GOS 1261030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091143639402
Annotathon code: GOS_1261030
Sample :
  • GPS :45°6'42n; 64°56'48w
  • North American East Coast: Bay of Fundy, Nova Scotia - Canada
  • Estuary (-1m, 11.2°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2010
Username : chadiou
Annotated on : 2010-05-25 19:29:15
  • bordet robin
  • boughiden chadia

Synopsis

Genomic Sequence

>JCVI_READ_1091143639402 GOS_1261030 Genomic DNA
CCTCCCCCCAAGCCTGCTTCAATGGGGATATTTTTATGAACTGTGATATGAAATCTCTGCTTAAAATCATTTTCCTCTCTTAAATATTGCAGTGATTTAT
GAATTGTAGAGTTTTCGTTTATCGGAACTTCAGAATGAAATTCAATAATATCTTTATCATCCTCTATTTCTCTTATTTTGATTTCATCATAAAGTGAAAT
TGGAATCATCAATGAAGATAGGGTATGTAAATCTTGTATGATTTCGGTATTTACTGTTAAATTAAGATTTATCTTTGCAGATGAAAAAATTTTCAATTTA
AGCTCTTTGCTAATTCTAAATATTGTTCTGGTGACAAATTTTGCGGTCTGTCATCAGGGTTTATTCCTAATTGCTCCAACTCCTCAACACTAAAAAAATC
TTGTAACGCAGATTTTACTTTTTTTCTTTTTTGCTGAAAAGCAATTTTAGAGAGACGAAAAGCTTCTAAACGATCTTCTTCATCAAATAGCGTCTCCCTT
TGAAGGGTAATAACACTAGAGGTAATTTTTGGTACAGGACTGAAACAATGTTTACTCACGTCGAACTGATGTTTTGGTGTTGCGAATAACGAGCAGACCA
CAGATAATGCCCCATATTCTTTAGTACCTGGTTGTGCTGTAATTCTTTCTGCTACTTCTTTTTGCACCATGACAACATAGCGATGAATAACTGGTACCTC
AGTTATTAACTTAACAAGCAGTCGAGTCCCTATGTTATATGGAAGGTTTGAAACTAGAATCCACCAACGTCCTGTTAACTGAGAGTAGTCATACT

Translation

[3 - 500/795]   indirect strand
>GOS_1261030 Translation [3-500   indirect strand]
YDYSQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRE
TLFDEEDRLEAFRLSKIAFQQKRKKVKSALQDFFSVEELEQLGINPDDRPQNLSPEQYLELAKSLN

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Apres cette analyse,nous pensons que notre séquence est codante.

Les résultats de recherche d'ORF et de Blast nous permettent de conclure que notre séquence est une séquence proteique partielle et qu'elle est incomplete en 5'.


Notre sequence comprend un motif Ribosomal RNA adenine methylase transferase ,en effet de bonnes similarités ont été obtenus par notre analyse blast avec des sequences connus présentant le meme motif.


Au début de notre analyse nous pensions que notre séquence appartenait à la famille bactéries,en effet d'après les rsultats du BLAST ainsi que l'arbre BioJN obtenu notre séquence semblait très proche de cetaines sequences appartenant à la famille des Bactéries .

Sans la présence d'Archées et d'eucaryotes dans la meme branche que notre sequence visualisé dans l'arbre PhyML obtenu notre séquence formerait un groupe monophylétique avec les bactéries. La présence de ces séquences appartenant au groupe exterieur nous empêche de conclure précisement sur la taxonomie de notre sequence même si il semble que ce soit une bactérie .

En effet notre sequence semble obtenir ses meilleurs homologues dans divers especes de bactéries,néanmoins elle possède des ancetre commun avec des archées et des eucaryotes.Cela nous laisse penser que notre séquence est une sequence extremement bien conservé dans le monde vivant et que son role doit etre vital pour une majeurs parties des especes vivantes.


.Ces ancetre commun contiennent ou contenaient le motif Ribosomal RNA adenine methylase transferase présent dans notre séquence.

Le motif Ribosomal RNA adenine methylase transferase que l'on trouve dans un large nombre de proteine impliqué dans le transfert de groupements methyle .Cette famille de protéine inclue les rRNA adenine dimethylases(KsgA)

ainsi que les Erythromycin resistance methylases (Erm). .

l'enzyme bactérienne KsgA permet le transfert d'un total de 4 groupements methyl de la S-adenosyl-l-methionine à deux autres bases adenosines dans l'ARNr 16S.Cetta enzyme semble bien conservée dans les espèces de eubactéries ,eucaryote, et archée.




ORF finding

PROTOCOLE:



ANALYSE DES RÉSULTATS:

PROTOCOLE:

Sur le site de SMS, dans la rubrique ORF Finder:

1. Recherche dans le sens direct, tous les cadres de lecture avec any codon

2. Recherche dans le sens indirect, tous les cadres de lecture avec any codon


programme ORF Finder: paramètres: au moins 60 codons, code génétique standard,any codon start ou ATG.


ANALYSE DES RÉSULTATS:

Nous avons trouvé 3ORF:


- 1 ORF dans le sens direct:

dans le cadre de lecture 1:

.de la base 193-393 (200 bases)

.présence d'un codons stop


- 2 ORF dans le sens indirect:

le premier ORF: Dans le cadre de lecture 2

.de la base 446-793 (347 bases)

.Pas de codons stop .

Le second ORF: Dans le cadre de lecture 3

.de la base 3-503 (500 bases)

.Présence d'un codons stop .




D'apres nos resultats ou l'on obtient de long ORF,cela nous laisse penser que la sequence nucleotidique est codante.

A la suite de notre analyse avec any codon ,on choisit arbitrairement d'analyser le plus long ORF, correspondant au fragment trouvé dans le sens indirecte composé de 500 bases ,localisé entre la troisième et la 503eme base.


La sequence choisie ne semble pas etre complete,en effet notre ORF commence à la troisième base ce qui signifie que ORF finder n'a pas trouvé de codons stop au debut de notre sequence,sinon notre ORF aurait commencé a la quatrieme base minimum .N'ayant pas de codons start ,nous ne pouvons pas calculer le poids moleculaire de celle-ci.


Hypothese :notre sequence semble etre incomplete en 5',la suite de notre etude nous en apprendra surement plus a ce sujet.

RÉsultats bruts

>ORF number 1 in reading frame 1 on the direct strand extends from base 193 to base 393.
AGTGAAATTGGAATCATCAATGAAGATAGGGTATGTAAATCTTGTATGATTTCGGTATTT
ACTGTTAAATTAAGATTTATCTTTGCAGATGAAAAAATTTTCAATTTAAGCTCTTTGCTA
ATTCTAAATATTGTTCTGGTGACAAATTTTGCGGTCTGTCATCAGGGTTTATTCCTAATT
GCTCCAACTCCTCAACACTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SEIGIINEDRVCKSCMISVFTVKLRFIFADEKIFNLSSLLILNIVLVTNFAVCHQGLFLI
APTPQH*
SULTATS BRUTS:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 446 to base 793.
CAGACCGCAAAATTTGTCACCAGAACAATATTTAGAATTAGCAAAGAGCTTAAATTGAAA
ATTTTTTCATCTGCAAAGATAAATCTTAATTTAACAGTAAATACCGAAATCATACAAGAT
TTACATACCCTATCTTCATTGATGATTCCAATTTCACTTTATGATGAAATCAAAATAAGA
GAAATAGAGGATGATAAAGATATTATTGAATTTCATTCTGAAGTTCCGATAAACGAAAAC
TCTACAATTCATAAATCACTGCAATATTTAAGAGAGGAAAATGATTTTAAGCAGAGATTT
CATATCACAGTTCATAAAAATATCCCCATTGAAGCAGGCTTGGGGGGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
QTAKFVTRTIFRISKELKLKIFSSAKINLNLTVNTEIIQDLHTLSSLMIPISLYDEIKIR
EIEDDKDIIEFHSEVPINENSTIHKSLQYLREENDFKQRFHITVHKNIPIEAGLGG

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 503.
TATGACTACTCTCAGTTAACAGGACGTTGGTGGATTCTAGTTTCAAACCTTCCATATAAC
ATAGGGACTCGACTGCTTGTTAAGTTAATAACTGAGGTACCAGTTATTCATCGCTATGTT
GTCATGGTGCAAAAAGAAGTAGCAGAAAGAATTACAGCACAACCAGGTACTAAAGAATAT
GGGGCATTATCTGTGGTCTGCTCGTTATTCGCAACACCAAAACATCAGTTCGACGTGAGT
AAACATTGTTTCAGTCCTGTACCAAAAATTACCTCTAGTGTTATTACCCTTCAAAGGGAG
ACGCTATTTGATGAAGAAGATCGTTTAGAAGCTTTTCGTCTCTCTAAAATTGCTTTTCAG
CAAAAAAGAAAAAAAGTAAAATCTGCGTTACAAGATTTTTTTAGTGTTGAGGAGTTGGAG
CAATTAGGAATAAACCCTGATGACAGACCGCAAAATTTGTCACCAGAACAATATTTAGAA
TTAGCAAAGAGCTTAAATTGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
YDYSQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEY
GALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLSKIAFQ
QKRKKVKSALQDFFSVEELEQLGINPDDRPQNLSPEQYLELAKSLN*

Multiple Alignement

PROTOCOLE:


Tout d'abord sur le site phylogeny.fr nous avons copié nos 25 séquences au format FASTA (séquence à comparer, groupe d'étude et groupe extérieur) et nous avons réalisé un alignement multiple avec MUSCLE.Ensuite nous avont éliminer les alignements ambigus grâce à Gblock.




ANALYSE DES RÉSULTATS:[


Les résulats obtenus par cet alignement multiple nous permettent de renforcer notre hypothèse que notre séquence est une séquence protéique partielle et qu'il lui manque environ 100 aa pour etre complète.En effet l'alignement de notre sequence avec ses homologues ne commence qu'à partir de leurs 100 aa environ.

Dans l'alignement multiple on peut observer un bon alignement de sequence.Grâce à Gblock nous avons pu éliminer les regions ayant un alignement de mauvaise qualité.Ceci nous a permis de conserver 3 régions de la séquence:


entre les bases:[270 281] ; [304 354] ; [386 398]


A certains endroit on peut observer un tres bon alignement pour l'ensemble de notre groupe d'etude ce qui nous laisse penser qu'il existe ou qu'il a existe un ancetre commun pour toutes ces sequences:


On observe que les sequences trouvées par Gblock sont trés conservées et nous permettent de dire qu'elles étaient surement présente chez l'ancêtre communs à nos sequences.ceci revient a dire que ces sequences etant toutes des dimethyl transférases ,cette famille d'enzyme semble etre présente chez tout les etres vivants .En effet un ancetre commun au archées,bactéries ,et eucaryotes est simplement l'ancétre de la vie.


Nous observons que notre domaine proteique trouvé dans notre sequence du 11eme au 165eme acide aminé est tres conservé chez les sequences choisies pour l'alignement,ce domaine etait donc surement present chez cet ancetre commun à toutes ces sequences.


Cet alignement multiple va nous permettre de réaliser un arbre phylogénètique permettant de mettre en evidence les liens de parentés entre nos sequences.

RÉSULTATS BRUTS:


1)CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

Pl.y.yoeli      -myVkkndKkkkekvnipisnkinInnnkIninnnkrniyfikknqfllLNtpNekSelv
Pa.chromat      ------------------------------------------------------------
H.triquetr      mptVpmasRgasaprayrrgtlstVvraaVaaagcaglaaaaaaaamwpVSgsSfvAswp
M.the.PT        ------------------------------------------------------------
R.b.RML369      ------------------------------------------------------------
R.b.OSU_85      ------------------------------------------------------------
R.ty.str.       ------------------------------------------------------------
R.p.str._M      ------------------------------------------------------------
R.cn.str.       ------------------------------------------------------------
R.a.str._H      ------------------------------------------------------------
I.scapular      ------------------------------------------------------------
Dn.thi.ASO      ------------------------------------------------------------
Dv.v.str.       ------------------------------------------------------------
DvsuDP4         ------------------------------------------------------------
Dv.v.RCH1       ------------------------------------------------------------
Dv.v.subsp      ------------------------------------------------------------
C.psittaci      ------------------------------------------------------------
C.cv.GPIC       ------------------------------------------------------------
C.f.Fe/C-5      ------------------------------------------------------------
GOS_126103      ------------------------------------------------------------
L.ferrodia      ------------------------------------------------------------

Pl.y.yoeli      yKnseQsgkndilnnkflSrdLegiqvfptkqkNeddekNIktllpSrefkPKrsLGQNy
Pa.chromat      --------------------------------------------mtfsghaaRKdfGQhw
H.triquetr      sRprsRrcitcraqddsnaieLaerkrdgailpkswsdkprtptlpAtlfkPKqsLsQNF
M.the.PT        -----------------------------------------------------mKsGQhF
R.b.RML369      ------------------------------------MlPSIAKHaAShqiHPlKKhGQNF
R.b.OSU_85      ------------------------------------MlPSIAKHaAShqiHPlKKhGQNF
R.ty.str.       ------------------------------------MlPSIAKHaAShqiNPlKKhGQNF
R.p.str._M      ------------------------------------MlPSIvKHatShkiNPlKKhGQNF
R.cn.str.       ------------------------------------MlPSIAKHaAlhhiNPlKKhGQNF
R.a.str._H      ------------------------------------MlPSIAKHvAShqiNPlKKhGQNF
I.scapular      ------------------------------------MlPSIAKHaAShqiNPlKKyGQNF
Dn.thi.ASO      ----------------------------------------------mihapaKKsLGQNF
Dv.v.str.       ------------------------------------MpPp----dgAggpraKKsLGQNF
DvsuDP4         -----------------------------------------------mppraKKsLGQNF
Dv.v.RCH1       -------------mrrerSpravrdaeeeGvaaAegqgtSeggrgpAmppraKKsLGQNF
Dv.v.subsp      -----------------------------------------------mppraKKsLGQNF
C.psittaci      --------------------------------mSRsspeqLtRflAevhgHPKKgLsQNF
C.cv.GPIC       --------------------------------mSRsspdqLtRflAqvqgrPKKgLsQNF
C.f.Fe/C-5      --------------------------malGdllSRsspdqLtRflAqvhgHPKKgLsQNF
GOS_126103      ------------------------------------------------------------
L.ferrodia      --------------------------------------mirpKgnreplpSParyLGQhF

Pl.y.yoeli      LkDeNIikKmVqAieLDasqfvlmkekkkkillkskkdkikdetdeqnklkinenncknm
Pa.chromat      LkDksIlnKIIlAAdLs-------------------------------------------
H.triquetr      LaDpNyvfKmVnAiedDsp-----------------------------------------
M.the.PT        LtDrgIAerIagyAeIs-------------------------------------------
R.b.RML369      ifDgslcdKIVrASgLE-------------------------------------------
R.b.OSU_85      ifDgslcdKIVrASgLE-------------------------------------------
R.ty.str.       ifDsslcdKIIrASnIs-------------------------------------------
R.p.str._M      ifDsslcdKIIrASnvl-------------------------------------------
R.cn.str.       ifDsslchKIVrvSnLE-------------------------------------------
R.a.str._H      ifDsslcdKIVrAShLa-------------------------------------------
I.scapular      ifDsslcdKIVhASnLa-------------------------------------------
Dn.thi.ASO      LqDmNIArKIVdAlepg-------------------------------------------
Dv.v.str.       LrDrNIAaKIVaAlrIg-------------------------------------------
DvsuDP4         LkDrNIAarIaaqlhIg-------------------------------------------
Dv.v.RCH1       LkDrNIAarIaaqlhIg-------------------------------------------
Dv.v.subsp      LkDrNIAarIaaqlhIg-------------------------------------------
C.psittaci      LiDgNIlrKIlavScvQ-------------------------------------------
C.cv.GPIC       LiDgNIlrKIlavScvE-------------------------------------------
C.f.Fe/C-5      LiDgNIlrKIlavScvE-------------------------------------------
GOS_126103      ------------------------------------------------------------
L.ferrodia      LtDdrIAqrIVdSlptEll-----------------------------------------

Pl.y.yoeli      eslknEgngiiElGcGlGqLsKhlfkKyknmta--IEiDsRaL----tiIsrtmPgfdfI
Pa.chromat      -----adDiVLEIGsGrGALTesll-assalLTlaVElDrdlasmLrk-rlgthtrfalI
H.triquetr      -----ggkqVLElGPGtGALTsrlhpRfPemma--VdlDQRaMrvLaQnV----PgctVI
M.the.PT        -----psDriLEIGPGkGsLTeflaaRagrvya--IEaD----PeLaryVEEsfPNveVI
R.b.RML369      -----ENsnVLEIGPGtGgLTRsIlhKnPklLTV-IEtDERCIPlLNE-IKQyhPNLNII
R.b.OSU_85      -----ENsnVLEIGPGtGgLTRsIlhKnPklLTV-IEtDERCIPlLNE-IKQyhPNLNII
R.ty.str.       -----ENskViEIGPGvGgLTRsIlhKnPksLTV-IEiDERCIPlLNE-IQgyyPNLNII
R.p.str._M      -----ENsnViEIGPGiGgLTRsIlqKnPksLTV-IEiDERCIPlLNE-IQEyyPNLNII
R.cn.str.       -----ENsrVLEIGPGsGgLTRsIlqKnPesLTV-IEtDERfIPlLNE-IKEyyPNLNII
R.a.str._H      -----ENsrVLEIGPGtGgLTRsIlqKnPesLTV-IEtDERfIPlLNE-IKEyyPNLNII
I.scapular      -----ENsrVLEIGPGtGgLTRsIlqKkPesLTV-IEtDERCIPlLNE-IKEyyPNLNII
Dn.thi.ASO      -----hkDrVLEIGPGkGvLTalladRaglvLg--VEKDyfltfaLDr-----cPgLqaV
Dv.v.str.       -----peDrViEIGPGpGALTRhIhaaGPaqLfl-lEKDyhwatehgrtrpaepPvItpV
DvsuDP4         -----pdDwViEIGPGpGALTRhIhaaGParLfl-lEKDhhwarehHlhplagtPeaqVV
Dv.v.RCH1       -----pdDwViEIGPGpGALTRhIhaaGParLfl-lEKDhhwarehrlhplagtPeaqVV
Dv.v.subsp      -----pdDwViEIGPGpGALTRhIhaaGParLfl-lEKDhhwarehrlhplagtPeaqVV
C.psittaci      -----agDwVLEIGPGfGALTevlvnqGahvva--lEKD----PmfeEtLKQlpiHLeI-
C.cv.GPIC       -----agDwVLEIGPGfGALTevlvnqGahvva--lEKD----PmfeEtLKQlpiDLeI-
C.f.Fe/C-5      -----agDwVLEIGPGfGALTevlvnqGahvva--lEKD----PmfeEtLKQlpiDLeI-
GOS_126103      ------------------------------------------------------------
L.ferrodia      -----EstptLEIGPGrmiLTRhlarRsPrlil--VEKDERlIPhLeEsLREfgekIeIr

Pl.y.yoeli      hdDvLqINykDLsin-------kntKlSVIgNLPfyItsqiLfcLLdfy-----kyIeQA
Pa.chromat      EgDiLRINfpnasty---------tpnkVvaNiPYnItgPLLkRLLgslnkplnkpykKi
H.triquetr      RsDvLlINyTkLaev-------rggplTivgNLPYHvtsqiLftLadhA-----ksVkdA
M.the.PT        QgDALRVdLpEyn--------------kVvSNLPYHIsTkitlRLLrn-------pfdlm
R.b.RML369      KQDALKLkLSDLntn----------KiTiISNLPYHIGTeLviRwLkES-----slVasm
R.b.OSU_85      KQDALKLkLSDLntn----------KiTiISNLPYHIGTeLviRwLkES-----slVasm
R.ty.str.       KQDvLKINLTDLiyd----------KvTVISNLPYHIGTeLviRLLkEA-----klItnm
R.p.str._M      KQDvLKINLTDLiyd----------KvTVISNLPYHIGTeLviRLLkEv-----klItnm
R.cn.str.       KQDALKINLTDLgyd----------KvTiISNLPYHIGTeLviRwLkEA-----rlItsm
R.a.str._H      KQDALKINLTDLdyd----------KvTiISNLPYHIGTeLviRwLkEA-----rlItdm
I.scapular      KQDALKINLTDLsydivnssksidyKvTiISNLPYHIGTeLviRwLkEA-----rlInnm
Dn.thi.ASO      nmDALqLdwSrLdrw---------pglkiIgNLPYnIaqtLLwdMaagc-----rsfdRA
Dv.v.str.       ltDALlfpwerLtsa---------rswkVIgNLPYnvasPLMwdILstA-----PgLaRA
DvsuDP4         ltDALlfpwerLdaa---------hpwkVIgNLPYnvasPLMwdIcsrA-----PgLvRA
Dv.v.RCH1       ltDALlfpwerLdaa---------hpwkVIgNLPYnvasPLMwdIcsrA-----PgLlRA
Dv.v.subsp      ltDALlfpwerLdaa---------hpwkVIgNLPYnvasPLMwdIcsrA-----PgLlRA
C.psittaci      -tDAcKypLSqLqdk------GwQgKgrVvaNLPYHvtTPLLtKLflEv-----PnqwKt
C.cv.GPIC       -tDAcKypLSqLeek------GwQgKgrVvaNLPYHItTPLLtKLflEv-----PnqwKt
C.f.Fe/C-5      -tDAcKypLSqLqek------GwQgKgrVvaNLPYHItTPLLtKLflEv-----PnqwKt
GOS_126103      ------ydySqLtgr----------wwilvSNLPYnIGTrLLvKLItEv-----PvIhRy
L.ferrodia      RgDALeeNLv-Legs----------pylVISNLPYnIsvPLLlKIIggt-----PpplmA

Pl.y.yoeli      V-vtIQyEVgqRIiAkPndKdYsiLSilfsLYthpyllFkiPsnAFYPiPKVeaAVmKIi
Pa.chromat      V-LlvQqEVgdRIrAnPGhtSYsaLSVkmQLlARcysvciVPPhcFdPsPsVvSeVIvLe
H.triquetr      h-vtMQKEVaERIvArPnTKkYGiLSVcfQLYAdpkilFdiPPnAFFPrPnVmSsyVKLn
M.the.PT        V-LMyQrEfVERmlAsPGsreYGRLSVnvsyYAdVEvletVPrSAFrPmPhVsSsVVRLr
R.b.RML369      t-LMLQKEVVERICAkPsTKAYGRLSViCsLiAtVEkCFdVaPTAFYPpPKVySAiVKLT
R.b.OSU_85      t-LMLQKEVVERICAkPsTKAYGRLSViCsLiAtVEkCFdVaPTAFYPpPKVySAiVKLT
R.ty.str.       I-LMLQKEVVERICAmPsTKAYGRLSViCQIvAKVEkCFdVaPTAFYPhPKVySAiVKIi
R.p.str._M      t-LMLQKEVVERICAiPsTKAYGRLSViCQIlAKVEkCFnVaPTAFYPhPKVySAiVKIi
R.cn.str.       t-LMLQKElVERICAmPsTKAYGRLSViCQLiAKVEkCFeVaPTAFYPpPKVySAiVKLT
R.a.str._H      t-LMLQKEVVERICAmPsTKAYGRLSViCQLiAKVEkCFdVsPTAFYPpPKVySAiVKLi
I.scapular      t-LMLQKEVVERICAmPsTKAYGRLSViCQLiAKVEkCFdVaPTAFYPpPKVySAiVKLi
Dn.thi.ASO      V-vMvQKEVaqRItAgPGgKeYGaLSiwlQsFttprvlFnVsPgvFrPrPsVdSsVlELr
Dv.v.str.       V-fMIQKEVgERIvAaPGsgAYGaLSVwlQsFvtprmeFiVPPqvFvPrPKVdSAVlsfv
DvsuDP4         s-fMIQKEVgERIvAaPGsrqYGaLSVwlQcFtKpEwCFvVPPhvFtPrPKVdSAVlafT
Dv.v.RCH1       s-fMIQKEVgERIvAaPGsrqYGaLSVwlQcFtKpEwCFvVPPhvFtPrPKVdSAVlafT
Dv.v.subsp      s-fMIQKEVgERIvAaPGsrqYGaLSVwlQcFtKpEwCFvVPPhvFtPrPKVdSAVlafT
C.psittaci      VTvMIQdEVarRIkAqPGgKeYGsLtiflQfFvdVryaFkVsPgcFlPkPqVsSAVVhMT
C.cv.GPIC       VTvMMQdEVarRItAqPGgKeYGsLtiflQfFAdVryaFkVsPgcFFPkPqVsSAVVhMT
C.f.Fe/C-5      ITvMMQdEVarRItAqPGgKeYGsLtiflQfFAdVryaFkVssgcFFPkPqVsSAVVhMT
GOS_126103      V-vMvQKEVaERItAqPGTKeYGaLSVvCsLFAtpkhqFdVskhcFsPvPKitSsVItLq
L.ferrodia      V-LMfQKEVaERItApaGsKdYGsLSVaarLlstprhlFdirPgsFtPpPKVqSsVlsfv

