GOS 1318010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343626144
Annotathon code: GOS_1318010
Sample :
  • GPS :15°8'37s; 147°26'6w
  • Polynesia Archipelagos: Rangirora Atoll - Fr. Polynesia
  • Coral Reef Atoll (-1m, 27.3°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : MSVMFV
Annotated on : 2010-10-16 00:42:29
  • MarianaFilipaVal a36955@ualg.pt
  • MiguelSousaViegas a29855@ualg.pt
  • a36786@ualg.pt TatianaMartins

Synopsis

  • Taxonomy: Rickettsiales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 766
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;

Genomic Sequence

>JCVI_READ_1092343626144 GOS_1318010 Genomic DNA
GAATTGGGGACGCATTATTATGGCAATTGGTAAAGCAGGAGTTGCAATTAATTTTGAGAAATTGTCAATTAAATTAGGAGATATATCTATTATTCAAAAT
GGAAAAATTTCATCTAATTACAATGAGCAGCAAGCATCTGATTATATGAAGAATGATAATATTGATATTGTTGTAAGTATTTTTAATGGTTCAAAAAATT
TTACTGTTTATACAATGGATTTTACAAAAAAATATATTGATATTAATGCAGATTATAGAAGTTAATCACTATTGAATTATATTTCTATAATATTATTTAT
AACAATATGATTAAATATAAACTTACATGCAAAGGTTGTAATCTATCATTTGATAGTTGGTTTGCATCATCTAAAGAATATGAAAAACTAAAAAAAAGAA
GTTTATTAAGTTGTCATAATTGTAACTCTAAAAAAATTGAAAAATCTTTAATGGCACCGCAATTGATCAGTACTTTCAATACTGATAAATTTGTTAAAAA
AGATTTAAAATTAAATGAAATAACCAAAAAAATAAAAGAGTATCAAAAATTCATAAAAACTAATTTCAAATATGTTGGTGAAAATTTTGCTTATGAAGCA
AGATCTATTCATTATGGCAAGAAATCGAAAAATAAAGGCATTTACGGAACAGCGTCTAAAAAAGAAATTGTTGAGCTTAAAGAGGAAGGGATCAACACAG
AGATTATTCCTTGGATTGAAGATAAAAAAAACTAATTTTTTATAAATTTACCAATATAATTTACTGATTTGTCTGAGCTGAGGTGCCATTTATCTTTAAT
TAAGTTAAACTTCATCCCATCAAGACTATCTAATTTTAAATTATGTTTTTTTGATATATTGATTAAATAATCTGGTCTAATAAATTTTTCCCATGAGTGT
GTA

Translation

[307 - 732/903]   direct strand
>GOS_1318010 Translation [307-732   direct strand]
MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARS
IHYGKKSKNKGIYGTASKKEIVELKEEGINTEIIPWIEDKKN

Annotator commentaries

After completing the analysis of the sequence under study, one can probably conclude that the sequence encodes a protein (blastp vs. NR: score _ 196 E-value _ 1e-48), but this is not yet known function (INTERPROSCAN: Family - DUF1178, which has unknown function).

As for the taxonomy we can conclude that the organism that provided the ORF, presents the following classification: Kingdom - Bacteria, Phylum - Proteobacteria, Class - a-proteobacteria and Order - Rickettsiales. It is not possible to tell if the lower taxonomic levels, because the organisms from the monophyletic branch where it is found GOS_1318010 still have no classification.







ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


While analyzing the results of SMS ORFind, it was verified the existence of three ORFs in the direct sense (5'-3 '), one on one reading frame and two in reading frame 2. In the indirect effect was only verified the existence of only one ORF in reading frame 1. Of all the ORFs found, selected the largest (number one in reading frame 1 on the direct strand). Of the remaining ORFs only the second largest (number one in reading frame 2 on direct strand) has any biological significance with an E-value _ 7e-25 and a score of 116. The analysis of this was ignored by comparing the results of BLAST, with the largest ORF found.

The selected ORF has a length of 158aa, where the START codon is at position 307 (ATG -> AUG, methionine START) and the STOP codon is at position 733 (TAA -> UAA STOP), results from MSA.

Since the ORF under study is complete, ie has START and STOP codon and length> 60aa this is probably coding.





RAW RESULTS

a)forward strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 259 to base 735.
AAGTTAATCACTATTGAATTATATTTCTATAATATTATTTATAACAATATGATTAAATAT
AAACTTACATGCAAAGGTTGTAATCTATCATTTGATAGTTGGTTTGCATCATCTAAAGAA
TATGAAAAACTAAAAAAAAGAAGTTTATTAAGTTGTCATAATTGTAACTCTAAAAAAATT
GAAAAATCTTTAATGGCACCGCAATTGATCAGTACTTTCAATACTGATAAATTTGTTAAA
AAAGATTTAAAATTAAATGAAATAACCAAAAAAATAAAAGAGTATCAAAAATTCATAAAA
ACTAATTTCAAATATGTTGGTGAAAATTTTGCTTATGAAGCAAGATCTATTCATTATGGC
AAGAAATCGAAAAATAAAGGCATTTACGGAACAGCGTCTAAAAAAGAAATTGTTGAGCTT
AAAGAGGAAGGGATCAACACAGAGATTATTCCTTGGATTGAAGATAAAAAAAACTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KLITIELYFYNIIYNNMIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKI
EKSLMAPQLISTFNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYG
KKSKNKGIYGTASKKEIVELKEEGINTEIIPWIEDKKN*

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 265.
AATTGGGGACGCATTATTATGGCAATTGGTAAAGCAGGAGTTGCAATTAATTTTGAGAAA
TTGTCAATTAAATTAGGAGATATATCTATTATTCAAAATGGAAAAATTTCATCTAATTAC
AATGAGCAGCAAGCATCTGATTATATGAAGAATGATAATATTGATATTGTTGTAAGTATT
TTTAATGGTTCAAAAAATTTTACTGTTTATACAATGGATTTTACAAAAAAATATATTGAT
ATTAATGCAGATTATAGAAGTTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
NWGRIIMAIGKAGVAINFEKLSIKLGDISIIQNGKISSNYNEQQASDYMKNDNIDIVVSI
FNGSKNFTVYTMDFTKKYIDINADYRS*

>ORF number 2 in reading frame 2 on the direct strand extends from base 557 to base 745.
AAACTAATTTCAAATATGTTGGTGAAAATTTTGCTTATGAAGCAAGATCTATTCATTATG
GCAAGAAATCGAAAAATAAAGGCATTTACGGAACAGCGTCTAAAAAAGAAATTGTTGAGC
TTAAAGAGGAAGGGATCAACACAGAGATTATTCCTTGGATTGAAGATAAAAAAAACTAAT
TTTTTATAA

>Translation of ORF number 2 in reading frame 2 on the direct strand.
KLISNMLVKILLMKQDLFIMARNRKIKAFTEQRLKKKLLSLKRKGSTQRLFLGLKIKKTN
FL*

No ORFs were found in reading frame 3.

---------------------------------------------------------------------------------------------------


b)reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 157 to base 393.
ATTTATAAAAAATTAGTTTTTTTTATCTTCAATCCAAGGAATAATCTCTGTGTTGATCCC
TTCCTCTTTAAGCTCAACAATTTCTTTTTTAGACGCTGTTCCGTAAATGCCTTTATTTTT
CGATTTCTTGCCATAATGAATAGATCTTGCTTCATAAGCAAAATTTTCACCAACATATTT
GAAATTAGTTTTTATGAATTTTTGATACTCTTTTATTTTTTTGGTTATTTCATTTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
IYKKLVFFIFNPRNNLCVDPFLFKLNNFFFRRCSVNAFIFRFLAIMNRSCFISKIFTNIF
EISFYEFLILFYFFGYFI*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL


a)ClustalW2 / default parameters EBI, output order _ input


RESULTS ANALYSIS


Analyzing the MSA it appears that the ORF starts with a methionine after 16aa of the start, this is very similar to sequences that had a higher homology in Blast, ie, there is the conservation of most positions.

With the results of the MSA and INTERPROSCAN, we can only say that these proteins probably belong to the family with characteristic domain found in INTERPROSCAN.



RAW RESULTS

CLUSTAL 2.0.12 multiple sequence alignment


GOS_1318010                         KLITIELYFYNIIYNNMIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLL 50
CPelag1_in|254456289|ref|ZP_05      ----------------MIKYKLICNDCEITFDSWFASSKEFEKLKRKKLL 34
CPelag2_in|91762350|ref|ZP_012      ----------------MIKYKLICKDCETTFDSWFSSSKEYEKLKQKKFL 34
Cpelag3_in|71083220|ref|YP_265      ----------------MIKYKLICKDCETTFDSWFSSSKEYEKLKKKKFL 34
aproteo_in|262277612|ref|ZP_060     ----------------MIKYHLKC-ECGVEFESWFSSSKEYDRLEKKKML 33
Ocarbox_in|209883250|ref|YP_00      ----------------MIRYALRC-ECGHSFESWFQSSATYESQRKRRLV 33
Csegnis_in|266628218|ref|ZP_06      ----------------MIRYALQC-DQAHAFEGWFGSSSDYDDQAARGLV 33
Csp.k31_in|167644908|ref|YP_00      ----------------MIKYALSC-DHDHAFEGWFGSSSDYDDQAARGLV 33
Bsp.BAL_in|254419245|ref|ZP_050     ----------------MIRYALKC-DQTHGFEAWFGSSSDYDDQAARGLV 33
Bsp.BTA_in|148258765|ref|YP_0012    ----------------MIRYALRC-ERDHTFESWFQSSSAYESQVKRKLV 33
Pzucine_in|197104237|ref|YP_0021    ----------------MIKYALTC-EQEHAFEGWFGSSADYDDQQARGLL 33
Msp.BNC_in|110635332|ref|YP_675540  ----------------MIRYGLIC-DKEHEFEAWFRSGEDFETQKSRKLV 33
BspORS2_in|146337711|ref|YP_001202  ----------------MIRYALRC-ERDHSFESWFQSSSAYDSQVKRKLV 33
Bsubvib_in|269921383|ref|ZP_061     ----------------MIRYALRC-EADHPFEAWFGSSGDYDDQAARGLV 33
Ccresce_in|16125080|ref|NP_4196     ----------------MIKYALRC-DRTHEFEGWFGSSADYDDQAARGLV 33
Bjaponi_in|27375323|ref|NP_76685    ----------------MIRYALHC-DRNHAFESWFQSSSAYDSQVKRKLV 33
Bsuisbv_in|254700521|ref|ZP_051     ----------------MIRFSLHC-DHGHEFEGWFRDNADFERQSEMKLV 33
Smelilo_in|15966369|ref|NP_386      ----------------MIHYNLAC-DKGHAFEGWFSSSDDFDRQVARRLV 33
BcanisA_in|161619792|ref|YP_00      ----------------MIRFSLHC-DHGHEFEGWFRDNADFERQSEMKLV 33
Ointerm_in|239832952|ref|ZP_046     ----MLRPTERGRINSMIRFSLHC-DQGHEFEGWFRDNADFDRQSGMKLV 45
Bsuis13_in|23502727|ref|NP_69885    -----MCEPERGCVRSMIRFSLHC-DHGHEFEGWFRDNADFERQSEMKLV 44
Bavium_out|187479009|ref|YP_787     --------------MALKVFDLEC-EHGHLFEGWFSSHDDYDAQQNRGLL 35
Rpicke_out|241663468|ref|YP_00      ----------------MKVLDLRC-ANGHRFEGWFGSDADLQSQQERGLL 33
Jsp.Ma_out|152981646|ref|YP_0013    ----------------MKVYNLCC-EHAHRFEGWFSSEADFLTQSSQELI 33
Sacidi_out|85858127|ref|YP_46       ----------------MIIYDLKC-ENGHKFEGWFRDRKAFEEQKAQRLI 33
Dalken_out|218782160|ref|YP_00      ----------------MIIFDLQC-INGHVFEGWFDDLESLEDQLSRKLV 33
                                                    :    * *      *:.** .           ::

GOS_1318010                         SCHNCNSKKIEKSLMAPQLIS-TFNTDKFVKKDL---------------- 83
CPelag1_in|254456289|ref|ZP_05      NCHNCNSLKIDKSLMAPKLIN-KNKSQKNNSEFT---------------- 67
CPelag2_in|91762350|ref|ZP_012      NCHFCNSLNVGKDLMSPNVSTSKNNLTDIDSSSE---------------- 68
Cpelag3_in|71083220|ref|YP_265      NCHFCNSLNVGKGLMSPNVSTSKNILTDIDSSSE---------------- 68
aproteo_in|262277612|ref|ZP_060     SCQCGKSNNISKQLMAPQIAS-KKVDTKKNKQEE---------------- 66
Ocarbox_in|209883250|ref|YP_00      TCPACDSAKVEKAIMAPRLAAKDKTSEPEVKASETSTPTLMMAP------ 77
Csegnis_in|266628218|ref|ZP_06      ECPVCGSHGVSKQIMAPAVAGTKAQR-ATPAPDP---------------- 66
Csp.k31_in|167644908|ref|YP_00      DCPVCGSKAVRKQIMAPAVAGTKARN-AAPQPSA---------------- 66
Bsp.BAL_in|254419245|ref|ZP_050     ECPFCGSNRVEKAVMAPAVGGARQADPASDMAV----------------- 66
Bsp.BTA_in|148258765|ref|YP_0012    ECPTCGSTKVEKAIMAPRIVSKKGRDAAPVPAAPVPAPAPEVIPPGPTSL 83
Pzucine_in|197104237|ref|YP_0021    ECPVCASRAVRKQIMAPALAG--VRKTAQDEVAG---------------- 65
Msp.BNC_in|110635332|ref|YP_675540  SCPQCGSHEVQKALMAPAVSTSRKQ-AQIALAMN---------------- 66
BspORS2_in|146337711|ref|YP_001202  ECPACGSTKVEKAIMAPRIVSKKGRETLPVPAAPAPVPTQEVIPPGPTSL 83
Bsubvib_in|269921383|ref|ZP_061     ECPFCGSRNVAKQIMAPAVSGTRKAAPAVEMA------------------ 65
Csp.k31_in|16125080|ref|NP_4196     ECPVCGSTGVSKQIMAPAIAGTKAQRSAEPAVDP---------------- 67
Bjaponi_in|27375323|ref|NP_76685    TCPICGSAKVEKAIMAPRIVGKKGRGPATPPPEPASTPVPEAAPSGPTPL 83
Bsubvib_in|254700521|ref|ZP_051     ACPACHSQTVQKSLMAPAVSTSRGR-EKMAIALN---------------- 66
Smelilo_in|15966369|ref|NP_386      TCPSCGSDSVSKQLMAPAVSTARKKEARRELVMD---------------- 67
BcanisA_in|161619792|ref|YP_00      ACPACHSQTVQKSLMAPAVSTSRGR-EKMAIALN---------------- 66
Ointerm_in|239832952|ref|ZP_046     ACPVCNSQVVQKSLMAPAVSTSRGK-EKIAMALG---------------- 78
Bsuis13_in|23502727|ref|NP_69885    ACPACHSQTVQKSLMAPAVSTSRGR-EKMAIALN---------------- 77
Bavium_out|187479009|ref|YP_787     SCPVCASRSIVKRLSAPRLNVAHLHQPSAQTS------------------ 67
Rpicke_out|241663468|ref|YP_00      TCPVCGHNEVERLPSAPRLNLSSSRADAAQKGPAAQTAGGDG-------- 75
Jsp.Ma_out|152981646|ref|YP_0013    ECPMCGNHQIKRLPSSPRLNLSGATARASDD------------------- 64
Sacidi_out|85858127|ref|YP_46       ACPVCGSSNSELLPSFPRIMSREGENASGKDAR----------------- 66
Dalken_out|218782160|ref|YP_00      SCPVCDSTQAVRVPSTFGIKTSSSQYREQAPPP----------------- 66
                                     *                :                               

