  1     KIEPKEKANFKYINKDTKRMEFAKVEEVKMKDIK--FEIKTEVTKDGMSQGGYALFDAYT  58
             ++E  +  +++  N    R  F   +EV+  ++   F        D +  G  A FD  T
Sbjct  3071  QLEDDQNKHYQKSNLYRYRGSFEDDQEVEAAEVSQLFPTFDGTIGDDLEIGTLAQFDVKT  3130

Query  59    VNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTT--  116
             +++  +   NN FS+L  ES++K            L+    K  GI+      D PT   
Sbjct  3131  ISLRLSHILNNLFSDLDKESTVK-----------RLLLDSTKLLGINMAKGSTDIPTMDP  3179

Query  117   ------AVEFLNDRRDYKK--MYNFL-APRVITGSRSYDEFEG---RIKEMYRS  158
                   A+ FL+D +  K+   YNF  +P ++   +  D  E    R KE+  S
Sbjct  3180  KSHLLGAILFLDDVKSIKQPTPYNFYSSPNLVEVKKLADLVETISVRFKELQNS  3233


>emb|CAA33743.1| adenine nucleotide translocator [Zea mays]
Length=387

 Score = 35.4 bits (80),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query  53   LFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQD  112
            LF  Y+++  RT  AN++        + KG G R     VD++   +KS GI+    ++ 
Sbjct  207  LFFVYSLDYARTRLANDA-------KAAKGGGDRQFNGLVDVIRKTLKSDGIA--GLYRG  257

Query  113  FPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            F  + V  +  R  Y  +Y+ + P V+TGS
Sbjct  258  FNISCVGIIVYRGLYFGLYDSIKPVVLTGS  287


>ref|NP_001048862.1| Os03g0131300 [Oryza sativa (japonica cultivar-group)]
 gb|ABF93812.1| Ubiquitin family protein, expressed [Oryza sativa (japonica cultivar-group)]
 dbj|BAF10776.1| Os03g0131300 [Oryza sativa Japonica Group]
 dbj|BAG94701.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58276.1| hypothetical protein OsJ_09294 [Oryza sativa Japonica Group]
Length=534

 Score = 35.4 bits (80),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query  83   SGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            +GG GG +  DL G L   +  SF+++    PT      N   + + M   L   +    
Sbjct  342  AGGLGGLSSTDLGGMLGGGSDTSFLSQVLQNPTMMQMMQNIMSNPQSMNQLL--NINPNV  399

Query  143  RSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQLEFFYESLNSAKGKK  188
            R+  E   +++EM+++ +  +   +   L QL  F +SL S  G++
Sbjct  400  RNMMESNTQLREMFQNPEFVRQLTSPETLQQLISFQQSLMSQLGQQ  445


>ref|XP_001833897.1| predicted protein [Coprinopsis cinerea okayama7#130]
 gb|EAU87927.1| predicted protein [Coprinopsis cinerea okayama7#130]
Length=590

 Score = 35.4 bits (80),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 45/112 (40%), Gaps = 30/112 (26%)

Query  106  FVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGSRSYDEFEGRIKEMYRSGDKKKMA  165
             +N+H + P   +E L +R D+ K+   L P +      +         + ++G  + MA
Sbjct  339  MINEHPNLPIKTIEELRERWDWSKVKAHLVPSIAGKHEGW-------PSVIKTGHPRLMA  391

Query  166  V-----------AQSKLMQLEFFYESLN------------SAKGKKAEFWTD  194
            V           +Q+K + LE    SL             SA+G+ AE W D
Sbjct  392  VVRKMAMRTGTGSQAKKLTLECQGSSLGNYTTQWLNEFYYSARGESAEDWLD  443


>gb|ABF93814.1| Ubiquitin family protein, expressed [Oryza sativa (japonica cultivar-group)]
Length=463

 Score = 35.0 bits (79),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query  83   SGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            +GG GG +  DL G L   +  SF+++    PT      N   + + M   L   +    
Sbjct  342  AGGLGGLSSTDLGGMLGGGSDTSFLSQVLQNPTMMQMMQNIMSNPQSMNQLL--NINPNV  399

Query  143  RSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQLEFFYESLNSAKGKK  188
            R+  E   +++EM+++ +  +   +   L QL  F +SL S  G++
Sbjct  400  RNMMESNTQLREMFQNPEFVRQLTSPETLQQLISFQQSLMSQLGQQ  445


>ref|YP_519562.1| hypothetical protein DSY3329 [Desulfitobacterium hafniense Y51]
 dbj|BAE85118.1| hypothetical protein [Desulfitobacterium hafniense Y51]
Length=1122

 Score = 35.0 bits (79),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query  24   KVEEVKMKDIKFEIKTEVTKDGMSQGGYA---LFDAYTVNIIRTPTANNSFSNLKFESSI  80
            KV ++ +   K  + T+   DG  Q GYA   +FD Y V+I  +  AN    N++F+S +
Sbjct  398  KVAKIDITSTKLGVVTKTKTDGQEQTGYATYKIFDQYGVDITNSALAN----NVEFQSGV  453