Pl.y.yoeli      ---fkKHi--fncnllflkQIlKhsFqQRRKkLKSSLK-----rLLnmy----niqnvpL
Pa.chromat      plNPdQHl--mpelaiRVeEllKfcFSsRRKMLRnSLt-----NLVPikfleiViAKsGI
H.triquetr      faDaeErrlalnvdprnlrnVTtrAFrmRRKMLqnSLK-----NLLdcxxt--LinELpe
M.the.PT        ---PrrDr--elvdelifssIsrdlFtKRRKkvKnALa-----sIgvaddv--MLdldps
R.b.RML369      ---PlENiP-nsdlisKVelITKmAFAgRRKMiKSSLK-----NLaPnise--LLAKLnI
R.b.OSU_85      ---PlENiP-nsdlisKVelITKmAFAgRRKMiKSSLK-----NLaPnise--LLAKLnI
R.ty.str.       ---PlENpP-sialinKVeQITKlvFAgRRKMiKSSLr-----NLVPnihe--VLtQLkI
R.p.str._M      ---PlENpP-sialinKVeQITKlvFAgRRKMiKSSLr-----NLIPnihe--VLtQLkI
R.cn.str.       ---PlENlP-sialitKVeQITKlAFAgRRKMiKSSLK-----NfVPvkne--VLtQLnI
R.a.str._H      ---PlaNpP-sialinRVeKITtfAFAgRRKMiKSSLK-----NLVPnihe--VLtQLkI
I.scapular      ---PlENpP-sialinKVeQITKlAFAgRRKMiKSSLK-----NLVPnihe--VLtQLkI
Dn.thi.ASO      ---Plpadk-iffvprdlaRVvKtmFqnRRKqLgriLK-----tywndrrki-aLeQcGL
Dv.v.str.       ---Plgaar-grfdpaRlsRllKvcFqQRRKqLqriLr-----gyVqgdvpa-LLAgLGL
DvsuDP4         ---PrtDrP-davqskRlahVlrlcFqQRRKqLqgiLr-----phVggdasa-LLAELGI
Dv.v.RCH1       ---PrtDrP-davqskRlaRVlrlcFqQRRKqLqgiLr-----phVggdasa-LLAgLGI
Dv.v.subsp      ---PrtDrP-davqskRlaRVlrlcFqQRRKqLqgiLr-----phVggdasa-LLAgLGI
C.psittaci      ---vkDrfPLeeplrtKffslTraAFgQRRKLLanALK-----dLyPkervfeaLSQLnf
C.cv.GPIC       ---vkEtfPLetslhqKffslTraAFgQRRKLLanALK-----dLyPkelvfsaLnQLnf
C.f.Fe/C-5      ---vkDtfPLeeslhkKffslTraAFgQRRKLLanALK-----NLyPkdlvfsaLnQLnf
GOS_126103      ----rEtlf-deedrlEafRlsKiAFqQkRKkvKSALq-----dffsve----eLeQLGI
L.ferrodia      ---PaEtr--adpslpgafhlaraAFAyRRKtLKnALKqglspeIVeavsp--LveaLpq

Pl.y.yoeli      pFsDlRPqqLyPEqfIeLtniLfplhdyPfdsniQtk----------
Pa.chromat      S-leqRPqeLtPsqwvdLAasLskfSdfPqssliak-----------
H.triquetr      eYaklRPEqiePwefvhLtQlLfgkkefPqdylrRawrgefgrxvkd
M.the.PT        i-lDaRPEdLgvDefvqiArvvsehrsrdsl----------------
R.b.RML369      S-dNcRaENLtPnDYLsLAsli-------------------------
R.b.OSU_85      S-nNcRaENLtPnDYLsLAsli-------------------------
R.ty.str.       N-nNdRaENLtPkDYLriAmqL-------------------------
R.p.str._M      N-cNdRaENLtPkDYLriAmkL-------------------------
R.cn.str.       N-dNyRaENLtPQDYLmiAacems-----------------------
R.a.str._H      N-dNyRaENLaPQDYLriAmsLsvnkl--------------------
I.scapular      N-dNyRaENLtPQDYLriAEiL-------------------------
Dn.thi.ASO      D-praRPEqLSPEDfqgLSKcLfse----------------------
Dv.v.str.       D-pavRPEsLaPEDfhmLSEsvkip----------------------
DvsuDP4         D-paaRPEtLSPErfIaLgEavamsAia-------------------
Dv.v.RCH1       D-paaRPEtLSPErfIaLgEavamsAia-------------------
Dv.v.subsp      D-paaRPEtLSPErfIaLgEavamsAia-------------------
C.psittaci      S-dktRPEtLSlDDYLkLfElLslhA---------------------
C.cv.GPIC       S-ektRPEtLSlneYLqLfhlLssnA---------------------
C.f.Fe/C-5      S-ektRPEtLSlDeYLkLfQlLslnS---------------------
GOS_126103      N-pDdRPqNLSPEqYLeLAKsLn------------------------
L.ferrodia      g-sDcRPENLSPEDwLfLArtLrehSpeifakikR------------


2)Résultat aprés élimination des alignements ambigus grâce à Gblock:
Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 21
Alignment assumed to be: Protein
New number of positions: 76 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  -MYVKKNDKKKKEKVNIPISNKININNNKININNNKRNIYFIKKNQFLLLNTPNEKSELV
Pa.chromatophor  ------------------------------------------------------------
H.triquetra      MPTVPMASRGASAPRAYRRGTLSTVVRAAVAAAGCAGLAAAAAAAAMWPVSGSSFVASWP
M.the.PT]        ------------------------------------------------------------
R.b.RML369-C]    ------------------------------------------------------------
R.b.OSU_85-389]  ------------------------------------------------------------
R.ty.str._Wilmi  ------------------------------------------------------------
R.p.str._Madrid  ------------------------------------------------------------
R.cn.str._McKie  ------------------------------------------------------------
R.a.str._Hartfo  ------------------------------------------------------------
I.scapularis     ------------------------------------------------------------
Dn.thi.ASO3-1]   ------------------------------------------------------------
Dv.v.str._'Miya  ------------------------------------------------------------
DvsuDP4]         ------------------------------------------------------------
Dv.v.RCH1]       ------------------------------------------------------------
Dv.v.subsp._vul  ------------------------------------------------------------
C.psittaci       ------------------------------------------------------------
C.cv.GPIC]       ------------------------------------------------------------
C.f.Fe/C-56]     ------------------------------------------------------------
GOS_1261030_Tra  ------------------------------------------------------------
L.ferrodiazotro  ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  YKNSEQSGKNDILNNKFLSRDLEGIQVFPTKQKNEDDEKNIKTLLPSREFKPKRSLGQNY
Pa.chromatophor  --------------------------------------------MTFSGHAARKDFGQHW
H.triquetra      SRPRSRRCITCRAQDDSNAIELAERKRDGAILPKSWSDKPRTPTLPATLFKPKQSLSQNF
M.the.PT]        -----------------------------------------------------MKSGQHF
R.b.RML369-C]    ------------------------------------MLPSIAKHAASHQIHPLKKHGQNF
R.b.OSU_85-389]  ------------------------------------MLPSIAKHAASHQIHPLKKHGQNF
R.ty.str._Wilmi  ------------------------------------MLPSIAKHAASHQINPLKKHGQNF
R.p.str._Madrid  ------------------------------------MLPSIVKHATSHKINPLKKHGQNF
R.cn.str._McKie  ------------------------------------MLPSIAKHAALHHINPLKKHGQNF
R.a.str._Hartfo  ------------------------------------MLPSIAKHVASHQINPLKKHGQNF
I.scapularis     ------------------------------------MLPSIAKHAASHQINPLKKYGQNF
Dn.thi.ASO3-1]   ----------------------------------------------MIHAPAKKSLGQNF
Dv.v.str._'Miya  ------------------------------------MPPP----DGAGGPRAKKSLGQNF
DvsuDP4]         -----------------------------------------------MPPRAKKSLGQNF
Dv.v.RCH1]       -------------MRRERSPRAVRDAEEEGVAAAEGQGTSEGGRGPAMPPRAKKSLGQNF
Dv.v.subsp._vul  -----------------------------------------------MPPRAKKSLGQNF
C.psittaci       --------------------------------MSRSSPEQLTRFLAEVHGHPKKGLSQNF
C.cv.GPIC]       --------------------------------MSRSSPDQLTRFLAQVQGRPKKGLSQNF
C.f.Fe/C-56]     --------------------------MALGDLLSRSSPDQLTRFLAQVHGHPKKGLSQNF
GOS_1261030_Tra  ------------------------------------------------------------
L.ferrodiazotro  --------------------------------------MIRPKGNREPLPSPARYLGQHF
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  LKDENIIKKMVQAIELDASQFVLMKEKKKKILLKSKKDKIKDETDEQNKLKINENNCKNM
Pa.chromatophor  LKDKSILNKIILAADLS-------------------------------------------
H.triquetra      LADPNYVFKMVNAIEDDSP-----------------------------------------
M.the.PT]        LTDRGIAERIAGYAEIS-------------------------------------------
R.b.RML369-C]    IFDGSLCDKIVRASGLE-------------------------------------------
R.b.OSU_85-389]  IFDGSLCDKIVRASGLE-------------------------------------------
R.ty.str._Wilmi  IFDSSLCDKIIRASNIS-------------------------------------------
R.p.str._Madrid  IFDSSLCDKIIRASNVL-------------------------------------------
R.cn.str._McKie  IFDSSLCHKIVRVSNLE-------------------------------------------
R.a.str._Hartfo  IFDSSLCDKIVRASHLA-------------------------------------------
I.scapularis     IFDSSLCDKIVHASNLA-------------------------------------------
Dn.thi.ASO3-1]   LQDMNIARKIVDALEPG-------------------------------------------
Dv.v.str._'Miya  LRDRNIAAKIVAALRIG-------------------------------------------
DvsuDP4]         LKDRNIAARIAAQLHIG-------------------------------------------
Dv.v.RCH1]       LKDRNIAARIAAQLHIG-------------------------------------------
Dv.v.subsp._vul  LKDRNIAARIAAQLHIG-------------------------------------------
C.psittaci       LIDGNILRKILAVSCVQ-------------------------------------------
C.cv.GPIC]       LIDGNILRKILAVSCVE-------------------------------------------
C.f.Fe/C-56]     LIDGNILRKILAVSCVE-------------------------------------------
GOS_1261030_Tra  ------------------------------------------------------------
L.ferrodiazotro  LTDDRIAQRIVDSLPTELL-----------------------------------------
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  ESLKNEGNGIIELGCGLGQLSKHLFKKYKNMTA--IEIDSRAL----TIISRTMPGFDFI
Pa.chromatophor  -----ADDIVLEIGSGRGALTESLL-ASSALLTLAVELDRDLASMLRK-RLGTHTRFALI
H.triquetra      -----GGKQVLELGPGTGALTSRLHPRFPEMMA--VDLDQRAMRVLAQNV----PGCTVI
M.the.PT]        -----PSDRILEIGPGKGSLTEFLAARAGRVYA--IEAD----PELARYVEESFPNVEVI
R.b.RML369-C]    -----ENSNVLEIGPGTGGLTRSILHKNPKLLTV-IETDERCIPLLNE-IKQYHPNLNII
R.b.OSU_85-389]  -----ENSNVLEIGPGTGGLTRSILHKNPKLLTV-IETDERCIPLLNE-IKQYHPNLNII
R.ty.str._Wilmi  -----ENSKVIEIGPGVGGLTRSILHKNPKSLTV-IEIDERCIPLLNE-IQGYYPNLNII
R.p.str._Madrid  -----ENSNVIEIGPGIGGLTRSILQKNPKSLTV-IEIDERCIPLLNE-IQEYYPNLNII
R.cn.str._McKie  -----ENSRVLEIGPGSGGLTRSILQKNPESLTV-IETDERFIPLLNE-IKEYYPNLNII
R.a.str._Hartfo  -----ENSRVLEIGPGTGGLTRSILQKNPESLTV-IETDERFIPLLNE-IKEYYPNLNII
I.scapularis     -----ENSRVLEIGPGTGGLTRSILQKKPESLTV-IETDERCIPLLNE-IKEYYPNLNII
Dn.thi.ASO3-1]   -----HKDRVLEIGPGKGVLTALLADRAGLVLG--VEKDYFLTFALDR-----CPGLQAV
Dv.v.str._'Miya  -----PEDRVIEIGPGPGALTRHIHAAGPAQLFL-LEKDYHWATEHGRTRPAEPPVITPV
DvsuDP4]         -----PDDWVIEIGPGPGALTRHIHAAGPARLFL-LEKDHHWAREHHLHPLAGTPEAQVV
Dv.v.RCH1]       -----PDDWVIEIGPGPGALTRHIHAAGPARLFL-LEKDHHWAREHRLHPLAGTPEAQVV
Dv.v.subsp._vul  -----PDDWVIEIGPGPGALTRHIHAAGPARLFL-LEKDHHWAREHRLHPLAGTPEAQVV
C.psittaci       -----AGDWVLEIGPGFGALTEVLVNQGAHVVA--LEKD----PMFEETLKQLPIHLEI-
C.cv.GPIC]       -----AGDWVLEIGPGFGALTEVLVNQGAHVVA--LEKD----PMFEETLKQLPIDLEI-
C.f.Fe/C-56]     -----AGDWVLEIGPGFGALTEVLVNQGAHVVA--LEKD----PMFEETLKQLPIDLEI-
GOS_1261030_Tra  ------------------------------------------------------------
L.ferrodiazotro  -----ESTPTLEIGPGRMILTRHLARRSPRLIL--VEKDERLIPHLEESLREFGEKIEIR
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  HDDVLQINYKDLSIN-------KNTKLSVIGNLPFYITSQILFCLLDFY-----KYIEQA
Pa.chromatophor  EGDILRINFPNASTY---------TPNKVVANIPYNITGPLLKRLLGSLNKPLNKPYKKI
H.triquetra      RSDVLLINYTKLAEV-------RGGPLTIVGNLPYHVTSQILFTLADHA-----KSVKDA
M.the.PT]        QGDALRVDLPEYN--------------KVVSNLPYHISTKITLRLLRN-------PFDLM
R.b.RML369-C]    KQDALKLKLSDLNTN----------KITIISNLPYHIGTELVIRWLKES-----SLVASM
R.b.OSU_85-389]  KQDALKLKLSDLNTN----------KITIISNLPYHIGTELVIRWLKES-----SLVASM
R.ty.str._Wilmi  KQDVLKINLTDLIYD----------KVTVISNLPYHIGTELVIRLLKEA-----KLITNM
R.p.str._Madrid  KQDVLKINLTDLIYD----------KVTVISNLPYHIGTELVIRLLKEV-----KLITNM
R.cn.str._McKie  KQDALKINLTDLGYD----------KVTIISNLPYHIGTELVIRWLKEA-----RLITSM
R.a.str._Hartfo  KQDALKINLTDLDYD----------KVTIISNLPYHIGTELVIRWLKEA-----RLITDM
I.scapularis     KQDALKINLTDLSYDIVNSSKSIDYKVTIISNLPYHIGTELVIRWLKEA-----RLINNM
Dn.thi.ASO3-1]   NMDALQLDWSRLDRW---------PGLKIIGNLPYNIAQTLLWDMAAGC-----RSFDRA
Dv.v.str._'Miya  LTDALLFPWERLTSA---------RSWKVIGNLPYNVASPLMWDILSTA-----PGLARA
DvsuDP4]         LTDALLFPWERLDAA---------HPWKVIGNLPYNVASPLMWDICSRA-----PGLVRA
Dv.v.RCH1]       LTDALLFPWERLDAA---------HPWKVIGNLPYNVASPLMWDICSRA-----PGLLRA
Dv.v.subsp._vul  LTDALLFPWERLDAA---------HPWKVIGNLPYNVASPLMWDICSRA-----PGLLRA
C.psittaci       -TDACKYPLSQLQDK------GWQGKGRVVANLPYHVTTPLLTKLFLEV-----PNQWKT
C.cv.GPIC]       -TDACKYPLSQLEEK------GWQGKGRVVANLPYHITTPLLTKLFLEV-----PNQWKT
C.f.Fe/C-56]     -TDACKYPLSQLQEK------GWQGKGRVVANLPYHITTPLLTKLFLEV-----PNQWKT
GOS_1261030_Tra  ------YDYSQLTGR----------WWILVSNLPYNIGTRLLVKLITEV-----PVIHRY
L.ferrodiazotro  RGDALEENLV-LEGS----------PYLVISNLPYNISVPLLLKIIGGT-----PPPLMA
                                              ############                   


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  V-VTIQYEVGQRIIAKPNDKDYSILSILFSLYTHPYLLFKIPSNAFYPIPKVEAAVMKII
Pa.chromatophor  V-LLVQQEVGDRIRANPGHTSYSALSVKMQLLARCYSVCIVPPHCFDPSPSVVSEVIVLE
H.triquetra      H-VTMQKEVAERIVARPNTKKYGILSVCFQLYADPKILFDIPPNAFFPRPNVMSSYVKLN
M.the.PT]        V-LMYQREFVERMLASPGSREYGRLSVNVSYYADVEVLETVPRSAFRPMPHVSSSVVRLR
R.b.RML369-C]    T-LMLQKEVVERICAKPSTKAYGRLSVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLT
R.b.OSU_85-389]  T-LMLQKEVVERICAKPSTKAYGRLSVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLT
R.ty.str._Wilmi  I-LMLQKEVVERICAMPSTKAYGRLSVICQIVAKVEKCFDVAPTAFYPHPKVYSAIVKII
R.p.str._Madrid  T-LMLQKEVVERICAIPSTKAYGRLSVICQILAKVEKCFNVAPTAFYPHPKVYSAIVKII
R.cn.str._McKie  T-LMLQKELVERICAMPSTKAYGRLSVICQLIAKVEKCFEVAPTAFYPPPKVYSAIVKLT
R.a.str._Hartfo  T-LMLQKEVVERICAMPSTKAYGRLSVICQLIAKVEKCFDVSPTAFYPPPKVYSAIVKLI
I.scapularis     T-LMLQKEVVERICAMPSTKAYGRLSVICQLIAKVEKCFDVAPTAFYPPPKVYSAIVKLI
Dn.thi.ASO3-1]   V-VMVQKEVAQRITAGPGGKEYGALSIWLQSFTTPRVLFNVSPGVFRPRPSVDSSVLELR
Dv.v.str._'Miya  V-FMIQKEVGERIVAAPGSGAYGALSVWLQSFVTPRMEFIVPPQVFVPRPKVDSAVLSFV
DvsuDP4]         S-FMIQKEVGERIVAAPGSRQYGALSVWLQCFTKPEWCFVVPPHVFTPRPKVDSAVLAFT
Dv.v.RCH1]       S-FMIQKEVGERIVAAPGSRQYGALSVWLQCFTKPEWCFVVPPHVFTPRPKVDSAVLAFT
Dv.v.subsp._vul  S-FMIQKEVGERIVAAPGSRQYGALSVWLQCFTKPEWCFVVPPHVFTPRPKVDSAVLAFT
C.psittaci       VTVMIQDEVARRIKAQPGGKEYGSLTIFLQFFVDVRYAFKVSPGCFLPKPQVSSAVVHMT
C.cv.GPIC]       VTVMMQDEVARRITAQPGGKEYGSLTIFLQFFADVRYAFKVSPGCFFPKPQVSSAVVHMT
C.f.Fe/C-56]     ITVMMQDEVARRITAQPGGKEYGSLTIFLQFFADVRYAFKVSSGCFFPKPQVSSAVVHMT
GOS_1261030_Tra  V-VMVQKEVAERITAQPGTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQ
L.ferrodiazotro  V-LMFQKEVAERITAPAGSKDYGSLSVAARLLSTPRHLFDIRPGSFTPPPKVQSSVLSFV
                    ###################################################      


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Pl.y.yoelii_str  ---FKKHI--FNCNLLFLKQILKHSFQQRRKKLKSSLK-----RLLNMY----NIQNVPL
Pa.chromatophor  PLNPDQHL--MPELAIRVEELLKFCFSSRRKMLRNSLT-----NLVPIKFLEIVIAKSGI
H.triquetra      FADAEERRLALNVDPRNLRNVTTRAFRMRRKMLQNSLK-----NLLDCXXT--LINELPE
M.the.PT]        ---PRRDR--ELVDELIFSSISRDLFTKRRKKVKNALA-----SIGVADDV--MLDLDPS
R.b.RML369-C]    ---PLENIP-NSDLISKVELITKMAFAGRRKMIKSSLK-----NLAPNISE--LLAKLNI
R.b.OSU_85-389]  ---PLENIP-NSDLISKVELITKMAFAGRRKMIKSSLK-----NLAPNISE--LLAKLNI
R.ty.str._Wilmi  ---PLENPP-SIALINKVEQITKLVFAGRRKMIKSSLR-----NLVPNIHE--VLTQLKI
R.p.str._Madrid  ---PLENPP-SIALINKVEQITKLVFAGRRKMIKSSLR-----NLIPNIHE--VLTQLKI
R.cn.str._McKie  ---PLENLP-SIALITKVEQITKLAFAGRRKMIKSSLK-----NFVPVKNE--VLTQLNI
R.a.str._Hartfo  ---PLANPP-SIALINRVEKITTFAFAGRRKMIKSSLK-----NLVPNIHE--VLTQLKI
I.scapularis     ---PLENPP-SIALINKVEQITKLAFAGRRKMIKSSLK-----NLVPNIHE--VLTQLKI
Dn.thi.ASO3-1]   ---PLPADK-IFFVPRDLARVVKTMFQNRRKQLGRILK-----TYWNDRRKI-ALEQCGL
Dv.v.str._'Miya  ---PLGAAR-GRFDPARLSRLLKVCFQQRRKQLQRILR-----GYVQGDVPA-LLAGLGL
DvsuDP4]         ---PRTDRP-DAVQSKRLAHVLRLCFQQRRKQLQGILR-----PHVGGDASA-LLAELGI
Dv.v.RCH1]       ---PRTDRP-DAVQSKRLARVLRLCFQQRRKQLQGILR-----PHVGGDASA-LLAGLGI
Dv.v.subsp._vul  ---PRTDRP-DAVQSKRLARVLRLCFQQRRKQLQGILR-----PHVGGDASA-LLAGLGI
C.psittaci       ---VKDRFPLEEPLRTKFFSLTRAAFGQRRKLLANALK-----DLYPKERVFEALSQLNF
C.cv.GPIC]       ---VKETFPLETSLHQKFFSLTRAAFGQRRKLLANALK-----DLYPKELVFSALNQLNF
C.f.Fe/C-56]     ---VKDTFPLEESLHKKFFSLTRAAFGQRRKLLANALK-----NLYPKDLVFSALNQLNF
GOS_1261030_Tra  ----RETLF-DEEDRLEAFRLSKIAFQQKRKKVKSALQ-----DFFSVE----ELEQLGI
L.ferrodiazotro  ---PAETR--ADPSLPGAFHLARAAFAYRRKTLKNALKQGLSPEIVEAVSP--LVEALPQ
                                          #############                      


                        430       440       450       460
                 =========+=========+=========+=========+=======
Pl.y.yoelii_str  PFSDLRPQQLYPEQFIELTNILFPLHDYPFDSNIQTK----------
Pa.chromatophor  S-LEQRPQELTPSQWVDLAASLSKFSDFPQSSLIAK-----------
H.triquetra      EYAKLRPEQIEPWEFVHLTQLLFGKKEFPQDYLRRAWRGEFGRXVKD
M.the.PT]        I-LDARPEDLGVDEFVQIARVVSEHRSRDSL----------------
R.b.RML369-C]    S-DNCRAENLTPNDYLSLASLI-------------------------
R.b.OSU_85-389]  S-NNCRAENLTPNDYLSLASLI-------------------------
R.ty.str._Wilmi  N-NNDRAENLTPKDYLRIAMQL-------------------------
R.p.str._Madrid  N-CNDRAENLTPKDYLRIAMKL-------------------------
R.cn.str._McKie  N-DNYRAENLTPQDYLMIAACEMS-----------------------
R.a.str._Hartfo  N-DNYRAENLAPQDYLRIAMSLSVNKL--------------------
I.scapularis     N-DNYRAENLTPQDYLRIAEIL-------------------------
Dn.thi.ASO3-1]   D-PRARPEQLSPEDFQGLSKCLFSE----------------------
Dv.v.str._'Miya  D-PAVRPESLAPEDFHMLSESVKIP----------------------
DvsuDP4]         D-PAARPETLSPERFIALGEAVAMSAIA-------------------
Dv.v.RCH1]       D-PAARPETLSPERFIALGEAVAMSAIA-------------------
Dv.v.subsp._vul  D-PAARPETLSPERFIALGEAVAMSAIA-------------------
C.psittaci       S-DKTRPETLSLDDYLKLFELLSLHA---------------------
C.cv.GPIC]       S-EKTRPETLSLNEYLQLFHLLSSNA---------------------
C.f.Fe/C-56]     S-EKTRPETLSLDEYLKLFQLLSLNS---------------------
GOS_1261030_Tra  N-PDDRPQNLSPEQYLELAKSLN------------------------
L.ferrodiazotro  G-SDCRPENLSPEDWLFLARTLREHSPEIFAKIKR------------
                                                                






Parameters used
Minimum Number Of Sequences For A Conserved Position: 11
Minimum Number Of Sequences For A Flanking Position: 18
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 3 selected block(s)
Flanks: [270  281]  [304  354]  [386  398]  

New number of positions in input.fasta-gb:  76  (16% of the original 467 positions)







Protein Domains

PROTOCOLE:

Nous avons utilisé InterProScan pour analyser notre sequence proteique;obtenus avec notre recherche des ORF.