GOS_1318010                         ---KLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYG 130
CPelag1_in|254456289|ref|ZP_05      ---KFQNIKKTIKDYQKFIKDNFKYVGENFAYEARSIHYEKKKNSKGIYG 114
CPelag2_in|91762350|ref|ZP_012      ---KYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSLHYKDKKKAKGIYG 115
Cpelag3_in|71083220|ref|YP_265      ---KYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSLHYKDKKKAKGIYG 115
aproteo_in|262277612|ref|ZP_060     ---FYKTVNKKLRDLRDYVEKNAEYVGDNFVSEARSIHYD-KKNVRSIYG 112
Ocarbox_in|209883250|ref|YP_00      ---QERELAAKLRELREHVEKNAENVGRKFPNEARKIHYG-DSEHRAIYG 123
Csegnis_in|266628218|ref|ZP_06      --KMREMMMAAIGEVRRHVEDNFDYVGDAFAKEARAIHEG-KSEERGIYG 113
Csp.k31_in|167644908|ref|YP_00      --QMREMMMTAMGEVRRQVEANFDYVGDGFAKEARDIHDG-KSEERGIYG 113
Bsp.BAL_in|254419245|ref|ZP_050     --RMQTVMMAAAREVRAHVEANFDYVGDAFAREARDIHEG-RSEKREIYG 113
Bsp.BTA_in|148258765|ref|YP_0012    LMAQERELRAKLKELRDHIVKNADDVGERFPTEARKMHYG-ETEHRPIYG 132
Pzucine_in|197104237|ref|YP_0021    --PPRAMMMEAMRRIRRHVEENFDDVGDAFAREARAIHEG-KAEERGIYG 112
Msp.BNC_in|110635332|ref|YP_675540  --EEQKRAMAKLKELSQKIRENSDYVGDKFAEEARKIHFG-EVEARGIYG 113
BspORS2_in|146337711|ref|YP_001202  LMAQERELRAKLKELRDHIVKNADDVGERFPTEARKMHYG-ETEHRPIYG 132
Bsubvib_in|269921383|ref|ZP_061     --RVQTMMMQAAREVRSHVEANFDYVGDTFAREARAIHEG-QSEKREIYG 112
Csp.k31_in|16125080|ref|NP_4196     --KMREMMMTAMGEVRRHVEENFDYVGDAFAKEARAIHEG-ASEERGIYG 114
Bjaponi_in|27375323|ref|NP_76685    LMAQERELRAKIKELRDHIVKNADNVGERFANEARAMHYG-DKEHRPIYG 132
Bsubvib_in|254700521|ref|ZP_051     --EAQKKVLEEMRALSRQVRENADYVGEKFAEEARKIHFG-QTQARGIYG 113
Smelilo_in|15966369|ref|NP_386      --QAQKETVAKLKELVKSIRENAEDVGERFPDEARKIHYG-EADQRGLIG 114
BcanisA_in|161619792|ref|YP_00      --EAQKKVLEEMRALSRQVRENADYVGEKFAEEARKIHFG-ETQARGIYG 113
Ointerm_in|239832952|ref|ZP_046     --DTQKQILDEMRELSRKVRENADYVGDKFAEEARKIHFG-EAETRGIYG 125
Bsuis13_in|23502727|ref|NP_69885    --EAQKKVLEEMRALSRQVRENADYVGEKFAEEARKIHFG-ETQARGIYG 124
Bavium_out|187479009|ref|YP_787     ----PQALQAEALRQMRKWVSQTENVGPAFAVEARRIHEG-EAAERPIRG 112
Rpicke_out|241663468|ref|YP_00      --GASAALQQLYLKAVRHVLANTEDVGERFAEEARRMHYK-EAPERGIRG 122
Jsp.Ma_out|152981646|ref|YP_0013    ----SARLQEQLMEFTRKVMANTEDVGNQFAEEARRIHYK-EVPEHGIRG 109
Sacidi_out|85858127|ref|YP_46       ----EISPLKLLHKIQKYVSKNFEDVGERFAETALNIHHG-KEDPRNIKG 111
Dalken_out|218782160|ref|YP_00      ----QLNEEQIIKQLTEYVDKNFDNVGSKFTDEALKIHYG-ASEPRNIRG 111
                                                         : . **  *   *  :*       : : *

GOS_1318010                         TASKKEIVELKEEGINTEIIPWIEDKKN---- 158
CPelag1_in|254456289|ref|ZP_05      SASKKDLIELQEEGIETQMIPWVEDKEN---- 142
CPelag2_in|91762350|ref|ZP_012      TATKKDLNELKEEGIKAEILPWIKNTTN---- 143
Cpelag3_in|71083220|ref|YP_265      TATKKDLNELKEEGIKAEILPWIKDTTN---- 143
aproteo_in|262277612|ref|ZP_060     KATPEQTEELLDEGIEVNTVPWIDKANN---- 140
Ocarbox_in|209883250|ref|YP_00      QATAEEAHSLLEEGVEVMPLPLLPGERN---- 151
Csegnis_in|266628218|ref|ZP_06      EASPTEVKALVEDGVKVAPLPPGPPKKTEVN- 144
Csp.k31_in|167644908|ref|YP_00      EATPQEVKALVEDGIQVAPLPPPAPKKSEVN- 144
Bsp.BAL_in|254419245|ref|ZP_050     EATPAEVKKLKEDGVPVSALPDAPPDPSKVN- 144
Bsp.BTA_in|148258765|ref|YP_0012    EASIEEARELIEEGIEVAPIPVLPDDRN---- 160
Pzucine_in|197104237|ref|YP_0021    QATPQEVRELVEDGVPVAPLPPEPPKKTEVN- 143
Msp.BNC_in|110635332|ref|YP_675540  EATPDEVKSLAEDGVDFMPLPVFPDDRN---- 141
BspORS2_in|146337711|ref|YP_001202  EASLDEARELIEEGIEVAPIPVLPDDRN---- 160
Bsubvib_in|269921383|ref|ZP_061     EATPAEVKALKADGVPCAALPPAPLDPAKVN- 143
Csp.k31_in|16125080|ref|NP_4196     EASPAEVKALVEDGVKVAPLPPGPPKKTDVN- 145
Bjaponi_in|27375323|ref|NP_76685    EASPDEAKSLIDEGIEVSPLPTLPEDRN---- 160
Bsubvib_in|254700521|ref|ZP_051     EASRDDVHSLLEDGVDILPLPVFPEDQN---- 141
Smelilo_in|15966369|ref|NP_386      KATAEEAIALIEEGIEIAPLPVLPDDTN---- 142
BcanisA_in|161619792|ref|YP_00      EASRDDVHSLLEDGVDILPLPVFPEDQN---- 141
Ointerm_in|239832952|ref|ZP_046     EASREDVHSLLEDGVDVLPLPVFPEDKN---- 153
Bsuis13_in|23502727|ref|NP_69885    EASRDDVHSLLEDGVDILPLPVFPEDQN---- 152
Bavium_out|187479009|ref|YP_787     TATPEERAELADDGIHVLPLPS-FLDDDSLQ- 142
Rpicke_out|241663468|ref|YP_00      TTSREEAQELAEEGIDVMPLLVPDVLKQPVH- 153
Jsp.Ma_out|152981646|ref|YP_0013    VATVEECAELAEEGIDVMALPLPVLPKQALQ- 140
Sacidi_out|85858127|ref|YP_46       TTTQQEEDVLKEEGIPFFKIPLP---KLDS-- 138
Dalken_out|218782160|ref|YP_00      TSTKAQEELLAKEGVNFVKFPMPAAPKNDTDA 143
                                     ::  :   *  :*:    .            

Protein Domains

PROTOCOL


InterpPro, default parameters at EBI.



RESULTS ANALYSIS


Using INTERPROSCAN it was obtained the same domain in two different databases with homology to our ORF. These have different E-value, where the best value (with greater statistical significance) is 8.6e-41.

This domain belongs to a family of hypothetical bacterial proteins of around 150 residues in length, whose function is unknown.

The length of the ORF fits within the pattern of this family of proteins.







RAW RESULTS


Sequence_1	AE2DD5EB2CBF6EE1	158	HMMPfam	PF06676	DUF1178	17	158	8.6e-41	T	15-Mar-2010	IPR009562	Protein of unknown function DUF1178	
Sequence_1	AE2DD5EB2CBF6EE1	158	HMMPIR	PIRSF032131	Uncharacterised conserved protein, UCP032131 type	17	158	3e-28	T	15-Mar-2010	IPR009562	Protein of unknown function DUF1178	

Phylogeny

PROTOCOL


a) Phylogeny.fr / BioNJ method / out group: [b-proteobacteria],[d-proteobacteria]

b) Phylogeny.fr / PhyML method / out group: [b-proteobacteria],[d-proteobacteria]



RESULTS ANALYSIS


Comparing the two phylogenetic trees obtained, it appears that they are consistent, ie both are rooted in and have a monophyletic group for ingroups (a-proteobacteria), with a support value of 1.00 (_ 100%) in BioNJ and 0.99 (_ 99%) in Phymol. This probably indicates that the donor organism of the sequence under study belong to the Kingdom - Bacteria, Phylum - Proteobacteria, Class - a-proteobacteria. The phylogenetic trees vary within a branch of ingroups that contain our ORF in BioNJ the branch is founded on a single node, while in PhyML is a discrepancy between the [alpha proteobacterium HIMB114] and [Candidatus Pelagibacter sp. HTCC7211] [Pelagibacter ubique HTCC1002 Candidatus], [Pelagibacter ubique HTCC1062 Candidatus] and GOS_1318010 with a support value of 0.99.

The taxonomic group of the donor organism most likely to be the taxon GOS_1318010 less common node of the tree where it is, ie Rickettsiales (Order). You can not assign a lower rating, once the trees are not concordant on the node most recent in the evolutionary scale.






RAW RESULTS

a)all branches not represented in the phylogenetic tree have a support value> 0.75
                                                                                                         
                                                                                                        -----0.1---
 
       +-------------------------------Smelilo_in_15966369_ref_NP_386                                                                     [a-proteobacteria]
       |
       |                                  +--------------------------------------GOS_1318010                |                                  |
       |-------------1--------------------+---------------------------------------------CPelag1_in_254456289_ref_ZP_05                    [a-proteobacteria]
       |                                  |
       |                                  |-----------------------------------------------CPelag2_in_91762350_ref_ZP_012                  [a-proteobacteria]
 +-0.87+                                  |
 |     |                                  |----------------------------------------------Cpelag3_in_71083220_ref_YP_265                   [a-proteobacteria]
 |     |                                  |
 |     |                                  |
 |     |                                  +--------------------------------aproteo_in_262277612_ref_ZP_060                                [a-proteobacteria]
 |     |
 |     |                +-----------------------Ocarbox_in_209883250_ref_YP_00                                                            [a-proteobacteria]
 |     |                |
 |     |----0.84--------+               +----Bsp.BTA_in_148258765_ref_YP_0012                                                             [a-proteobacteria]
 |     |                |    +---1------+
 |     |                +0.84+          +--BspORS2_in_146337711_ref_YP_001202                                                             [a-proteobacteria]
 |     |                     |
 |     |                     +---------Bjaponi_in_27375323_ref_NP_76685                                                                   [a-proteobacteria]
 |     |
 |     |                     +--------------Pzucine_in_197104237_ref_YP_0021                                                              [a-proteobacteria]
 |     |                     |
 |     |------0.98-----------+----------Csp.k31_in_167644908_ref_YP_00                                                                    [a-proteobacteria]
 |     |                     |
 |     |                     |---------------------Bsp.BAL_in_254419245_ref_ZP_050                                                        [a-proteobacteria]
 |     |                     |
 |     |                     |
 |     |                     |-----------------------Bsubvib_in_269921383_ref_ZP_061                                                      [a-proteobacteria]
 |     |                     |
 |     |                     |      +----Csegnis_in_266628218_ref_ZP_06                                                                   [a-proteobacteria]
 |     |                     +0.91--+
 |     |                            +----Ccresce_in_16125080_ref_NP_4196                                                                  [a-proteobacteria]
 |     |
 |     |              +----------------Msp.BNC_in_110635332_ref_YP_675540                                                                 [a-proteobacteria]
 |     |              |
 |     +---0.99-------+                  +----Ointerm_in_239832952_ref_ZP_046                                                             [a-proteobacteria]        
 |                    |                  |
 |                    +--------1---------+       +Bsuisbv_in_254700521_ref_ZP_051                                                         [a-proteobacteria]
 |                                       |       1
 |                                       |       |BcanisA_in_161619792_ref_YP_00                                                          [a-proteobacteria]
 |                                       +--1----+
 |                                               +Bsuis13_in_23502727_ref_NP_69885                                                        [a-proteobacteria]
 |
 |
 |        +-----------------------------------Bavium_out_187479009_ref_YP_787                                                             [b-proteobacteria]
 |        |
 +--0.87--+                  +-----------------------Rpicke_out_241663468_ref_YP_00                                                       [b-proteobacteria]
          |-----0.86---------+
          |                  +-------------------------------Jsp.Ma_out_152981646_ref_YP_0013                                             [b-proteobacteria]
          |
          |----------------------------------------------------------------------Sacidi_out_85858127_ref_YP_46                            [d-proteobacteria]
          |
          +-------------------------------------------------------------------------------Dalken_out_218782160_ref_YP_00                  [d-proteobacteria]




--------------------------------------------------------------------------------------------------------------------------------------------
b)all branches not represented in the phylogenetic tree have a support value> 0.75


                                                                                                     ------0.2-----
 
            +-------------------Smelilo_in_15966369_ref_NP_386                                                                    [a-proteobacteria]
            |
            |                                                                 +-----------CPelag2_in_91762350_ref_ZP_012          [a-proteobacteria]
            |                                                                 |
            |                                     +-----------0.99------------+----------Cpelag3_in_71083220_ref_YP_265           [a-proteobacteria]
            |                                     |                           |
 +--0.82----+                                     |                           |----------CPelag1_in_254456289_ref_ZP_05           [a-proteobacteria]
 |          |--------------0.99-------------------+                           |
 |          |                                     |                           +-----------------GOS_1318010
 |          |                                     |
 |          |                                     |
 |          |                                     +--------------aproteo_in_262277612_ref_ZP_060                                  [a-proteobacteria]
 |          |
 |          |--------------------------Ocarbox_in_209883250_ref_YP_00                                                             [a-proteobacteria]
 |          |
 |          |                        +-----------Bsp.BTA_in_148258765_ref_YP_0012                                                 [a-proteobacteria]
 |          |--------------0.83------+
 |          |                        |-------BspORS2_in_146337711_ref_YP_001202                                                   [a-proteobacteria]
 |          |                        |
 |          |                        +-----Bjaponi_in_27375323_ref_NP_76685                                                       [a-proteobacteria]
 |          |
 |          |                                   +----Csegnis_in_266628218_ref_ZP_06                                               [a-proteobacteria]
 |          |                                   |
 |          |------------0.92-------------------+---------Ccresce_in_16125080_ref_NP_4196                                         [a-proteobacteria]
 |          |                                   |
 |          |                                   |-------Csp.k31_in_167644908_ref_YP_00                                            [a-proteobacteria]
 |          |                                   |
 |          |                                   |
 |          |                                   |------------------Bsp.BAL_in_254419245_ref_ZP_050                                [a-proteobacteria]
 |          |                                   |
 |          |                                   |-----------------Bsubvib_in_269921383_ref_ZP_061                                 [a-proteobacteria]
 |          |                                   |
 |          |                                   +-----------Pzucine_in_197104237_ref_YP_0021                                      [a-proteobacteria]
 |          |
 |          |               +------------Msp.BNC_in_110635332_ref_YP_675540                                                       [a-proteobacteria]
 |          |               |
 |          |-------0.75----+              +Ointerm_in_239832952_ref_ZP_046                                                       [a-proteobacteria]
 |          |               |              |
 |          |               +---0.99-------+     +Bsuisbv_in_254700521_ref_ZP_051                                                 [a-proteobacteria]
 |          |                              |     |
 |          |                              +--1--+BcanisA_in_161619792_ref_YP_00                                                  [a-proteobacteria]
 |          |                                    |
 |          |                                    +Bsuis13_in_23502727_ref_NP_69885                                                [a-proteobacteria]
 |          |
 |          |
 |          +--------------------------------------------Bavium_out_187479009_ref_YP_787                                          [b-proteobacteria]
 |
 |          +----------------Rpicke_out_241663468_ref_YP_00                                                                       [b-proteobacteria]
 +--0.82----+
            |------------------------Jsp.Ma_out_152981646_ref_YP_0013                                                             [b-proteobacteria]
            |
            |----------------------------------------------Sacidi_out_85858127_ref_YP_46                                          [d-proteobacteria]
            |
            +--------------------------------------------------------------Dalken_out_218782160_ref_YP_00                         [d-proteobacteria]

Taxonomy report

PROTOCOL


BLASTp vs NR, default NCBI parameters *"1000 max target sequences"



RESULTS ANALYSIS


Comparing the results of blastp vs. NR (E-value and score) and the results of the Lineage Report (taxon) it was selected the ingroup, in order to get a true taxonomic lineage, and outgroup. For the ingroup it was selected all sequences belonging to a-proteobacteria. For outgroups it was selected sequences of higher homology with the same strain taxonomic level than the ingroup. We had to be careful with the selecting of the outgroups with the highest possible diversity and length of the ORF. The chosen outgroups were b-proteobacteria and d-proteobacteria. Selection of these was drawn up using the MSA.