Query  81   -KGSGGRGG  88
             K   GR G
Sbjct  454  AKSIEGRKG  462

                                                                  
----------------------------------------------------------------------------------------------------------------------
b)blastx

                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|EEH11643.1|  midasin [Ajellomyces capsulatus G186AR]            40.0    0.35 
ref|XP_002738323.1|  PREDICTED: zonadhesin-like [Saccoglossus ...  39.3    0.60 
gb|EEC73899.1|  hypothetical protein OsI_08713 [Oryza sativa I...  38.9    0.79 
ref|NP_001047941.1|  Os02g0718900 [Oryza sativa (japonica cult...  38.9    0.79 
ref|ZP_05624047.1|  FAD dependent oxidoreductase [Campylobacte...  38.1    1.3  
ref|ZP_03797347.1|  conserved hypothetical protein [Borrelia b...  37.7    1.8  
ref|YP_002375021.1|  hypothetical protein BbuZS7_0522 [Borreli...  37.7    1.8  
ref|NP_212646.1|  hypothetical protein BB0512 [Borrelia burgdo...  37.7    1.8  
ref|YP_003425363.1|  DNA topoisomerase III [Bacillus pseudofir...  37.0    3.0  
gb|EFA07261.1|  hypothetical protein TcasGA2_TC013292 [Triboli...  37.0    3.0  
ref|YP_756170.1|  hypothetical protein Mmar10_0939 [Maricaulis...  37.0    3.0  
ref|XP_972018.1|  PREDICTED: similar to Proteasome activator c...  37.0    3.0  
ref|YP_519562.1|  hypothetical protein DSY3329 [Desulfitobacte...  37.0    3.0  
ref|XP_001350758.2|  conserved Plasmodium protein [Plasmodium ...  36.6    3.9  
ref|ZP_03623424.1|  conserved hypothetical protein [Borrelia b...  36.6    3.9  
ref|ZP_03087030.1|  hypothetical protein Bbur8_02046 [Borrelia...  36.6    3.9  
ref|ZP_03769623.1|  conserved hypothetical protein [Borrelia b...  36.6    3.9  
ref|ZP_03436839.1|  conserved hypothetical protein [Borrelia b...  36.6    3.9  
ref|XP_001741340.1|  hypothetical protein [Entamoeba dispar SA...  36.6    3.9  
ref|ZP_05247951.1|  LOW QUALITY PROTEIN: pathogenicity determi...  35.8    6.7  
ref|ZP_03666019.1|  hypothetical protein FtultM_07809 [Francis...  35.8    6.7  
ref|ZP_03674156.1|  conserved hypothetical protein [Borrelia b...  35.8    6.7  
ref|ZP_03673506.1|  conserved hypothetical protein [Borrelia b...  35.8    6.7  
ref|YP_001891763.1|  hypothetical protein FTM_1086 [Francisell...  35.8    6.7  
ref|ZP_03589555.1|  conserved hypothetical protein [Borrelia b...  35.8    6.7  
ref|ZP_03770622.1|  conserved hypothetical protein [Borrelia b...  35.8    6.7  
ref|ZP_04984941.1|  hypothetical protein FTAG_00751 [Francisel...  35.8    6.7  
ref|YP_001121177.1|  pathogenicity deteminant protein pdpA1 [F...  35.8    6.7  
ref|XP_001458334.1|  hypothetical protein [Paramecium tetraure...  35.8    6.7  
ref|YP_512924.1|  hypothetical protein FTL_0126 [Francisella t...  35.8    6.7  
ref|YP_170296.1|  hypothetical protein FTT_1344 [Francisella t...  35.8    6.7  
ref|ZP_01036523.1|  hypothetical protein ROS217_01345 [Roseova...  35.8    6.7  
ref|ZP_04047034.1|  Protein of unknown function DUF262 [Brachy...  35.4    8.7  
ref|ZP_03796538.1|  conserved hypothetical protein [Borrelia b...  35.4    8.7  
ref|ZP_03672665.1|  conserved hypothetical protein [Borrelia v...  35.4    8.7  

ALIGNMENTS
>gb|EEH11643.1| midasin [Ajellomyces capsulatus G186AR]
Length=4866

 Score = 40.0 bits (92),  Expect = 0.35
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 27/174 (15%)
 Frame = -2

Query  898   KIEPKEKANFKYINKDTKRMEFAKVEEVKMKDIK--FEIKTEVTKDGMSQGGYALFDAYT  725
             ++E  +  +++  N    R  F   +EV+  ++   F      T+D +  G  A FD  T
Sbjct  3126  QLEDDQNKHYEKSNLYRYRGSFEDDQEVEAAEVSQLFPTFDGTTEDDLEIGTLAQFDVKT  3185