Ce logiciel recherche dans interpro un ou plusieurs domaines protéiques présentant des similarités avec notre séquences.



ANALYSE DES RÉSULTATS:

Aprés analyse ;nous avons obtenu 5 domaines protéique:

. 3 domaines sur interpro dans les banques de données :PFAM

. 2 domaines non intergré à interpro que l'on retrouve dans 2 banques différentes: SUPERFAMILY et GENE3D


Les positions de chacun de ces cinqs domaines se chevauchent ce qui nous laisse penser qu'il s'agit du même domaine, ou du moins qu'ils aient des liens de parenté..


Ici on choisit le domaine integré sur interpro avec un numero IPR:IPR001737.l'IPR est le numéro correspondant au domaine fonctionnel dans la banque de données interpro. En effet ce domaine est locaisé du 11ème au 165 acides aminés de notre séquence ,ce qui correspond à la quasi totalité de notre sequence.De plus il n'existe aucun lien de parenté avec le deuxième domaine trouvé intégré lui aussi à interpro.Le domaine IPRO22272 est un domaine lipocalin ,nous ne connaissons ni son E-Value ni sa probable position sur notre séquence.


Nous avons choisi ce domaine notamment par la valeure de l'E-value de l'ordre de 10e-28 ce qui semble significatifs, et avons favorisé ce domaine car il est intégré à interpro .Cela nous laisse penser que notre séquence possède un domaine présentant un motif Ribosomal RNA adenine methylase transferase que l'on trouve dans un large nombre de proteine impliqué dans le transfert de groupements methyle .Cette famille de protéine inclue les rRNA adenine dimethylases(KsgA)

ainsi que les Erythromycin resistance methylases (Erm). .

l'enzyme bactérienne KsgA permet le transfert d'un total de 4 groupements methyl de la S-adenosyl-l-methionine à deux autres bases adenosines dans l'ARNr 16S.Cetta enzyme semble bien conservée dans les espèces de eubactéries ,eucaryote, et archée.





RÉSULTATS BRUTS:
Translation	92BC9B5BE7A7B5B3	166	HMMPfam	PF00398	RrnaAD	11	165	5.8e-28	T	06-Apr-2010	IPR001737	Ribosomal RNA adenine methylase transferase	Biological Process: rRNA modification (GO:0000154), Molecular Function: rRNA (adenine-N6,N6-)-dimethyltransferase activity (GO:0000179), Molecular Function: rRNA methyltransferase activity (GO:0008649)
Translation	92BC9B5BE7A7B5B3	166	Gene3D	G3DSA:3.40.50.150	no description	8	103	1.1e-25	T	06-Apr-2010	NULL	NULL	
Translation	92BC9B5BE7A7B5B3	166	PatternScan	PS00213	LIPOCALIN	2	13	NA	?	06-Apr-2010	IPR022272	Lipocalin conserved site	
Translation	92BC9B5BE7A7B5B3	166	HMMPanther	PTHR11727	DIMETHYLADENOSINE TRANSFERASE	9	161	2.7e-29	T	06-Apr-2010	IPR001737	Ribosomal RNA adenine methylase transferase	Biological Process: rRNA modification (GO:0000154), Molecular Function: rRNA (adenine-N6,N6-)-dimethyltransferase activity (GO:0000179), Molecular Function: rRNA methyltransferase activity (GO:0008649)
Translation	92BC9B5BE7A7B5B3	166	superfamily	SSF53335	S-adenosyl-L-methionine-dependent methyltransferases	8	166	2.7e-41	T	06-Apr-2010	NULL	NULL	


Phylogeny

PROTOCOLE:

1. Phylogeny.fr/PhyML/ groupe extérieur:archées et eucaryotes

2. Phylogeny.fr/BioNJ/ pas de bootstrap/ default substitution model/ groupe extérieur:archées et eucaryotes


ANALYSE DES RÉSULTATS:

Les résultats obtenus grâce aux deux analyses PhyML et BioNJ nous donne deux arbres différent.En effet l'analyse BioNJ nous donne un arbre qui est en concordance avec notre analyse, c'est à dire que les sequences appartenant aux groupe extérieurs sont enraciné dans l'arbre et separées du groupe d'etude.cela signifie que notre sequence appartient a la famille des bactéries et forme un groupe monophylétique avec Leptospirillum_ferrodiazotrophum et partagent donc le même ancêtre commun.Les sequences du groupe exterieur sont dans ce cas percues comme des sequences appartenant à d'autres groupes taxonomiques mais dont la fonction ainsi que le motif protéique sont trés bien conservé par apport a notre sequence.

.

L'analyse PhyML nous donne un arbre différent qui ne concorde pas avec celui obtenu précedement .En effet les sequences du groupe exterieur et du groupe d'études ne sont pas séparées.Notre sequence partageant un ancetre commun avec des bactéries mais aussi des archées et des eucaryotes.


De ce fait , les arbres obtenus ne nous permettent pas de conclure quand à l'appartenance de notre séquence à un groupe taxonomique précis.

RÉSULTATS BRUTS:

1)BioNJ:

                                                                                                    -------0.2-----
 
   +--------------------------------------------------Heterocapsa_triquetra                             [dinoflagellates]
   |
 +-+                   +------------------------------------Desulfonatronospira_thiodismutans_ASO3-1    [d-proteobacteria]
 | |                   |
 | +-------------------+                      +---------------Desulfovibrio_vulgaris_str._Miyazaki_F    [d-proteobacteria]
 |                     |                      |
 |                     +----------------------+              +Desulfovibrio_vulgaris_subsp._vulgaris    [d-proteobacteria]
 |                                            |              |
 |                                            +--------------+
 |                                                           |  +---Desulfovibrio_vulgaris_RCH1         [d-proteobacteria]
 |                                                           +--+
 |                                                            --+desulfovibrio_vulgaris_subsp.          [d-proteobacteria]
 |
 |                                                     +----Rickettsia_akari_str._Hartford              [a-proteobacteria]  
 |                                                     |
 |                                                     |--Ixodes_scapularis                              [mites & ticks]
 |                                                    ++
 |                                                    ||     +-Rickettsia_typhi_str._Wilmington         [a-proteobacteria]  
 |                                                    |+-----+
 |                                                +---+      +--Rickettsia_prowazekii_str._Madrid_E     [a-proteobacteria]   
 |                                                |   |
 |                                                |   +-----Rickettsia_canadensis_str._McKiel           [a-proteobacteria]   
 |           +------------------------------------+
 |           |                                    |
 |           |                                    |     +-Rickettsia_bellii_RML369-C                    [a-proteobacteria]  
 |         +-+                                    +-----+
 |         | |                                          +-Rickettsia_bellii_OSU_85-389                  [a-proteobacteria]  
 
 |         | ||        +-------------------------------------------------------------Plasmodium         [apicomplexans]
 |    +----+ +---------+
 |    |    |           +---------------------------------------------------Paulinella_chromatophora      [cercozoans]
 |    |    |
 |    |    +----------------------------------------------------Methanosaeta_thermophila_PT            [euryarchaeotes] 
 |    |
 +----+                                               +-Chlamydophila_caviae_GPIC                      [chlamydias]
      |                                               |
      |+----------------------------------------------+
      ||                                              |-----Chlamydophila_psittaci_6BC                 [chlamydias]
      ||                                              |
      ++                                              +---Chlamydophila_felis_Fe/C-56                  [chlamydias]
       |
       |      +----------------------------GOS_1261030_Traduction_3-500_sens_indirect
       +------+
              +---------------------------------------------Leptospirillum_ferrodiazotrophum            [bacteria]


2)PhyML:
                                                                                                         ----0.2---
 
                                                              +Desulfovibrio_vulgaris_RCH1          [d-proteobacteria]       
                                                              |
                                                              |Desulfovibrio_vulgaris_              [d-proteobacteria]
                                               +--------------+
                                               |              +-Desulfovibrio_vulgaris_             [d-proteobacteria]
                            +------------------+
                            |                  +-------Desulfovibrio_vulgaris_str.                  [d-proteobacteria]
        +-------------------+
        |                   |
 +------+                   +-------------------Desulfonatronospira_thiodismutans_ASO3-1            [d-proteobacteria]
 |      |
 |      |                      +---------------------------------Plasmodium_yoelii_yoelii_          [apicomplexans]
 |      +----------------------+
 |                             +-------------------Heterocapsa_triquetra                            [dinoflagellates]
 |
 |      +---------------------GOS_1261030_Traduction_3-500_sens_indirect
 |      |
 |      |  +-------------------------------------Leptospirillum_ferrodiazotrophum                       [bacteria]    
 |      |  |
 |      |  |        +----------------------------------------------------------Paulinella_chromatophora [cercozoans]
 +------+  |        |
        |  |        |     +-------------------------------------------------------------Methanosaeta    [euryarchaeotes] 
        |  |   +----+     |
        |  |   |    |     |
        +--+   |    +-----+                               +Rickettsia_bellii_RML369-C                [a-proteobacteria]  
           |   |          |                         +-----+
           |   |          |                         |     +Rickettsia_bellii_OSU_85-389              [a-proteobacteria]  
           |   |          +-------------------------+
           |   |                                    |  +---Rickettsia_canadensis_str._McKiel         [a-proteobacteria]  
           |   |                                    |  |
           |   |                                    +--++-Ixodes_scapularis                           [mites & ticks]
           +---+                                       ||
               |                                       +++--Rickettsia_akari_str._Hartford           [a-proteobacteria]  
               |                                        ||
               |                                        ++  +-Rickettsia_typhi_str._Wilmington       [a-proteobacteria]  
               |                                         +--+
               |                                            |
               |                                            +--Rickettsia_prowazekii_str._Madrid_E    [a-proteobacteria]  
               |
               |                                +--Chlamydophila_caviae_GPIC                           [chlamydias]
               +--------------------------------+
                                                |----Chlamydophila_psittaci_6BC                        [chlamydias]
                                                |
                                                +--Chlamydophila_felis_Fe/C-56                         [chlamydias]

Taxonomy report


protocole :


Avec 100 alignements nous avions du mal a determiner un groupe extérieur nous avons donc refait un BLAST en augmentant le nombre d'alignements,nous avons pris 1000 ,puis 5000 alignements.

Aprés le BlastP nr nous avons étudier le taxonomy report afin de degager notre groupe d'étude et notre groupe exterieur.


Les résultats obtenus par le linéage report nous montre qu'une majeure partie des sequences présentant de fortes similarités avec notre sequence appartiennent à la famille des bactéries .Les scores s'echelonnent de 129 pour le meilleur à 33 pour le moin bon.

Néanmoins de bon scores ont étés trouvé pour des séquences appartenant à des eucaryotes et des Archées.Le mmeilleur score trouvé est 114 et le moin bon est 33.


..Determination du groupe d'etude: On suppose que notre séquence appartient au groupe des bactéries car les homoloques de meilleures score appartiennent à ce groupe taxonomique.Nous pensons que des scores tels que 129 avec des E-Value de e-28 sont réelment significatifs. En effet notre sequence semble avoir des homologues dans une multitude d'espèces bactériennes mais aussi chez des eucaryotes ou des archées .Nous avons donc choisi comme groupe d'étude bactéries avec comme représentants des diverses espèces notamment des protéobactéries .

Nous avons ainsi selectionné les 20 meilleurs sequences de ce groupe.


..Determination du groupe exterieur : D'après l'arbre de la vie , nous avons choisi les eucaryotes et les archées comme groupe exterieur ,en effet après les scores des bacteries ce sont les meilleurs hits obtenus pour notre séquence .

De plus parmis ces 2 grandes familles d'organismes vivants nous obtenons par le BLAST des homologues(ayant des scores>a notre seuil) avec notre séquence .

Nous avons donc choisi comme groupe exterieur les Eucaryotes et les archées avec pour représentants des mites & ticks,apicomplexans,cercozoans,euryarchaeotes et des dinoflagellates .



analyse des resultats :


Groupe d'etude : [bacteria] Scores E-value


Leptospirillum ferrodiazotrophum [bacteria] taxid 412449

gb|EES53737.1| dimethyladenosine transferase [Leptospirill... 129 1e-28


Chlamydophila caviae GPIC [chlamydias] taxid 227941

ref|NP_829174.1| dimethyladenosine transferase [Chlamydoph... 120 5e-26

gb|AAP05052.1| dimethyladenosine transferase [Chlamydophil... 120 5e-26


Chlamydophila caviae [chlamydias] taxid 83557

sp|Q823V2.1|RSMA_CHLCV RecName: Full_Ribosomal RNA small s... 120 5e-26


Desulfovibrio vulgaris RCH1 [d-proteobacteria] taxid 573059

ref|ZP_04791089.1| dimethyladenosine transferase [Desulfov... 120 7e-26

gb|EER80545.1| dimethyladenosine transferase [Desulfovibri... 120 7e-26


Desulfovibrio vulgaris DP4 [d-proteobacteria] taxid 391774

ref|YP_966808.1| dimethyladenosine transferase [Desulfovib... 120 7e-26

sp|A1VD65.1|RSMA_DESVV RecName: Full_Ribosomal RNA small s... 120 7e-26

gb|ABM28381.1| dimethyladenosine transferase [Desulfovibri... 120 7e-26


Desulfovibrio vulgaris str. Hildenborough [d-proteobacteria] taxid 882

ref|YP_011015.1| dimethyladenosine transferase [Desulfovib... 119 8e-26

sp|Q72B41.1|RSMA_DESVH RecName: Full_Ribosomal RNA small s... 119 8e-26

gb|AAS96274.1| dimethyladenosine transferase [Desulfovibri... 119 8e-26


Chlamydophila felis Fe/C-56 [chlamydias] taxid 264202

ref|YP_515617.1| dimethyladenosine transferase [Chlamydoph... 119 1e-25

sp|Q253R6.1|RSMA_CHLFF RecName: Full_Ribosomal RNA small s... 119 1e-25

dbj|BAE81472.1| dimethyladenosine transferase [Chlamydophi... 119 1e-25


Rickettsia bellii RML369-C [a-proteobacteria] taxid 336407

ref|YP_537374.1| dimethyladenosine transferase [Rickettsia... 118 2e-25

sp|Q1RK29.1|RSMA_RICBR RecName: Full_Ribosomal RNA small s... 118 2e-25

gb|ABE04285.1| Dimethyladenosine transferase [Rickettsia b... 118 2e-25


Rickettsia bellii OSU 85-389 [a-proteobacteria] taxid 391896

ref|YP_001496714.1| dimethyladenosine transferase [Rickett... 118 2e-25

sp|A8GXS7.1|RSMA_RICB8 RecName: Full_Ribosomal RNA small s... 118 2e-25

gb|ABV79677.1| dimethyladenosine transferase [Rickettsia b... 118 2e-



Chlamydophila psittaci 6BC [chlamydias] taxid 331636

gb|ACT68006.1| dimethyladenosine transferase [Chlamydophil... 117 3e-25


Rickettsia typhi str. Wilmington [a-proteobacteria] taxid 257363

ref|YP_067608.1| dimethyladenosine transferase [Rickettsia... 117 4e-25

gb|AAU04126.1| dimethyladenosine transferase [Rickettsia t... 117 4e-25


Rickettsia typhi [a-proteobacteria] taxid 785

sp|Q68W66.1|RSMA_RICTY RecName: Full_Ribosomal RNA small s... 117 4e-25


Desulfovibrio vulgaris str. 'Miyazaki F' [d-proteobacteria] taxid 883

ref|YP_002434926.1| dimethyladenosine transferase [Desulfo... 117 5e-25

gb|ACL07458.1| dimethyladenosine transferase [Desulfovibri... 117 5e-25


Rickettsia prowazekii str. Madrid E [a-proteobacteria] taxid 272947

ref|NP_221033.1| dimethyladenosine transferase [Rickettsia... 115 1e-24


Rickettsia prowazekii [a-proteobacteria] taxid 782

sp|O05952.1|RSMA_RICPR RecName: Full_Ribosomal RNA small s... 115 1e-24

emb|CAA72482.1| dimethyladenosine transferase [Rickettsia ... 115 1e-24

emb|CAA15109.1| DIMETHYLADENOSINE TRANSFERASE (ksgA) [Rick... 115 1e-24


Rickettsia prowazekii Rp22 [a-proteobacteria] taxid 449216

gb|ADE30218.1| Dimethyladenosine transferase [Rickettsia p... 115 1e-24


Rickettsia akari str. Hartford [a-proteobacteria] taxid 293614

ref|YP_001493800.1| dimethyladenosine transferase [Rickett... 115 1e-24

sp|A8GPG7.1|RSMA_RICAH RecName: Full_Ribosomal RNA small s... 115 1e-24

gb|ABV75292.1| dimethyladenosine transferase [Rickettsia a... 115 1e-24


Desulfonatronospira thiodismutans ASO3-1 [d-proteobacteria] taxid 555779

ref|ZP_03736278.1| dimethyladenosine transferase [Desulfon... 115 2e-24

gb|EEG82044.1| dimethyladenosine transferase [Desulfonatro... 115 2e-24


Rickettsia canadensis str. McKiel [a-proteobacteria] taxid 293613

ref|YP_001492601.1| dimethyladenosine transferase [Rickett... 115 2e-24

sp|A8EZN3.1|RSMA_RICCK RecName: Full_Ribosomal RNA small s... 115 2e-24

gb|ABV73816.1| dimethyladenosine transferase [Rickettsia c... 115 2e-24


groupe extérieur :


Ixodes scapularis (shoulder tick, ...) [mites & ticks] taxid 6945

ref|XP_002408487.1| ribosomal RNA adenine dimethylase, put... 114 3e-24



Plasmodium yoelii yoelii str. 17XNL [apicomplexans] taxid 352914

ref|XP_726907.1| dimethyladenosine transferase [Plasmodium... 90 6e-17


Paulinella chromatophora [cercozoans] taxid 39717

ref|YP_002048899.1| putative rRNA (adenine-N6,N6)- dimethy... 88 2e-16



.Methanosaeta thermophila PT [euryarchaeotes] taxid 349307

ref|YP_843421.1| dimethyladenosine transferase [Methanosae... 86 1e-15


Heterocapsa triquetra [dinoflagellates] taxid 66468

gb|AAW79335.1| chloroplast dimethyladenosine synthase [Het... 82 1e-14





RÉSULTATS BRUTS:

root
. cellular organisms
. . Bacteria           [bacteria]
. . . Nitrospiraceae     [bacteria]
. . . . Leptospirillum     [bacteria]
. . . . . Leptospirillum ferrodiazotrophum -------------------------------------  129  1 hit  [bacteria]               dimethyladenosine transferase [Leptospirillum ferrodiazotro
. . . . . Leptospirillum rubarum ...............................................   82  1 hit  [bacteria]               putative dimethyladenosine transferase [Leptospirillum ruba
. . . . . Leptospirillum sp. Group II '5-way CG' ...............................   81  1 hit  [bacteria]               Putative dimethyladenosine transferase [Leptospirillum sp. 
. . . . Thermodesulfovibrio yellowstonii DSM 11347 -----------------------------   83  2 hits [bacteria]               dimethyladenosine transferase [Thermodesulfovibrio yellowst
. . . Chlamydophila caviae GPIC ------------------------------------------------  120  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila caviae GPIC] >
. . . Chlamydophila caviae .....................................................  120  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydophila caviae GPIC] >
. . . Desulfovibrio vulgaris RCH1 ..............................................  120  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio vulgaris RCH1]
. . . Desulfovibrio vulgaris DP4 ...............................................  120  3 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio vulgaris subsp
. . . Desulfovibrio vulgaris str. Hildenborough ................................  119  3 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio vulgaris subsp
. . . Chlamydophila felis Fe/C-56 ..............................................  119  3 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila felis Fe/C-56]
. . . Rickettsia bellii RML369-C ...............................................  118  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia bellii RML369-C] 
. . . Rickettsia bellii OSU 85-389 .............................................  118  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia bellii OSU 85-389
. . . Chlamydophila psittaci 6BC ...............................................  117  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydophila psittaci 6BC]
. . . Rickettsia typhi str. Wilmington .........................................  117  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia typhi str. Wilmin
. . . Rickettsia typhi .........................................................  117  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rickettsia typhi str. Wilmin
. . . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  117  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio vulgaris str. 
. . . Rickettsia prowazekii str. Madrid E ......................................  115  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rickettsia prowazekii str. M
. . . Rickettsia prowazekii ....................................................  115  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia prowazekii str. M
. . . Rickettsia prowazekii Rp22 ...............................................  115  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rickettsia prowazekii str. M
. . . Rickettsia akari str. Hartford ...........................................  115  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia akari str. Hartfo
. . . Desulfonatronospira thiodismutans ASO3-1 .................................  115  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfonatronospira thiodism
. . . Rickettsia canadensis str. McKiel ........................................  115  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia canadensis str. M
. . . Chlamydophila abortus S26/3 ..............................................  115  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila abortus S26/3]
. . . Chlamydophila abortus ....................................................  115  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydophila abortus S26/3]
. . . Rickettsia endosymbiont of Ixodes scapularis .............................  114  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia endosymbiont of I
. . . Parachlamydia acanthamoebae str. Hall's coccus ...........................  113  2 hits [chlamydias]             hypothetical protein pah_c200o016 [Parachlamydia acanthamoe
. . . Magnetococcus sp. MC-1 ...................................................  113  3 hits [proteobacteria]         dimethyladenosine transferase [Magnetococcus sp. MC-1] >gi|
. . . Rickettsia rickettsii str. 'Sheila Smith' ................................  113  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia rickettsii str. '
. . . Chlamydia trachomatis B/Jali20/OT ........................................  113  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis B/Jali
. . . Rickettsia rickettsii str. Iowa ..........................................  113  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia rickettsii str. I
. . . Rickettsia conorii str. Malish 7 .........................................  113  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia conorii str. Mali
. . . Acinetobacter sp. RUH2624 ................................................  112  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter sp. RUH2624] >
. . . Lawsonia intracellularis PHE/MN1-00 ......................................  112  3 hits [d-proteobacteria]       dimethyladenosine transferase [Lawsonia intracellularis PHE
. . . Rickettsia massiliae MTU5 ................................................  112  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia massiliae MTU5] >
. . . Acinetobacter baumannii ATCC 17978 .......................................  112  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N'N'-adenosyl [Acinetobacter baumann
. . . Rickettsia conorii .......................................................  112  1 hit  [a-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Rickettsia sibirica 246 ..................................................  112  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia sibirica 246] >gi
. . . Acinetobacter baumannii SDF ..............................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii AYE ..............................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii ACICU ............................................  112  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii AB0057 ...........................................  112  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii AB900 ............................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii ATCC 19606 .......................................  112  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter sp. 6013113 ................................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter sp. 6014059 ................................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter sp. 6013150 ................................................  112  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter baumannii ..................................................  112  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Chlamydophila pneumoniae TW-183 ..........................................  112  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae TW-
. . . Chlamydophila pneumoniae LPCoLN ..........................................  112  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae LPC
. . . Rickettsia peacockii str. Rustic .........................................  112  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia peacockii str. Ru
. . . Acinetobacter calcoaceticus RUH2202 ......................................  112  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter calcoaceticus 
. . . Chlamydia trachomatis 6276 ...............................................  112  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis 6276] 
. . . Chlamydia trachomatis 6276s ..............................................  112  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis 6276] 
. . . Chlamydia trachomatis D/UW-3/CX ..........................................  112  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D/UW-3
. . . Chlamydia trachomatis A/HAR-13 ...........................................  112  3 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D/UW-3
. . . Chlamydia trachomatis 434/Bu .............................................  112  3 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D/UW-3
. . . Chlamydia trachomatis L2b/UCH-1/proctitis ................................  112  3 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D/UW-3
. . . Chlamydia trachomatis ....................................................  112  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D/UW-3
. . . Chlamydia trachomatis D(s)2923 ...........................................  111  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D(s)29
. . . Chlamydia trachomatis Sweden2 ............................................  111  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis D(s)29
. . . Chlamydia trachomatis 70 .................................................  111  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis 70] >g
. . . Chlamydia trachomatis 70s ................................................  111  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis 70] >g
. . . Rubrobacter xylanophilus DSM 9941 ........................................  111  3 hits [high GC Gram+]          dimethyladenosine transferase [Rubrobacter xylanophilus DSM
. . . Chlamydophila pneumoniae CWL029 ..........................................  111  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae CWL
. . . Chlamydophila pneumoniae J138 ............................................  111  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae CWL
. . . Chlamydophila pneumoniae AR39 ............................................  111  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae CWL
. . . Chlamydophila pneumoniae .................................................  111  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydophila pneumoniae CWL
. . . Gardnerella vaginalis ATCC 14019 .........................................  110  2 hits [high GC Gram+]          possible dimethyladenosine transferase [Gardnerella vaginal
. . . Xenorhabdus bovienii SS-2004 .............................................  110  2 hits [enterobacteria]         S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Neisseria gonorrhoeae FA6140 .............................................  110  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae FA6140]
. . . Acinetobacter sp. SH024 ..................................................  110  2 hits [g-proteobacteria]       conserved hypothetical protein [Acinetobacter sp. SH024] >g
. . . Providencia alcalifaciens DSM 30120 ......................................  110  2 hits [enterobacteria]         hypothetical protein PROVALCAL_02269 [Providencia alcalifac
. . . Rickettsia africae ESF-5 .................................................  110  3 hits [a-proteobacteria]       Dimethyladenosine transferase [Rickettsia africae ESF-5] >g
. . . Neisseria sicca ATCC 29256 ...............................................  110  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria sicca ATCC 29256] 
. . . Providencia rettgeri DSM 1131 ............................................  110  2 hits [enterobacteria]         dimethyladenosine transferase [Providencia rettgeri DSM 113
. . . Syntrophobacter fumaroxidans MPOB ........................................  110  2 hits [d-proteobacteria]       dimethyladenosine transferase [Syntrophobacter fumaroxidans
. . . Neisseria mucosa ATCC 25996 ..............................................  110  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria mucosa ATCC 25996]
. . . Acinetobacter lwoffii SH145 ..............................................  110  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter lwoffii SH145]
. . . Neisseria meningitidis MC58 ..............................................  110  4 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis MC58]
. . . Neisseria meningitidis serogroup B .......................................  110  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis MC58]
. . . Neisseria meningitidis FAM18 .............................................  110  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis FAM18
. . . Legionella drancourtii LLAP12 ............................................  109  2 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella drancourtii LLAP1
. . . Mesorhizobium loti MAFF303099 ............................................  109  2 hits [a-proteobacteria]       dimethyladenosine transferase [Mesorhizobium loti MAFF30309
. . . Mesorhizobium loti .......................................................  109  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Mesorhizobium loti MAFF30309
. . . Neisseria meningitidis alpha275 ..........................................  109  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis serog
. . . Desulfohalobium retbaense DSM 5692 .......................................  109  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfohalobium retbaense DS
. . . Desulfovibrio aespoeensis Aspo-2 .........................................  109  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio aespoeensis As
. . . Clostridium papyrosolvens DSM 2782 .......................................  109  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium papyrosolvens DS
. . . Neisseria flavescens NRL30031/H210 .......................................  109  2 hits [b-proteobacteria]       hypothetical protein NEIFLAOT_00629 [Neisseria flavescens N
. . . Methylophaga thiooxidans DMS010 ..........................................  109  2 hits [g-proteobacteria]       dimethyladenosine transferase [Methylophaga thiooxidans DMS
. . . Legionella longbeachae D-4968 ............................................  109  2 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella longbeachae D-496
. . . Legionella longbeachae NSW150 ............................................  109  2 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella longbeachae D-496
. . . Chlamydia trachomatis B/TZ1A828/OT .......................................  108  2 hits [chlamydias]             dimethyladenosine transferase [Chlamydia trachomatis B/TZ1A
. . . Clavibacter michiganensis subsp. michiganensis NCPPB 382 .................  108  2 hits [high GC Gram+]          dimethyladenosine transferase [Clavibacter michiganensis su
. . . Neisseria elongata subsp. glycolytica ATCC 29315 .........................  108  2 hits [b-proteobacteria]       hypothetical protein NEIELOOT_01401 [Neisseria elongata sub
. . . Neisseria meningitidis Z2491 .............................................  108  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis Z2491
. . . Neisseria meningitidis alpha14 ...........................................  108  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis Z2491
. . . Neisseria meningitidis serogroup A .......................................  108  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis Z2491
. . . Bifidobacterium dentium Bd1 ..............................................  108  2 hits [high GC Gram+]          KsgA Dimethyladenosine transferase [Bifidobacterium dentium
. . . Neisseria cinerea ATCC 14685 .............................................  108  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria cinerea ATCC 14685
. . . Neisseria meningitidis alpha153 ..........................................  108  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis alpha
. . . Neisseria gonorrhoeae NCCP11945 ..........................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae 35/02 ..............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae DGI18 ..............................................  108  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae FA19 ...............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae PID18 ..............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae PID1 ...............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae PID24-1 ............................................  108  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae PID332 .............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae SK-92-679 ..........................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae SK-93-1035 .........................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae DGI2 ...............................................  108  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Neisseria gonorrhoeae ....................................................  108 33 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11
. . . Syntrophomonas wolfei subsp. wolfei str. Goettingen ......................  108  2 hits [firmicutes]             rRNA (adenine-N(6)-)-methyltransferase [Syntrophomonas wolf
. . . Neisseria flavescens SK114 ...............................................  108  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria flavescens SK114] 
. . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  108  3 hits [enterobacteria]         dimethyladenosine transferase [Candidatus Blochmannia penns
. . . Bifidobacterium dentium ATCC 27678 .......................................  108  2 hits [high GC Gram+]          hypothetical protein BIFDEN_00841 [Bifidobacterium dentium 
. . . Clavibacter michiganensis subsp. sepedonicus .............................  108  2 hits [high GC Gram+]          dimethyladenosine transferase [Clavibacter michiganensis su
. . . Actinomyces odontolyticus F0309 ..........................................  108  2 hits [high GC Gram+]          dimethyladenosine transferase [Actinomyces odontolyticus F0
. . . Acinetobacter radioresistens SK82 ........................................  108  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter radioresistens
. . . Acinetobacter radioresistens SH164 .......................................  108  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter radioresistens
. . . Acinetobacter sp. ADP1 ...................................................  108  3 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Mycoplasma penetrans HF-2 ................................................  108  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma penetrans HF-2] >
. . . Mycoplasma penetrans .....................................................  108  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma penetrans HF-2] >
. . . Atopobium parvulum DSM 20469 .............................................  108  2 hits [high GC Gram+]          dimethyladenosine transferase [Atopobium parvulum DSM 20469
. . . Saccharomonospora viridis DSM 43017 ......................................  107  2 hits [high GC Gram+]          dimethyladenosine transferase [Saccharomonospora viridis DS
. . . Acinetobacter venetianus .................................................  107  1 hit  [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Methylococcus capsulatus str. Bath .......................................  107  2 hits [g-proteobacteria]       dimethyladenosine transferase [Methylococcus capsulatus str
. . . Methylococcus capsulatus .................................................  107  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Methylococcus capsulatus str
. . . Neisseria gonorrhoeae FA 1090 ............................................  107  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae FA 109
. . . Neisseria gonorrhoeae F62 ................................................  107  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae FA 109
. . . Neisseria gonorrhoeae MS11 ...............................................  107  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae MS11] 
. . . Neisseria gonorrhoeae 1291 ...............................................  107  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria gonorrhoeae MS11] 
. . . Marinobacter aquaeolei VT8 ...............................................  107  3 hits [g-proteobacteria]       dimethyladenosine transferase [Marinobacter aquaeolei VT8] 
. . . Shewanella sp. MR-7 ......................................................  107  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. MR-7] >gi|123
. . . Shewanella sp. ANA-3 .....................................................  107  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. ANA-3] >gi|16
. . . Neisseria lactamica ATCC 23970 ...........................................  107  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria lactamica ATCC 239
. . . Corynebacterium genitalium ATCC 33030 ....................................  107  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium genitalium A
. . . Actinomyces odontolyticus ATCC 17982 .....................................  107  2 hits [high GC Gram+]          hypothetical protein ACTODO_02132 [Actinomyces odontolyticu
. . . Corynebacterium jeikeium ATCC 43734 ......................................  107  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium jeikeium ATC
. . . Acinetobacter junii SH205 ................................................  107  2 hits [g-proteobacteria]       dimethyladenosine transferase [Acinetobacter junii SH205] >
. . . Collinsella intestinalis DSM 13280 .......................................  107  2 hits [high GC Gram+]          hypothetical protein COLINT_03499 [Collinsella intestinalis
. . . Nakamurella multipartita DSM 44233 .......................................  107  4 hits [high GC Gram+]          dimethyladenosine transferase [Nakamurella multipartita DSM
. . . Carboxydothermus hydrogenoformans Z-2901 .................................  107  3 hits [firmicutes]             dimethyladenosine transferase [Carboxydothermus hydrogenofo
. . . Acinetobacter johnsonii SH046 ............................................  107  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [
. . . Providencia stuartii ATCC 25827 ..........................................  107  2 hits [enterobacteria]         hypothetical protein PROSTU_01151 [Providencia stuartii ATC
. . . Candidatus Protochlamydia amoebophila UWE25 ..............................  107  3 hits [chlamydias]             dimethyladenosine transferase [Candidatus Protochlamydia am
. . . Wolbachia endosymbiont of Muscidifurax uniraptor .........................  107  2 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Mu
. . . Clostridium thermocellum ATCC 27405 ......................................  107  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium thermocellum ATC
. . . Clostridium thermocellum DSM 2360 ........................................  107  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium thermocellum ATC
. . . Clostridium thermocellum JW20 ............................................  107  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium thermocellum ATC
. . . Neisseria meningitidis 8013 ..............................................  107  1 hit  [b-proteobacteria]       dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Arsenophonus nasoniae ....................................................  106  1 hit  [enterobacteria]         dimethyladenosine transferase [Arsenophonus nasoniae]
. . . Wolbachia endosymbiont of Drosophila ananassae ...........................  106  2 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Dr
. . . Providencia rustigianii DSM 4541 .........................................  106  2 hits [enterobacteria]         hypothetical protein PROVRUST_06046 [Providencia rustigiani
. . . Bifidobacterium animalis subsp. lactis HN019 .............................  106  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium animalis sub
. . . Bifidobacterium animalis subsp. lactis AD011 .............................  106  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium animalis sub
. . . Bifidobacterium animalis subsp. lactis Bl-04 .............................  106  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium animalis sub
. . . Bifidobacterium animalis subsp. lactis DSM 10140 .........................  106  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium animalis sub
. . . Chlamydia muridarum Nigg .................................................  106  3 hits [chlamydias]             dimethyladenosine transferase [Chlamydia muridarum Nigg] >g
. . . Chlamydia muridarum Weiss ................................................  106  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia muridarum Nigg] >g
. . . Chlamydia muridarum (agent of mouse pneumon...) ..........................  106  1 hit  [chlamydias]             dimethyladenosine transferase [Chlamydia muridarum Nigg] >g
. . . Neisseria subflava NJ9703 ................................................  106  2 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria subflava NJ9703] >
. . . Wolbachia sp. wRi ........................................................  106  3 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia sp. wRi] >gi|25480
. . . Bifidobacterium angulatum DSM 20098 ......................................  106  2 hits [high GC Gram+]          hypothetical protein BIFANG_02235 [Bifidobacterium angulatu
. . . Wolbachia endosymbiont of Drosophila simulans ............................  106  2 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Dr
. . . Staphylococcus haemolyticus JCSC1435 .....................................  106  5 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus haemolyticus 
. . . Bifidobacterium animalis subsp. lactis BB-12 .............................  106  1 hit  [high GC Gram+]          Dimethyladenosine transferase [Bifidobacterium animalis sub
. . . Methylophilales bacterium HTCC2181 .......................................  106  2 hits [b-proteobacteria]       dimethyladenosine transferase [Methylophilales bacterium HT
. . . Ehrlichia ruminantium str. Gardel ........................................  106  3 hits [a-proteobacteria]       dimethyladenosine transferase [Ehrlichia ruminantium str. G
. . . Bacteroides capillosus ATCC 29799 ........................................  105  2 hits [CFB group bacteria]     hypothetical protein BACCAP_02129 [Bacteroides capillosus A
. . . Ehrlichia ruminantium str. Welgevonden ...................................  105  5 hits [a-proteobacteria]       dimethyladenosine transferase [Ehrlichia ruminantium str. W
. . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  105  2 hits [enterobacteria]         dimethyladenosine transferase [Photorhabdus luminescens sub
. . . Photorhabdus luminescens subsp. laumondii ................................  105  1 hit  [enterobacteria]         dimethyladenosine transferase [Photorhabdus luminescens sub
. . . Acinetobacter sp. ATCC 27244 .............................................  105  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Acinetobacter haemolyticus ATCC 19194 ....................................  105  2 hits [g-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Corynebacterium lipophiloflavum DSM 44291 ................................  105  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium lipophilofla
. . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................  105  2 hits [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. Tuc
. . . Photorhabdus asymbiotica .................................................  105  2 hits [enterobacteria]         dimethyladenosine transferase [Photorhabdus asymbiotica] >g
. . . Shewanella oneidensis MR-1 ...............................................  105  2 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella oneidensis MR-1] 
. . . Shewanella oneidensis ....................................................  105  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Shewanella oneidensis MR-1] 
. . . Orientia tsutsugamushi str. Ikeda ........................................  105  2 hits [a-proteobacteria]       dimethyladenosine transferase [Orientia tsutsugamushi str. 
. . . Shewanella sp. MR-4 ......................................................  105  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. MR-4] >gi|123
. . . Corynebacterium aurimucosum ATCC 700975 ..................................  105  3 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium aurimucosum 
. . . Brevundimonas sp. BAL3 ...................................................  105  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brevundimonas sp. BAL3] >gi|
. . . Staphylococcus warneri L37603 ............................................  105  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus warneri L3760
. . . Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum) ......................  105  1 hit  [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. LSR
. . . Neisseria meningitidis 053442 ............................................  105  3 hits [b-proteobacteria]       dimethyladenosine transferase [Neisseria meningitidis 05344
. . . Tolumonas auensis DSM 9187 ...............................................  105  3 hits [g-proteobacteria]       dimethyladenosine transferase [Tolumonas auensis DSM 9187] 
. . . Nitrosococcus oceani ATCC 19707 ..........................................  105  3 hits [g-proteobacteria]       16S rRNA dimethylase [Nitrosococcus oceani ATCC 19707] >gi|
. . . Nitrosococcus oceani AFC27 ...............................................  105  2 hits [g-proteobacteria]       16S rRNA dimethylase [Nitrosococcus oceani ATCC 19707] >gi|
. . . Hoeflea phototrophica DFL-43 .............................................  104  2 hits [a-proteobacteria]       dimethyladenosine transferase [Hoeflea phototrophica DFL-43
. . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................  104  2 hits [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. 5A 
. . . Wolbachia endosymbiont strain TRS of Brugia malayi .......................  104  3 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont strai
. . . Mesorhizobium opportunistum WSM2075 ......................................  104  2 hits [a-proteobacteria]       dimethyladenosine transferase [Mesorhizobium opportunistum 
. . . Alcanivorax sp. DG881 ....................................................  104  2 hits [g-proteobacteria]       dimethyladenosine transferase [Alcanivorax sp. DG881] >gi|1
. . . Corynebacterium glucuronolyticum ATCC 51867 ..............................  104  4 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium glucuronolyt
. . . Oceanicaulis alexandrii HTCC2633 .........................................  104  2 hits [a-proteobacteria]       dimethyladenosine transferase [Oceanicaulis alexandrii HTCC
. . . Bacillus tusciae DSM 2912 ................................................  104  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus tusciae DSM 2912]
. . . Nitrosococcus halophilus Nc4 .............................................  104  2 hits [g-proteobacteria]       dimethyladenosine transferase [Nitrosococcus halophilus Nc4
. . . Citrobacter sp. 30_2 .....................................................  103  2 hits [enterobacteria]         dimethyladenosine transferase [Citrobacter sp. 30_2] >gi|22
. . . Phenylobacterium zucineum HLK1 ...........................................  103  3 hits [a-proteobacteria]       dimethyladenosine transferase [Phenylobacterium zucineum HL
. . . Corynebacterium jeikeium K411 ............................................  103  5 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium jeikeium K41
. . . gamma proteobacterium HTCC5015 ...........................................  103  2 hits [g-proteobacteria]       dimethyladenosine transferase [gamma proteobacterium HTCC50
. . . Chelativorans sp. BNC1 ...................................................  103  3 hits [a-proteobacteria]       dimethyladenosine transferase [Mesorhizobium sp. BNC1] >gi|
. . . Desulfovibrio piger ATCC 29098 ...........................................  103  2 hits [d-proteobacteria]       hypothetical protein DESPIG_00281 [Desulfovibrio piger ATCC
. . . Shewanella sp. W3-18-1 ...................................................  103  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. W3-18-1] >gi|
. . . Shewanella putrefaciens 200 ..............................................  103  2 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. W3-18-1] >gi|
. . . Shewanella putrefaciens CN-32 ............................................  103  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sp. W3-18-1] >gi|
. . . Kangiella koreensis DSM 16069 ............................................  103  2 hits [g-proteobacteria]       dimethyladenosine transferase [Kangiella koreensis DSM 1606
. . . Capnocytophaga gingivalis ATCC 33624 .....................................  103  2 hits [CFB group bacteria]     dimethyladenosine transferase [Capnocytophaga gingivalis AT
. . . Caulobacter crescentus CB15 ..............................................  103  2 hits [a-proteobacteria]       dimethyladenosine transferase [Caulobacter crescentus CB15]
. . . Caulobacter vibrioides ...................................................  103  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Caulobacter crescentus CB15]
. . . Bifidobacterium bifidum NCIMB 41171 ......................................  103  1 hit  [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium bifidum NCIM
. . . Parascardovia denticolens F0305 ..........................................  103  2 hits [high GC Gram+]          dimethyladenosine transferase [Parascardovia denticolens F0
. . . Corynebacterium glucuronolyticum ATCC 51866 ..............................  103  4 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium glucuronolyt
. . . Caulobacter crescentus NA1000 ............................................  103  2 hits [a-proteobacteria]       dimethyladenosine transferase [Caulobacter crescentus NA100
. . . Buchnera aphidicola str. APS (Acyrthosiphon pisum) .......................  103  2 hits [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. APS
. . . Buchnera aphidicola (Acyrthosiphon pisum) ................................  103  1 hit  [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. APS
. . . Buchnera sp. .............................................................  103  1 hit  [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. APS
. . . Clostridium cellulolyticum H10 ...........................................  103  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium cellulolyticum H
. . . Wolbachia endosymbiont of Culex quinquefasciatus Pel .....................  103  3 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Cu
. . . Wolbachia endosymbiont of Culex quinquefasciatus JHB .....................  103  2 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Cu
. . . Frankia sp. EUN1f ........................................................  103  2 hits [high GC Gram+]          ribosomal RNA adenine methylase transferase [Frankia sp. EU
. . . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................  103  3 hits [g-proteobacteria]       dimethyladenosine transferase [Baumannia cicadellinicola st
. . . Pseudomonas aeruginosa PAO1 ..............................................  103  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa PAO1]
. . . Pseudomonas aeruginosa ...................................................  103  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa PAO1]
. . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa UCBPP
. . . Pseudomonas aeruginosa LESB58 ............................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa UCBPP
. . . Pseudomonas aeruginosa C3719 .............................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa UCBPP
. . . Parvibaculum lavamentivorans DS-1 ........................................  102  2 hits [a-proteobacteria]       dimethyladenosine transferase [Parvibaculum lavamentivorans
. . . Brevundimonas subvibrioides ATCC 15264 ...................................  102  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brevundimonas subvibrioides 