In group: a-proteobacteria

ref|ZP_05069718.1| CPelag1_in 1e-48 [Candidatus Pelagibacter sp. HTCC7211]

ref|ZP_01264315.1| CPelag2_in 2e-39 [Candidatus Pelagibacter ubique HTCC1002]

ref|YP_265939.1| CPelag3_in 3e-35 [Candidatus Pelagibacter ubique HTCC1062]

ref|ZP_06055405.1| aproteo_in 1e-25 [alpha proteobacterium HIMB114]

ref|YP_002287107.1| Ocarbox_in 1e-22 [Oligotropha carboxidovorans OM5]

ref|ZP_06121143.1| Csegnis_in 2e-22 [Caulobacter segnis ATCC 21756]

ref|YP_001682571.1| Csp.k31_in 3e-21 [Caulobacter sp. K31]

ref|ZP_05032969.1| Bsp.BAL_in 4e-21 [Brevundimonas sp. BAL3]

ref|YP_001243350.1| Bsp.BTA_in 1e-20 [Bradyrhizobium sp. BTAi1]

ref|YP_002129614.1| Pzucine_in 2e-20 [Phenylobacterium zucineum HLK1]

ref|YP_675540.1| Msp.BNC_in 2e-20 [Mesorhizobium sp. BNC1]

ref|YP_675540.1| BspORS2_in 3e-20 [Bradyrhizobium sp. ORS278]

ref|YP_001202759.1| Bsubvib_in 4e-20 [Brevundimonas subvibrioides ATCC 15264]

ref|NP_419644.1| Ccresce_in 6e-20 [Caulobacter crescentus CB15]

ref|NP_766852.1| Bjaponi_in 1e-19 [Bradyrhizobium japonicum USDA 110]

ref|ZP_05162349.1| Bsuisbv_in 1e-19 [Brucella suis bv. 5 str. 513]

ref|NP_386722.1| Smelilo_in 2e-19 [Sinorhizobium meliloti 1021]

ref|YP_001593679.1| BcanisA_in 2e-19 [Brucella canis ATCC 23365]

ref|ZP_04681281.1| Ointerm_in 2e-19 [Ochrobactrum intermedium LMG 3301]

ref|NP_698854.1| Bsuis13_in 2e-19 [Brucella suis 1330]


Out group: other proteobacteria: (b-proteobacteria, d-proteobacteria)



ref|YP_787033.1| Bavium_out 1e-12 [Bordetella avium 197N] (b-proteobacteria)

ref|YP_002981828.1| Rpicke_out 9e-12 [Ralstonia pickettii 12D] (b-proteobacteria)

ref|YP_001353068.1| Jsp.Ma_out 1e-11 [Janthinobacterium sp. Marseille] (b-proteobacteria)

ref|YP_460329.1| Sacidi_out 9e-11 [Syntrophus aciditrophicus SB] (d-proteobacteria)

ref|YP_002433478.1| Dalken_out 3e-07 [Desulfatibacillum alkenivorans AK-01](d-proteobacteria)