Query  724   VNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTT--  551
             +++  +   NN FS+L  ES++K            L+    K  GI+      D PT   
Sbjct  3186  ISLRLSHILNNLFSDLDKESTVK-----------RLLLDSTKLLGINMAKSSTDIPTMDP  3234

Query  550   ------AVEFLNDRRDYKK--MYNFL-APRVITGSRSYDEFEG---RIKEMYRS  425
                   A+ FL+D +  K+   YNF  +P ++   +  D  E    R KE+  S
Sbjct  3235  KSHLLGAILFLDDVKSIKQPTSYNFYSSPNLVEVKKLADLVETISVRFKELQNS  3288


>ref|XP_002738323.1| PREDICTED: zonadhesin-like [Saccoglossus kowalevskii]
Length=3191

 Score = 39.3 bits (90),  Expect = 0.60
 Identities = 35/166 (21%), Positives = 75/166 (45%), Gaps = 10/166 (6%)
 Frame = -2

Query  559   PTTAVEFLNDRRDYKKMYNFLAPRVITGSRSYDEFEGRIKEMYRSGDKKKMAVAQSKLMQ  380
             P    EF   ++  K  YN +  ++    + Y++F     E  +   KK  +  +     
Sbjct  2217  PEYREEFEKMQKTVKDKYNDILYKM---EQKYEDFRREYAEELKETLKKTWSDIKDN--S  2271

Query  379   LEFFYESLNSAKGKKAEFWTDLLYLSLKRNISQFGSRFAPH-GKLA*YNMENLTDLIQSF  203
              E++Y+ +    G+  E W D+ YL+ K+++      +     +L  Y  +   DL++ +
Sbjct  2272  EEYYYDEIRPVVGEVKEAWEDVSYLA-KKDLEDIREYWQEQLDELKEYLDDVKRDLMERY  2330

Query  202   HPDAKKGKDKYEQFLLYVYMSFDKRIKTVK-SDKLKNKYKEIRQRV  68
             + D K   +K  +   Y     D +I+ ++   KL +K+ E+R+++
Sbjct  2331  YSDVKPMVEKMRR--QYEETKMDMKIRYIEYKQKLGDKWDELREKI  2374


>gb|EEC73899.1| hypothetical protein OsI_08713 [Oryza sativa Indica Group]
Length=382

 Score = 38.9 bits (89),  Expect = 0.79
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 9/98 (9%)
 Frame = -2

Query  766  GMSQGGYALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGI  587
            G + G  +LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI
Sbjct  194  GGAAGASSLFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGI  246

Query  586  SFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGS  473
            + +  ++ F  + V  +  R  Y  MY+ L P V+TGS
Sbjct  247  AGL--YRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGS  282


>ref|NP_001047941.1| Os02g0718900 [Oryza sativa (japonica cultivar-group)]
 sp|P31691.1|ADT_ORYSJ RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor
 dbj|BAA02161.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAD12908.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAF09855.1| Os02g0718900 [Oryza sativa Japonica Group]
 gb|ABL74578.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|EAZ24408.1| hypothetical protein OsJ_08162 [Oryza sativa Japonica Group]
 dbj|BAG93461.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 38.9 bits (89),  Expect = 0.79
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 9/98 (9%)
 Frame = -2

Query  766  GMSQGGYALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGI  587
            G + G  +LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI
Sbjct  194  GGAAGASSLFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGI  246

Query  586  SFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGS  473
            + +  ++ F  + V  +  R  Y  MY+ L P V+TGS
Sbjct  247  AGL--YRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGS  282


>ref|ZP_05624047.1| FAD dependent oxidoreductase [Campylobacter gracilis RM3268]
 gb|EEV18754.1| FAD dependent oxidoreductase [Campylobacter gracilis RM3268]
Length=381

 Score = 38.1 bits (87),  Expect = 1.3
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = -2

Query  883  EKANFKYINKDTKRMEFAKVEEVKMKDIKFEIKTEVTKDGMSQGGYALF  737
            +K+NFKY+  D KR     +E+V  KD  FE+KT + K+ M+ G   LF
Sbjct  286  KKSNFKYMINDAKRY-IPMLEDVIYKDSIFEVKTVLVKNEMNDGRPILF  333


>ref|ZP_03797347.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
 gb|EEH31763.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
Length=2166

 Score = 37.7 bits (86),  Expect = 1.8
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 42/183 (22%)
 Frame = -2

Query  466   YDEFEGRIK-------EMYRSGDKKKMAVAQSKLMQLEFFYESLNSA-------------  347
             YDEF  R+        E ++S +K+ +   +S+L  L+     LN+              
Sbjct  1364  YDEFSERLNSYIATLSEEFKSSNKEMIFELESQLKNLKNLESDLNNVEKDVIRLKEESYH  1423