. . . Rhodococcus opacus B4 ....................................................  102  3 hits [high GC Gram+]          dimethyladenosine transferase [Rhodococcus opacus B4] >gi|2
. . . Candidatus Blochmannia floridanus ........................................  102  3 hits [enterobacteria]         dimethyladenosine transferase [Candidatus Blochmannia flori
. . . Enterobacter cloacae subsp. cloacae ATCC 13047 ...........................  102  1 hit  [enterobacteria]         dimethyladenosine transferase [Enterobacter cloacae subsp. 
. . . Orientia tsutsugamushi str. Boryong ......................................  102  2 hits [a-proteobacteria]       dimethyladenosine transferase [Orientia tsutsugamushi str. 
. . . Pediococcus pentosaceus ATCC 25745 .......................................  102  3 hits [firmicutes]             dimethyladenosine transferase [Pediococcus pentosaceus ATCC
. . . Marinobacter sp. ELB17 ...................................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Marinobacter sp. ELB17] >gi|
. . . Citrobacter youngae ATCC 29220 ...........................................  102  2 hits [enterobacteria]         dimethyladenosine transferase [Citrobacter youngae ATCC 292
. . . Enterococcus faecium 1,231,408 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,231,4
. . . Bermanella marisrubri ....................................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Oceanobacter sp. RED65] >gi|
. . . Thermotoga sp. RQ2 .......................................................  102  3 hits [thermotogales]          dimethyladenosine transferase [Thermotoga sp. RQ2] >gi|2267
. . . Nocardia farcinica IFM 10152 .............................................  102  2 hits [high GC Gram+]          dimethyladenosine transferase [Nocardia farcinica IFM 10152
. . . Nocardia farcinica .......................................................  102  1 hit  [high GC Gram+]          dimethyladenosine transferase [Nocardia farcinica IFM 10152
. . . Collinsella aerofaciens ATCC 25986 .......................................  102  2 hits [high GC Gram+]          Hypothetical protein COLAER_01138 [Collinsella aerofaciens 
. . . Aurantimonas manganoxydans SI85-9A1 ......................................  102  2 hits [a-proteobacteria]       dimethyladenosine transferase [Aurantimonas manganoxydans S
. . . Enterococcus faecium TC 6 ................................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TC 6] >
. . . Enterococcus faecium D344SRF .............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TC 6] >
. . . Enterococcus faecium E1636 ...............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TC 6] >
. . . Enterococcus faecium E1679 ...............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TC 6] >
. . . Novosphingobium aromaticivorans DSM 12444 ................................  102  3 hits [a-proteobacteria]       dimethyladenosine transferase [Novosphingobium aromaticivor
. . . Enterococcus faecium 1,230,933 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium 1,231,502 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium 1,231,501 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium 1,231,410 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium DO ..................................................  102  1 hit  [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium C68 .................................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium E1162 ...............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium E1071 ...............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Enterococcus faecium U0317 ...............................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium 1,230,9
. . . Blattabacterium sp. (Periplaneta americana) str. BPLAN ...................  102  2 hits [CFB group bacteria]     dimethyladenosine transferase [Blattabacterium sp. (Peripla
. . . Bifidobacterium adolescentis ATCC 15703 ..................................  102  3 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium adolescentis
. . . Rhodobacterales bacterium HTCC2255 .......................................  102  3 hits [a-proteobacteria]       dimethyladenosine transferase [alpha proteobacterium HTCC22
. . . Streptococcus mitis B6 ...................................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus mitis B6] >gi|
. . . Bacillus coahuilensis m4-4 ...............................................  102  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus coahuilensis m4-4]
. . . Bifidobacterium adolescentis L2-32 .......................................  102  2 hits [high GC Gram+]          hypothetical protein BIFADO_00135 [Bifidobacterium adolesce
. . . Eubacterium rectale ATCC 33656 ...........................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Eubacterium rectale ATCC 336
. . . Bifidobacterium breve DSM 20213 ..........................................  102  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium breve DSM 20
. . . Staphylococcus epidermidis M23864:W1 .....................................  102  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis M
. . . Vibrio coralliilyticus ATCC BAA-450 ......................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio coralliilyticus ATCC 
. . . Aliivibrio salmonicida LFI1238 ...........................................  102  3 hits [g-proteobacteria]       dimethyladenosine transferase [Aliivibrio salmonicida LFI12
. . . Pseudomonas aeruginosa PACS2 .............................................  102  1 hit  [g-proteobacteria]       hypothetical protein PaerPA_01000591 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa 2192 ..............................................  102  2 hits [g-proteobacteria]       hypothetical protein PaerPA_01000591 [Pseudomonas aeruginos
. . . gamma proteobacterium NOR5-3 .............................................  102  2 hits [g-proteobacteria]       dimethyladenosine transferase [gamma proteobacterium NOR5-3
. . . Corynebacterium matruchotii ATCC 14266 ...................................  101  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium matruchotii 
. . . Shewanella baltica OS155 .................................................  101  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella baltica OS155] >g
. . . Shewanella baltica OS223 .................................................  101  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella baltica OS155] >g
. . . Bifidobacterium pseudocatenulatum DSM 20438 ..............................  101  2 hits [high GC Gram+]          hypothetical protein BIFPSEUDO_03972 [Bifidobacterium pseud
. . . Corynebacterium matruchotii ATCC 33806 ...................................  101  2 hits [high GC Gram+]          hypothetical protein CORMATOL_03081 [Corynebacterium matruc
. . . Shewanella baltica OS185 .................................................  101  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella baltica OS185] >g
. . . Shewanella baltica OS195 .................................................  101  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella baltica OS185] >g
. . . Capnocytophaga sputigena ATCC 33612 ......................................  101  2 hits [CFB group bacteria]     dimethyladenosine transferase [Capnocytophaga sputigena Cap
. . . Bifidobacterium pseudocatenulatum D2CA ...................................  101  1 hit  [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium pseudocatenu
. . . Thermotoga maritima MSB8 .................................................  101  2 hits [thermotogales]          dimethyladenosine transferase [Thermotoga maritima MSB8] >g
. . . Thermotoga maritima ......................................................  101  1 hit  [thermotogales]          dimethyladenosine transferase [Thermotoga maritima MSB8] >g
. . . alpha proteobacterium BAL199 .............................................  101  2 hits [a-proteobacteria]       16S rRNA dimethylase [alpha proteobacterium BAL199] >gi|159
. . . Alcanivorax borkumensis SK2 ..............................................  101  3 hits [g-proteobacteria]       ribosomal RNA adenine dimethylase [Alcanivorax borkumensis 
. . . Acidiphilium cryptum JF-5 ................................................  101  2 hits [a-proteobacteria]       dimethyladenosine transferase [Acidiphilium cryptum JF-5] >
. . . Photobacterium damselae subsp. damselae CIP 102761 .......................  101  2 hits [g-proteobacteria]       dimethyladenosine transferase [Photobacterium damselae subs
. . . Flavobacteria bacterium MS024-2A .........................................  101  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteria bacterium MS02
. . . Serratia odorifera DSM 4582 ..............................................  101  2 hits [enterobacteria]         dimethyladenosine transferase [Serratia odorifera DSM 4582]
. . . Thermotoga naphthophila RKU-10 ...........................................  101  2 hits [thermotogales]          dimethyladenosine transferase [Thermotoga naphthophila RKU-
. . . Streptococcus sp. M143 ...................................................  101  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus sp. M143] >gi|
. . . Enterococcus faecium E980 ................................................  101  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium E980] >
. . . Caulobacter segnis ATCC 21756 ............................................  101  2 hits [a-proteobacteria]       dimethyladenosine transferase [Caulobacter segnis ATCC 2175
. . . Pseudomonas aeruginosa PA7 ...............................................  100  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas aeruginosa PA7] 
. . . Enterococcus faecium Com15 ...............................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium Com15] 
. . . Enterococcus faecium TX1330 ..............................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TX1330]
. . . Enterococcus faecium 1,141,733 ...........................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TX1330]
. . . Enterococcus faecium Com12 ...............................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TX1330]
. . . Enterococcus faecalis PC1.1 ..............................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium TX1330]
. . . Streptococcus pneumoniae P1031 ...........................................  100  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae P10
. . . Legionella pneumophila str. Lens .........................................  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella pneumophila str. 
. . . uncultured Termite group 1 bacterium phylotype Rs-D17 ....................  100  2 hits [bacteria]               dimethyladenosine transferase [uncultured Termite group 1 b
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  100  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  100  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Enterobacter cancerogenus ATCC 35316 .....................................  100  2 hits [enterobacteria]         hypothetical protein ENTCAN_05155 [Enterobacter cancerogenu
. . . Eubacterium rectale M104/1 ...............................................  100  1 hit  [firmicutes]             dimethyladenosine transferase [Eubacterium rectale M104/1]
. . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  100  2 hits [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. Bp 
. . . Buchnera aphidicola (Baizongia pistaciae) ................................  100  1 hit  [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. Bp 
. . . alpha proteobacterium IMCC1322 ...........................................  100  2 hits [a-proteobacteria]       dimethyladenosine transferase [alpha proteobacterium IMCC13
. . . Citrobacter koseri ATCC BAA-895 ..........................................  100  3 hits [enterobacteria]         dimethyladenosine transferase [Citrobacter koseri ATCC BAA-
. . . Marinomonas sp. MED121 ...................................................  100  2 hits [g-proteobacteria]       rRNA (adenine-N6,N6)-dimethyltransferase [Marinomonas sp. M
. . . Vibrio fischeri ES114 ....................................................  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio fischeri ES114] >gi|1
. . . Vibrio fischeri MJ11 .....................................................  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio fischeri ES114] >gi|1
. . . Mycoplasma crocodyli MP145 ...............................................  100  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma crocodyli MP145] 
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 .............  100  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus saprophyticus
. . . Bifidobacterium catenulatum DSM 16992 ....................................  100  2 hits [high GC Gram+]          hypothetical protein BIFCAT_00011 [Bifidobacterium catenula
. . . Mitsuokella multacida DSM 20544 ..........................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Mitsuokella multacida DSM 20
. . . Yersinia aldovae ATCC 35236 ..............................................  100  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia aldovae ATCC 35236]
. . . marine gamma proteobacterium HTCC2148 ....................................  100  2 hits [g-proteobacteria]       dimethyladenosine transferase [marine gamma proteobacterium
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella pneumophila subsp
. . . Buchnera aphidicola str. Sg (Schizaphis graminum) ........................  100  2 hits [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. Sg 
. . . Buchnera aphidicola (Schizaphis graminum) ................................  100  1 hit  [enterobacteria]         dimethyladenosine transferase [Buchnera aphidicola str. Sg 
. . . Thauera sp. MZ1T .........................................................  100  2 hits [b-proteobacteria]       dimethyladenosine transferase [Thauera sp. MZ1T] >gi|217507
. . . Exiguobacterium sp. AT1b .................................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Exiguobacterium sp. AT1b] >g
. . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........  100  3 hits [enterobacteria]         hypothetical protein WGLp020 [Wigglesworthia glossinidia en
. . . Pseudomonas stutzeri A1501 ...............................................  100  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas stutzeri A1501] 
. . . Rickettsiella grylli .....................................................  100  2 hits [g-proteobacteria]       dimethyladenosine transferase [Rickettsiella grylli] >gi|15
. . . Legionella pneumophila str. Paris ........................................  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella pneumophila str. 
. . . Legionella pneumophila str. Corby ........................................  100  3 hits [g-proteobacteria]       dimethyladenosine transferase [Legionella pneumophila str. 
. . . Wolbachia endosymbiont of Drosophila melanogaster ........................  100  3 hits [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Dr
. . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 ........  100  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Wolbachia endosymbiont of Dr
. . . Yersinia mollaretii ATCC 43969 ...........................................  100  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia mollaretii ATCC 439
. . . Bryantella formatexigens DSM 14469 .......................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Bryantella formatexigens DSM
. . . Yersinia bercovieri ATCC 43970 ...........................................  100  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia bercovieri ATCC 439
. . . Enterococcus faecium E1039 ...............................................  100  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecium E1039] 
. . . Corynebacterium striatum ATCC 6940 .......................................  100  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium striatum ATC
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  100  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia enterocolitica subs
. . . Neorickettsia sennetsu str. Miyayama .....................................   99  3 hits [a-proteobacteria]       dimethyladenosine transferase [Neorickettsia sennetsu str. 
. . . Klebsiella pneumoniae 342 ................................................   99  3 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae 342] >
. . . Klebsiella variicola At-22 ...............................................   99  2 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae 342] >
. . . Klebsiella sp. 1_1_55 ....................................................   99  2 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae 342] >
. . . Streptococcus pneumoniae CDC1873-00 ......................................   99  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae CDC
. . . Streptococcus pneumoniae R6 ..............................................   99  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae R6]
. . . Streptococcus pneumoniae D39 .............................................   99  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae R6]
. . . Streptococcus pneumoniae CDC0288-04 ......................................   99  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae R6]
. . . Azotobacter vinelandii DJ ................................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Azotobacter vinelandii DJ] >
. . . Selenomonas noxia ATCC 43541 .............................................   99  2 hits [firmicutes]             dimethyladenosine transferase [Selenomonas noxia ATCC 43541
. . . Streptococcus pneumoniae CGSP14 ..........................................   99  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae CGS
. . . Corynebacterium glutamicum R .............................................   99  3 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium glutamicum R
. . . Photobacterium profundum 3TCK ............................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Photobacterium profundum 3TC
. . . Streptococcus pneumoniae SP6-BS73 ........................................   99  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP6
. . . Corynebacterium glutamicum ATCC 13032 ....................................   99  4 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium glutamicum A
. . . Corynebacterium glutamicum ...............................................   99  1 hit  [high GC Gram+]          dimethyladenosine transferase [Corynebacterium glutamicum A
. . . Gloeobacter violaceus PCC 7421 ...........................................   99  2 hits [cyanobacteria]          rRNA (adenine-N6,N6)-dimethyltransferase [Gloeobacter viola
. . . Gloeobacter violaceus ....................................................   99  1 hit  [cyanobacteria]          rRNA (adenine-N6,N6)-dimethyltransferase [Gloeobacter viola
. . . Gardnerella vaginalis 409-05 .............................................   99  2 hits [high GC Gram+]          dimethyladenosine transferase [Gardnerella vaginalis 409-05
. . . Ehrlichia canis str. Jake ................................................   99  3 hits [a-proteobacteria]       dimethyladenosine transferase [Ehrlichia canis str. Jake] >
. . . Streptomyces hygroscopicus ATCC 53653 ....................................   99  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces hygroscopicus A
. . . Thermotoga petrophila RKU-1 ..............................................   99  3 hits [thermotogales]          dimethyladenosine transferase [Thermotoga petrophila RKU-1]
. . . Marinitoga piezophila KA3 ................................................   99  2 hits [thermotogales]          dimethyladenosine transferase [Thermotoga petrophila RKU-1]
. . . Rhodospirillum centenum SW ...............................................   99  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodospirillum centenum SW] 
. . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............   99  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Shigella boydii ..........................................................   99 17 hits [enterobacteria]         KsgA [Shigella boydii]
. . . Rhodococcus jostii RHA1 ..................................................   99  3 hits [high GC Gram+]          dimethyladenosine transferase [Rhodococcus jostii RHA1] >gi
. . . Pseudomonas putida W619 ..................................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas putida W619] >gi
. . . Anaerostipes caccae DSM 14662 ............................................   99  2 hits [firmicutes]             hypothetical protein ANACAC_02744 [Anaerostipes caccae DSM 
. . . marine gamma proteobacterium HTCC2143 ....................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [marine gamma proteobacterium
. . . Pseudomonas putida F1 ....................................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas putida F1] >gi|1
. . . Streptomyces roseosporus NRRL 15998 ......................................   99  3 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces roseosporus NRR
. . . Streptomyces roseosporus NRRL 11379 ......................................   99  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces roseosporus NRR
. . . Capnocytophaga ochracea DSM 7271 .........................................   99  2 hits [CFB group bacteria]     dimethyladenosine transferase [Capnocytophaga ochracea DSM 
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   99  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Staphylococcus aureus subsp. aureus WW2703/97 ............................   99  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus WBG10049 .............................   99  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Coxiella burnetii RSA 334 ................................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii RSA 334] >
. . . Coxiella burnetii CbuG_Q212 ..............................................   99  3 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii RSA 334] >
. . . Coxiella burnetii RSA 493 ................................................   99  2 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii RSA 334] >
. . . Coxiella burnetii ........................................................   99  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii RSA 334] >
. . . Pseudomonas putida KT2440 ................................................   99  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas putida KT2440] >
. . . Coxiella burnetii RSA 331 ................................................   99  3 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii RSA 331] >
. . . Photobacterium angustum S14 ..............................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio angustum S14] >gi|904
. . . Thermomicrobium roseum DSM 5159 ..........................................   98  2 hits [GNS bacteria]           dimethyladenosine transferase [Thermomicrobium roseum DSM 5
. . . Escherichia albertii TW07627 .............................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia albertii TW07627
. . . Dickeya dadantii Ech703 ..................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Dickeya dadantii Ech703] >gi
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Streptococcus pneumoniae CDC1087-00 ......................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae CDC
. . . Staphylococcus aureus subsp. aureus MRSA252 ..............................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus 55/2053 ..............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus 65-1322 ..............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus 68-397 ...............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus E1410 ................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus M876 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus C160 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus Btn1260 ..............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus M899 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus C427 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus C101 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus A017934/97 ...........................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus 58-424 ...............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus M809 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus M1015 ................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus EMRSA16 ..............................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Oxalobacter formigenes OXCC13 ............................................   98  2 hits [b-proteobacteria]       dimethyladenosine transferase dimethyltransferase [Oxalobac
. . . Prochlorococcus marinus str. MIT 9211 ....................................   98  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica ......................................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Brachybacterium faecium DSM 4810 .........................................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Brachybacterium faecium DSM 
. . . Staphylococcus aureus subsp. aureus MN8 ..................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus TCH60 ................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Saccharopolyspora erythraea NRRL 2338 ....................................   98  8 hits [high GC Gram+]          dimethyladenosine transferase [Saccharopolyspora erythraea 
. . . Coxiella burnetii Dugway 5J108-111 .......................................   98  3 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii Dugway 5J1
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhi ........................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Vibrio orientalis CIP 102891 .............................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio orientalis CIP 102891
. . . Yersinia ruckeri ATCC 29473 ..............................................   98  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia ruckeri ATCC 29473]
. . . Photobacterium profundum .................................................   98  1 hit  [g-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Roseovarius sp. HTCC2601 .................................................   98  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseovarius sp. HTCC2601] >g
. . . Streptococcus pneumoniae TIGR4 ...........................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae TIG
. . . Streptococcus pneumoniae 70585 ...........................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae 705
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................   98  3 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio desulfuricans 
. . . Kocuria rhizophila DC2201 ................................................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Kocuria rhizophila DC2201] >
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   98  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Photobacterium profundum SS9 .............................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Photobacterium profundum SS9
. . . Streptococcus pneumoniae Hungary19A-6 ....................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae Hun
. . . Streptococcus pneumoniae G54 .............................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae Hun
. . . Streptococcus pneumoniae CCRI 1974 .......................................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae Hun
. . . Streptococcus pneumoniae CCRI 1974M2 .....................................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae Hun
. . . Streptococcus pneumoniae CDC3059-06 ......................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae CDC
. . . Streptococcus pneumoniae JJA .............................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae CDC
. . . Rhodococcus erythropolis PR4 .............................................   98  3 hits [high GC Gram+]          dimethyladenosine transferase [Rhodococcus erythropolis PR4
. . . Rhodococcus erythropolis SK121 ...........................................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Rhodococcus erythropolis PR4
. . . Sphingomonas wittichii RW1 ...............................................   98  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sphingomonas wittichii RW1] 
. . . Streptococcus pneumoniae SP11-BS70 .......................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP1
. . . Streptococcus pneumoniae MLV-016 .........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP1
. . . Cellvibrio japonicus Ueda107 .............................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Cellvibrio japonicus Ueda107
. . . Streptococcus pneumoniae SP3-BS71 ........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP3
. . . Yersinia frederiksenii ATCC 33641 ........................................   98  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia frederiksenii ATCC 
. . . Streptococcus pneumoniae SP9-BS68 ........................................   98  2 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae SP23-BS72 .......................................   98  2 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae SP195 ...........................................   98  2 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae ATCC 700669 .....................................   98  3 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae Taiwan19F-14 ....................................   98  3 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae TCH8431/19A .....................................   98  2 hits [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Streptococcus pneumoniae .................................................   98  1 hit  [firmicutes]             hypothetical protein SpneT_02000042 [Streptococcus pneumoni
. . . Yersinia intermedia ATCC 29909 ...........................................   98  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia intermedia ATCC 299
. . . Streptococcus pneumoniae SP19-BS75 .......................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP1
. . . Bifidobacterium longum DJO10A ............................................   98  4 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum DJO10
. . . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Staphylococcus epidermidis ATCC 12228 ....................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis A
. . . Staphylococcus epidermidis RP62A .........................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis A
. . . Staphylococcus epidermidis BCM-HMP0060 ...................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis A
. . . Staphylococcus epidermidis SK135 .........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis A
. . . Staphylococcus epidermidis M23864:W2(grey) ...............................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis A
. . . Caulobacter sp. K31 ......................................................   98  2 hits [a-proteobacteria]       dimethyladenosine transferase [Caulobacter sp. K31] >gi|167
. . . Streptococcus oralis ATCC 35037 ..........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus oralis ATCC 35
. . . Anaerococcus tetradius ATCC 35098 ........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Anaerococcus tetradius ATCC 
. . . Bifidobacterium longum subsp. infantis ATCC 15697 ........................   98  3 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum subsp
. . . Bifidobacterium longum subsp. infantis CCUG 52486 ........................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum subsp
. . . Shigella flexneri ........................................................   98 11 hits [enterobacteria]         KsgA [Shigella flexneri] >gi|86516091|gb|ABC97696.1| KsgA [
. . . Staphylococcus aureus A5948 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus A5948]
. . . Bifidobacterium longum subsp. infantis ATCC 55813 ........................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum subsp
. . . Dechloromonas aromatica RCB ..............................................   98  3 hits [b-proteobacteria]       dimethyladenosine transferase [Dechloromonas aromatica RCB]
. . . Vibrio sp. MED222 ........................................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio sp. MED222] >gi|21870
. . . Vibrio splendidus LGP32 ..................................................   98  3 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio sp. MED222] >gi|21870
. . . Ruminococcus albus 8 .....................................................   98  4 hits [firmicutes]             putative dimethyladenosine transferase [Ruminococcus albus 
. . . Staphylococcus aureus A9781 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus A9781]
. . . Staphylococcus aureus A9763 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus A9781]
. . . Staphylococcus aureus A9719 ..............................................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus A9781]
. . . Staphylococcus aureus A9635 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus A9781]
. . . Staphylococcus aureus subsp. aureus TCH70 ................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 ........................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus TCH130 ...............................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Escherichia fergusonii ATCC 35469 ........................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia fergusonii ATCC 
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. a
. . . Staphylococcus aureus RF122 ..............................................   98  3 hits [firmicutes]             RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Thiomicrospira crunogena XCL-2 ...........................................   98  3 hits [g-proteobacteria]       dimethyladenosine transferase [Thiomicrospira crunogena XCL
. . . Rhodospirillum rubrum ATCC 11170 .........................................   98  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodospirillum rubrum ATCC 1
. . . Staphylococcus aureus subsp. aureus str. Newman ..........................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus N315 .................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus MW2 ..................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus MSSA476 ..............................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus Mu50 .................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus COL ..................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 .......................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ............................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus JH9 ..................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus JH1 ..................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus Mu3 ..................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 .......................   98  3 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus str. JKD6008 .........................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus str. JKD6009 .........................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus str. CF-Marseille ....................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus Mu50-omega ...........................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A9299 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A6300 ..............................................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A6224 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A5937 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus D30 ................................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus 930918-3 ...........................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus ED98 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A8117 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus D139 .................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A9765 ..............................................   98  4 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus H19 ..................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus 132 ..................................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A9754 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus A8819 ..............................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus USA300 ...............................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus TW20 .................................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus subsp. aureus ST398 ................................   98  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Staphylococcus aureus 04-02981 ...........................................   98  1 hit  [firmicutes]             dimethyladenosine transferase [Staphylococcus aureus subsp.