RAW RESULTS

Lineage Report

root
. cellular organisms
. . Bacteria                [bacteria]
. . . Proteobacteria          [proteobacteria]
. . . . Alphaproteobacteria     [a-proteobacteria]
. . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter sp. HTCC7211 --------------------  196 2 hits [a-proteobacteria]  conserved hypothetical protein [Candidatus Pelagibacter sp.
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 .................  164 2 hits [a-proteobacteria]  hypothetical protein PU1002_03756 [Candidatus Pelagibacter 
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 .................  150 2 hits [a-proteobacteria]  hypothetical protein SAR11_0514 [Candidatus Pelagibacter ub
. . . . . . alpha proteobacterium HIMB114 -----------------------------  119 2 hits [a-proteobacteria]  conserved hypothetical protein [alpha proteobacterium HIMB1
. . . . . Oligotropha carboxidovorans OM5 -----------------------------  108 2 hits [a-proteobacteria]  hypothetical protein OCAR_4091 [Oligotropha carboxidovorans
. . . . . Caulobacter segnis ATCC 21756 ...............................  108 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Caulobacter segnis ATC
. . . . . Caulobacter sp. K31 .........................................  104 2 hits [a-proteobacteria]  hypothetical protein Caul_0942 [Caulobacter sp. K31] >gi|16
. . . . . Brevundimonas sp. BAL3 ......................................  103 2 hits [a-proteobacteria]  conserved hypothetical protein [Brevundimonas sp. BAL3] >gi
. . . . . Bradyrhizobium sp. BTAi1 ....................................  102 2 hits [a-proteobacteria]  hypothetical protein BBta_7597 [Bradyrhizobium sp. BTAi1] >
. . . . . Phenylobacterium zucineum HLK1 ..............................  102 2 hits [a-proteobacteria]  hypothetical protein PHZ_c0771 [Phenylobacterium zucineum H
. . . . . Chelativorans sp. BNC1 ......................................  101 2 hits [a-proteobacteria]  hypothetical protein Meso_3003 [Mesorhizobium sp. BNC1] >gi
. . . . . Bradyrhizobium sp. ORS278 ...................................  101 2 hits [a-proteobacteria]  hypothetical protein BRADO0580 [Bradyrhizobium sp. ORS278] 
. . . . . Brevundimonas subvibrioides ATCC 15264 ......................  100 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Brevundimonas subvibri
. . . . . Caulobacter crescentus CB15 .................................  100 2 hits [a-proteobacteria]  hypothetical protein CC_0827 [Caulobacter crescentus CB15] 
. . . . . Caulobacter crescentus NA1000 ...............................  100 2 hits [a-proteobacteria]  hypothetical protein CC_0827 [Caulobacter crescentus CB15] 
. . . . . Bradyrhizobium japonicum USDA 110 ...........................   99 2 hits [a-proteobacteria]  hypothetical protein blr0212 [Bradyrhizobium japonicum USDA
. . . . . Brucella suis bv. 5 str. 513 ................................   99 3 hits [a-proteobacteria]  hypothetical protein Bsuib55_06666 [Brucella suis bv. 5 str
. . . . . Sinorhizobium meliloti 1021 .................................   98 2 hits [a-proteobacteria]  hypothetical protein SMc02441 [Sinorhizobium meliloti 1021]
. . . . . Brucella canis ATCC 23365 ...................................   98 2 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella suis bv. 3 str. 686 ................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella pinnipedialis B2/94 ................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella ceti M644/93/1 .....................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella ceti M13/05/1 ......................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella sp. 83/13 ..........................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella pinnipedialis M292/94/1 ............................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella ceti M490/95/1 .....................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella ceti B1/94 .........................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella sp. F5/99 ..........................................   98 3 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Brucella suis bv. 4 str. 40 .................................   98 2 hits [a-proteobacteria]  hypothetical protein BCAN_A1918 [Brucella canis ATCC 23365]
. . . . . Ochrobactrum intermedium LMG 3301 ...........................   98 2 hits [a-proteobacteria]  Hypothetical protein, conserved [Ochrobactrum intermedium L
. . . . . Brucella suis 1330 ..........................................   98 2 hits [a-proteobacteria]  hypothetical protein BR1874 [Brucella suis 1330] >gi|225628
. . . . . Brucella ceti str. Cudo .....................................   98 2 hits [a-proteobacteria]  hypothetical protein BR1874 [Brucella suis 1330] >gi|225628
. . . . . Brucella microti CCM 4915 ...................................   98 2 hits [a-proteobacteria]  hypothetical protein BR1874 [Brucella suis 1330] >gi|225628
. . . . . Brucella ovis ATCC 25840 ....................................   98 2 hits [a-proteobacteria]  hypothetical protein BOV_1805 [Brucella ovis ATCC 25840] >g
. . . . . Methylobacterium radiotolerans JCM 2831 .....................   98 2 hits [a-proteobacteria]  hypothetical protein Mrad2831_0046 [Methylobacterium radiot
. . . . . Brucella abortus bv. 1 str. 9-941 ...........................   97 2 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus S19 ........................................   97 2 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus bv. 6 str. 870 .............................   97 3 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus bv. 3 str. Tulya ...........................   97 3 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus bv. 2 str. 86/8/59 .........................   97 3 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus bv. 4 str. 292 .............................   97 3 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus bv. 9 str. C68 .............................   97 3 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella abortus NCTC 8038 ..................................   97 2 hits [a-proteobacteria]  hypothetical protein BruAb1_1853 [Brucella abortus bv. 1 st
. . . . . Brucella melitensis biovar Abortus 2308 .....................   97 2 hits [a-proteobacteria]  hypothetical protein BAB1_1877 [Brucella melitensis biovar 
. . . . . Brucella abortus str. 2308 A ................................   97 2 hits [a-proteobacteria]  hypothetical protein BAB1_1877 [Brucella melitensis biovar 
. . . . . Agrobacterium tumefaciens str. C58 ..........................   97 2 hits [a-proteobacteria]  hypothetical protein Atu3509 [Agrobacterium tumefaciens str
. . . . . alpha proteobacterium BAL199 ................................   97 2 hits [a-proteobacteria]  phosphopentomutase [alpha proteobacterium BAL199] >gi|15918
. . . . . Agrobacterium vitis S4 ......................................   97 2 hits [a-proteobacteria]  hypothetical protein Avi_3967 [Agrobacterium vitis S4] >gi|
. . . . . Brucella melitensis bv. 1 str. 16M ..........................   97 4 hits [a-proteobacteria]  putative cytoplasmic protein [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis ATCC 23457 ..............................   97 2 hits [a-proteobacteria]  putative cytoplasmic protein [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 1 str. Rev.1 ........................   97 3 hits [a-proteobacteria]  putative cytoplasmic protein [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 3 str. Ether ........................   97 3 hits [a-proteobacteria]  putative cytoplasmic protein [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 2 str. 63/9 .........................   97 2 hits [a-proteobacteria]  putative cytoplasmic protein [Brucella melitensis 16M] >gi|
. . . . . Asticcacaulis excentricus CB 48 .............................   97 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Asticcacaulis excentri
. . . . . Rhizobium sp. NGR234 ........................................   96 2 hits [a-proteobacteria]  hypothetical protein NGR_c26620 [Rhizobium sp. NGR234] >gi|
. . . . . Hyphomonas neptunium ATCC 15444 .............................   96 2 hits [a-proteobacteria]  hypothetical protein HNE_3168 [Hyphomonas neptunium ATCC 15
. . . . . Brucella neotomae 5K33 ......................................   95 3 hits [a-proteobacteria]  hypothetical protein Bneo5_05817 [Brucella neotomae 5K33] >
. . . . . Rhodospirillum centenum SW ..................................   95 2 hits [a-proteobacteria]  hypothetical protein RC1_2655 [Rhodospirillum centenum SW] 
. . . . . Brucella suis ATCC 23445 ....................................   95 2 hits [a-proteobacteria]  hypothetical protein BSUIS_A1715 [Brucella suis ATCC 23445]
. . . . . Rhizobium leguminosarum bv. viciae 3841 .....................   95 2 hits [a-proteobacteria]  hypothetical protein RL4287 [Rhizobium leguminosarum bv. vi
. . . . . Oceanicaulis alexandrii HTCC2633 ............................   95 2 hits [a-proteobacteria]  hypothetical protein OA2633_06814 [Oceanicaulis alexandrii 
. . . . . Ruegeria pomeroyi DSS-3 .....................................   95 2 hits [a-proteobacteria]  hypothetical protein SPO3052 [Ruegeria pomeroyi DSS-3] >gi|
. . . . . Ochrobactrum anthropi ATCC 49188 ............................   95 2 hits [a-proteobacteria]  hypothetical protein Oant_1031 [Ochrobactrum anthropi ATCC 
. . . . . Mesorhizobium opportunistum WSM2075 .........................   95 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Mesorhizobium opportun
. . . . . Nitrobacter hamburgensis X14 ................................   94 4 hits [a-proteobacteria]  hypothetical protein Nham_0477 [Nitrobacter hamburgensis X1
. . . . . Methylobacterium sp. 4-46 ...................................   94 2 hits [a-proteobacteria]  hypothetical protein M446_5214 [Methylobacterium sp. 4-46] 
. . . . . Maricaulis maris MCS10 ......................................   94 2 hits [a-proteobacteria]  hypothetical protein Mmar10_2261 [Maricaulis maris MCS10] >
. . . . . Magnetospirillum magnetotacticum MS-1 .......................   93 3 hits [a-proteobacteria]  COG5319: Uncharacterized protein conserved in bacteria [Mag
. . . . . Sinorhizobium medicae WSM419 ................................   93 2 hits [a-proteobacteria]  hypothetical protein Smed_2507 [Sinorhizobium medicae WSM41
. . . . . Roseobacter sp. AzwK-3b .....................................   93 2 hits [a-proteobacteria]  hypothetical protein RAZWK3B_07939 [Roseobacter sp. AzwK-3b
. . . . . Rhodopseudomonas palustris CGA009 ...........................   92 2 hits [a-proteobacteria]  hypothetical protein RPA0600 [Rhodopseudomonas palustris CG
. . . . . Rhodopseudomonas palustris TIE-1 ............................   92 2 hits [a-proteobacteria]  hypothetical protein RPA0600 [Rhodopseudomonas palustris CG
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ................   92 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Rhizobium leguminosaru
. . . . . Parvibaculum lavamentivorans DS-1 ...........................   92 2 hits [a-proteobacteria]  hypothetical protein Plav_1739 [Parvibaculum lavamentivoran
. . . . . Magnetospirillum gryphiswaldense MSR-1 ......................   92 2 hits [a-proteobacteria]  protein containing DUF1178 [Magnetospirillum gryphiswaldens
. . . . . Hirschia baltica ATCC 49814 .................................   92 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Hirschia baltica ATCC 
. . . . . Methylobacterium nodulans ORS 2060 ..........................   92 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Methylobacterium nodul
. . . . . Azorhizobium caulinodans ORS 571 ............................   92 2 hits [a-proteobacteria]  hypothetical protein AZC_4298 [Azorhizobium caulinodans ORS
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ................   92 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Rhizobium leguminosaru
. . . . . Parvularcula bermudensis HTCC2503 ...........................   92 2 hits [a-proteobacteria]  hypothetical protein PB2503_12889 [Parvularcula bermudensis
. . . . . Jannaschia sp. CCS1 .........................................   92 2 hits [a-proteobacteria]  hypothetical protein Jann_3271 [Jannaschia sp. CCS1] >gi|88
. . . . . Agrobacterium radiobacter K84 ...............................   92 2 hits [a-proteobacteria]  hypothetical protein Arad_4135 [Agrobacterium radiobacter K
. . . . . Roseobacter denitrificans OCh 114 ...........................   91 2 hits [a-proteobacteria]  hypothetical protein RD1_2156 [Roseobacter denitrificans OC
. . . . . Magnetospirillum magneticum AMB-1 ...........................   91 4 hits [a-proteobacteria]  hypothetical protein amb1609 [Magnetospirillum magneticum A
. . . . . Hoeflea phototrophica DFL-43 ................................   91 2 hits [a-proteobacteria]  hypothetical protein HPDFL43_16666 [Hoeflea phototrophica D
. . . . . Rhodopseudomonas palustris BisA53 ...........................   91 2 hits [a-proteobacteria]  hypothetical protein RPE_0155 [Rhodopseudomonas palustris B
. . . . . Nitrobacter winogradskyi Nb-255 .............................   91 4 hits [a-proteobacteria]  hypothetical protein Nwi_0382 [Nitrobacter winogradskyi Nb-
. . . . . Nitrobacter sp. Nb-311A .....................................   90 4 hits [a-proteobacteria]  hypothetical protein NB311A_04684 [Nitrobacter sp. Nb-311A]
. . . . . Rhodopseudomonas palustris BisB5 ............................   90 2 hits [a-proteobacteria]  hypothetical protein RPD_0104 [Rhodopseudomonas palustris B
. . . . . Rhodopseudomonas palustris DX-1 .............................   90 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Rhodopseudomonas palus
. . . . . Rhizobium etli CFN 42 .......................................   90 2 hits [a-proteobacteria]  hypothetical protein RHE_CH03760 [Rhizobium etli CFN 42] >g
. . . . . Rhizobium etli CIAT 652 .....................................   90 2 hits [a-proteobacteria]  hypothetical protein RHECIAT_CH0004028 [Rhizobium etli CIAT
. . . . . Aurantimonas manganoxydans SI85-9A1 .........................   89 2 hits [a-proteobacteria]  conserved hypothetical protein [Aurantimonas manganoxydans 
. . . . . Rhodopseudomonas palustris HaA2 .............................   89 2 hits [a-proteobacteria]  hypothetical protein RPB_0023 [Rhodopseudomonas palustris H
. . . . . Roseovarius sp. HTCC2601 ....................................   89 2 hits [a-proteobacteria]  hypothetical protein R2601_17928 [Roseovarius sp. HTCC2601]
. . . . . Rhodobacterales bacterium HTCC2654 ..........................   89 2 hits [a-proteobacteria]  hypothetical protein RB2654_20488 [Rhodobacterales bacteriu
. . . . . Rhodopseudomonas palustris BisB18 ...........................   89 2 hits [a-proteobacteria]  hypothetical protein RPC_0517 [Rhodopseudomonas palustris B
. . . . . Labrenzia alexandrii DFL-11 .................................   88 2 hits [a-proteobacteria]  conserved hypothetical protein [Labrenzia alexandrii DFL-11
. . . . . Rhodobacter sphaeroides ATCC 17025 ..........................   88 2 hits [a-proteobacteria]  hypothetical protein Rsph17025_1885 [Rhodobacter sphaeroide
. . . . . Oceanicola batsensis HTCC2597 ...............................   88 2 hits [a-proteobacteria]  hypothetical protein OB2597_15950 [Oceanicola batsensis HTC
. . . . . Oceanicola granulosus HTCC2516 ..............................   88 2 hits [a-proteobacteria]  hypothetical protein OG2516_15794 [Oceanicola granulosus HT
. . . . . Rhodobacteraceae bacterium KLH11 ............................   88 2 hits [a-proteobacteria]  conserved hypothetical protein [Rhodobacteraceae bacterium 
. . . . . Roseovarius nubinhibens ISM .................................   87 2 hits [a-proteobacteria]  hypothetical protein ISM_01365 [Roseovarius nubinhibens ISM
. . . . . Acidiphilium cryptum JF-5 ...................................   87 2 hits [a-proteobacteria]  hypothetical protein Acry_1497 [Acidiphilium cryptum JF-5] 
. . . . . Roseovarius sp. 217 .........................................   87 2 hits [a-proteobacteria]  hypothetical protein ROS217_23875 [Roseovarius sp. 217] >gi
. . . . . Erythrobacter sp. SD-21 .....................................   87 2 hits [a-proteobacteria]  hypothetical protein ED21_27788 [Erythrobacter sp. SD-21] >
. . . . . Labrenzia aggregata IAM 12614 ...............................   87 2 hits [a-proteobacteria]  hypothetical protein SIAM614_24627 [Stappia aggregata IAM 1
. . . . . Methylobacterium populi BJ001 ...............................   87 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Methylobacterium popul
. . . . . Methylobacterium extorquens DM4 .............................   87 2 hits [a-proteobacteria]  hypothetical protein METDI4071 [Methylobacterium extorquens
. . . . . Ruegeria sp. R11 ............................................   87 2 hits [a-proteobacteria]  conserved hypothetical protein [Ruegeria sp. R11] >gi|21403
. . . . . Methylobacterium chloromethanicum CM4 .......................   87 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Methylobacterium chlor
. . . . . Methylobacterium extorquens AM1 .............................   86 2 hits [a-proteobacteria]  hypothetical protein MexAM1_META1p3491 [Methylobacterium ex
. . . . . Rhodobacter sphaeroides ATCC 17029 ..........................   86 2 hits [a-proteobacteria]  hypothetical protein Rsph17029_1051 [Rhodobacter sphaeroide
. . . . . Methylobacterium extorquens PA1 .............................   85 2 hits [a-proteobacteria]  hypothetical protein Mext_3279 [Methylobacterium extorquens
. . . . . Roseobacter litoralis Och 149 ...............................   85 2 hits [a-proteobacteria]  hypothetical protein RLO149_18023 [Roseobacter litoralis Oc
. . . . . Acetobacter pasteurianus IFO 3283-01 ........................   85 2 hits [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-03 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-07 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-22 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-26 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-32 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-01-42C ....................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Acetobacter pasteurianus IFO 3283-12 ........................   85 1 hit  [a-proteobacteria]  hypothetical protein APA01_11230 [Acetobacter pasteurianus 
. . . . . Dinoroseobacter shibae DFL 12 ...............................   85 2 hits [a-proteobacteria]  conserved hypothetical protein DUF1178 [Dinoroseobacter shi
. . . . . Oceanibulbus indolifex HEL-45 ...............................   85 2 hits [a-proteobacteria]  hypothetical protein OIHEL45_09843 [Oceanibulbus indolifex 
. . . . . Roseovarius sp. TM1035 ......................................   85 2 hits [a-proteobacteria]  hypothetical protein RTM1035_13083 [Roseovarius sp. TM1035]
. . . . . Paracoccus denitrificans PD1222 .............................   84 2 hits [a-proteobacteria]  hypothetical protein Pden_2570 [Paracoccus denitrificans PD
. . . . . Roseobacter sp. SK209-2-6 ...................................   83 2 hits [a-proteobacteria]  hypothetical protein RSK20926_12699 [Roseobacter sp. SK209-
. . . . . Ruegeria sp. TM1040 .........................................   83 2 hits [a-proteobacteria]  hypothetical protein TM1040_2316 [Ruegeria sp. TM1040] >gi|
. . . . . Xanthobacter autotrophicus Py2 ..............................   83 2 hits [a-proteobacteria]  hypothetical protein Xaut_3087 [Xanthobacter autotrophicus 
. . . . . Roseobacter sp. CCS2 ........................................   83 2 hits [a-proteobacteria]  hypothetical protein RCCS2_05214 [Roseobacter sp. CCS2] >gi
. . . . . Silicibacter sp. TrichCH4B ..................................   83 2 hits [a-proteobacteria]  conserved hypothetical protein [Silicibacter sp. TrichCH4B]
. . . . . Rhodobacter sphaeroides 2.4.1 ...............................   82 2 hits [a-proteobacteria]  hypothetical protein RSP_2387 [Rhodobacter sphaeroides 2.4.
. . . . . Granulibacter bethesdensis CGDNIH1 ..........................   82 2 hits [a-proteobacteria]  putative cytoplasmic protein [Granulibacter bethesdensis CG
. . . . . Novosphingobium aromaticivorans DSM 12444 ...................   82 2 hits [a-proteobacteria]  hypothetical protein Saro_2011 [Novosphingobium aromaticivo
. . . . . Rhodobacterales bacterium HTCC2083 ..........................   82 2 hits [a-proteobacteria]  conserved hypothetical protein [Rhodobacterales bacterium H
. . . . . Rhodobacter sphaeroides KD131 ...............................   81 2 hits [a-proteobacteria]  hypothetical protein RSKD131_0703 [Rhodobacter sphaeroides 
. . . . . Gluconacetobacter diazotrophicus PAl 5 ......................   81 4 hits [a-proteobacteria]  hypothetical protein GDI_1905 [Gluconacetobacter diazotroph
. . . . . Roseobacter sp. MED193 ......................................   81 2 hits [a-proteobacteria]  hypothetical protein MED193_08868 [Roseobacter sp. MED193] 
. . . . . Thalassiobium sp. R2A62 .....................................   81 2 hits [a-proteobacteria]  conserved hypothetical protein [Thalassiobium sp. R2A62] >g
. . . . . Rhodobacter sp. SW2 .........................................   81 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Rhodobacter sp. SW2] >
. . . . . Sphingomonas wittichii RW1 ..................................   80 2 hits [a-proteobacteria]  hypothetical protein Swit_0556 [Sphingomonas wittichii RW1]
. . . . . Silicibacter lacuscaerulensis ITI-1157 ......................   80 2 hits [a-proteobacteria]  conserved hypothetical protein [Silicibacter lacuscaerulens
. . . . . Sagittula stellata E-37 .....................................   79 2 hits [a-proteobacteria]  hypothetical protein SSE37_23124 [Sagittula stellata E-37] 
. . . . . Sphingomonas sp. SKA58 ......................................   79 2 hits [a-proteobacteria]  hypothetical protein SKA58_12742 [Sphingomonas sp. SKA58] >
. . . . . Rhodobacterales bacterium HTCC2150 ..........................   79 2 hits [a-proteobacteria]  hypothetical protein RB2150_06998 [Rhodobacterales bacteriu
. . . . . Sphingobium japonicum UT26S .................................   78 1 hit  [a-proteobacteria]  conserved hypothetical protein [Sphingobium japonicum UT26S]
. . . . . Sulfitobacter sp. EE-36 .....................................   77 2 hits [a-proteobacteria]  hypothetical protein EE36_03308 [Sulfitobacter sp. EE-36] >
. . . . . Roseobacter sp. GAI101 ......................................   77 2 hits [a-proteobacteria]  conserved hypothetical protein [Roseobacter sp. GAI101] >gi
. . . . . Erythrobacter sp. NAP1 ......................................   77 2 hits [a-proteobacteria]  hypothetical protein NAP1_05705 [Erythrobacter sp. NAP1] >g
. . . . . Sulfitobacter sp. NAS-14.1 ..................................   77 2 hits [a-proteobacteria]  hypothetical protein NAS141_08236 [Sulfitobacter sp. NAS-14
. . . . . Octadecabacter antarcticus 238 ..............................   77 2 hits [a-proteobacteria]  conserved hypothetical protein [Octadecabacter antarcticus 
. . . . . alpha proteobacterium IMCC1322 ..............................   75 1 hit  [a-proteobacteria]  Protein of unknown function DUF1178 [alpha proteobacterium 
. . . . . Azospirillum sp. B510 .......................................   75 4 hits [a-proteobacteria]  hypothetical protein AZL_001510 [Azospirillum sp. B510] >gi
. . . . . Phaeobacter gallaeciensis 2.10 ..............................   75 2 hits [a-proteobacteria]  hypothetical protein RG210_03188 [Phaeobacter gallaeciensis