Query  346   ------KGKKAEFWTDL------LYLSLKRNISQFGSRFAPHGKLA*YNMENLTDLIQSF  203
                   K  + +F+ DL      L  SL+  I+ +  +          N+EN T+LIQSF
Sbjct  1424  NVSSHLKLLEEDFFKDLKIRGEELKYSLENFIASYNDKIQNLEYDLSKNLENKTELIQSF  1483

Query  202   HPD-AKKGKDKYEQFLLYVYMSFDKRIKTVKSD---KLKNKYKEIRQRVLEYT--VANKR  41
               D  +K KD  E F    Y+ F K   + K D   ++      I  +V E+   V NK+
Sbjct  1484  RLDIEQKMKDDKENF----YLDFTKEFSSKKKDMQSEIALMETNITGKVDEFVDFVNNKQ  1539

Query  40    KII  32
              II
Sbjct  1540  SII  1542


>ref|YP_002375021.1| hypothetical protein BbuZS7_0522 [Borrelia burgdorferi ZS7]
 gb|ACK74909.1| conserved hypothetical protein [Borrelia burgdorferi ZS7]
Length=2166

 Score = 37.7 bits (86),  Expect = 1.8
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 42/183 (22%)
 Frame = -2

Query  466   YDEFEGRIK-------EMYRSGDKKKMAVAQSKLMQLEFFYESLNSA-------------  347
             YDEF  R+        E ++S +K+ +   +S+L  L+     LN+              
Sbjct  1364  YDEFSERLNSYIATLSEEFKSSNKEMIFELESQLKNLKNLESDLNNVEKDVIRLKEESYH  1423

Query  346   ------KGKKAEFWTDL------LYLSLKRNISQFGSRFAPHGKLA*YNMENLTDLIQSF  203
                   K  + +F+ DL      L  SL+  I+ +  +          N+EN T+LIQSF
Sbjct  1424  NVSSHLKLLEEDFFKDLKIRGEELKYSLENFIASYNDKIQNLEYDLSKNLENKTELIQSF  1483

Query  202   HPD-AKKGKDKYEQFLLYVYMSFDKRIKTVKSD---KLKNKYKEIRQRVLEYT--VANKR  41
               D  +K KD  E F    Y+ F K   + K D   ++      I  +V E+   V NK+
Sbjct  1484  RLDIEQKMKDDKENF----YLDFTKEFSSKKKDMQSEIALMETNITGKVDEFVDFVNNKQ  1539

Query  40    KII  32
              II
Sbjct  1540  SII  1542


>ref|NP_212646.1| hypothetical protein BB0512 [Borrelia burgdorferi B31]
 gb|AAC66876.1| predicted coding region BB0512 [Borrelia burgdorferi B31]
Length=2166

 Score = 37.7 bits (86),  Expect = 1.8
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 42/183 (22%)
 Frame = -2

Query  466   YDEFEGRIK-------EMYRSGDKKKMAVAQSKLMQLEFFYESLNSA-------------  347
             YDEF  R+        E ++S +K+ +   +S+L  L+     LN+              
Sbjct  1364  YDEFSERLNSYIATLSEEFKSSNKEMIFELESQLKNLKNLESDLNNVEKDVIRLKEESYH  1423

Query  346   ------KGKKAEFWTDL------LYLSLKRNISQFGSRFAPHGKLA*YNMENLTDLIQSF  203
                   K  + +F+ DL      L  SL+  I+ +  +          N+EN T+LIQSF
Sbjct  1424  NVSSHLKLLEEDFFKDLKIRGEELKYSLENFIASYNDKIQNLEYDLSKNLENKTELIQSF  1483

Query  202   HPD-AKKGKDKYEQFLLYVYMSFDKRIKTVKSD---KLKNKYKEIRQRVLEYT--VANKR  41
               D  +K KD  E F    Y+ F K   + K D   ++      I  +V E+   V NK+
Sbjct  1484  RLDIEQKMKDDKENF----YLDFTKEFSSKKKDMQSEIALMETNITGKVDEFVDFVNNKQ  1539

Query  40    KII  32
              II
Sbjct  1540  SII  1542


>ref|YP_003425363.1| DNA topoisomerase III [Bacillus pseudofirmus OF4]
 gb|ADC48471.1| DNA topoisomerase III [Bacillus pseudofirmus OF4]
Length=723

 Score = 37.0 bits (84),  Expect = 3.0
 Identities = 29/149 (19%), Positives = 63/149 (42%), Gaps = 11/149 (7%)
 Frame = -2

Query  790  IKTEVTKDGMSQGGYALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVG  611
            +   V K+GM+Q      +   + +++   A  S  + + E  +  S G G  A    + 
Sbjct  468  VSKSVVKEGMTQPPKRYTEGQLITVMKA--AGKSIEDKELEKVMMESHGLGTEATRAGII  525