. . . Enterobacter sp. 638 .....................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Enterobacter sp. 638] >gi|16
. . . Coxiella burnetii 'MSU Goat Q177' ........................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii 'MSU Goat 
. . . Coxiella burnetii CbuK_Q154 ..............................................   98  3 hits [g-proteobacteria]       dimethyladenosine transferase [Coxiella burnetii 'MSU Goat 
. . . Cronobacter sakazakii ATCC BAA-894 .......................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Cronobacter sakazakii ATCC B
. . . Shigella dysenteriae .....................................................   98 12 hits [enterobacteria]         KsgA [Shigella boydii] >gi|86516033|gb|ABC97667.1| KsgA [Sh
. . . Escherichia coli .........................................................   98 13 hits [enterobacteria]         KsgA [Shigella boydii] >gi|86516033|gb|ABC97667.1| KsgA [Sh
. . . Vibrio splendidus 12B01 ..................................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio splendidus 12B01] >gi
. . . Escherichia coli CFT073 ..................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli UTI89 ...................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli 536 .....................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli APEC O1 .................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli F11 .....................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli O127:H6 str. E2348/69 ...................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli S88 .....................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli 83972 ...................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia sp. 3_2_53FAA ................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli O6 ......................................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli SE15 ....................................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Escherichia coli IHE3034 .................................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli CFT073] >gi
. . . Edwardsiella tarda EIB202 ................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase (rRNA methylation) [Edwardsie
. . . Escherichia coli B7A .....................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli B7A] >gi|19
. . . Escherichia coli str. K-12 substr. MG1655 ................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Shigella sonnei Ss046 ....................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Shigella boydii Sb227 ....................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli str. K-12 substr. W3110 .................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Shigella flexneri 5 str. 8401 ............................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli HS ......................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli ATCC 8739 ...............................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli str. K-12 substr. DH10B .................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli SMS-3-5 .................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli 53638 ...................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli E22 .....................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli E110019 .................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli B171 ....................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Shigella dysenteriae 1012 ................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli 101-1 ...................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli IAI1 ....................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli IAI39 ...................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli BW2952 ..................................................   98  3 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli BL21(DE3) ...............................................   98  4 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia sp. 1_1_43 ...................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli B str. REL606 ...........................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Shigella sp. D9 ..........................................................   98  1 hit  [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia sp. 4_1_40B ..................................................   98  1 hit  [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli O103:H2 str. 12009 ......................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli O26:H11 str. 11368 ......................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli O111:H- str. 11128 ......................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli B354 ....................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli B185 ....................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli B088 ....................................................   98  2 hits [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli K-12 ....................................................   98  1 hit  [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli DH1 .....................................................   98  1 hit  [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Escherichia coli 042 .....................................................   98  1 hit  [enterobacteria]         16S rRNA dimethyladenosine transferase, SAM-dependent [Esch
. . . Citrobacter rodentium ICC168 .............................................   98  2 hits [enterobacteria]         dimethyladenosine transferase (S-adenosylmethionine-6-N',N'
. . . Escherichia coli E24377A .................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli E24377A] >g
. . . Escherichia coli FVEC1412 ................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli E24377A] >g
. . . Escherichia coli SE11 ....................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli SE11] >gi|2
. . . Magnetospirillum magnetotacticum MS-1 ....................................   98  3 hits [a-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Dickeya dadantii Ech586 ..................................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Dickeya dadantii Ech586] >gi
. . . Lactobacillus sakei subsp. sakei 23K .....................................   98  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus sakei subsp. s
. . . Escherichia coli UMN026 ..................................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli UMN026] >gi
. . . Marinobacter algicola DG893 ..............................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Marinobacter algicola DG893]
. . . Escherichia coli O157:H7 EDL933 ..........................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. Sakai ......................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4113 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4401 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4501 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4486 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4196 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4076 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC869 ......................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC508 ......................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4024 .....................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4206 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4045 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4042 .....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. EC4115 .....................................   98  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. TW14588 ....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. TW14359 ....................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. FRIK2000 ...................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 str. FRIK966 ....................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O55:H7 str. CB9615 ......................................   98  2 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Escherichia coli O157:H7 .................................................   98  1 hit  [enterobacteria]         dimethyladenosine transferase [Escherichia coli O157:H7 EDL
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................   98  2 hits [g-proteobacteria]       dimethyladenosine transferase [Alkalilimnicola ehrlichii ML
. . . Streptomyces flavogriseus ATCC 33331 .....................................   98  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces flavogriseus AT
. . . Edwardsiella tarda ATCC 23685 ............................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Edwardsiella tarda ATCC 2368
. . . Streptomyces griseus subsp. griseus NBRC 13350 ...........................   97  3 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces griseus subsp. 
. . . Streptomyces sp. ACT-1 ...................................................   97  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces griseus subsp. 
. . . Shigella flexneri 2a str. 301 ............................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Shigella flexneri 2a str. 30
. . . Shigella flexneri 2a str. 2457T ..........................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Shigella flexneri 2a str. 30
. . . Shigella flexneri 2002017 ................................................   97  1 hit  [enterobacteria]         dimethyladenosine transferase [Shigella flexneri 2a str. 30
. . . Edwardsiella ictaluri 93-146 .............................................   97  2 hits [enterobacteria]         dimethyladenosine transferase, putative [Edwardsiella ictal
. . . Rhodobacterales bacterium HTCC2150 .......................................   97  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacterales bacterium HT
. . . Clostridium scindens ATCC 35704 ..........................................   97  2 hits [firmicutes]             hypothetical protein CLOSCI_03028 [Clostridium scindens ATC
. . . Ehrlichia chaffeensis str. Arkansas ......................................   97  3 hits [a-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Reinekea blandensis MED297 ...............................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Reinekea sp. MED297] >gi|887
. . . Ehrlichia chaffeensis str. Sapulpa .......................................   97  2 hits [a-proteobacteria]       RRNA 16S rRNA dimethylase [Ehrlichia chaffeensis str. Sapul
. . . Exiguobacterium sibiricum 255-15 .........................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Exiguobacterium sibiricum 25
. . . Lactobacillus paracasei subsp. paracasei 8700:2 ..........................   97  2 hits [firmicutes]             dimethyladenosine transferase dimethyltransferase [Lactobac
. . . Lactobacillus paracasei subsp. paracasei ATCC 25302 ......................   97  2 hits [firmicutes]             dimethyladenosine transferase (S-adenosylmethionine-6-N , N
. . . Vibrio sp. AND4 ..........................................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio sp. AND4] >gi|1591735
. . . Haemophilus parasuis SH0165 ..............................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus parasuis SH0165]
. . . Serratia proteamaculans 568 ..............................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Serratia proteamaculans 568]
. . . Lactobacillus antri DSM 16041 ............................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus antri DSM 1604
. . . Geobacter sp. M21 ........................................................   97  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter sp. M21] >gi|25177
. . . Lactobacillus casei BL23 .................................................   97  2 hits [firmicutes]             Dimethyladenosine transferase (S-adenosylmethionine-6-N , N
. . . Synechococcus sp. WH 7803 ................................................   97  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. WH 7803] >
. . . Brucella abortus bv. 1 str. 9-941 ........................................   97  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella abortus bv. 1 str. 
. . . Brucella abortus .........................................................   97  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Brucella abortus bv. 1 str. 
. . . Corynebacterium urealyticum DSM 7109 .....................................   97  5 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium urealyticum 
. . . marine gamma proteobacterium HTCC2080 ....................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [marine gamma proteobacterium
. . . Yersinia pseudotuberculosis IP 32953 .....................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pseudotuberculosis 
. . . Yersinia pseudotuberculosis IP 31758 .....................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pseudotuberculosis 
. . . Yersinia pseudotuberculosis YPIII ........................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pseudotuberculosis 
. . . Yersinia pseudotuberculosis PB1/+ ........................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pseudotuberculosis 
. . . Yersinia pseudotuberculosis ..............................................   97  1 hit  [enterobacteria]         dimethyladenosine transferase [Yersinia pseudotuberculosis 
. . . Shewanella sediminis HAW-EB3 .............................................   97  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella sediminis HAW-EB3
. . . Congregibacter litoralis KT71 ............................................   97  4 hits [g-proteobacteria]       Dimethyladenosine transferase [Congregibacter litoralis KT7
. . . Neptuniibacter caesariensis ..............................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Oceanospirillum sp. MED92] >
. . . Enterococcus casseliflavus EC30 ..........................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus casseliflavus E
. . . Enterococcus casseliflavus EC10 ..........................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus casseliflavus E
. . . Enterococcus casseliflavus EC20 ..........................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus casseliflavus E
. . . Roseovarius sp. TM1035 ...................................................   97  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseovarius sp. TM1035] >gi|
. . . Yersinia pestis KIM 10 ...................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Microtus str. 91001 ...............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Antiqua ..................................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Nepal516 .................................................   97  5 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Pestoides F ..............................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis CA88-4125 ................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Angola ...................................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Orientalis str. IP275 .............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis CO92 .....................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Pestoides A ..............................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Orientalis str. PEXU2 .............................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis biovar Orientalis str. India 195 .........................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis KIM D27 ..................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis Z176003 ..................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis ..........................................................   97  1 hit  [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis D106004 ..................................................   97  1 hit  [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Yersinia pestis D182038 ..................................................   97  1 hit  [enterobacteria]         dimethyladenosine transferase [Yersinia pestis KIM 10] >gi|
. . . Zymomonas mobilis subsp. mobilis ZM4 .....................................   97  4 hits [a-proteobacteria]       dimethyladenosine transferase [Zymomonas mobilis subsp. mob
. . . Zymomonas mobilis subsp. mobilis ATCC 10988 ..............................   97  4 hits [a-proteobacteria]       dimethyladenosine transferase [Zymomonas mobilis subsp. mob
. . . Zymomonas mobilis ........................................................   97  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Zymomonas mobilis subsp. mob
. . . Herminiimonas arsenicoxydans .............................................   97  3 hits [b-proteobacteria]       S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Staphylococcus hominis SK119 .............................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus hominis SK119
. . . Shigella dysenteriae Sd197 ...............................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Shigella dysenteriae Sd197] 
. . . Pseudomonas mendocina ymp ................................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas mendocina ymp] >
. . . Symbiobacterium thermophilum IAM 14863 ...................................   97  4 hits [firmicutes]             dimethyladenosine transferase [Symbiobacterium thermophilum
. . . Symbiobacterium thermophilum .............................................   97  1 hit  [firmicutes]             dimethyladenosine transferase [Symbiobacterium thermophilum
. . . Ruminococcus sp. 5_1_39BFAA ..............................................   97  2 hits [firmicutes]             conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FA
. . . Bifidobacterium gallicum DSM 20093 .......................................   97  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium gallicum DSM
. . . Yersinia kristensenii ATCC 33638 .........................................   97  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia kristensenii ATCC 3
. . . Staphylococcus carnosus subsp. carnosus TM300 ............................   97  3 hits [firmicutes]             ribosomal RNA adenine dimethylase [Staphylococcus carnosus 
. . . Mycobacterium intracellulare ATCC 13950 ..................................   97  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium intracellulare
. . . Rhodomicrobium vannielii ATCC 17100 ......................................   97  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodomicrobium vannielii ATC
. . . Staphylococcus epidermidis W23144 ........................................   97  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus epidermidis W
. . . Vibrio vulnificus CMCP6 ..................................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio vulnificus CMCP6] >gi
. . . Vibrio vulnificus YJ016 ..................................................   97  3 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio vulnificus CMCP6] >gi
. . . Vibrio vulnificus ........................................................   97  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio vulnificus CMCP6] >gi
. . . Serratia odorifera 4Rx13 .................................................   97  2 hits [enterobacteria]         dimethyladenosine transferase [Serratia odorifera 4Rx13] >g
. . . gamma proteobacterium NOR51-B ............................................   97  2 hits [g-proteobacteria]       dimethyladenosine transferase [gamma proteobacterium NOR51-
. . . Roseovarius sp. 217 ......................................................   97  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseovarius sp. 217] >gi|856
. . . Corynebacterium diphtheriae NCTC 13129 ...................................   97  1 hit  [high GC Gram+]          dimethyladenosine transferase [Corynebacterium diphtheriae 
. . . Corynebacterium diphtheriae ..............................................   97  4 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium diphtheriae 
. . . Shigella boydii CDC 3083-94 ..............................................   97  3 hits [enterobacteria]         dimethyladenosine transferase [Shigella boydii CDC 3083-94]
. . . Eubacterium hallii DSM 3353 ..............................................   97  2 hits [firmicutes]             hypothetical protein EUBHAL_00918 [Eubacterium hallii DSM 3
. . . Neorickettsia risticii str. Illinois .....................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Neorickettsia risticii str. 
. . . Gordonia bronchialis DSM 43247 ...........................................   96  2 hits [high GC Gram+]          dimethyladenosine transferase [Gordonia bronchialis DSM 432
. . . Vibrio alginolyticus 12G01 ...............................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio alginolyticus 12G01] 
. . . Vibrio sp. Ex25 ..........................................................   96  4 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio alginolyticus 12G01] 
. . . Vibrio alginolyticus 40B .................................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio alginolyticus 12G01] 
. . . Bifidobacterium longum NCC2705 ...........................................   96  2 hits [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum NCC27
. . . Bifidobacterium longum ...................................................   96  1 hit  [high GC Gram+]          dimethyladenosine transferase [Bifidobacterium longum NCC27
. . . Lactobacillus casei ATCC 334 .............................................   96  2 hits [firmicutes]             dimethyladenosine transferase (rRNA methylation) [Lactobaci
. . . Escherichia coli ED1a ....................................................   96  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli ED1a] >gi|2
. . . Streptomyces pristinaespiralis ATCC 25486 ................................   96  2 hits [high GC Gram+]          dimethyladenosine transferase dimethyltransferase [Streptom
. . . Oceanicola batsensis HTCC2597 ............................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Oceanicola batsensis HTCC259
. . . Haemophilus parasuis 29755 ...............................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus parasuis 29755] 
. . . Vibrio shilonii AK1 ......................................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio shilonii AK1] >gi|148
. . . Flavobacteriales bacterium HTCC2170 ......................................   96  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteriales bacterium H
. . . Escherichia coli 55989 ...................................................   96  3 hits [enterobacteria]         dimethyladenosine transferase [Escherichia coli 55989] >gi|
. . . Mycoplasma alligatoris A21JP2 ............................................   96  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma alligatoris A21JP
. . . Teredinibacter turnerae T7901 ............................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferaseS-adenosylmethionine-6-N',N'-a
. . . Streptococcus pneumoniae SP18-BS74 .......................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP1
. . . Yersinia rohdei ATCC 43380 ...............................................   96  2 hits [enterobacteria]         Dimethyladenosine transferase [Yersinia rohdei ATCC 43380] 
. . . Streptococcus uberis 0140J ...............................................   96  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus uberis 0140J] 
. . . Ruminococcus torques ATCC 27756 ..........................................   96  2 hits [firmicutes]             hypothetical protein RUMTOR_01452 [Ruminococcus torques ATC
. . . Kosmotoga olearia TBF 19.5.1 .............................................   96  2 hits [thermotogales]          dimethyladenosine transferase [Kosmotoga olearia TBF 19.5.1
. . . Shewanella loihica PV-4 ..................................................   96  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella loihica PV-4] >gi
. . . Enterococcus faecalis HIP11704 ...........................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis HIP117
. . . Staphylococcus capitis SK14 ..............................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Staphylococcus capitis SK14]
. . . Photobacterium sp. SKA34 .................................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Photobacterium sp. SKA34] >g
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   96  3 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae subsp.
. . . Klebsiella pneumoniae NTUH-K2044 .........................................   96  3 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae subsp.
. . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................   96  2 hits [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae subsp.
. . . Klebsiella pneumoniae ....................................................   96  1 hit  [enterobacteria]         dimethyladenosine transferase [Klebsiella pneumoniae subsp.
. . . Rhodobacter sp. SW2 ......................................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacter sp. SW2] >gi|259
. . . Synechococcus sp. BL107 ..................................................   96  2 hits [cyanobacteria]          16S rRNA dimethylase [Synechococcus sp. BL107] >gi|11606613
. . . Pseudomonas entomophila L48 ..............................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas entomophila L48]
. . . Eubacterium saphenum ATCC 49989 ..........................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Eubacterium saphenum ATCC 49
. . . Acidaminococcus sp. D21 ..................................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Acidaminococcus sp. D21] >gi
. . . Thermosinus carboxydivorans Nor1 .........................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Thermosinus carboxydivorans 
. . . Brucella sp. NVSL 07-0026 ................................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella sp. NVSL 07-0026] >
. . . Campylobacter rectus RM3267 ..............................................   96  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter rectus RM3267]
. . . Bacillus sp. B14905 ......................................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus sp. B14905] >gi|126
. . . Vibrio harveyi 1DA3 ......................................................   96  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio harveyi 1DA3] >gi|269
. . . Beutenbergia cavernae DSM 12333 ..........................................   96  2 hits [high GC Gram+]          dimethyladenosine transferase [Beutenbergia cavernae DSM 12
. . . Brucella suis 1330 .......................................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella melitensis biovar Abortus 2308 ..................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ovis ATCC 25840 .................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella canis ATCC 23365 ................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus S19 .....................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ceti str. Cudo ..................................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella melitensis ATCC 23457 ...........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus str. 2308 A .............................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus bv. 6 str. 870 ..........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus bv. 3 str. Tulya ........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus bv. 2 str. 86/8/59 ......................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella suis bv. 5 str. 513 .............................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella suis bv. 3 str. 686 .............................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella pinnipedialis M163/99/10 ........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella pinnipedialis B2/94 .............................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ceti M644/93/1 ..................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ceti M13/05/1 ...................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus bv. 4 str. 292 ..........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella pinnipedialis M292/94/1 .........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella melitensis bv. 3 str. Ether .....................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ceti M490/95/1 ..................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella ceti B1/94 ......................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus bv. 9 str. C68 ..........................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella melitensis bv. 2 str. 63/9 ......................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella microti CCM 4915 ................................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella sp. F5/99 .......................................................   96  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella abortus NCTC 8038 ...............................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella suis bv. 4 str. 40 ..............................................   96  2 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Brucella suis ............................................................   96  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Brucella suis 1330] >gi|8269
. . . Lactobacillus coleohominis 101-4-CHN .....................................   96  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus coleohominis 1
. . . Desulfovibrio salexigens DSM 2638 ........................................   96  3 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio salexigens DSM
. . . Mycobacterium smegmatis str. MC2 155 .....................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium smegmatis str.
. . . Magnetospirillum magneticum AMB-1 ........................................   95  3 hits [a-proteobacteria]       dimethyladenosine transferase [Magnetospirillum magneticum 
. . . Paenibacillus sp. oral taxon 786 str. D14 ................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Paenibacillus sp. oral taxon
. . . Pseudomonas syringae pv. oryzae str. 1_6 .................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. ory
. . . Pseudomonas fluorescens Pf0-1 ............................................   95  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas fluorescens Pf0-
. . . Synechococcus sp. CC9311 .................................................   95  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. CC9311] >g
. . . Zymomonas mobilis subsp. mobilis NCIMB 11163 .............................   95  4 hits [a-proteobacteria]       dimethyladenosine transferase [Zymomonas mobilis subsp. mob
. . . Brucella neotomae 5K33 ...................................................   95  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella neotomae 5K33] >gi|
. . . Saccharophagus degradans 2-40 ............................................   95  3 hits [g-proteobacteria]       dimethyladenosine transferase [Saccharophagus degradans 2-4
. . . Mycobacterium avium subsp. avium ATCC 25291 ..............................   95  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium avium subsp. a
. . . Clostridiales bacterium 1_7_47FAA ........................................   95  2 hits [firmicutes]             conserved hypothetical protein [Clostridiales bacterium 1_7
. . . Agrobacterium tumefaciens str. C58 .......................................   95  3 hits [a-proteobacteria]       dimethyladenosine transferase [Agrobacterium tumefaciens st
. . . Vibrionales bacterium SWAT-3 .............................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrionales bacterium SWAT-3
. . . Geobacter bemidjiensis Bem ...............................................   95  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter bemidjiensis Bem] 
. . . Mobiluncus mulieris ATCC 35243 ...........................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mobiluncus mulieris ATCC 352
. . . Mobiluncus mulieris 28-1 .................................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mobiluncus mulieris ATCC 352
. . . Anaerocellum thermophilum DSM 6725 .......................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Anaerocellum thermophilum DS
. . . Croceibacter atlanticus HTCC2559 .........................................   95  2 hits [CFB group bacteria]     dimethyladenosine transferase [Croceibacter atlanticus HTCC
. . . Ruminococcus gnavus ATCC 29149 ...........................................   95  2 hits [firmicutes]             hypothetical protein RUMGNA_03152 [Ruminococcus gnavus ATCC
. . . Desulfobacterium autotrophicum HRM2 ......................................   95  3 hits [d-proteobacteria]       KsgA [Desulfobacterium autotrophicum HRM2] >gi|259494248|sp
. . . Azoarcus sp. BH72 ........................................................   95  2 hits [b-proteobacteria]       dimethyladenosine transferase [Azoarcus sp. BH72] >gi|11967
. . . Streptococcus equi subsp. zooepidemicus MGCS10565 ........................   95  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus equi subsp. zo
. . . Streptococcus equi subsp. zooepidemicus ..................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus equi subsp. zo
. . . Steptococcus equi subsp. zooepidemicus H70 ...............................   95  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus equi subsp. zo
. . . Geobacillus sp. Y412MC10 .................................................   95  4 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. Y412MC10] >g
. . . Mycobacterium avium 104 ..................................................   95  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium avium 104] >gi
. . . Streptococcus equi subsp. equi 4047 ......................................   95  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus equi subsp. eq
. . . Mycobacterium marinum M ..................................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase KsgA [Mycobacterium marinum M
. . . Dialister invisus DSM 15470 ..............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Dialister invisus DSM 15470]
. . . Pectobacterium atrosepticum SCRI1043 .....................................   95  2 hits [enterobacteria]         dimethyladenosine transferase [Pectobacterium atrosepticum 
. . . Pectobacterium atrosepticum ..............................................   95  1 hit  [enterobacteria]         dimethyladenosine transferase [Pectobacterium atrosepticum 