. . . . . Sphingopyxis alaskensis RB2256 ..............................   75 2 hits [a-proteobacteria]  hypothetical protein Sala_1789 [Sphingopyxis alaskensis RB2
. . . . . Citreicella sp. SE45 ........................................   75 2 hits [a-proteobacteria]  conserved hypothetical protein [Citreicella sp. SE45] >gi|2
. . . . . Phaeobacter gallaeciensis BS107 .............................   74 2 hits [a-proteobacteria]  hypothetical protein RGBS107_10271 [Phaeobacter gallaeciens
. . . . . Hyphomicrobium denitrificans ATCC 51888 .....................   72 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Hyphomicrobium denitri
. . . . . Rhodobacterales bacterium Y4I ...............................   71 2 hits [a-proteobacteria]  conserved hypothetical protein [Rhodobacterales bacterium Y
. . . . . Erythrobacter litoralis HTCC2594 ............................   70 2 hits [a-proteobacteria]  hypothetical protein ELI_06440 [Erythrobacter litoralis HTC
. . . . . Rhodospirillum rubrum ATCC 11170 ............................   70 4 hits [a-proteobacteria]  hypothetical protein Rru_A0740 [Rhodospirillum rubrum ATCC 
. . . . . Loktanella vestfoldensis SKA53 ..............................   69 2 hits [a-proteobacteria]  hypothetical protein SKA53_08331 [Loktanella vestfoldensis 
. . . . . Methylocella silvestris BL2 .................................   68 2 hits [a-proteobacteria]  protein of unknown function DUF1178 [Methylocella silvestri
. . . . . Pseudovibrio sp. JE062 ......................................   63 2 hits [a-proteobacteria]  conserved hypothetical protein [Pseudovibrio sp. JE062] >gi
. . . . . Mesorhizobium loti MAFF303099 ...............................   62 2 hits [a-proteobacteria]  hypothetical protein mll3449 [Mesorhizobium loti MAFF303099
. . . . . Fulvimarina pelagi HTCC2506 .................................   59 2 hits [a-proteobacteria]  hypothetical protein FP2506_05286 [Fulvimarina pelagi HTCC2
. . . . . Octadecabacter antarcticus 307 ..............................   58 2 hits [a-proteobacteria]  conserved hypothetical protein [Octadecabacter antarcticus 
. . . . . Brucella pinnipedialis M163/99/10 ...........................   57 3 hits [a-proteobacteria]  hypothetical protein BpinM_11636 [Brucella pinnipedialis M1
. . . . . Beijerinckia indica subsp. indica ATCC 9039 .................   56 2 hits [a-proteobacteria]  hypothetical protein Bind_3309 [Beijerinckia indica subsp. 
. . . . . Rhodobacterales bacterium HTCC2255 ..........................   54 2 hits [a-proteobacteria]  hypothetical protein OM2255_12362 [alpha proteobacterium HT
. . . . Bordetella avium 197N -----------------------------------------   75 2 hits [b-proteobacteria]  hypothetical protein BAV2523 [Bordetella avium 197N] >gi|11
. . . . Ralstonia pickettii 12D .......................................   73 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Ralstonia pickettii 12
. . . . Janthinobacterium sp. Marseille ...............................   72 2 hits [b-proteobacteria]  hypothetical protein mma_1378 [Janthinobacterium sp. Marsei
. . . . Bordetella bronchiseptica RB50 ................................   72 2 hits [b-proteobacteria]  hypothetical protein BB1836 [Bordetella bronchiseptica RB50
. . . . Achromobacter piechaudii ATCC 43553 ...........................   71 1 hit  [b-proteobacteria]  conserved hypothetical protein [Achromobacter piechaudii AT
. . . . Bordetella parapertussis 12822 ................................   71 1 hit  [b-proteobacteria]  hypothetical protein BPP2386 [Bordetella parapertussis 1282
. . . . Bordetella parapertussis ......................................   71 1 hit  [b-proteobacteria]  hypothetical protein BPP2386 [Bordetella parapertussis 1282
. . . . Ralstonia solanacearum MolK2 ..................................   70 2 hits [b-proteobacteria]  protein of unknown function duf1178 [Ralstonia solanacearum
. . . . Ralstonia pickettii 12J .......................................   70 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Ralstonia pickettii 12
. . . . Ralstonia solanacearum UW551 ..................................   70 2 hits [b-proteobacteria]  Hypothetical Protein RRSL_03906 [Ralstonia solanacearum UW5
. . . . Ralstonia solanacearum IPO1609 ................................   70 2 hits [b-proteobacteria]  Hypothetical Protein RRSL_03906 [Ralstonia solanacearum UW5
. . . . Syntrophus aciditrophicus SB ..................................   69 2 hits [d-proteobacteria]  putative cytoplasmic protein [Syntrophus aciditrophicus SB]
. . . . Comamonas testosteroni CNB-2 ..................................   68 2 hits [b-proteobacteria]  hypothetical protein CtCNB1_1077 [Comamonas testosteroni CN
. . . . Acidovorax ebreus TPSY ........................................   68 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Acidovorax ebreus TPSY
. . . . Bordetella petrii DSM 12804 ...................................   68 1 hit  [b-proteobacteria]  hypothetical protein Bpet3369 [Bordetella petrii DSM 12804]
. . . . Bordetella petrii .............................................   68 1 hit  [b-proteobacteria]  hypothetical protein Bpet3369 [Bordetella petrii DSM 12804]
. . . . Bordetella pertussis Tohama I .................................   67 2 hits [b-proteobacteria]  hypothetical protein BP2006 [Bordetella pertussis Tohama I]
. . . . Methylibium petroleiphilum PM1 ................................   67 2 hits [b-proteobacteria]  hypothetical protein Mpe_A1419 [Methylibium petroleiphilum 
. . . . Burkholderia sp. CCGE1003 .....................................   67 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia sp. CCGE1
. . . . Acidovorax citrulli AAC00-1 ...................................   67 2 hits [b-proteobacteria]  hypothetical protein Aave_1278 [Acidovorax avenae subsp. ci
. . . . Polaromonas sp. JS666 .........................................   67 2 hits [b-proteobacteria]  hypothetical protein Bpro_3240 [Polaromonas sp. JS666] >gi|
. . . . Burkholderia thailandensis MSMB43 .............................   67 1 hit  [b-proteobacteria]  hypothetical protein Bpse38_06207 [Burkholderia thailandens
. . . . Burkholderia multivorans ATCC 17616 ...........................   66 4 hits [b-proteobacteria]  hypothetical protein Bmul_1044 [Burkholderia multivorans AT
. . . . Burkholderia multivorans CGD2M ................................   66 2 hits [b-proteobacteria]  hypothetical protein Bmul_1044 [Burkholderia multivorans AT
. . . . Burkholderia multivorans CGD2 .................................   66 2 hits [b-proteobacteria]  hypothetical protein Bmul_1044 [Burkholderia multivorans AT
. . . . Burkholderia multivorans CGD1 .................................   66 2 hits [b-proteobacteria]  hypothetical protein Bmul_1044 [Burkholderia multivorans AT
. . . . Cupriavidus taiwanensis .......................................   66 2 hits [b-proteobacteria]  conserved hypothetical protein, DUF1178 [Cupriavidus taiwan
. . . . Acidovorax sp. JS42 ...........................................   66 2 hits [b-proteobacteria]  hypothetical protein Ajs_0972 [Acidovorax sp. JS42] >gi|120
. . . . Acidovorax delafieldii 2AN ....................................   65 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Acidovorax delafieldii
. . . . Polaromonas naphthalenivorans CJ2 .............................   65 2 hits [b-proteobacteria]  hypothetical protein Pnap_1440 [Polaromonas naphthalenivora
. . . . Curvibacter putative symbiont of Hydra magnipapillata .........   65 1 hit  [b-proteobacteria]  hypothetical protein [Curvibacter putative symbiont of Hydr
. . . . Burkholderia oklahomensis EO147 ...............................   65 1 hit  [b-proteobacteria]  hypothetical protein BoklE_06477 [Burkholderia oklahomensis
. . . . Burkholderia oklahomensis C6786 ...............................   65 1 hit  [b-proteobacteria]  hypothetical protein BoklE_06477 [Burkholderia oklahomensis
. . . . Burkholderia glumae BGR1 ......................................   65 2 hits [b-proteobacteria]  hypothetical protein bglu_1g25780 [Burkholderia glumae BGR1
. . . . Rhodoferax ferrireducens T118 .................................   65 2 hits [b-proteobacteria]  hypothetical protein Rfer_1508 [Rhodoferax ferrireducens T1
. . . . Burkholderia dolosa AUO158 ....................................   64 2 hits [b-proteobacteria]  hypothetical protein BDAG_01080 [Burkholderia dolosa AUO158
. . . . Burkholderia ambifaria MEX-5 ..................................   64 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia ambifaria
. . . . Burkholderia thailandensis E264 ...............................   64 3 hits [b-proteobacteria]  hypothetical protein BTH_I1077 [Burkholderia thailandensis 
. . . . Burkholderia thailandensis TXDOH ..............................   64 1 hit  [b-proteobacteria]  hypothetical protein BTH_I1077 [Burkholderia thailandensis 
. . . . Burkholderia thailandensis Bt4 ................................   64 1 hit  [b-proteobacteria]  hypothetical protein BTH_I1077 [Burkholderia thailandensis 
. . . . Dechloromonas aromatica RCB ...................................   64 2 hits [b-proteobacteria]  hypothetical protein Daro_2040 [Dechloromonas aromatica RCB
. . . . Ralstonia solanacearum GMI1000 ................................   64 2 hits [b-proteobacteria]  hypothetical protein RSc2046 [Ralstonia solanacearum GMI100
. . . . Burkholderia sp. 383 ..........................................   63 2 hits [b-proteobacteria]  hypothetical protein Bcep18194_A5561 [Burkholderia sp. 383]
. . . . Burkholderia ambifaria MC40-6 .................................   63 2 hits [b-proteobacteria]  hypothetical protein BamMC406_2150 [Burkholderia ambifaria 
. . . . Burkholderia pseudomallei K96243 ..............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei ATCC 23344 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei GB8 horse 4 ...............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 1710b ...............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei SAVP1 .....................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei NCTC 10229 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei NCTC 10247 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 1106a ...............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 305 .................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei PRL-20 ....................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei DM98 ................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 14 ..................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 91 ..................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 9 ...................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei B7210 ...............................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 7894 ................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei NCTC 13177 ..........................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 112 .................................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei BCC215 ..............................   63 1 hit  [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 576 .................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei Pakistan 9 ..........................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei MSHR346 .............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 1106b ...............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei ATCC 10399 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 1655 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei Pasteur 52237 .......................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei S13 .................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei FMH .......................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei JHU .......................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 1710a ...............................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia pseudomallei 406e ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia mallei 2002721280 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BPSL1227 [Burkholderia pseudomallei K9
. . . . Burkholderia ambifaria AMMD ...................................   63 2 hits [b-proteobacteria]  hypothetical protein Bamb_2271 [Burkholderia ambifaria AMMD
. . . . Burkholderia ambifaria IOP40-10 ...............................   63 2 hits [b-proteobacteria]  hypothetical protein Bamb_2271 [Burkholderia ambifaria AMMD
. . . . Burkholderia sp. H160 .........................................   63 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia sp. H160]
. . . . Burkholderia phytofirmans PsJN ................................   63 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia phytofirm
. . . . Burkholderia sp. CCGE1002 .....................................   63 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia sp. CCGE1
. . . . Burkholderia cenocepacia J2315 ................................   63 2 hits [b-proteobacteria]  hypothetical protein BCAL2328 [Burkholderia cenocepacia J23
. . . . Burkholderia cenocepacia AU 1054 ..............................   62 2 hits [b-proteobacteria]  hypothetical protein Bcen_1621 [Burkholderia cenocepacia AU
. . . . Burkholderia cenocepacia HI2424 ...............................   62 2 hits [b-proteobacteria]  hypothetical protein Bcen_1621 [Burkholderia cenocepacia AU
. . . . Burkholderia cenocepacia MC0-3 ................................   62 2 hits [b-proteobacteria]  hypothetical protein Bcen_1621 [Burkholderia cenocepacia AU
. . . . Burkholderia cenocepacia PC184 ................................   62 2 hits [b-proteobacteria]  hypothetical protein Bcen_1621 [Burkholderia cenocepacia AU
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ....................   62 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Acidovorax avenae subs
. . . . Burkholderia ubonensis Bu .....................................   62 1 hit  [b-proteobacteria]  hypothetical protein BuboB_11667 [Burkholderia ubonensis Bu]
. . . . Cupriavidus metallidurans CH34 ................................   62 2 hits [b-proteobacteria]  hypothetical protein Rmet_0943 [Cupriavidus metallidurans C
. . . . Burkholderia pseudomallei 668 .................................   62 2 hits [b-proteobacteria]  hypothetical protein BURPS668_1306 [Burkholderia pseudomall
. . . . Azoarcus sp. BH72 .............................................   62 2 hits [b-proteobacteria]  hypothetical protein azo1652 [Azoarcus sp. BH72] >gi|119670
. . . . Ralstonia eutropha JMP134 .....................................   62 2 hits [b-proteobacteria]  hypothetical protein Reut_A0977 [Ralstonia eutropha JMP134]
. . . . Verminephrobacter eiseniae EF01-2 .............................   62 2 hits [b-proteobacteria]  hypothetical protein Veis_4072 [Verminephrobacter eiseniae 
. . . . Herminiimonas arsenicoxydans ..................................   62 2 hits [b-proteobacteria]  hypothetical protein HEAR1958 [Herminiimonas arsenicoxydans
. . . . Ralstonia eutropha H16 ........................................   61 2 hits [b-proteobacteria]  hypothetical protein H16_A1066 [Ralstonia eutropha H16] >gi
. . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ......   61 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Candidatus Accumulibac
. . . . Burkholderia vietnamiensis G4 .................................   61 2 hits [b-proteobacteria]  hypothetical protein Bcep1808_2318 [Burkholderia vietnamien
. . . . Comamonas testosteroni KF-1 ...................................   61 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Comamonas testosteroni
. . . . Burkholderia xenovorans LB400 .................................   60 2 hits [b-proteobacteria]  hypothetical protein Bxe_A3193 [Burkholderia xenovorans LB4
. . . . Burkholderia sp. CCGE1001 .....................................   60 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia sp. CCGE1
. . . . Desulfatibacillum alkenivorans AK-01 ..........................   58 2 hits [d-proteobacteria]  protein of unknown function DUF1178 [Desulfatibacillum alke
. . . . Burkholderia phymatum STM815 ..................................   58 2 hits [b-proteobacteria]  hypothetical protein Bphy_1993 [Burkholderia phymatum STM81
. . . . Leptothrix cholodnii SP-6 .....................................   57 2 hits [b-proteobacteria]  hypothetical protein Lcho_1516 [Leptothrix cholodnii SP-6] 
. . . . Thauera sp. MZ1T ..............................................   57 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Thauera sp. MZ1T] >gi|
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .   56 2 hits [b-proteobacteria]  hypothetical protein Pnuc_1036 [Polynucleobacter necessariu
. . . . Variovorax paradoxus S110 .....................................   56 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Variovorax paradoxus S
. . . . Limnobacter sp. MED105 ........................................   55 2 hits [b-proteobacteria]  hypothetical protein LMED105_13022 [Limnobacter sp. MED105]
. . . . Desulfobacterium autotrophicum HRM2 ...........................   55 2 hits [d-proteobacteria]  hypothetical protein HRM2_05140 [Desulfobacterium autotroph
. . . . Delftia acidovorans SPH-1 .....................................   51 2 hits [b-proteobacteria]  hypothetical protein Daci_5165 [Delftia acidovorans SPH-1] 
. . . . Burkholderia graminis C4D1M ...................................   37 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Burkholderia graminis 
. . . . Shewanella sediminis HAW-EB3 ..................................   34 2 hits [g-proteobacteria]  phage integrase [Shewanella sediminis HAW-EB3] >gi|15731975
. . . . Pseudoalteromonas haloplanktis TAC125 .........................   34 2 hits [g-proteobacteria]  electron transport complex protein RnfC [Pseudoalteromonas 
. . . . Neptuniibacter caesariensis ...................................   34 2 hits [g-proteobacteria]  electron transport complex protein RnfC [Oceanospirillum sp
. . . . Alteromonadales bacterium TW-7 ................................   33 2 hits [g-proteobacteria]  electron transport complex protein RnfC [Alteromonadales ba
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 .........   33 2 hits [b-proteobacteria]  protein of unknown function DUF1178 [Polynucleobacter neces
. . . uncultured marine bacterium 440 ---------------------------------  119 1 hit  [bacteria]          conserved hypothetical protein [uncultured marine bacterium
. . . uncultured marine bacterium 313 .................................  116 1 hit  [bacteria]          conserved hypothetical protein [uncultured marine bacterium
. . . uncultured marine bacterium HF4000_APKG3108 .....................  114 1 hit  [bacteria]          putative protein of unknown function (DUF1178) [uncultured 
. . . Bacillus sp. B14905 .............................................   36 2 hits [firmicutes]        precorrin-4 methylase [Bacillus sp. B14905] >gi|126591061|g
. . . Lysinibacillus sphaericus C3-41 .................................   36 2 hits [firmicutes]        cobalt-precorrin-4 C(11)-methyltransferase [Lysinibacillus 
. . . Lactobacillus jensenii 269-3 ....................................   36 2 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 269-3] >
. . . Lactobacillus jensenii 1153 .....................................   36 2 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 269-3] >
. . . Lactobacillus jensenii SJ-7A-US .................................   36 2 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 269-3] >
. . . Lactobacillus jensenii 208-1 ....................................   36 4 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 269-3] >
. . . Lactobacillus jensenii 27-2-CHN .................................   35 2 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 27-2-CHN
. . . Lactobacillus jensenii 115-3-CHN ................................   35 2 hits [firmicutes]        UDP-galactopyranose mutase [Lactobacillus jensenii 27-2-CHN
. . . Mycoplasma alligatoris A21JP2 ...................................   35 2 hits [mycoplasmas]       proline--tRNA ligase [Mycoplasma alligatoris A21JP2] >gi|29
. . . Bacillus cereus AH1273 ..........................................   35 2 hits [firmicutes]        Molybdopterin biosynthesis MoeB protein [Bacillus cereus AH
. . . Bacillus cereus AH1272 ..........................................   35 2 hits [firmicutes]        Molybdopterin biosynthesis MoeB protein [Bacillus cereus AH
. . . Alkaliphilus metalliredigens QYMF ...............................   34 2 hits [firmicutes]        riboflavin biosynthesis protein RibF [Alkaliphilus metallir
. . . Synechococcus sp. WH 7805 .......................................   33 2 hits [cyanobacteria]     heat shock protein 90 [Synechococcus sp. WH 7805] >gi|88787
. . . Mycoplasma crocodyli MP145 ......................................   33 1 hit  [mycoplasmas]       proline--tRNA ligase [Mycoplasma crocodyli MP145]
. . . Bacillus thuringiensis IBL 4222 .................................   33 2 hits [firmicutes]        Molybdopterin biosynthesis MoeB protein [Bacillus thuringie
. . . Bacillus thuringiensis serovar sotto str. T04001 ................   33 2 hits [firmicutes]        Molybdopterin biosynthesis MoeB protein [Bacillus thuringie
. . . Bacillus cereus G9842 ...........................................   33 2 hits [firmicutes]        putative molybdopterin biosynthesis protein MoeB [Bacillus 
. . Ricinus communis --------------------------------------------------   44 2 hits [eudicots]          conserved hypothetical protein [Ricinus communis] >gi|22351
. . Sordaria macrospora ...............................................   35 1 hit  [ascomycetes]       unnamed protein product [Sordaria macrospora]
. . Trypanosoma cruzi strain CL Brener ................................   35 1 hit  [kinetoplastids]    hypothetical protein [Trypanosoma cruzi strain CL Brener] >
. . Trypanosoma cruzi .................................................   35 1 hit  [kinetoplastids]    hypothetical protein [Trypanosoma cruzi strain CL Brener] >
. . Leishmania major strain Friedlin ..................................   34 2 hits [kinetoplastids]    tryptophanyl-tRNA synthetase [Leishmania major strain Fried
. . Vitis vinifera (wine grape) .......................................   34 1 hit  [eudicots]          PREDICTED: hypothetical protein [Vitis vinifera]
. . Pyrenophora tritici-repentis Pt-1C-BFP ............................   34 2 hits [ascomycetes]       conserved hypothetical protein [Pyrenophora tritici-repenti
. . Aspergillus niger CBS 513.88 ......................................   34 1 hit  [ascomycetes]       hypothetical protein An12g00840 [Aspergillus niger] >gi|134
. . Aspergillus niger .................................................   34 1 hit  [ascomycetes]       hypothetical protein An12g00840 [Aspergillus niger] >gi|134
. . Populus trichocarpa (black cottonwood) ............................   34 2 hits [eudicots]          predicted protein [Populus trichocarpa] >gi|222845000|gb|EE
. . Nematostella vectensis ............................................   33 2 hits [sea anemones]      predicted protein [Nematostella vectensis] >gi|156221404|gb
. . Homo sapiens (man) ................................................   33 1 hit  [primates]          hCG1650657, isoform CRA_a [Homo sapiens]
. uncultured marine microorganism HF4000_005D21 -----------------------  114 1 hit  [unclassified]      putative protein of unknown function (DUF1178) [uncultured 