Query  610  TLMKSAGISFVNKHQDFPTTAVEFLNDRRDYKKMYNFLAPRVITGSRSYDEFEGRIKEMY  431
            T++K  G   V K+  FPT     L D          L   ++  +    ++E R++E+ 
Sbjct  526  TVLKDRGYMMVEKNIVFPTQKGRLLIDS---------LGTSILASAEMTAKWEQRLREIG  576

Query  430  RSGDKKKMAVAQSKLMQLEFFYESLNSAK  344
            +    K   + Q++ + +    E+++ ++
Sbjct  577  KGAASKNDFMEQARKLSVHLINEAVSQSR  605


>gb|EFA07261.1| hypothetical protein TcasGA2_TC013292 [Tribolium castaneum]
Length=1831

 Score = 37.0 bits (84),  Expect = 3.0
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 15/76 (19%)
 Frame = -2

Query  238   NMENLTDLIQSFHPDAKKGKDKYEQFLLYVYMSFDKRIKTVKSDKLKNKYKEIRQRVLEY  59
             N ENL   I+ F  + KKGKD   QF  Y ++ F            KN +K    ++L+ 
Sbjct  1298  NAENLDQFIKYFSMEEKKGKD---QFNAYKFLLF------------KNLFKLFEDKLLDP  1342

Query  58    TVANKRKIIADLNKVS  11
              + +  K++AD N+ S
Sbjct  1343  IIPHLEKLVADKNESS  1358


>ref|YP_756170.1| hypothetical protein Mmar10_0939 [Maricaulis maris MCS10]
 gb|ABI65232.1| protein of unknown function DUF938 [Maricaulis maris MCS10]
Length=218

 Score = 37.0 bits (84),  Expect = 3.0
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 8/92 (8%)
 Frame = -2

Query  793  EIKTEVTKDGMSQGGY-ALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDL  617
            E    + +D +  GG+  L+  Y +     P      SNL F++S+K      G  P+D 
Sbjct  132  EALASLAQDRLRPGGHLVLYGPYLLGDETAP------SNLAFDASLKSRNPEWGVRPLDA  185

Query  616  VGTLMKSAGISFVNKHQDFPTTAVEFLNDRRD  521
            V TL+ S G+  V +  D P   +  +  RR+
Sbjct  186  VTTLLASHGLVLVER-VDMPANNLMLIFQRRE  216


>ref|XP_972018.1| PREDICTED: similar to Proteasome activator complex subunit 4 
(Proteasome activator PA200) [Tribolium castaneum]
Length=1808

 Score = 37.0 bits (84),  Expect = 3.0
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 15/76 (19%)
 Frame = -2

Query  238   NMENLTDLIQSFHPDAKKGKDKYEQFLLYVYMSFDKRIKTVKSDKLKNKYKEIRQRVLEY  59
             N ENL   I+ F  + KKGKD   QF  Y ++ F            KN +K    ++L+ 
Sbjct  1275  NAENLDQFIKYFSMEEKKGKD---QFNAYKFLLF------------KNLFKLFEDKLLDP  1319

Query  58    TVANKRKIIADLNKVS  11
              + +  K++AD N+ S
Sbjct  1320  IIPHLEKLVADKNESS  1335

---------------------------------------------------------------------------------------------------------------

c) tBLASTn


                                                                    Score     E
Sequences producing significant alignments:                       (Bits)  Value

emb|AL606466.12|  Mouse DNA sequence from clone RP23-348N2 on ...  42.4    0.12 
dbj|AK100143.1|  Oryza sativa Japonica Group cDNA clone:J02301...  38.1    2.5  
gb|CP000449.1|  Maricaulis maris MCS10, complete genome            37.0    5.3  
dbj|AP004098.3|  Oryza sativa Japonica Group genomic DNA, chro...  36.2    9.8  

ALIGNMENTS
>emb|AL606466.12| Mouse DNA sequence from clone RP23-348N2 on chromosome 11 Contains 
the 5' end of the Ppp3r1 gene for protein phospatase 3 
regulatory subunit B alpha isoform (calcineurin B, type I), 
a ribosomal protein L39 (Rpl39) pseudogene, a novel gene, the 
Plek gene for pleckstrin, a CUB domain and EGF-like repeat 
containing (Cegf) protein pseudogene and a CpG island, complete 
sequence
Length=201805

 Features in this part of subject sequence:
   CUB domain and EGF-like repeat containing (Cegf) protein ...