. . . Geobacter sp. M18 ........................................................   95  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter sp. M18] >gi|25498
. . . Desulfuromonas acetoxidans DSM 684 .......................................   95  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfuromonas acetoxidans D
. . . Bartonella grahamii as4aup ...............................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Bartonella grahamii as4aup] 
. . . Ruminococcus sp. SR1/5 ...................................................   95  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus sp. SR1/5]
. . . Rhodothermus marinus DSM 4252 ............................................   95  2 hits [CFB group bacteria]     dimethyladenosine transferase [Rhodothermus marinus DSM 425
. . . Vibrio parahaemolyticus RIMD 2210633 .....................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus AQ3810 ...........................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus K5030 ............................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus AN-5034 ..........................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus Peru-466 .........................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus AQ4037 ...........................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Vibrio parahaemolyticus ..................................................   95  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus RIMD
. . . Mycobacterium ulcerans Agy99 .............................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium ulcerans Agy99
. . . Clostridium hylemonae DSM 15053 ..........................................   95  2 hits [firmicutes]             hypothetical protein CLOHYLEM_07308 [Clostridium hylemonae 
. . . Enterococcus faecalis Merz96 .............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis Merz96
. . . Cronobacter turicensis z3032 .............................................   95  2 hits [enterobacteria]         Dimethyladenosine transferase [Cronobacter turicensis z3032
. . . Geobacter sp. FRC-32 .....................................................   95  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter sp. FRC-32] >gi|22
. . . Brucella suis ATCC 23445 .................................................   95  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella suis ATCC 23445] >g
. . . Eubacterium ventriosum ATCC 27560 ........................................   95  2 hits [firmicutes]             hypothetical protein EUBVEN_00288 [Eubacterium ventriosum A
. . . Bacillus sp. SG-1 ........................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus sp. SG-1] >gi|14884
. . . Streptococcus thermophilus LMG 18311 .....................................   95  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus thermophilus L
. . . Enterococcus faecalis TX1322 .............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis TX1322
. . . Enterococcus faecalis T8 .................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis TX1322
. . . Enterococcus faecalis ATCC 29200 .........................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis ATCC 2
. . . Enterococcus faecalis T1 .................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis ATCC 2
. . . Enterococcus faecalis X98 ................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis ATCC 2
. . . Erythrobacter sp. SD-21 ..................................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Erythrobacter sp. SD-21] >gi
. . . Thioalkalivibrio sp. HL-EbGR7 ............................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Thioalkalivibrio sp. HL-EbGR
. . . Roseobacter sp. AzwK-3b ..................................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter sp. AzwK-3b] >gi
. . . Enterococcus faecalis E1Sol ..............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis E1Sol]
. . . Sphingobium japonicum UT26S ..............................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sphingobium japonicum UT26S]
. . . Enterococcus faecalis V583 ...............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis TX0104 .............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis HH22 ...............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis TUSoD Ef11 .........................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis T2 .................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis ATCC 4200 ..........................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis T3 .................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis DS5 ................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis JH1 ................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis Fly1 ...............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis D6 .................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis CH188 ..............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis ARO1/DG ............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis T11 ................................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis R712 ...............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis S613 ...............................................   95  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Bacteroides vulgatus EK4.2 ...............................................   95  2 hits [CFB group bacteria]     dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Enterococcus faecalis ....................................................   95  1 hit  [firmicutes]             dimethyladenosine transferase [Enterococcus faecalis V583] 
. . . Stenotrophomonas maltophilia R551-3 ......................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Stenotrophomonas maltophilia
. . . Stenotrophomonas maltophilia K279a .......................................   95  2 hits [g-proteobacteria]       putative dimethyladenosine transferase [Stenotrophomonas ma
. . . Synechococcus sp. CC9902 .................................................   95  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. CC9902] >g
. . . Pseudomonas fluorescens Pf-5 .............................................   95  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas fluorescens Pf-5
. . . Silicibacter lacuscaerulensis ITI-1157 ...................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Silicibacter lacuscaerulensi
. . . Erwinia amylovora CFBP1430 ...............................................   95  2 hits [enterobacteria]         S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Erwinia amylovora ATCC 49946 .............................................   95  2 hits [enterobacteria]         S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Mycobacterium avium subsp. paratuberculosis K-10 .........................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium avium subsp. p
. . . Mycobacterium avium subsp. paratuberculosis ..............................   95  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium avium subsp. p
. . . Pseudomonas fluorescens SBW25 ............................................   95  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas fluorescens SBW2
. . . Stigmatella aurantiaca DW4/3-1 ...........................................   95  2 hits [d-proteobacteria]       dimethyladenosine transferase [Stigmatella aurantiaca DW4/3
. . . Oceanicola granulosus HTCC2516 ...........................................   95  2 hits [a-proteobacteria]       dimethyladenosine transferase [Oceanicola granulosus HTCC25
. . . Mycobacterium leprae TN ..................................................   95  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium leprae TN] >gi
. . . Mycobacterium leprae Br4923 ..............................................   95  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium leprae TN] >gi
. . . Mycobacterium leprae .....................................................   95  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium leprae TN] >gi
. . . Synechococcus sp. RS9916 .................................................   95  2 hits [cyanobacteria]          putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechoc
. . . Vibrio harveyi ATCC BAA-1116 .............................................   95  3 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio harveyi ATCC BAA-1116
. . . Kingella oralis ATCC 51147 ...............................................   94  2 hits [b-proteobacteria]       hypothetical protein GCWU000324_00743 [Kingella oralis ATCC
. . . Oribacterium sinus F0268 .................................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Oribacterium sinus F0268] >g
. . . Vibrio harveyi HY01 ......................................................   94  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio harveyi HY01] >gi|148
. . . Brevibacillus brevis NBRC 100599 .........................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Brevibacillus brevis NBRC 10
. . . Streptococcus thermophilus CNRZ1066 ......................................   94  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus thermophilus C
. . . Ruminococcus torques L2-14 ...............................................   94  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus torques L2-14]
. . . Roseovarius nubinhibens ISM ..............................................   94  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseovarius nubinhibens ISM]
. . . Eubacterium biforme DSM 3989 .............................................   94  2 hits [firmicutes]             hypothetical protein EUBIFOR_02405 [Eubacterium biforme DSM
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................   94  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. pha
. . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................   94  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. pha
. . . Haemophilus ducreyi 35000HP ..............................................   94  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus ducreyi 35000HP]
. . . Haemophilus ducreyi ......................................................   94  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Haemophilus ducreyi 35000HP]
. . . Streptococcus thermophilus LMD-9 .........................................   94  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus thermophilus L
. . . Psychroflexus torquis ATCC 700755 ........................................   94  3 hits [CFB group bacteria]     dimethyladenosine transferase [Psychroflexus torquis ATCC 7
. . . Coprococcus sp. ART55/1 ..................................................   94  1 hit  [firmicutes]             dimethyladenosine transferase [Coprococcus sp. ART55/1]
. . . Pseudomonas syringae pv. tomato T1 .......................................   94  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. tom
. . . Bacillus coagulans 36D1 ..................................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus coagulans 36D1] >gi
. . . Nitrosospira multiformis ATCC 25196 ......................................   94  3 hits [b-proteobacteria]       dimethyladenosine transferase [Nitrosospira multiformis ATC
. . . Corynebacterium efficiens YS-314 .........................................   94  4 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium efficiens YS
. . . Corynebacterium efficiens ................................................   94  1 hit  [high GC Gram+]          dimethyladenosine transferase [Corynebacterium efficiens YS
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................   94  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. tom
. . . Pseudomonas syringae pv. tomato ..........................................   94  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. tom
. . . Shewanella violacea DSS12 ................................................   94  2 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella violacea DSS12] >
. . . Ruminococcus obeum ATCC 29174 ............................................   94  2 hits [firmicutes]             hypothetical protein RUMOBE_02385 [Ruminococcus obeum ATCC 
. . . Shewanella woodyi ATCC 51908 .............................................   94  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella woodyi ATCC 51908
. . . Clostridium butyricum 5521 ...............................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium butyricum 5521] 
. . . Clostridium butyricum E4 str. BoNT E BL5262 ..............................   94  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium butyricum 5521] 
. . . Flavobacteria bacterium BAL38 ............................................   94  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteria bacterium BAL3
. . . Lactobacillus reuteri DSM 20016 ..........................................   94  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri DSM 20
. . . Lactobacillus reuteri JCM 1112 ...........................................   94  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri DSM 20
. . . Lactobacillus reuteri MM2-3 ..............................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri DSM 20
. . . Lactobacillus reuteri MM4-1A .............................................   94  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri DSM 20
. . . Mycobacterium vanbaalenii PYR-1 ..........................................   94  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium vanbaalenii PY
. . . Prochlorococcus marinus str. NATL2A ......................................   94  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Coprococcus eutactus ATCC 27759 ..........................................   94  2 hits [firmicutes]             hypothetical protein COPEUT_00938 [Coprococcus eutactus ATC
. . . Pectobacterium wasabiae WPP163 ...........................................   93  2 hits [enterobacteria]         dimethyladenosine transferase [Pectobacterium wasabiae WPP1
. . . Streptomyces clavuligerus ATCC 27064 .....................................   93  4 hits [high GC Gram+]          dimethyladenosine transferase dimethyltransferase [Streptom
. . . Corynebacterium amycolatum SK46 ..........................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium amycolatum S
. . . Ruminococcus lactaris ATCC 29176 .........................................   93  2 hits [firmicutes]             hypothetical protein RUMLAC_00054 [Ruminococcus lactaris AT
. . . Anaerococcus prevotii DSM 20548 ..........................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Anaerococcus prevotii DSM 20
. . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Mannheimia haemolytica serot
. . . Mannheimia haemolytica serotype A2 str. OVINE ............................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Mannheimia haemolytica serot
. . . Actinosynnema mirum DSM 43827 ............................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Actinosynnema mirum DSM 4382
. . . Roseobacter sp. SK209-2-6 ................................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter sp. SK209-2-6] >
. . . Labrenzia aggregata IAM 12614 ............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Stappia aggregata IAM 12614]
. . . Agrobacterium radiobacter K84 ............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Agrobacterium radiobacter K8
. . . Vibrio cholerae MZO-2 ....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae MZO-2] >gi|1
. . . Brevibacterium mcbrellneri ATCC 49030 ....................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Brevibacterium mcbrellneri A
. . . Oxalobacter formigenes HOxBLS ............................................   93  2 hits [b-proteobacteria]       dimethyladenosine transferase dimethyltransferase [Oxalobac
. . . Pseudomonas syringae pv. aesculi str. 2250 ...............................   93  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. aes
. . . Lysinibacillus sphaericus C3-41 ..........................................   93  3 hits [firmicutes]             dimethyladenosine transferase [Lysinibacillus sphaericus C3
. . . Idiomarina loihiensis L2TR ...............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Idiomarina loihiensis L2TR] 
. . . Idiomarina loihiensis ....................................................   93  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Idiomarina loihiensis L2TR] 
. . . Lactobacillus reuteri 100-23 .............................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri 100-23
. . . Bacillus halodurans C-125 ................................................   93  4 hits [firmicutes]             dimethyladenosine transferase [Bacillus halodurans C-125] >
. . . Bacillus halodurans ......................................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus halodurans C-125] >
. . . Silicibacter sp. TrichCH4B ...............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Silicibacter sp. TrichCH4B] 
. . . Thermoanaerobacterium thermosaccharolyticum DSM 571 ......................   93  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacterium thermo
. . . Psychromonas ingrahamii 37 ...............................................   93  3 hits [g-proteobacteria]       dimethyladenosine transferase [Psychromonas ingrahamii 37] 
. . . Pseudomonas syringae pv. syringae FF5 ....................................   93  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. syr
. . . Corynebacterium kroppenstedtii DSM 44385 .................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium kroppenstedt
. . . Rhizobium etli GR56 ......................................................   93  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rhizobium etli GR56]
. . . Streptomyces sp. AA4 .....................................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces sp. AA4]
. . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ................   93  2 hits [firmicutes]             hypothetical protein STRINF_00988 [Streptococcus infantariu
. . . Jannaschia sp. CCS1 ......................................................   93  3 hits [a-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Pseudomonas syringae pv. syringae B728a ..................................   93  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. syr
. . . Rothia mucilaginosa ATCC 25296 ...........................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Rothia mucilaginosa ATCC 252
. . . Streptococcus agalactiae 2603V/R .........................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae 260
. . . Streptococcus agalactiae 18RS21 ..........................................   93  4 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae 260
. . . Streptococcus agalactiae serogroup V .....................................   93  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae 260
. . . Streptococcus gallolyticus UCN34 .........................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus gallolyticus U
. . . Streptococcus sanguinis SK36 .............................................   93  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus sanguinis SK36
. . . Buchnera aphidicola str. Cc (Cinara cedri) ...............................   93  2 hits [enterobacteria]         hypothetical protein BCc_089 [Buchnera aphidicola str. Cc (
. . . Ruegeria sp. TM1040 ......................................................   93  3 hits [a-proteobacteria]       dimethyladenosine transferase [Ruegeria sp. TM1040] >gi|118
. . . Actinomyces urogenitalis DSM 15434 .......................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Actinomyces urogenitalis DSM
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Aeromonas salmonicida subsp.
. . . Bacteroides vulgatus PC510 ...............................................   93  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides vulgatus PC510] 
. . . Bacteroides sp. 4_3_47FAA ................................................   93  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 4_3_47FAA] >
. . . Rothia mucilaginosa DY-18 ................................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Rothia mucilaginosa DY-18] >
. . . Candidatus Pelagibacter ubique HTCC1002 ..................................   93  2 hits [a-proteobacteria]       Dimethyladenosine transferase [Candidatus Pelagibacter ubiq
. . . Ochrobactrum intermedium LMG 3301 ........................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Ochrobactrum intermedium LMG
. . . Vibrio cholerae CT 5369-93 ...............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae CT 5369-93] 
. . . Slackia heliotrinireducens DSM 20476 .....................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Slackia heliotrinireducens D
. . . Bacteroides vulgatus ATCC 8482 ...........................................   93  3 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides vulgatus ATCC 84
. . . Stenotrophomonas sp. SKA14 ...............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Stenotrophomonas sp. SKA14] 
. . . Vibrio cholerae 2740-80 ..................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae O395 .....................................................   93  4 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae 1587 .....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae MAK 757 ..................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae MZO-3 ....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae NCTC 8457 ................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae BX 330286 ................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae B33 ......................................................   93  6 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae TMA 21 ...................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae RC9 ......................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae TM 11079-80 ..............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae bv. albensis VL426 .......................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae 12129(1) .................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae MJ-1236 ..................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae MO10 .....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholera CIRS 101 ..................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae INDRE 91/1 ...............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae RC27 .....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Vibrio cholerae ..........................................................   93  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae 2740-80] >gi
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................   93  1 hit  [enterobacteria]         dimethyladenosine transferase [Pectobacterium carotovorum s
. . . Actinobacillus minor NM305 ...............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Actinobacillus minor NM305] 
. . . Mycobacterium tuberculosis T85 ...........................................   93  3 hits [high GC Gram+]          predicted protein [Mycobacterium tuberculosis T85] >gi|2897
. . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae O1 biovar El
. . . Vibrio cholerae V52 ......................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae O1 biovar El
. . . Vibrio cholerae 623-39 ...................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae O1 biovar El
. . . Vibrio cholerae M66-2 ....................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae O1 biovar El
. . . Vibrio cholerae AM-19226 .................................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio cholerae O1 biovar El
. . . Roseobacter sp. MED193 ...................................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter sp. MED193] >gi|
. . . Peptoniphilus lacrimalis 315-B ...........................................   93  2 hits [firmicutes]             dimethyladenosine transferase [Peptoniphilus lacrimalis 315
. . . Erwinia tasmaniensis Et1/99 ..............................................   93  2 hits [enterobacteria]         dimethyladenosine transferase [Erwinia tasmaniensis Et1/99]
. . . Erwinia tasmaniensis .....................................................   93  1 hit  [enterobacteria]         dimethyladenosine transferase [Erwinia tasmaniensis Et1/99]
. . . Rickettsia felis URRWXCal2 ...............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rickettsia felis URRWXCal2] 
. . . Caldicellulosiruptor saccharolyticus DSM 8903 ............................   93  2 hits [firmicutes]             dimethyladenosine transferase [Caldicellulosiruptor sacchar
. . . Erythrobacter litoralis HTCC2594 .........................................   93  3 hits [a-proteobacteria]       dimethyladenosine transferase [Erythrobacter litoralis HTCC
. . . Haemophilus somnus 129PT .................................................   93  3 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus somnus 129PT] >g
. . . Haemophilus somnus 2336 ..................................................   93  3 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus somnus 129PT] >g
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........   93  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio desulfuricans 
. . . Haemophilus influenzae PittII ............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae PittI
. . . Labrenzia alexandrii DFL-11 ..............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase [Labrenzia alexandrii DFL-11]
. . . Staphylococcus lugdunensis HKU09-01 ......................................   93  2 hits [firmicutes]             Dimethyladenosine transferase [Staphylococcus lugdunensis H
. . . Fulvimarina pelagi HTCC2506 ..............................................   93  2 hits [a-proteobacteria]       dimethyladenosine transferase (16S rRNA dimethylase) protei
. . . Scardovia inopinata F0304 ................................................   93  2 hits [high GC Gram+]          dimethyladenosine transferase [Scardovia inopinata F0304] >
. . . Rickettsia felis .........................................................   93  1 hit  [a-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Haemophilus influenzae 22.4-21 ...........................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae R3021
. . . Mycobacterium gilvum PYR-GCK .............................................   93  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium gilvum PYR-GCK
. . . Haemophilus influenzae PittHH ............................................   93  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae PittH
. . . Haemophilus influenzae Rd KW20 ...........................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae Rd KW
. . . Haemophilus influenzae 22.1-21 ...........................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae Rd KW
. . . Haemophilus influenzae RdAW ..............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae Rd KW
. . . Haemophilus influenzae ...................................................   92  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae Rd KW
. . . Ochrobactrum anthropi ATCC 49188 .........................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase [Ochrobactrum anthropi ATCC 4
. . . Streptococcus pyogenes MGAS10750 .........................................   92  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS1
. . . Tropheryma whipplei TW08/27 ..............................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Tropheryma whipplei TW08/27]
. . . Bacillus cellulosilyticus DSM 2522 .......................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus cellulosilyticus DS
. . . Mannheimia haemolytica PHL213 ............................................   92  2 hits [g-proteobacteria]       rRNA (adenine-N6,N6-)-dimethyltransferase [Mannheimia haemo
. . . Vibrio sp. RC341 .........................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio sp. RC341] >gi|260841
. . . Leifsonia xyli subsp. xyli str. CTCB07 ...................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Leifsonia xyli subsp. xyli s
. . . Leifsonia xyli subsp. xyli ...............................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Leifsonia xyli subsp. xyli s
. . . Simonsiella muelleri ATCC 29453 ..........................................   92  2 hits [b-proteobacteria]       dimethyladenosine transferase [Simonsiella muelleri ATCC 29
. . . Turicibacter sp. PC909 ...................................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Turicibacter sp. PC909] >gi|
. . . Haemophilus influenzae R2846 .............................................   92  1 hit  [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Haemophilus influenzae PittEE ............................................   92  3 hits [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Haemophilus influenzae PittGG ............................................   92  3 hits [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Haemophilus influenzae 6P18H1 ............................................   92  2 hits [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Haemophilus influenzae 7P49H1 ............................................   92  2 hits [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Bacteroides dorei DSM 17855 ..............................................   92  4 hits [CFB group bacteria]     hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17
. . . Bacteroides sp. 9_1_42FAA ................................................   92  2 hits [CFB group bacteria]     hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17
. . . Bacteroides dorei 5_1_36/D4 ..............................................   92  2 hits [CFB group bacteria]     hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17
. . . Bacteroides sp. 3_1_33FAA ................................................   92  2 hits [CFB group bacteria]     hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17
. . . Desulfomicrobium baculatum DSM 4028 ......................................   92  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfomicrobium baculatum D
. . . Paenibacillus sp. JDR-2 ..................................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Paenibacillus sp. JDR-2] >gi
. . . Haliangium ochraceum DSM 14365 ...........................................   92  2 hits [d-proteobacteria]       dimethyladenosine transferase [Haliangium ochraceum DSM 143
. . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ..........................   92  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas syringae pv. aes
. . . Janthinobacterium sp. Marseille ..........................................   92  3 hits [b-proteobacteria]       dimethyladenosine transferase [Janthinobacterium sp. Marsei
. . . Shewanella denitrificans OS217 ...........................................   92  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella denitrificans OS2
. . . Megasphaera genomosp. type_1 str. 28L ....................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Megasphaera genomosp. type_1
. . . Cryptobacterium curtum DSM 15641 .........................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Cryptobacterium curtum DSM 1
. . . Pseudoalteromonas tunicata D2 ............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudoalteromonas tunicata D
. . . Rhizobium etli CIAT 652 ..................................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase (16S rRNA dimethylase) protei
. . . Rhizobium etli 8C-3 ......................................................   92  1 hit  [a-proteobacteria]       dimethyladenosine transferase (16S rRNA dimethylase) protei
. . . Haemophilus influenzae 3655 ..............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae 3655]
. . . Octadecabacter antarcticus 238 ...........................................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Octadecabacter antarcticus 2
. . . Ureaplasma urealyticum serovar 13 str. ATCC 33698 ........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 5 str. ATCC 27817 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 7 str. ATCC 27819 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 11 str. ATCC 33695 ........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 12 str. ATCC 33696 ........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 9 str. ATCC 33175 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 4 str. ATCC 27816 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 10 str. ATCC 33699 ........................   92  3 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 2 str. ATCC 27814 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Ureaplasma urealyticum serovar 8 str. ATCC 27618 .........................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma urealyticum serov
. . . Beijerinckia indica subsp. indica ATCC 9039 ..............................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Beijerinckia indica subsp. i
. . . Haemophilus influenzae R3021 .............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae 22.4-
. . . Ureaplasma parvum serovar 3 str. ATCC 700970 .............................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Acidaminococcus fermentans DSM 20731 .....................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Acidaminococcus fermentans D
. . . Haemophilus influenzae NT127 .............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae NT127
. . . Vibrio parahaemolyticus 16 ...............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio parahaemolyticus 16] 
. . . Geobacillus thermoglucosidasius C56-YS93 .................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Geobacillus thermoglucosidas
. . . Geobacillus sp. Y4.1MC1 ..................................................   92  4 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. Y4.1MC1] >gi
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   92  3 hits [enterobacteria]         dimethyladenosine transferase [Pectobacterium carotovorum s
. . . Tropheryma whipplei str. Twist ...........................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Tropheryma whipplei str. Twi
. . . Dinoroseobacter shibae DFL 12 ............................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase [Dinoroseobacter shibae DFL 1
. . . Haemophilus influenzae 86-028NP ..........................................   92  3 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae 86-02
. . . Haemophilus influenzae PittAA ............................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae 86-02
. . . Hahella chejuensis KCTC 2396 .............................................   92  3 hits [g-proteobacteria]       dimethyladenosine transferase [Hahella chejuensis KCTC 2396
. . . Glaciecola sp. HTCC2999 ..................................................   92  1 hit  [g-proteobacteria]       dimethyladenosine transferase [alpha proteobacterium HTCC22
. . . Campylobacter curvus 525.92 ..............................................   92  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter curvus 525.92]
. . . Methylobacillus flagellatus KT ...........................................   92  3 hits [b-proteobacteria]       dimethyladenosine transferase [Methylobacillus flagellatus 
. . . Rhodobacter sphaeroides KD131 ............................................   92  3 hits [a-proteobacteria]       Dimethyladenosine transferase [Rhodobacter sphaeroides KD13
. . . Oribacterium sp. oral taxon 078 str. F0262 ...............................   92  2 hits [firmicutes]             dimethyladenosine transferase [Oribacterium sp. oral taxon 
. . . Moorella thermoacetica ATCC 39073 ........................................   92  3 hits [firmicutes]             dimethyladenosine transferase [Moorella thermoacetica ATCC 