BLAST

PROTOCOL



a)BLASTp versus SWISSPROT, NCBI default parameters apart from "Number of descriptions_1000"

b)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS´


While analyzing the results of blastp vs. SwissProt it was obtained 12 hits, no hits with significant homologies, because the best result obtained was an E-value _ 0.98 with a score of 32.3. These values are not biologically significant because the parameters are minimum E-value <1e-4 and a score of _> 100.

In blastp vs. NR there was a total of 244 hits of which the most significant features a score of 196 and an E-value _ 1e-48. Analyzing these results, it appears likely that the ORF under study encodes a conserved hypothetical protein whose function is still unknown.



RAW RESULTS

a) BLASTp versus SWISSPROT

Sequences producing significant alignments:                       (Bits)  Value

sp|Q8RAK6.1|ALR1_THETN  RecName: Full=Alanine racemase 1           32.3    0.98 
sp|Q46628.1|AMSG_ERWAM  RecName: Full=UDP-galactose-lipid carr...  32.3    1.2  
sp|Q9FPS7.1|UBP20_ARATH  RecName: Full=Ubiquitin carboxyl-term...  32.0    1.6  
sp|Q9BY84.1|DUS16_HUMAN  RecName: Full=Dual specificity protei...  31.6    1.8  
sp|Q6C2F4.1|NOP14_YARLI  RecName: Full=Probable nucleolar comp...  30.8    2.9  
sp|P23172.1|RDRP_SCVLB  RecName: Full=RNA-directed RNA polymerase  30.4    4.2  
sp|B0VEF2.1|SUCC_ACIBY  RecName: Full=Succinyl-CoA ligase [ADP...  30.0    5.7  
sp|Q09738.1|UBP8_SCHPO  RecName: Full=Probable ubiquitin carbo...  30.0    6.0  
sp|Q9K993.1|XYLA_BACHD  RecName: Full=Xylose isomerase             29.6    7.1  
sp|Q9WXZ5.3|GLMS_THEMA  RecName: Full=Glucosamine--fructose-6-...  29.6    7.2  
sp|B0VSL0.1|SUCC_ACIBS  RecName: Full=Succinyl-CoA ligase [ADP...  29.6    7.5  
sp|Q7NYR7.1|SYM_CHRVO  RecName: Full=Methionyl-tRNA synthetase...  29.6    7.7  

ALIGNMENTS
>sp|Q8RAK6.1|ALR1_THETN RecName: Full=Alanine racemase 1
Length=388

 Score = 32.3 bits (72),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query  73   FNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVG--ENFAYEARSIHYGKKSKNKGI--  128
            F+  +  + ++ L+ IT   +E +K +  N K +   +  AY   + +  K  + +G+  
Sbjct  3    FDGVRPTRVEVYLDAITHNFREIKKIVGKNVKIMAVIKGDAYGHGASYVAKFLEKEGVDY  62

Query  129  YGTASKKEIVELKEEGINTEII  150
            +G A+ +E +EL+E+GI T I+
Sbjct  63   FGVATTEEALELREKGIKTPIL  84


>sp|Q46628.1|AMSG_ERWAM RecName: Full=UDP-galactose-lipid carrier transferase
Length=477

 Score = 32.3 bits (72),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 10/109 (9%)

Query  32   DSWFASSKEYEKLKKRSL----LSCHNCNSKKIEKSLMAPQLISTFNTDKFVKKDLKLNE  87
            D+ F  + EYE+ + R      L+ HNC S  +  SL    L  T     F  + + L  
Sbjct  209  DTQFIVAVEYEQSQSRDRWLKNLATHNCRSVSVIPSLRGVPLYGTDMAYIFSHEVMILRV  268

Query  88   ITKKIKEYQKFIKTNFKYVGE----NFAYEARSIHYGKKSKNKG--IYG  130
                 K   +F+K  F  VG          A  I   + S++ G  IYG
Sbjct  269  SNNLAKHSSRFLKRTFDLVGALSIITLLLPALVILIFRVSRDGGAPIYG  317


>sp|Q9FPS7.1|UBP20_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 20; AltName: 
Full=Ubiquitin thioesterase 20; AltName: Full=Ubiquitin-specific-processing 
protease 20; AltName: Full=Deubiquitinating 
enzyme 20; Short=AtUBP20
Length=695

 Score = 32.0 bits (71),  Expect = 1.6, Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 20/108 (18%)

Query  30   SFDSWFASSKEYEKLKKRSLLSCHNCNSK-KIEKSLMAPQL--ISTFNTDKFVKKDLKLN  86
            +  S   S    EKL ++  L+C NCN K   EK L+  +L  ++TF+  +F    L + 
Sbjct  331  TLGSALESFTRVEKLDEQ--LTCDNCNEKVSKEKQLLLDKLPLVATFHLKRFKNNGLYME  388

Query  87   EITKKIK--------EYQKFIKTN---FKY----VGENFAYEARSIHY  119
            +I K +K         Y + I+ N    KY    + E+F Y     HY
Sbjct  389  KIYKHVKIPLEIDLQPYMRNIQENEVSTKYHLYALVEHFGYSVAYGHY  436


>sp|Q9BY84.1|DUS16_HUMAN RecName: Full=Dual specificity protein phosphatase 16; AltName: 
Full=Mitogen-activated protein kinase phosphatase 7; Short=MAP 
kinase phosphatase 7; Short=MKP-7
Length=665

 Score = 31.6 bits (70),  Expect = 1.8, Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query  80   KKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNK-GIYGTASKKEIV  138
            + D+ L+E  + +KE +  I  NF ++G+   YE       KK KN+ G  G  SK +++
Sbjct  262  RMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYE-------KKIKNQTGASGPKSKLKLL  314

Query  139  ELKE  142
             L++
Sbjct  315  HLEK  318


>sp|Q6C2F4.1|NOP14_YARLI RecName: Full=Probable nucleolar complex protein 14
Length=832

 Score = 30.8 bits (68),  Expect = 2.9, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query  43   KLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTDK-FVKKDLKLNEITKKIKEYQKFIKT  101
            KL  R  L+ H    + +    MAP+    FN DK     D+ L E  K   E +K  K+
Sbjct  715  KLADRKPLTLHK--HRPLAIKTMAPKFEENFNVDKKSYNPDMALQETQKLRAELKKEKKS  772

Query  102  NFKYVGENFAYEAR  115
              + + ++ A+EAR
Sbjct  773  ALREIRKDAAFEAR  786


>sp|P23172.1|RDRP_SCVLB RecName: Full=RNA-directed RNA polymerase
Length=242

 Score = 30.4 bits (67),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 1/66 (1%)

Query  50   LSCHNCNSKKIEKSLMAPQLISTFNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGEN  109
            +SC     K    S M  Q +   N D + K  +    I K + +Y  F+KTNF  + + 
Sbjct  95   ISCGGLQEKG-RVSEMVLQEVDIENIDSYRKTRMIAKLIDKGVGDYTAFLKTNFSEIADA  153

Query  110  FAYEAR  115
               E R
Sbjct  154  ITRETR  159


>sp|B0VEF2.1|SUCC_ACIBY RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
 sp|B7GXK7.1|SUCC_ACIB3 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
 sp|B7I6T2.1|SUCC_ACIB5 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
 sp|B2HXG0.1|SUCC_ACIBC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
 sp|A3M887.2|SUCC_ACIBT RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
Length=388

 Score = 30.0 bits (66),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  103  FKYVGENFAYEARSIHYGKKSKNKGIYGTASKKEIVELKEEGINTEIIPWIED  155
            F+ +G  FA     +H G + K  G+    SK++++E     I T ++ +  D
Sbjct  35   FEQLGGKFAVMKAQVHAGGRGKAGGVKVAKSKEDVIEFANNIIGTRLVTYQTD  87


>sp|Q09738.1|UBP8_SCHPO RecName: Full=Probable ubiquitin carboxyl-terminal hydrolase 
8; AltName: Full=Ubiquitin thioesterase 8; AltName: Full=Ubiquitin-specific-processing 
protease 8; AltName: Full=Deubiquitinating 
enzyme 8
Length=449

 Score = 30.0 bits (66),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query  51   SCHNCNSKKIEKSLMAPQLIST--FNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGE  108
            SCH+C SK   K L+  +L  T      +F + +  ++    K   Y  F++  + +  +
Sbjct  316  SCHSCGSKNAIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQD  375

Query  109  NFAYEARSIHYGKKSKNKGIY  129
            +  Y+  S+   K + + G Y
Sbjct  376  DVDYQLYSVVCHKGTLDTGHY  396


>sp|Q9K993.1|XYLA_BACHD RecName: Full=Xylose isomerase
Length=440

 Score = 29.6 bits (65),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 0/51 (0%)

Query  85   LNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
            L+EI   IK+Y K  KT   +   N     R IH    S N  +Y  A+ K
Sbjct  117  LDEIVLMIKDYMKTSKTKLLWNTANMFTHPRWIHGAATSPNADVYAYAAAK  167


>sp|Q9WXZ5.3|GLMS_THEMA RecName: Full=Glucosamine--fructose-6-phosphate aminotransferase 
[isomerizing]; AltName: Full=Hexosephosphate aminotransferase; 
AltName: Full=D-fructose-6-phosphate amidotransferase; 
AltName: Full=GFAT; AltName: Full=L-glutamine-D-fructose-6-phosphate 
amidotransferase; AltName: Full=Glucosamine-6-phosphate 
synthase
Length=606

 Score = 29.6 bits (65),  Expect = 7.2, Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 10/53 (18%)

Query  60   IEKSLMAPQLISTFNTDKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAY  112
            ++K +  P+L+     +  ++KD ++ E+++K K+Y+     NF Y+G  + Y
Sbjct  432  LDKLVRMPELL-----ENVLRKDPQIRELSEKYKDYR-----NFMYIGRGYGY  474


>sp|B0VSL0.1|SUCC_ACIBS RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit beta; 
AltName: Full=Succinyl-CoA synthetase subunit beta; Short=SCS-beta
Length=388

 Score = 29.6 bits (65),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  103  FKYVGENFAYEARSIHYGKKSKNKGIYGTASKKEIVELKEEGINTEIIPWIED  155
            F+ +G  FA     +H G + K  G+    SK++++E     I T ++ +  D
Sbjct  35   FEQLGGKFAVMKAQVHAGGRGKAGGVKVAKSKEDVIEFANNIIRTRLVTYQTD  87


>sp|Q7NYR7.1|SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase; AltName: Full=Methionine--tRNA 
ligase; Short=MetRS
Length=689

 Score = 29.6 bits (65),  Expect = 7.7, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 0/26 (0%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYE  42
            M  +K  C+  NL+FD WFA   + E
Sbjct  273  MASFKNLCERLNLNFDEWFAKDSQTE  298

-------------------------------------------------------------------------------------------------------------------------
b)BLASTp versus NR
 


                                                               