 Score = 42.4 bits (98),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 0/60 (0%)
 Frame = +2

Query  70      SFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEFLNDRRDYKK  129
                FS+L+ +    G+GG G   P+DL G L    G   V+  QD PT  +    D  D+ +
Sbjct  140396  GFSDLEVDPEFPGTGGEGNGTPIDLAGLLSGDGGWGGVSHDQDVPTLVLR*QEDLGDHDE  140575


>dbj|AK100143.1| Oryza sativa Japonica Group cDNA clone:J023011P12, full insert 
sequence
Length=1577

 Score = 38.1 bits (87),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 9/90 (10%)
 Frame = +2

Query  53   LFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQD  112
            LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI+ +  ++ 
Sbjct  728  LFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGIAGL--YRG  880

Query  113  FPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
            F  + VE +  R  Y  MY+ L P V+TGS
Sbjct  881  FNISCVEIIVYRGLYFGMYDSLKPVVLTGS  970


>gb|CP000449.1| Maricaulis maris MCS10, complete genome
Length=3368780

 Features in this part of subject sequence:
   protein of unknown function DUF938

 Score = 37.0 bits (84),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 8/92 (8%)
 Frame = +2

Query  36       EIKTEVTKDGMSQGGY-ALFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDL  94
                E    + +D +  GG+  L+  Y +     P      SNL F++S+K      G  P+D 
Sbjct  1035374  EALASLAQDRLRPGGHLVLYGPYLLGDETAP------SNLAFDASLKSRNPEWGVRPLDA  1035535

Query  95       VGTLMKSAGISFVNKHQDFPTTAVEFLNDRRD  126
                V TL+ S G+  V +  D P   +  +  RR+
Sbjct  1035536  VTTLLASHGLVLVER-VDMPANNLMLIFQRRE  1035628


>dbj|AP004098.3| Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ2056_H01
Length=123428

 Score = 36.2 bits (82),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 9/90 (10%)
 Frame = +3

Query  53     LFDAYTVNIIRTPTANNSFSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQD  112
              LF  Y+++  RT  AN++        + KG G R     VD+    +KS GI+    ++ 
Sbjct  99027  LFFVYSLDYARTRLANDA-------KAAKGGGERQFNGLVDVYRKTLKSDGIA--GLYRG  99179

Query  113    FPTTAVEFLNDRRDYKKMYNFLAPRVITGS  142
              F  + V  +  R  Y  MY+ L P V+TGS
Sbjct  99180  FNISCVGIIVYRGLYFGMYDSLKPVVLTGS  99269

----------------------------------------------------------------------------------------------------------

d) tBLASTx

 Score     E
Sequences producing significant alignments:                       (Bits)  Value  N

emb|AL606466.12|  Mouse DNA sequence from clone RP23-348N2 on ...  46.4    0.048  1
gb|AC098860.2|  Homo sapiens BAC clone RP11-229G4 from 4, comp...  44.1    0.23   1
emb|CR382285.2|  Human DNA sequence from clone bP-21201H5 on c...  43.2    0.44   1
gb|AC145202.24|  Medicago truncatula clone mth2-15e9, complete...  42.8    0.61   1
gb|AC148487.14|  Medicago truncatula clone mth2-57f20, complet...  42.8    0.61   1
gb|CP000382.1|  Clostridium novyi NT, complete genome              42.3    0.83   1
dbj|AP006497.2|  Cyanidioschyzon merolae DNA, chromosome 15, c...  41.8    1.1    1
emb|AL365201.14|  Human DNA sequence from clone RP11-39C22 on ...  40.9    2.2    1
emb|CR376785.10|  Zebrafish DNA sequence from clone CH211-266K...  35.9    2.2    1
gb|AC127189.4|  Rattus norvegicus 1 BAC CH230-266M16 (Children...  40.5    3.0    1
gb|FJ940765.1|  Anguillid herpesvirus 1 strain 500138, complet...  40.0    4.1    1
gb|EU862324.1|  Tomato leaf curl Patna virus satellite DNA bet...  40.0    4.1    1
gb|AC225508.2|  Medicago truncatula clone mth2-5b2, complete s...  40.0    4.1    1
emb|AM910996.2|  Plasmodium knowlesi strain H chromosome 14, c...  40.0    4.1    1
gb|AC170798.32|  Medicago truncatula chromosome 6 clone mth2-2...  40.0    4.1    1
gb|AC170581.3|  Medicago truncatula chromosome 2 BAC clone mte...  40.0    4.1    1
gb|AC202517.12|  Medicago truncatula clone mth2-67f22, complet...  40.0    4.1    1
gb|AC126781.22|  Medicago truncatula chromosome 8 clone mth2-1...  40.0    4.1    1
gb|AC087170.6|  Homo sapiens chromosome 8, clone RP11-258J10, ...  40.0    4.1    1
emb|CU302347.1|  Medicago truncatula chromosome 5 clone mth2-5...  39.6    5.6    1
gb|AC140286.3|  Mus musculus BAC clone RP24-573E14 from chromo...  39.6    5.6    1
gb|AC107908.3|  Homo sapiens chromosome 15, clone CTD1-2291N1,...  39.6    5.6    1
gb|AC007494.8|  Homo sapiens chromosome 16 clone RP11-329J18, ...  39.6    5.6    1
gb|AC119268.12|  Mus musculus chromosome 5, clone RP24-324M10,...  39.6    5.6    1
emb|BX322625.9|  Mouse DNA sequence from clone RP24-158I12 on ...  39.6    5.6    1
emb|BX088592.12|  Zebrafish DNA sequence from clone DKEYP-61C1...  34.5    5.9    1
gb|AC203550.5|  Medicago truncatula clone mth2-145m13, complet...  35.9    7.1    1
emb|FP104531.7|  Pig DNA sequence from clone CH242-222L13 on c...  39.1    7.7    1
emb|FP085367.4|  Pig DNA sequence from clone CH242-184K14 on c...  39.1    7.7    1
gb|AC225831.5|  Macaca mulatta Y BAC CH250-204D1 (Children's H...  39.1    7.7    1
gb|AC207616.3|  MACACA MULATTA BAC clone CH250-3M7 from chromo...  39.1    7.7    1
gb|AC215315.3|  Pongo abelii BAC clone CH276-289G9 from chromo...  39.1    7.7    1
gb|AC208303.2|  MACACA MULATTA BAC clone CH250-499N5 from chro...  39.1    7.7    1
ref|XM_640241.1|  Dictyostelium discoideum AX4 hypothetical pr...  39.1    7.7    1
gb|AC162284.11|  Mus musculus chromosome 8, clone RP23-256C11,...  39.1    7.7    1
gb|AC127416.7|  Mus musculus BAC clone RP23-457J22 from chromo...  39.1    7.7    1
gb|AC160547.6|  Mus musculus chromosome 8, clone RP23-240F23, ...  39.1    7.7    1
emb|CR931743.1|  Medicago truncatula chromosome 5 clone mth2-4...  39.1    7.7    1
gb|EF710652.1|  Glyptapanteles indiensis clone BAC 1H21, compl...  31.8    8.0    1
gb|AE009951.2|  Fusobacterium nucleatum subsp. nucleatum ATCC ...  28.6    8.4    1
ref|XM_002259829.1|  Plasmodium knowlesi strain H hypothetical...  38.2    8.7    1
emb|CU074337.8|  S.lycopersicum DNA sequence from clone SL_Mbo...  35.4    9.9    1