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05069718.1|  conserved hypothetical protein [Candidatus...   196    1e-48
ref|ZP_01264315.1|  hypothetical protein PU1002_03756 [Candida...   164    2e-39
ref|YP_265939.1|  hypothetical protein SAR11_0514 [Candidatus ...   150    3e-35
ref|ZP_06055405.1|  conserved hypothetical protein [alpha prot...   119    1e-25
gb|AAR37685.1|  conserved hypothetical protein [uncultured mar...   119    2e-25
gb|AAR37558.1|  conserved hypothetical protein [uncultured mar...   116    7e-25
gb|ABZ06025.1|  putative protein of unknown function (DUF1178)...   114    3e-24
ref|YP_002287107.1|  hypothetical protein OCAR_4091 [Oligotrop...   108    1e-22
ref|ZP_06121143.1|  protein of unknown function DUF1178 [Caulo...   108    2e-22
ref|YP_001682571.1|  hypothetical protein Caul_0942 [Caulobact...   104    3e-21
ref|ZP_05032969.1|  conserved hypothetical protein [Brevundimo...   103    4e-21
ref|YP_001243350.1|  hypothetical protein BBta_7597 [Bradyrhiz...   102    1e-20
ref|YP_002129614.1|  hypothetical protein PHZ_c0771 [Phenyloba...   102    2e-20
ref|YP_675540.1|  hypothetical protein Meso_3003 [Mesorhizobiu...   101    2e-20
ref|YP_001202759.1|  hypothetical protein BRADO0580 [Bradyrhiz...   101    3e-20
ref|ZP_06170292.1|  protein of unknown function DUF1178 [Brevu...   100    4e-20
ref|NP_419644.1|  hypothetical protein CC_0827 [Caulobacter cr...   100    6e-20
ref|NP_766852.1|  hypothetical protein blr0212 [Bradyrhizobium...  99.4    1e-19
ref|ZP_05162349.1|  hypothetical protein Bsuib55_06666 [Brucel...  99.4    1e-19
ref|NP_386722.1|  hypothetical protein SMc02441 [Sinorhizobium...  99.0    2e-19
ref|YP_001593679.1|  hypothetical protein BCAN_A1918 [Brucella...  99.0    2e-19
ref|ZP_04681281.1|  Hypothetical protein, conserved [Ochrobact...  98.6    2e-19
ref|NP_698854.1|  hypothetical protein BR1874 [Brucella suis 1...  98.6    2e-19
ref|YP_001259702.1|  hypothetical protein BOV_1805 [Brucella o...  98.6    2e-19
ref|YP_001752756.1|  hypothetical protein Mrad2831_0046 [Methy...  98.2    2e-19
ref|YP_222527.1|  hypothetical protein BruAb1_1853 [Brucella a...  97.8    3e-19
ref|YP_415220.1|  hypothetical protein BAB1_1877 [Brucella mel...  97.8    3e-19
ref|NP_357101.1|  hypothetical protein Atu3509 [Agrobacterium ...  97.4    4e-19
ref|ZP_02187902.1|  phosphopentomutase [alpha proteobacterium ...  97.4    4e-19
ref|YP_002550876.1|  hypothetical protein Avi_3967 [Agrobacter...  97.1    6e-19
ref|NP_539104.1|  putative cytoplasmic protein [Brucella melit...  97.1    6e-19
ref|ZP_04771384.1|  protein of unknown function DUF1178 [Astic...  97.1    6e-19
ref|YP_002827165.1|  hypothetical protein NGR_c26620 [Rhizobiu...  96.7    7e-19
ref|YP_761843.1|  hypothetical protein HNE_3168 [Hyphomonas ne...  96.7    8e-19
ref|ZP_05450041.1|  hypothetical protein Bneo5_05817 [Brucella...  95.5    1e-18
ref|YP_002298842.1|  hypothetical protein RC1_2655 [Rhodospiri...  95.5    2e-18
ref|YP_001628304.1|  hypothetical protein BSUIS_A1715 [Brucell...  95.5    2e-18
ref|YP_769861.1|  hypothetical protein RL4287 [Rhizobium legum...  95.1    2e-18
ref|ZP_00953210.1|  hypothetical protein OA2633_06814 [Oceanic...  95.1    2e-18
ref|YP_168256.1|  hypothetical protein SPO3052 [Ruegeria pomer...  95.1    2e-18
ref|YP_001369581.1|  hypothetical protein Oant_1031 [Ochrobact...  95.1    2e-18
ref|ZP_05813330.1|  protein of unknown function DUF1178 [Mesor...  95.1    2e-18
ref|YP_575827.1|  hypothetical protein Nham_0477 [Nitrobacter ...  94.7    2e-18
ref|YP_001771973.1|  hypothetical protein M446_5214 [Methyloba...  94.7    3e-18
ref|YP_757491.1|  hypothetical protein Mmar10_2261 [Maricaulis...  94.4    4e-18
ref|ZP_00055460.1|  COG5319: Uncharacterized protein conserved...  94.0    5e-18
ref|YP_001328172.1|  hypothetical protein Smed_2507 [Sinorhizo...  93.6    6e-18
ref|ZP_01904735.1|  hypothetical protein RAZWK3B_07939 [Roseob...  93.6    7e-18
ref|NP_945953.1|  hypothetical protein RPA0600 [Rhodopseudomon...  92.8    9e-18
ref|YP_002977602.1|  protein of unknown function DUF1178 [Rhiz...  92.8    1e-17
ref|YP_001413015.1|  hypothetical protein Plav_1739 [Parvibacu...  92.8    1e-17
emb|CAM77015.1|  protein containing DUF1178 [Magnetospirillum ...  92.4    1e-17
ref|YP_003059192.1|  protein of unknown function DUF1178 [Hirs...  92.4    1e-17
ref|YP_002501085.1|  protein of unknown function DUF1178 [Meth...  92.4    1e-17
ref|YP_001527214.1|  hypothetical protein AZC_4298 [Azorhizobi...  92.4    2e-17
ref|YP_002283022.1|  protein of unknown function DUF1178 [Rhiz...  92.0    2e-17
ref|ZP_01018432.1|  hypothetical protein PB2503_12889 [Parvula...  92.0    2e-17
ref|YP_511213.1|  hypothetical protein Jann_3271 [Jannaschia s...  92.0    2e-17
ref|YP_002545845.1|  hypothetical protein Arad_4135 [Agrobacte...  92.0    2e-17
ref|YP_682437.1|  hypothetical protein RD1_2156 [Roseobacter d...  91.7    2e-17
ref|YP_420972.1|  hypothetical protein amb1609 [Magnetospirill...  91.7    2e-17
ref|ZP_02166966.1|  hypothetical protein HPDFL43_16666 [Hoefle...  91.7    2e-17
ref|YP_779096.1|  hypothetical protein RPE_0155 [Rhodopseudomo...  91.7    3e-17
ref|YP_317001.1|  hypothetical protein Nwi_0382 [Nitrobacter w...  91.3    3e-17
ref|ZP_01044797.1|  hypothetical protein NB311A_04684 [Nitroba...  90.9    4e-17
ref|YP_567245.1|  hypothetical protein RPD_0104 [Rhodopseudomo...  90.5    5e-17
ref|ZP_06356891.1|  protein of unknown function DUF1178 [Rhodo...  90.5    5e-17
ref|YP_471236.1|  hypothetical protein RHE_CH03760 [Rhizobium ...  90.5    5e-17
ref|YP_001980137.1|  hypothetical protein RHECIAT_CH0004028 [R...  90.1    6e-17
ref|ZP_01228106.1|  conserved hypothetical protein [Aurantimon...  89.7    8e-17
ref|YP_483646.1|  hypothetical protein RPB_0023 [Rhodopseudomo...  89.7    9e-17
ref|ZP_01444221.1|  hypothetical protein R2601_17928 [Roseovar...  89.7    1e-16
ref|ZP_01011692.1|  hypothetical protein RB2654_20488 [Rhodoba...  89.4    1e-16
ref|YP_530411.1|  hypothetical protein RPC_0517 [Rhodopseudomo...  89.4    1e-16
ref|ZP_05114972.1|  conserved hypothetical protein [Labrenzia ...  89.0    1e-16
ref|YP_001168081.1|  hypothetical protein Rsph17025_1885 [Rhod...  89.0    1e-16
ref|ZP_00999882.1|  hypothetical protein OB2597_15950 [Oceanic...  88.6    2e-16
ref|ZP_01157724.1|  hypothetical protein OG2516_15794 [Oceanic...  88.6    2e-16
ref|ZP_05123019.1|  conserved hypothetical protein [Rhodobacte...  88.2    3e-16
ref|ZP_00958434.1|  hypothetical protein ISM_01365 [Roseovariu...  87.8    3e-16
ref|YP_001234624.1|  hypothetical protein Acry_1497 [Acidiphil...  87.8    3e-16
ref|ZP_01038312.1|  hypothetical protein ROS217_23875 [Roseova...  87.4    5e-16
ref|ZP_01862912.1|  hypothetical protein ED21_27788 [Erythroba...  87.4    5e-16
ref|ZP_01545934.1|  hypothetical protein SIAM614_24627 [Stappi...  87.4    5e-16
ref|YP_001926162.1|  protein of unknown function DUF1178 [Meth...  87.4    5e-16
ref|YP_003069550.1|  hypothetical protein METDI4071 [Methyloba...  87.0    6e-16
ref|ZP_05089948.1|  conserved hypothetical protein [Ruegeria s...  87.0    6e-16
ref|YP_002422351.1|  protein of unknown function DUF1178 [Meth...  87.0    6e-16
ref|YP_002964505.1|  hypothetical protein MexAM1_META1p3491 [M...  86.7    7e-16
ref|YP_001042934.1|  hypothetical protein Rsph17029_1051 [Rhod...  86.3    1e-15
ref|YP_001640737.1|  hypothetical protein Mext_3279 [Methyloba...  85.9    1e-15
ref|ZP_02141017.1|  hypothetical protein RLO149_18023 [Roseoba...  85.5    1e-15
ref|YP_003187651.1|  hypothetical protein APA01_11230 [Acetoba...  85.5    2e-15
ref|YP_001533395.1|  conserved hypothetical protein DUF1178 [D...  85.1    2e-15
ref|ZP_02153238.1|  hypothetical protein OIHEL45_09843 [Oceani...  85.1    2e-15
ref|ZP_01879235.1|  hypothetical protein RTM1035_13083 [Roseov...  85.1    2e-15
ref|YP_916353.1|  hypothetical protein Pden_2570 [Paracoccus d...  84.7    3e-15
ref|ZP_01753028.1|  hypothetical protein RSK20926_12699 [Roseo...  84.0    5e-15
ref|YP_614310.1|  hypothetical protein TM1040_2316 [Ruegeria s...  83.6    6e-15
ref|YP_001417974.1|  hypothetical protein Xaut_3087 [Xanthobac...  83.6    7e-15
ref|ZP_01749275.1|  hypothetical protein RCCS2_05214 [Roseobac...  83.2    7e-15
ref|ZP_05740782.1|  conserved hypothetical protein [Silicibact...  83.2    8e-15
ref|YP_352450.1|  hypothetical protein RSP_2387 [Rhodobacter s...  82.8    1e-14
ref|YP_744419.1|  putative cytoplasmic protein [Granulibacter ...  82.8    1e-14
ref|YP_497284.1|  hypothetical protein Saro_2011 [Novosphingob...  82.0    2e-14
ref|ZP_05076545.1|  conserved hypothetical protein [Rhodobacte...  82.0    2e-14
ref|YP_002525064.1|  hypothetical protein RSKD131_0703 [Rhodob...  81.6    2e-14
ref|YP_001602150.1|  hypothetical protein GDI_1905 [Gluconacet...  81.6    2e-14
ref|ZP_01056538.1|  hypothetical protein MED193_08868 [Roseoba...  81.6    3e-14
ref|ZP_05340990.1|  conserved hypothetical protein [Thalassiob...  81.6    3e-14
ref|ZP_05843480.1|  protein of unknown function DUF1178 [Rhodo...  81.3    3e-14
ref|YP_001261062.1|  hypothetical protein Swit_0556 [Sphingomo...  80.9    4e-14
ref|ZP_05785021.1|  conserved hypothetical protein [Silicibact...  80.5    5e-14
ref|ZP_01744957.1|  hypothetical protein SSE37_23124 [Sagittul...  79.7    9e-14
ref|ZP_01303497.1|  hypothetical protein SKA58_12742 [Sphingom...  79.3    1e-13
ref|ZP_01741776.1|  hypothetical protein RB2150_06998 [Rhodoba...  79.3    1e-13
dbj|BAI97477.1|  conserved hypothetical protein [Sphingobium j...  79.0    1e-13
ref|ZP_00953686.1|  hypothetical protein EE36_03308 [Sulfitoba...  77.8    3e-13
ref|ZP_05099475.1|  conserved hypothetical protein [Roseobacte...  77.4    4e-13
ref|ZP_01039776.1|  hypothetical protein NAP1_05705 [Erythroba...  77.4    5e-13
ref|ZP_00948231.1|  hypothetical protein NAS141_08236 [Sulfito...  77.0    5e-13
ref|ZP_05067376.1|  conserved hypothetical protein [Octadecaba...  77.0    6e-13
gb|ADE40168.1|  Protein of unknown function DUF1178 [alpha pro...  75.9    1e-12
ref|YP_787033.1|  hypothetical protein BAV2523 [Bordetella avi...  75.9    1e-12
ref|YP_003447333.1|  hypothetical protein AZL_001510 [Azospiri...  75.1    2e-12
ref|ZP_02149570.1|  hypothetical protein RG210_03188 [Phaeobac...  75.1    2e-12
ref|YP_616834.1|  hypothetical protein Sala_1789 [Sphingopyxis...  75.1    2e-12
ref|ZP_05782306.1|  conserved hypothetical protein [Citreicell...  75.1    2e-12
ref|ZP_02145816.1|  hypothetical protein RGBS107_10271 [Phaeob...  74.3    4e-12
ref|YP_002981828.1|  protein of unknown function DUF1178 [Rals...  73.2    9e-12
ref|ZP_05376277.1|  protein of unknown function DUF1178 [Hypho...  72.8    1e-11
ref|YP_001353068.1|  hypothetical protein mma_1378 [Janthinoba...  72.8    1e-11
ref|NP_888381.1|  hypothetical protein BB1836 [Bordetella bron...  72.0    2e-11
gb|EFF74226.1|  conserved hypothetical protein [Achromobacter ...  71.6    2e-11
ref|ZP_05078309.1|  conserved hypothetical protein [Rhodobacte...  71.6    3e-11
ref|NP_884622.1|  hypothetical protein BPP2386 [Bordetella par...  71.2    3e-11
ref|YP_458177.1|  hypothetical protein ELI_06440 [Erythrobacte...  70.9    4e-11
ref|YP_002253465.1|  protein of unknown function duf1178 [Rals...  70.9    4e-11
ref|YP_425831.1|  hypothetical protein Rru_A0740 [Rhodospirill...  70.9    4e-11
ref|YP_001899764.1|  protein of unknown function DUF1178 [Rals...  70.9    4e-11
ref|ZP_00943366.1|  Hypothetical Protein RRSL_03906 [Ralstonia...  70.5    6e-11
ref|YP_460329.1|  putative cytoplasmic protein [Syntrophus aci...  69.7    9e-11
ref|ZP_01003963.1|  hypothetical protein SKA53_08331 [Loktanel...  69.3    1e-10
ref|YP_003277119.1|  hypothetical protein CtCNB1_1077 [Comamon...  68.9    2e-10
ref|YP_002552365.1|  protein of unknown function DUF1178 [Acid...  68.2    3e-10
ref|YP_001631979.1|  hypothetical protein Bpet3369 [Bordetella...  68.2    3e-10
ref|YP_002363935.1|  protein of unknown function DUF1178 [Meth...  68.2    3e-10
ref|NP_880676.1|  hypothetical protein BP2006 [Bordetella pert...  67.8    3e-10
ref|YP_001020616.1|  hypothetical protein Mpe_A1419 [Methylibi...  67.4    5e-10
ref|ZP_06464625.1|  protein of unknown function DUF1178 [Burkh...  67.0    5e-10
ref|YP_969643.1|  hypothetical protein Aave_1278 [Acidovorax a...  67.0    6e-10
ref|YP_550052.1|  hypothetical protein Bpro_3240 [Polaromonas ...  67.0    6e-10
ref|ZP_02462949.1|  hypothetical protein Bpse38_06207 [Burkhol...  67.0    7e-10
ref|YP_001579232.1|  hypothetical protein Bmul_1044 [Burkholde...  66.2    1e-09
ref|YP_002005082.1|  conserved hypothetical protein, DUF1178 [...  66.2    1e-09
ref|YP_985288.1|  hypothetical protein Ajs_0972 [Acidovorax sp...  66.2    1e-09
ref|ZP_04761360.1|  protein of unknown function DUF1178 [Acido...  65.9    1e-09
ref|YP_981675.1|  hypothetical protein Pnap_1440 [Polaromonas ...  65.9    2e-09
emb|CBA33382.1|  hypothetical protein [Curvibacter putative sy...  65.5    2e-09
ref|ZP_02355110.1|  hypothetical protein BoklE_06477 [Burkhold...  65.5    2e-09
ref|YP_002912358.1|  hypothetical protein bglu_1g25780 [Burkho...  65.5    2e-09
ref|YP_522772.1|  hypothetical protein Rfer_1508 [Rhodoferax f...  65.1    2e-09
ref|ZP_04945196.1|  hypothetical protein BDAG_01080 [Burkholde...  64.7    3e-09
ref|ZP_02905540.1|  protein of unknown function DUF1178 [Burkh...  64.7    3e-09
ref|YP_441630.1|  hypothetical protein BTH_I1077 [Burkholderia...  64.7    3e-09
ref|YP_285255.1|  hypothetical protein Daro_2040 [Dechloromona...  64.3    4e-09
ref|NP_520167.1|  hypothetical protein RSc2046 [Ralstonia sola...  64.3    4e-09
ref|YP_369799.1|  hypothetical protein Bcep18194_A5561 [Burkho...  63.9    5e-09
ref|YP_001808845.1|  hypothetical protein BamMC406_2150 [Burkh...  63.9    5e-09
ref|YP_107849.1|  hypothetical protein BPSL1227 [Burkholderia ...  63.9    5e-09
ref|YP_774161.1|  hypothetical protein Bamb_2271 [Burkholderia...  63.9    6e-09
ref|ZP_03267317.1|  protein of unknown function DUF1178 [Burkh...  63.9    6e-09
ref|ZP_05085687.1|  conserved hypothetical protein [Pseudovibr...  63.5    7e-09
ref|YP_001895000.1|  protein of unknown function DUF1178 [Burk...  63.5    7e-09
ref|ZP_06229853.1|  protein of unknown function DUF1178 [Burkh...  63.2    8e-09
ref|YP_002231452.1|  hypothetical protein BCAL2328 [Burkholder...  63.2    9e-09
ref|YP_621499.1|  hypothetical protein Bcen_1621 [Burkholderia...  62.8    1e-08
ref|ZP_06209861.1|  protein of unknown function DUF1178 [Acido...  62.8    1e-08
ref|ZP_02378377.1|  hypothetical protein BuboB_11667 [Burkhold...  62.8    1e-08
ref|YP_583098.1|  hypothetical protein Rmet_0943 [Cupriavidus ...  62.8    1e-08
ref|YP_001058354.1|  hypothetical protein BURPS668_1306 [Burkh...  62.8    1e-08
ref|YP_933156.1|  hypothetical protein azo1652 [Azoarcus sp. B...  62.4    1e-08
ref|YP_295200.1|  hypothetical protein Reut_A0977 [Ralstonia e...  62.4    1e-08
ref|YP_998795.1|  hypothetical protein Veis_4072 [Verminephrob...  62.4    2e-08
ref|NP_104549.1|  hypothetical protein mll3449 [Mesorhizobium ...  62.0    2e-08
ref|YP_001100231.1|  hypothetical protein HEAR1958 [Herminiimo...  62.0    2e-08
ref|YP_725575.1|  hypothetical protein H16_A1066 [Ralstonia eu...  61.6    2e-08
ref|YP_003167127.1|  protein of unknown function DUF1178 [Cand...  61.6    2e-08
ref|YP_001120152.1|  hypothetical protein Bcep1808_2318 [Burkh...  61.2    3e-08
ref|ZP_03544702.1|  protein of unknown function DUF1178 [Comam...  61.2    3e-08
ref|YP_557839.1|  hypothetical protein Bxe_A3193 [Burkholderia...  60.8    5e-08
ref|ZP_06297850.1|  protein of unknown function DUF1178 [Burkh...  60.5    6e-08
ref|ZP_01437228.1|  hypothetical protein FP2506_05286 [Fulvima...  59.3    1e-07
ref|ZP_05050160.1|  conserved hypothetical protein [Octadecaba...  58.5    2e-07
ref|YP_002433478.1|  protein of unknown function DUF1178 [Desu...  58.2    3e-07
ref|YP_001858218.1|  hypothetical protein Bphy_1993 [Burkholde...  58.2    3e-07
ref|YP_001790549.1|  hypothetical protein Lcho_1516 [Leptothri...  57.8    3e-07
ref|YP_002355677.1|  protein of unknown function DUF1178 [Thau...  57.4    5e-07
ref|ZP_05169421.1|  hypothetical protein BpinM_11636 [Brucella...  57.4    5e-07
ref|YP_001834357.1|  hypothetical protein Bind_3309 [Beijerinc...  57.0    6e-07
ref|YP_001155816.1|  hypothetical protein Pnuc_1036 [Polynucle...  57.0    6e-07
ref|YP_317002.1|  hypothetical protein Nwi_0383 [Nitrobacter w...  57.0    7e-07
ref|YP_575828.1|  hypothetical protein Nham_0478 [Nitrobacter ...  56.6    8e-07
ref|YP_002945377.1|  protein of unknown function DUF1178 [Vari...  56.6    8e-07
ref|ZP_00052302.1|  COG5319: Uncharacterized protein conserved...  56.6    9e-07
ref|ZP_05954277.1|  conserved hypothetical protein [Brucella p...  56.2    1e-06
ref|ZP_01915183.1|  hypothetical protein LMED105_13022 [Limnob...  55.8    2e-06
ref|YP_002601792.1|  hypothetical protein HRM2_05140 [Desulfob...  55.8    2e-06
ref|ZP_01450539.1|  hypothetical protein OM2255_12362 [alpha p...  54.3    5e-06
ref|ZP_01044796.1|  hypothetical protein NB311A_04679 [Nitroba...  52.8    1e-05
ref|YP_001566179.1|  hypothetical protein Daci_5165 [Delftia a...  52.0    2e-05
ref|XP_002537645.1|  conserved hypothetical protein [Ricinus c...  44.7    0.004
ref|YP_003453058.1|  hypothetical protein AZL_e01690 [Azospiri...  43.9    0.005
ref|YP_419568.1|  hypothetical protein amb0205 [Magnetospirill...  42.7    0.012
ref|ZP_00055270.1|  COG5319: Uncharacterized protein conserved...  42.7    0.012
emb|CAM74182.1|  protein containing DUF1178 [Magnetospirillum ...  40.8    0.048
ref|ZP_02887510.1|  protein of unknown function DUF1178 [Burkh...  37.4    0.47 
ref|ZP_01724335.1|  precorrin-4 methylase [Bacillus sp. B14905...  37.0    0.70 
ref|YP_001699060.1|  cobalt-precorrin-4 C(11)-methyltransferas...  37.0    0.72 
ref|ZP_04646041.1|  UDP-galactopyranose mutase [Lactobacillus ...  36.6    0.83 
emb|CBI60679.1|  unnamed protein product [Sordaria macrospora]     35.8    1.5  
ref|ZP_06337372.1|  UDP-galactopyranose mutase [Lactobacillus ...  35.4    2.0  
ref|ZP_05556405.1|  UDP-galactopyranose mutase [Lactobacillus ...  35.4    2.0  
ref|ZP_06610300.1|  proline--tRNA ligase [Mycoplasma alligator...  35.4    2.0  
ref|XP_812597.1|  hypothetical protein [Trypanosoma cruzi stra...  35.4    2.1  
ref|YP_428637.1|  hypothetical protein Rru_A3556 [Rhodospirill...  35.4    2.2  
ref|ZP_04177649.1|  Molybdopterin biosynthesis MoeB protein [B...  35.0    2.9  
ref|YP_001475981.1|  phage integrase [Shewanella sediminis HAW...  34.7    3.5  
ref|XP_847665.1|  tryptophanyl-tRNA synthetase [Leishmania maj...  34.3    4.0  
ref|XP_002278432.1|  PREDICTED: hypothetical protein [Vitis vi...  34.3    4.1  
ref|XP_001933697.1|  conserved hypothetical protein [Pyrenopho...  34.3    4.1  
ref|XP_001395173.1|  hypothetical protein An12g00840 [Aspergil...  34.3    4.1  
ref|YP_339621.1|  electron transport complex protein RnfC [Pse...  34.3    4.3  
ref|YP_001320480.1|  riboflavin biosynthesis protein RibF [Alk...  34.3    4.3  
ref|XP_002297742.1|  predicted protein [Populus trichocarpa] >...  34.3    4.6  
ref|ZP_01165658.1|  electron transport complex protein RnfC [O...  34.3    5.0  
ref|ZP_01124090.1|  heat shock protein 90 [Synechococcus sp. W...  33.9    6.0  
ref|XP_001634322.1|  predicted protein [Nematostella vectensis...  33.9    6.1  
gb|ADE19576.1|  proline--tRNA ligase [Mycoplasma crocodyli MP145]  33.9    6.5  
ref|ZP_01614852.1|  electron transport complex protein RnfC [A...  33.5    7.9  
ref|YP_001797654.1|  protein of unknown function DUF1178 [Poly...  33.1    8.8  
gb|EAW73600.1|  hCG1650657, isoform CRA_a [Homo sapiens]           33.1    9.2  
ref|ZP_04064980.1|  Molybdopterin biosynthesis MoeB protein [B...  33.1    10.0 
ref|YP_002445547.1|  putative molybdopterin biosynthesis prote...  33.1    10.0 

ALIGNMENTS
>ref|ZP_05069718.1| conserved hypothetical protein [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ60717.1| conserved hypothetical protein [Candidatus Pelagibacter sp. HTCC7211]
Length=142

 Score =  196 bits (497),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKYKL C  C ++FDSWFASSKE+EKLK++ LL+CHNCNS KI+KSLMAP+LI+   + 
Sbjct  1    MIKYKLICNDCEITFDSWFASSKEFEKLKRKKLLNCHNCNSLKIDKSLMAPKLINKNKSQ  60

Query  77   KFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKKE  136
            K   +  K   I K IK+YQKFIK NFKYVGENFAYEARSIHY KK  +KGIYG+ASKK+
Sbjct  61   KNNSEFTKFQNIKKTIKDYQKFIKDNFKYVGENFAYEARSIHYEKKKNSKGIYGSASKKD  120

Query  137  IVELKEEGINTEIIPWIEDKKN  158
            ++EL+EEGI T++IPW+EDK+N
Sbjct  121  LIELQEEGIETQMIPWVEDKEN  142


>ref|ZP_01264315.1| hypothetical protein PU1002_03756 [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|EAS84802.1| hypothetical protein PU1002_03756 [Candidatus Pelagibacter ubique 
HTCC1002]
Length=143

 Score =  164 bits (416),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 103/143 (72%), Gaps = 1/143 (0%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQL-ISTFNT  75
            MIKYKL CK C  +FDSWF+SSKEYEKLK++  L+CH CNS  + K LM+P +  S  N 
Sbjct  1    MIKYKLICKDCETTFDSWFSSSKEYEKLKQKKFLNCHFCNSLNVGKDLMSPNVSTSKNNL  60

Query  76   DKFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
                    K  EI K I +YQ+FIK NF+YVGENFAYEARS+HY  K K KGIYGTA+KK
Sbjct  61   TDIDSSSEKYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSLHYKDKKKAKGIYGTATKK  120

Query  136  EIVELKEEGINTEIIPWIEDKKN  158
            ++ ELKEEGI  EI+PWI++  N
Sbjct  121  DLNELKEEGIKAEILPWIKNTTN  143


>ref|YP_265939.1| hypothetical protein SAR11_0514 [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|AAZ21336.1| hypothetical protein SAR11_0514 [Candidatus Pelagibacter ubique 
HTCC1062]
Length=143

 Score =  150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/147 (59%), Positives = 107/147 (72%), Gaps = 9/147 (6%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKYKL CK C  +FDSWF+SSKEYEKLKK+  L+CH CNS  + K LM+P +    +T 
Sbjct  1    MIKYKLICKDCETTFDSWFSSSKEYEKLKKKKFLNCHFCNSLNVGKGLMSPNV----STS  56

Query  77   KFVKKDL-----KLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGT  131
            K +  D+     K  EI K I +YQ+FIK NF+YVGENFAYEARS+HY  K K KGIYGT
Sbjct  57   KNILTDIDSSSEKYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSLHYKDKKKAKGIYGT  116

Query  132  ASKKEIVELKEEGINTEIIPWIEDKKN  158
            A+KK++ ELKEEGI  EI+PWI+D  N
Sbjct  117  ATKKDLNELKEEGIKAEILPWIKDTTN  143


>ref|ZP_06055405.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gb|EEY75174.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
Length=140

 Score =  119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 92/142 (64%), Gaps = 2/142 (1%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKY L C+ C + F+SWF+SSKEY++L+K+ +LSC    S  I K LMAPQ+ S     
Sbjct  1    MIKYHLKCE-CGVEFESWFSSSKEYDRLEKKKMLSCQCGKSNNISKQLMAPQIASKKVDT  59

Query  77   KFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKKE  136
            K  K++     + KK+++ + +++ N +YVG+NF  EARSIHY KK+  + IYG A+ ++
Sbjct  60   KKNKQEEFYKTVNKKLRDLRDYVEKNAEYVGDNFVSEARSIHYDKKNV-RSIYGKATPEQ  118

Query  137  IVELKEEGINTEIIPWIEDKKN  158
              EL +EGI    +PWI+   N
Sbjct  119  TEELLDEGIEVNTVPWIDKANN  140


>gb|AAR37685.1| conserved hypothetical protein [uncultured marine bacterium 440]
Length=138

 Score =  119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (64%), Gaps = 4/142 (2%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKY LTCK C  SF+SWF SS  ++ L ++ L+ C  C S  I+KS+MAP L S  N  
Sbjct  1    MIKYNLTCK-CGESFESWFLSSSGFDYLCRKKLIKCIYCGSLSIKKSVMAPNLPSKSN--  57

Query  77   KFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKKE  136
            K  KK      I K++ +++K+I+ N K VGENF  EARSIHY KK+ ++GIYG A+ +E
Sbjct  58   KVFKKTKLEKNIKKQLLDFRKYIEKNCKDVGENFTREARSIHYDKKT-SQGIYGKATPEE  116

Query  137  IVELKEEGINTEIIPWIEDKKN  158
              EL EEGI    IPWI+  +N
Sbjct  117  TSELLEEGIEIATIPWIDKSEN  138


>gb|AAR37558.1| conserved hypothetical protein [uncultured marine bacterium 313]
Length=139

 Score =  116 bits (291),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 92/143 (64%), Gaps = 6/143 (4%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKY L C+ C  +F+SWF+SS +++  +K+ L++C  C+S  + KS+MAP L S  N  
Sbjct  2    MIKYNLICE-CGKTFESWFSSSDDHDVQRKKKLINCIYCDSTSVRKSVMAPNLFSKTNK-  59

Query  77   KFVKKDLKLN-EITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
                KD  +  +I K++ E +++I+ N K VG+NF  EARSIHY KK  +KGIYG A+ K
Sbjct  60   --TSKDTNIEKKIKKQLVELRRYIENNCKNVGDNFPSEARSIHYDKKI-SKGIYGKATPK  116

Query  136  EIVELKEEGINTEIIPWIEDKKN  158
            E  EL EEGI+   IPW    +N
Sbjct  117  ETAELLEEGIDVATIPWPNKSEN  139


>gb|ABZ06025.1| putative protein of unknown function (DUF1178) [uncultured marine 
microorganism HF4000_005D21]
 gb|ABZ10420.1| putative protein of unknown function (DUF1178) [uncultured marine 
bacterium HF4000_APKG3108]
Length=138

 Score =  114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 4/136 (2%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKY L C+ C  +F+SWF SS EY+  +++ L++C  C+S  + KS+MAP L S   T+
Sbjct  1    MIKYNLICE-CGKTFESWFLSSDEYDIQRRKKLINCIYCDSTSVRKSVMAPNLFS--KTN  57

Query  77   KFVKKDLKLNEITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKKE  136
            K  K      +I K++ E +++I+ N K VG+NF  EAR IHY KK+ +KGIYG A+ +E
Sbjct  58   KTSKNTNIEKKIKKQLLELRRYIEKNCKNVGDNFPREARRIHYDKKT-SKGIYGKATPEE  116

Query  137  IVELKEEGINTEIIPW  152
              EL EEGI+   IPW
Sbjct  117  TAELLEEGIDVATIPW  132


>ref|YP_002287107.1| hypothetical protein OCAR_4091 [Oligotropha carboxidovorans OM5]
 gb|ACI91242.1| protein of unknown function [Oligotropha carboxidovorans OM5]
Length=151

 Score =  108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 91/156 (58%), Gaps = 19/156 (12%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MI+Y L C+ C  SF+SWF SS  YE  +KR L++C  C+S K+EK++MAP+L +    D
Sbjct  1    MIRYALRCE-CGHSFESWFQSSATYESQRKRRLVTCPACDSAKVEKAIMAPRLAA---KD  56

Query  77   KFVKKDLKLN--------------EITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKK  122
            K  + ++K +              E+  K++E ++ ++ N + VG  F  EAR IHYG  
Sbjct  57   KTSEPEVKASETSTPTLMMAPQERELAAKLRELREHVEKNAENVGRKFPNEARKIHYG-D  115

Query  123  SKNKGIYGTASKKEIVELKEEGINTEIIPWIEDKKN  158
            S+++ IYG A+ +E   L EEG+    +P +  ++N
Sbjct  116  SEHRAIYGQATAEEAHSLLEEGVEVMPLPLLPGERN  151


>ref|ZP_06121143.1| protein of unknown function DUF1178 [Caulobacter segnis ATCC 
21756]
 gb|EEZ37029.1| protein of unknown function DUF1178 [Caulobacter segnis ATCC 
21756]
Length=144

 Score =  108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 78/143 (54%), Gaps = 3/143 (2%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MI+Y L C   + +F+ WF SS +Y+    R L+ C  C S  + K +MAP +  T    
Sbjct  1    MIRYALQCDQAH-AFEGWFGSSSDYDDQAARGLVECPVCGSHGVSKQIMAPAVAGTKAQR  59

Query  77   KFVKKDLKLNE-ITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
                 D K+ E +   I E ++ ++ NF YVG+ FA EAR+IH G KS+ +GIYG AS  
Sbjct  60   ATPAPDPKMREMMMAAIGEVRRHVEDNFDYVGDAFAKEARAIHEG-KSEERGIYGEASPT  118

Query  136  EIVELKEEGINTEIIPWIEDKKN  158
            E+  L E+G+    +P    KK 
Sbjct  119  EVKALVEDGVKVAPLPPGPPKKT  141


>ref|YP_001682571.1| hypothetical protein Caul_0942 [Caulobacter sp. K31]
 gb|ABZ70073.1| protein of unknown function DUF1178 [Caulobacter sp. K31]
Length=144

 Score =  104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 77/132 (58%), Gaps = 3/132 (2%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MIKY L+C   + +F+ WF SS +Y+    R L+ C  C SK + K +MAP +  T   +
Sbjct  1    MIKYALSCD-HDHAFEGWFGSSSDYDDQAARGLVDCPVCGSKAVRKQIMAPAVAGTKARN  59

Query  77   KFVKKDLKLNE-ITKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
               +   ++ E +   + E ++ ++ NF YVG+ FA EAR IH G KS+ +GIYG A+ +
Sbjct  60   AAPQPSAQMREMMMTAMGEVRRQVEANFDYVGDGFAKEARDIHDG-KSEERGIYGEATPQ  118

Query  136  EIVELKEEGINT  147
            E+  L E+GI  
Sbjct  119  EVKALVEDGIQV  130


>ref|ZP_05032969.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gb|EDX80398.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
Length=144

 Score =  103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MI+Y L C   +  F++WF SS +Y+    R L+ C  C S ++EK++MAP +      D
Sbjct  1    MIRYALKCDQTH-GFEAWFGSSSDYDDQAARGLVECPFCGSNRVEKAVMAPAVGGARQAD  59

Query  77   KFVKKDLKLNEI-TKKIKEYQKFIKTNFKYVGENFAYEARSIHYGKKSKNKGIYGTASKK  135
                  +++  +     +E +  ++ NF YVG+ FA EAR IH G+  K + IYG A+  
Sbjct  60   PASDMAVRMQTVMMAAAREVRAHVEANFDYVGDAFAREARDIHEGRSEKRE-IYGEATPA  118

Query  136  EIVELKEEGINTEIIP  151
            E+ +LKE+G+    +P
Sbjct  119  EVKKLKEDGVPVSALP  134


>ref|YP_001243350.1| hypothetical protein BBta_7597 [Bradyrhizobium sp. BTAi1]
 gb|ABQ39444.1| hypothetical protein BBta_7597 [Bradyrhizobium sp. BTAi1]
Length=160

 Score =  102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (51%), Gaps = 22/162 (13%)

Query  17   MIKYKLTCKGCNLSFDSWFASSKEYEKLKKRSLLSCHNCNSKKIEKSLMAPQLISTFNTD  76
            MI+Y L C+  + +F+SWF SS  YE   KR L+ C  C S K+EK++MAP+++S    D
Sbjct  1    MIRYALRCER-DHTFESWFQSSSAYESQVKRKLVECPTCGSTKVEKAIMAPRIVSKKGRD  59

Query  77   KFVKKD--------------------LKLNEITKKIKEYQKFIKTNFKYVGENFAYEARS  116
                                       +  E+  K+KE +  I  N   VGE F  EAR 
Sbjct  60   AAPVPAAPVPAPAPEVIPPGPTSLLMAQERELRAKLKELRDHIVKNADDVGERFPTEARK  119

Query  117  IHYGKKSKNKGIYGTASKKEIVELKEEGINTEIIPWIEDKKN  158
            +HYG +++++ IYG AS +E  EL EEGI    IP + D +N
Sbjct  120  MHYG-ETEHRPIYGEASIEEARELIEEGIEVAPIPVLPDDRN  160