ALIGNMENTS
>emb|AL606466.12| Mouse DNA sequence from clone RP23-348N2 on chromosome 11 Contains 
the 5' end of the Ppp3r1 gene for protein phospatase 3 
regulatory subunit B alpha isoform (calcineurin B, type I), 
a ribosomal protein L39 (Rpl39) pseudogene, a novel gene, the 
Plek gene for pleckstrin, a CUB domain and EGF-like repeat 
containing (Cegf) protein pseudogene and a CpG island, complete 
sequence
Length=201805

 Features in this part of subject sequence:
   CUB domain and EGF-like repeat containing (Cegf) protein ...

 Score = 46.4 bits (95),  Expect = 0.048
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2/+2

Query  688     FSNLKFESSIKGSGGRGGAAPVDLVGTLMKSAGISFVNKHQDFPTTAVEFLNDRRDY  518
               FS+L+ +    G+GG G   P+DL G L    G   V+  QD PT  +    D  D+
Sbjct  140399  FSDLEVDPEFPGTGGEGNGTPIDLAGLLSGDGGWGGVSHDQDVPTLVLR*QEDLGDH  140569


>gb|AC098860.2| Homo sapiens BAC clone RP11-229G4 from 4, complete sequence
Length=119491

 Score = 44.1 bits (90),  Expect = 0.23
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 0/42 (0%)
 Frame = +3/+1

Query  762    IPSLVTSVFISNLISFILTSSTFANSILLVSLFIYLKFAFSF  887
              +PS + S F+S  +SF L+ S F +  L +SLF++L F+F F
Sbjct  60715  LPSFLPSFFLSFFLSFFLSFSFFLSPFLSLSLFLFLSFSFFF  60840


>emb|CR382285.2| Human DNA sequence from clone bP-21201H5 on chromosome 21, complete 
sequence
Length=178865

 Score = 43.2 bits (88),  Expect = 0.44
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 0/41 (0%)
 Frame = +3/-3

Query  765    PSLVTSVFISNLISFILTSSTFANSILLVSLFIYLKFAFSF  887
              PS + S F+S  +SF L+ S F +  L +SLF++L F+F F
Sbjct  85620  PSFLRSFFLSFFLSFFLSFSFFLSPFLSLSLFLFLSFSFFF  85498


>gb|AC145202.24| Medicago truncatula clone mth2-15e9, complete sequence
Length=89293

 Score = 42.8 bits (87),  Expect = 0.61
 Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 0/28 (0%)
 Frame = +2/+1

Query  815    DFFNLCKLHPLSIFVYILKVCFFFWFNF  898
              DFFNL ++ P+  F+ ++KVCFFF+F +
Sbjct  23632  DFFNLSQVRPIVEFINLVKVCFFFFFMY  23715


>gb|AC148487.14| Medicago truncatula clone mth2-57f20, complete sequence
Length=119671

 Score = 42.8 bits (87),  Expect = 0.61
 Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 0/28 (0%)
 Frame = +2/-1

Query  815   DFFNLCKLHPLSIFVYILKVCFFFWFNF  898
             DFFNL ++ P+  F+ ++KVCFFF+F +
Sbjct  3985  DFFNLSQVRPIVEFINLVKVCFFFFFMY  3902


>gb|CP000382.1| Clostridium novyi NT, complete genome
Length=2547720

 Features in this part of subject sequence:
   hypothetical protein

 Score = 42.3 bits (86),  Expect = 0.83
 Identities = 20/39 (51%), Positives = 28/39 (71%), Gaps = 0/39 (0%)
 Frame = +3/-3

Query  783     VFISNLISFILTSSTFANSILLVSLFIYLKFAFSFGSIF  899
               + IS+L S IL++S+F +SIL VS FI+LK + S  S F
Sbjct  840175  LIISSLFSSILSNSSFNDSILFVSSFIFLKSSISLSSHF  840059


>dbj|AP006497.2| Cyanidioschyzon merolae DNA, chromosome 15, complete genome, 
complete sequence
Length=902900

 Score = 41.8 bits (85),  Expect = 1.1
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = +2/-3

Query  629     CCSTSTATSFNTTLKLQVTKTIIGGGSSYDVNGIGIK*SISTLTHTIFSNFSLYLKFNIL  808
               C STST+TS +TT+ + V + + G  +  D+ GIG + + + L        +L    N+ 
Sbjct  480054  CTSTSTSTSTSTTVGIPVARLVDGAAAFVDIQGIGFRKTFAALVAGALGTLTL*H*NNVY  479875

Query  809     H  811
               H
Sbjct  479874  H  479872


>emb|AL365201.14| Human DNA sequence from clone RP11-39C22 on chromosome 9, complete 
sequence
Length=114026

 Score = 40.9 bits (83),  Expect = 2.2
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3/+2

Query  762    IPSLVTSVFISNLISFILTSSTFANSILLVSLFIYLKFAF  881
              +PS + S F+S  +SF L+ S F +  L +SLF++L F F
Sbjct  65975  LPSFLPSFFLSFFLSFFLSFSFFLSPFLSLSLFLFLSFFF  66094


>emb|CR376785.10| Zebrafish DNA sequence from clone CH211-266K8 in linkage group 
25, complete sequence
Length=173989

 Score = 35.9 bits (72),  Expect = 2.2
 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 0/31 (0%)
 Frame = +3/+2

Query  39     FLLFATVYSKTLCLISLYLFFNLSDFTVLIL  131
              +LLF  VY K   LI+ +LF+N+  F ++IL
Sbjct  30887  YLLFVHVYFKKCLLINSFLFYNIYKFLIIIL  30979


 Score = 32.7 bits (65),  Expect = 2.2
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +2/+1

Query  791     LKFNILHLDFFNLCKLHPLSIFVYILKVCFF  883
               L+++ LHL+ +N+C     +  V  LK CFF
Sbjct  123010  LRYSALHLNNYNICYRFQCNTSVLSLKTCFF  123102


>gb|AC127189.4| Rattus norvegicus 1 BAC CH230-266M16 (Children's Hospital Oakland 
Research Institute) complete sequence
Length=222423

 Score = 40.5 bits (82),  Expect = 3.0
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2/+3

Query  404     SHLLFITRSIHFFYPTLKLIITPTSSNNSRC*KIIHLFVISSV  532
               S  +F   + HF +     ++  TSS +SRC*K++HLF+ S +
Sbjct  109395  SFYIFTLFTYHFIFFNKTFLLLDTSSPSSRC*KMLHLFIYSCI  109523


>gb|FJ940765.1| Anguillid herpesvirus 1 strain 500138, complete genome
Length=248531

 Features in this part of subject sequence:
   ORF45

 Score = 40.0 bits (81),  Expect = 4.1
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 0/35 (0%)
 Frame = +2/-1

Query  764    TIFSNFSLYLKFNILHLDFFNLCKLHPLSIFVYIL  868
              T F  FS+ +K + + L FFN+C ++ LS FVY L
Sbjct  74957  TAFKTFSVPVKSSSVALPFFNVCPIYHLSFFVYFL  74853


>gb|EU862324.1| Tomato leaf curl Patna virus satellite DNA beta, complete sequence
Length=1349

 Score = 40.0 bits (81),  Expect = 4.1
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 0/32 (0%)
 Frame = +2/-2

Query  803  ILHLDFFNLCKLHPLSIFVYILKVCFFFWFNF  898
            +L  D FN+C     S+F+ IL +CFFF F+F
Sbjct  799  VLFSDLFNVCFFFLFSLFIIIL*LCFFFSFSF  704