. . . Mycobacterium tuberculosis H37Rv .........................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis CDC1551 .......................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium bovis AF2122/97 ............................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium bovis BCG str. Pasteur 1173P2 ..............................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis H37Ra .........................................   92  4 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis F11 ...........................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis 02_1987 .......................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis 94_M4241A .....................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis EAS054 ........................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis GM 1503 .......................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis T17 ...........................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium bovis BCG str. Tokyo 172 ...................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis C .............................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis str. Haarlem ..................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis '98-R604 INH-RIF-EM' ..........................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis KZN 4207 ......................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis CPHL_A ........................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis T46 ...........................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis K85 ...........................................   92  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis KZN 605 .......................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis KZN V2475 .....................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis KZN R506 ......................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis 210 ...........................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium bovis ......................................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis ...............................................   92  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium tuberculosis H
. . . Mycobacterium tuberculosis T92 ...........................................   92  3 hits [high GC Gram+]          LOW QUALITY PROTEIN: dimethyladenosine transferase ksgA [My
. . . Mycobacterium tuberculosis KZN 1435 ......................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase ksgA [Mycobacterium tuberculo
. . . Candidatus Pelagibacter ubique HTCC1062 ..................................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Candidatus Pelagibacter ubiq
. . . Candidatus Pelagibacter ubique ...........................................   92  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Candidatus Pelagibacter ubiq
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................   92  1 hit  [enterobacteria]         dimethyladenosine transferase [Pectobacterium carotovorum s
. . . Ureaplasma parvum serovar 3 str. ATCC 27815 ..............................   92  3 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Ureaplasma parvum serovar 1 str. ATCC 27813 ..............................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Ureaplasma parvum serovar 14 str. ATCC 33697 .............................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Ureaplasma parvum serovar 6 str. ATCC 27818 ..............................   92  2 hits [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Ureaplasma parvum ........................................................   92  1 hit  [mycoplasmas]            dimethyladenosine transferase [Ureaplasma parvum serovar 3 
. . . Heliobacterium modesticaldum Ice1 ........................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Heliobacterium modesticaldum
. . . Clostridium leptum DSM 753 ...............................................   92  2 hits [firmicutes]             hypothetical protein CLOLEP_02918 [Clostridium leptum DSM 7
. . . Anaplasma centrale str. Israel ...........................................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Anaplasma centrale str. Isra
. . . Thermomonospora curvata DSM 43183 ........................................   92  4 hits [high GC Gram+]          dimethyladenosine transferase [Thermomonospora curvata DSM 
. . . bacterium Ellin514 .......................................................   92  2 hits [verrucomicrobia]        dimethyladenosine transferase [bacterium Ellin514] >gi|2238
. . . Asticcacaulis excentricus CB 48 ..........................................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Asticcacaulis excentricus CB
. . . Lutiella nitroferrum 2002 ................................................   92  2 hits [b-proteobacteria]       dimethyladenosine transferase [Lutiella nitroferrum 2002] >
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................   92  3 hits [g-proteobacteria]       dimethyladenosine transferase [Aeromonas hydrophila subsp. 
. . . Rhizobium leguminosarum bv. trifolii WSM1325 .............................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhizobium leguminosarum bv. 
. . . Frankia sp. EuI1c ........................................................   92  2 hits [high GC Gram+]          ribosomal RNA adenine methylase transferase [Frankia sp. Eu
. . . Vibrio mimicus VM223 .....................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio mimicus VM223] >gi|26
. . . Vibrio mimicus VM573 .....................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio mimicus VM573] >gi|26
. . . Vibrio mimicus MB-451 ....................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio mimicus VM573] >gi|26
. . . Rhodobacter sphaeroides ATCC 17029 .......................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacter sphaeroides ATCC
. . . Vibrio mimicus VM603 .....................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio mimicus VM603] >gi|25
. . . Prevotella bivia JCVIHMP010 ..............................................   92  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella bivia JCVIHMP010]
. . . Pedobacter sp. BAL39 .....................................................   92  2 hits [CFB group bacteria]     dimethyladenosine transferase [Pedobacter sp. BAL39] >gi|14
. . . Rhodobacter sphaeroides 2.4.1 ............................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacter sphaeroides 2.4.
. . . Acidithiobacillus caldus ATCC 51756 ......................................   92  2 hits [g-proteobacteria]       Dimethyladenosine transferase [Acidithiobacillus caldus ATC
. . . Desulfotomaculum acetoxidans DSM 771 .....................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Desulfotomaculum acetoxidans
. . . Erwinia pyrifoliae Ep1/96 ................................................   92  2 hits [enterobacteria]         Dimethyladenosine transferase [Erwinia pyrifoliae Ep1/96] >
. . . Erwinia pyrifoliae DSM 12163 .............................................   92  1 hit  [enterobacteria]         Dimethyladenosine transferase [Erwinia pyrifoliae Ep1/96] >
. . . Clostridium sp. SS2/1 ....................................................   92  2 hits [firmicutes]             hypothetical protein CLOSS21_00513 [Clostridium sp. SS2/1] 
. . . Clostridium botulinum C str. Eklund ......................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum C str.
. . . Streptococcus agalactiae COH1 ............................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae COH
. . . Actinobacillus minor 202 .................................................   92  2 hits [g-proteobacteria]       dimethyladenosine transferase [Actinobacillus minor 202] >g
. . . Parvularcula bermudensis HTCC2503 ........................................   92  2 hits [a-proteobacteria]       dimethyladenosine transferase [Parvularcula bermudensis HTC
. . . Streptococcus mutans NN2025 ..............................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus mutans NN2025]
. . . Prochlorococcus marinus str. NATL1A ......................................   92  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Selenomonas flueggei ATCC 43531 ..........................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Selenomonas flueggei ATCC 43
. . . Bacteroides caccae ATCC 43185 ............................................   92  2 hits [CFB group bacteria]     hypothetical protein BACCAC_01706 [Bacteroides caccae ATCC 
. . . Clostridium sp. M62/1 ....................................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium sp. M62/1] >gi|2
. . . Sphaerobacter thermophilus DSM 20745 .....................................   92  2 hits [GNS bacteria]           dimethyladenosine transferase [Sphaerobacter thermophilus D
. . . Synechococcus sp. WH 7805 ................................................   92  2 hits [cyanobacteria]          putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechoc
. . . Clostridium hiranonis DSM 13275 ..........................................   92  2 hits [firmicutes]             hypothetical protein CLOHIR_01644 [Clostridium hiranonis DS
. . . Bacillus clausii KSM-K16 .................................................   92  5 hits [firmicutes]             dimethyladenosine transferase [Bacillus clausii KSM-K16] >g
. . . Atopobium vaginae DSM 15829 ..............................................   92  2 hits [high GC Gram+]          possible dimethyladenosine transferase [Atopobium vaginae D
. . . Tsukamurella paurometabola DSM 20162 .....................................   92  2 hits [high GC Gram+]          dimethyladenosine transferase [Tsukamurella paurometabola D
. . . Clostridium novyi NT .....................................................   92  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium novyi NT] >gi|11
. . . Brucella melitensis bv. 1 str. 16M .......................................   92  4 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella melitensis 16M] >gi
. . . Brucella melitensis bv. 1 str. Rev.1 .....................................   92  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella melitensis 16M] >gi
. . . Brucella melitensis ......................................................   92  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Brucella melitensis 16M] >gi
. . . Desulfurivibrio alkaliphilus AHT2 ........................................   91  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfurivibrio alkaliphilus
. . . Clostridium phytofermentans ISDg .........................................   91  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium phytofermentans 
. . . Beggiatoa sp. PS .........................................................   91  2 hits [g-proteobacteria]       Ribosomal RNA adenine methylase transferase [Beggiatoa sp. 
. . . Streptococcus agalactiae A909 ............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae A90
. . . Streptococcus agalactiae H36B ............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae A90
. . . Streptococcus agalactiae serogroup Ia ....................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae A90
. . . Nitrosomonas sp. AL212 ...................................................   91  2 hits [b-proteobacteria]       dimethyladenosine transferase [Nitrosomonas sp. AL212] >gi|
. . . Rhizobium leguminosarum bv. trifolii WSM2304 .............................   91  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhizobium leguminosarum bv. 
. . . Pseudomonas putida GB-1 ..................................................   91  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudomonas putida GB-1] >gi
. . . Pasteurella dagmatis ATCC 43325 ..........................................   91  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pasteurella dagmatis ATCC 43
. . . Chitinophaga pinensis DSM 2588 ...........................................   91  2 hits [CFB group bacteria]     dimethyladenosine transferase [Chitinophaga pinensis DSM 25
. . . Jonesia denitrificans DSM 20603 ..........................................   91  2 hits [high GC Gram+]          dimethyladenosine transferase [Jonesia denitrificans DSM 20
. . . Roseburia inulinivorans DSM 16841 ........................................   91  2 hits [firmicutes]             hypothetical protein ROSEINA2194_00434 [Roseburia inulinivo
. . . Streptococcus agalactiae CJB111 ..........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae CJB
. . . Lactobacillus reuteri CF48-3A ............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri CF48-3
. . . Lactobacillus reuteri SD2112 .............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus reuteri CF48-3
. . . Streptomyces albus J1074 .................................................   91  3 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces albus J1074]
. . . Prevotella tannerae ATCC 51259 ...........................................   91  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella tannerae ATCC 512
. . . Mycobacterium sp. KMS ....................................................   91  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium sp. KMS] >gi|1
. . . Mycobacterium sp. JLS ....................................................   91  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium sp. KMS] >gi|1
. . . Meiothermus silvanus DSM 9946 ............................................   91  2 hits [bacteria]               dimethyladenosine transferase [Meiothermus silvanus DSM 994
. . . Mycobacterium sp. MCS ....................................................   91  3 hits [high GC Gram+]          dimethyladenosine transferase [Mycobacterium sp. MCS] >gi|1
. . . Aromatoleum aromaticum EbN1 ..............................................   91  3 hits [b-proteobacteria]       dimethyladenosine transferase [Aromatoleum aromaticum EbN1]
. . . Butyrivibrio fibrisolvens 16/4 ...........................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Butyrivibrio fibrisolvens 16
. . . Enterococcus gallinarum EG2 ..............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Enterococcus gallinarum EG2]
. . . Loktanella vestfoldensis SKA53 ...........................................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Loktanella vestfoldensis SKA
. . . Prochlorococcus marinus subsp. marinus str. CCMP1375 .....................   91  2 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus subs
. . . Prochlorococcus marinus ..................................................   91  1 hit  [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus subs
. . . Clostridium bolteae ATCC BAA-613 .........................................   91  2 hits [firmicutes]             hypothetical protein CLOBOL_04506 [Clostridium bolteae ATCC
. . . Maricaulis maris MCS10 ...................................................   91  3 hits [a-proteobacteria]       dimethyladenosine transferase [Maricaulis maris MCS10] >gi|
. . . Hyphomicrobium denitrificans ATCC 51888 ..................................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Hyphomicrobium denitrificans
. . . Candidatus Liberibacter asiaticus str. psy62 .............................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Candidatus Liberibacter asia
. . . Streptococcus agalactiae NEM316 ..........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae NEM
. . . Streptococcus agalactiae 515 .............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae NEM
. . . Streptococcus agalactiae serogroup III ...................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus agalactiae NEM
. . . Clostridium asparagiforme DSM 15981 ......................................   91  2 hits [firmicutes]             hypothetical protein CLOSTASPAR_00018 [Clostridium asparagi
. . . butyrate-producing bacterium SM4/1 .......................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [butyrate-producing bacterium
. . . Lactobacillus rhamnosus HN001 ............................................   91  2 hits [firmicutes]             Dimethyladenosine transferase (rRNA methylation) [Lactobaci
. . . Lactobacillus rhamnosus GG ...............................................   91  3 hits [firmicutes]             Dimethyladenosine transferase (rRNA methylation) [Lactobaci
. . . Sphingomonas sp. SKA58 ...................................................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sphingomonas sp. SKA58] >gi|
. . . Sphingobacterium spiritivorum ATCC 33861 .................................   91  2 hits [CFB group bacteria]     dimethyladenosine transferase [Sphingobacterium spiritivoru
. . . Bartonella tribocorum CIP 105476 .........................................   91  3 hits [a-proteobacteria]       dimethyladenosine transferase [Bartonella tribocorum CIP 10
. . . Streptococcus pyogenes MGAS9429 ..........................................   91  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS9
. . . Streptococcus pyogenes MGAS2096 ..........................................   91  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS9
. . . Streptococcus pyogenes M1 GAS ............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes M1 GA
. . . Streptococcus pyogenes MGAS5005 ..........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes M1 GA
. . . Streptococcus pyogenes serotype M1 .......................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes M1 GA
. . . Psychrobacter sp. PRwf-1 .................................................   91  2 hits [g-proteobacteria]       dimethyladenosine transferase [Psychrobacter sp. PRwf-1] >g
. . . Sphingobacterium spiritivorum ATCC 33300 .................................   91  2 hits [CFB group bacteria]     dimethyladenosine transferase [Sphingobacterium spiritivoru
. . . Streptococcus pyogenes MGAS6180 ..........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS6
. . . Streptococcus pyogenes MGAS10270 .........................................   91  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS6
. . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ....................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS6
. . . Streptococcus pyogenes serotype M28 ......................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS6
. . . Streptococcus pyogenes MGAS8232 ..........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS8
. . . Streptococcus pyogenes NZ131 .............................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS8
. . . Streptococcus pyogenes serotype M18 ......................................   91  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS8
. . . Ruegeria sp. R11 .........................................................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Ruegeria sp. R11] >gi|214031
. . . Moritella sp. PE36 .......................................................   91  2 hits [g-proteobacteria]       dimethyladenosine transferase [Moritella sp. PE36] >gi|1498
. . . Synechococcus sp. WH 8109 ................................................   91  2 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. WH 8109] >
. . . Roseobacter sp. CCS2 .....................................................   91  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter sp. CCS2] >gi|12
. . . Dorea longicatena DSM 13814 ..............................................   91  2 hits [firmicutes]             hypothetical protein DORLON_02017 [Dorea longicatena DSM 13
. . . Desulfotomaculum reducens MI-1 ...........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Desulfotomaculum reducens MI
. . . Proteus penneri ATCC 35198 ...............................................   91  2 hits [enterobacteria]         hypothetical protein PROPEN_00993 [Proteus penneri ATCC 351
. . . Macrococcus caseolyticus JCSC5402 ........................................   91  3 hits [firmicutes]             dimethyladenosine transferase [Macrococcus caseolyticus JCS
. . . Aggregatibacter actinomycetemcomitans D11S-1 .............................   91  2 hits [g-proteobacteria]       dimethyladenosine transferase [Aggregatibacter actinomycete
. . . Rhizobium leguminosarum bv. viciae 3841 ..................................   91  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhizobium leguminosarum bv. 
. . . Lactobacillus rhamnosus LMS2-1 ...........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus rhamnosus LMS2
. . . Lactobacillus rhamnosus Lc 705 ...........................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus rhamnosus LMS2
. . . Bacteroides coprocola DSM 17136 ..........................................   91  2 hits [CFB group bacteria]     hypothetical protein BACCOP_02425 [Bacteroides coprocola DS
. . . Coprothermobacter proteolyticus DSM 5265 .................................   91  2 hits [firmicutes]             dimethyladenosine transferase [Coprothermobacter proteolyti
. . . Desulfitobacterium hafniense Y51 .........................................   91  3 hits [firmicutes]             hypothetical protein DSY0135 [Desulfitobacterium hafniense 
. . . Desulfitobacterium hafniense DCB-2 .......................................   91  3 hits [firmicutes]             hypothetical protein DSY0135 [Desulfitobacterium hafniense 
. . . Blautia hydrogenotrophica DSM 10507 ......................................   91  2 hits [firmicutes]             hypothetical protein RUMHYD_03790 [Blautia hydrogenotrophic
. . . Azospirillum sp. B510 ....................................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Azospirillum sp. B510] >gi|2
. . . Helicobacter cinaedi CCUG 18818 ..........................................   90  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter cinaedi CCUG 18
. . . Veillonella dispar ATCC 17748 ............................................   90  2 hits [firmicutes]             hypothetical protein VEIDISOL_01455 [Veillonella dispar ATC
. . . Bacteroides plebeius DSM 17135 ...........................................   90  2 hits [CFB group bacteria]     hypothetical protein BACPLE_03195 [Bacteroides plebeius DSM
. . . Streptococcus pyogenes MGAS10394 .........................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS1
. . . Idiomarina baltica OS145 .................................................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Idiomarina baltica OS145] >g
. . . Megamonas hypermegale ART12/1 ............................................   90  1 hit  [firmicutes]             dimethyladenosine transferase [Megamonas hypermegale ART12/
. . . Granulicatella adiacens ATCC 49175 .......................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Granulicatella adiacens ATCC
. . . Bacteroides finegoldii DSM 17565 .........................................   90  4 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides finegoldii DSM 1
. . . Campylobacter jejuni subsp. jejuni 260.94 ................................   90  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni subsp. jejuni HB93-13 ...............................   90  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni subsp. jejuni 81116 .................................   90  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Methylocella silvestris BL2 ..............................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylocella silvestris BL2]
. . . Streptococcus pyogenes str. Manfredo .....................................   90  3 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes str. 
. . . Streptococcus pyogenes serotype M6 .......................................   90  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes str. 
. . . Shewanella benthica KT99 .................................................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella benthica KT99] >g
. . . Ruminococcus obeum A2-162 ................................................   90  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus obeum A2-162]
. . . Aggregatibacter actinomycetemcomitans D7S-1 ..............................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Aggregatibacter actinomycete
. . . Synechococcus sp. RS9917 .................................................   90  2 hits [cyanobacteria]          putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechoc
. . . Synechocystis sp. PCC 6803 ...............................................   90  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechocystis sp. PCC 6803] 
. . . Bacillus selenitireducens MLS10 ..........................................   90  2 hits [firmicutes]             binding-protein-dependent transport systems inner membrane 
. . . Gramella forsetii KT0803 .................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Gramella forsetii KT0803] >g
. . . Hyphomonas neptunium ATCC 15444 ..........................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Hyphomonas neptunium ATCC 15
. . . Sinorhizobium medicae WSM419 .............................................   90  3 hits [a-proteobacteria]       dimethyladenosine transferase [Sinorhizobium medicae WSM419
. . . Clostridium nexile DSM 1787 ..............................................   90  2 hits [firmicutes]             hypothetical protein CLONEX_03589 [Clostridium nexile DSM 1
. . . Alteromonadales bacterium TW-7 ...........................................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Alteromonadales bacterium TW
. . . Synechococcus sp. CC9605 .................................................   90  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. CC9605] >g
. . . Desulfatibacillum alkenivorans AK-01 .....................................   90  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfatibacillum alkenivora
. . . Streptococcus salivarius SK126 ...........................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus salivarius SK1
. . . Subdoligranulum variabile DSM 15176 ......................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Subdoligranulum variabile DS
. . . Robiginitalea biformata HTCC2501 .........................................   90  4 hits [CFB group bacteria]     dimethyladenosine transferase [Robiginitalea biformata HTCC
. . . Erythrobacter sp. NAP1 ...................................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Erythrobacter sp. NAP1] >gi|
. . . Rhodobacter sphaeroides ATCC 17025 .......................................   90  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacter sphaeroides ATCC
. . . Octadecabacter antarcticus 307 ...........................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Octadecabacter antarcticus 3
. . . Atopobium rimae ATCC 49626 ...............................................   90  2 hits [high GC Gram+]          dimethyladenosine transferase [Atopobium rimae ATCC 49626] 
. . . Pelobacter carbinolicus DSM 2380 .........................................   90  3 hits [d-proteobacteria]       dimethyladenosine transferase [Pelobacter carbinolicus DSM 
. . . Microscilla marina ATCC 23134 ............................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Microscilla marina ATCC 2313
. . . Granulibacter bethesdensis CGDNIH1 .......................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Granulibacter bethesdensis C
. . . Shewanella amazonensis SB2B ..............................................   90  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella amazonensis SB2B]
. . . Bulleidia extructa W1219 .................................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Bulleidia extructa W1219] >g
. . . Blattabacterium sp. (Blattella germanica) str. Bge .......................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Blattabacterium sp. (Blattel
. . . Brucella sp. 83/13 .......................................................   90  3 hits [a-proteobacteria]       dimethyladenosine transferase [Brucella sp. 83/13] >gi|2659
. . . Roseobacter denitrificans OCh 114 ........................................   90  3 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter denitrificans OC
. . . Chromobacterium violaceum ATCC 12472 .....................................   90  2 hits [b-proteobacteria]       dimethyladenosine transferase [Chromobacterium violaceum AT
. . . Chromobacterium violaceum ................................................   90  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Chromobacterium violaceum AT
. . . Epulopiscium sp. 'N.t. morphotype B' .....................................   90  1 hit  [firmicutes]             dimethyladenosine transferase [Epulopiscium sp. 'N.t. morph
. . . Rhizobium etli CFN 42 ....................................................   90  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhizobium etli CFN 42] >gi|1
. . . Candidatus Desulforudis audaxviator MP104C ...............................   90  2 hits [firmicutes]             dimethyladenosine transferase [Candidatus Desulforudis auda
. . . Aggregatibacter aphrophilus NJ8700 .......................................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Aggregatibacter aphrophilus 
. . . Rhodobacterales bacterium Y4I ............................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacterales bacterium Y4
. . . Anaerofustis stercorihominis DSM 17244 ...................................   90  2 hits [firmicutes]             hypothetical protein ANASTE_01510 [Anaerofustis stercorihom
. . . Bacteroides uniformis ATCC 8492 ..........................................   90  2 hits [CFB group bacteria]     hypothetical protein BACUNI_03648 [Bacteroides uniformis AT
. . . Thermotoga neapolitana DSM 4359 ..........................................   90  3 hits [thermotogales]          Dimethyladenosine transferase [Thermotoga neapolitana DSM 4
. . . Bacteroides sp. D2 .......................................................   90  1 hit  [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D2]
. . . Bacteroides sp. D1 .......................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D1] >gi|2624
. . . Bacteroides sp. 2_1_22 ...................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D1] >gi|2624
. . . Bacteroides ovatus SD CMC 3f .............................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D1] >gi|2624
. . . Bacteroides ovatus SD CC 2a ..............................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D1] >gi|2624
. . . Bacteroides xylanisolvens SD CC 1b .......................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D1] >gi|2624
. . . Kytococcus sedentarius DSM 20547 .........................................   90  2 hits [high GC Gram+]          dimethyladenosine transferase [Kytococcus sedentarius DSM 2
. . . Bacteroides stercoris ATCC 43183 .........................................   90  2 hits [CFB group bacteria]     hypothetical protein BACSTE_03355 [Bacteroides stercoris AT
. . . Alkaliphilus oremlandii OhILAs ...........................................   90  5 hits [firmicutes]             dimethyladenosine transferase [Alkaliphilus oremlandii OhIL
. . . Streptosporangium roseum DSM 43021 .......................................   90  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptosporangium roseum DSM
. . . Nostoc sp. PCC 7120 ......................................................   90  3 hits [cyanobacteria]          dimethyladenosine transferase [Nostoc sp. PCC 7120] >gi|271
. . . Flavobacterium psychrophilum JIP02/86 ....................................   90  3 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacterium psychrophilum
. . . Streptococcus mutans UA159 ...............................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus mutans UA159] 
. . . Streptococcus mutans .....................................................   90  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus mutans UA159] 
. . . Bacteroides sp. D20 ......................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. D20] >gi|270
. . . Agrobacterium vitis S4 ...................................................   90  3 hits [a-proteobacteria]       rRNA-adenine N6N6-dimethyltransferase [Agrobacterium vitis 
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................   90  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pasteurella multocida subsp.
. . . Pasteurella multocida ....................................................   90  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Pasteurella multocida subsp.
. . . Bacteroides thetaiotaomicron VPI-5482 ....................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides thetaiotaomicron
. . . Bacteroides sp. 1_1_6 ....................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides thetaiotaomicron
. . . Bacteroides thetaiotaomicron .............................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides thetaiotaomicron
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................   90  1 hit  [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Actinobacillus pleuropneumoniae L20 ......................................   90  3 hits [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Prevotella melaninogenica D18 ............................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella melaninogenica D1
. . . Bacteroides sp. 2_2_4 ....................................................   90  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 2_2_4] >gi|2
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................   90  3 hits [enterobacteria]         S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransf
. . . Veillonella parvula DSM 2008 .............................................   90  2 hits [firmicutes]             dimethyladenosine transferase [Veillonella parvula DSM 2008
. . . Shewanella piezotolerans WP3 .............................................   90  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella piezotolerans WP3
. . . Clostridium bartlettii DSM 16795 .........................................   90  2 hits [firmicutes]             hypothetical protein CLOBAR_02510 [Clostridium bartlettii D
. . . Marinomonas sp. MWYL1 ....................................................   90  3 hits [g-proteobacteria]       dimethyladenosine transferase [Marinomonas sp. MWYL1] >gi|1
. . . Bartonella quintana str. Toulouse ........................................   90  2 hits [a-proteobacteria]       dimethyladenosine transferase [Bartonella quintana str. Tou
. . . Bartonella quintana ......................................................   90  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Bartonella quintana str. Tou
. . . Corynebacterium pseudogenitalium ATCC 33035 ..............................   90  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium pseudogenita
. . . Lactobacillus helveticus DPC 4571 ........................................   90  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus helveticus DPC
. . . Sodalis glossinidius str. 'morsitans' ....................................   90  3 hits [enterobacteria]         dimethyladenosine transferase [Sodalis glossinidius str. 'm
. . . Bacteroides fragilis 3_1_12 ..............................................   89  1 hit  [CFB group bacteria]     dimethyladenosine transferase [Bacteroides fragilis 3_1_12]
. . . Prevotella ruminicola 23 .................................................   89  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella ruminicola 23] >g
. . . Veillonella parvula ATCC 17745 ...........................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Veillonella parvula ATCC 177
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................   89  3 hits [g-proteobacteria]       dimethyladenosine transferase [Actinobacillus pleuropneumon
. . . Geobacter metallireducens GS-15 ..........................................   89  3 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter metallireducens GS
. . . Sagittula stellata E-37 ..................................................   89  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sagittula stellata E-37] >gi
. . . Haemophilus influenzae R2866 .............................................   89  1 hit  [g-proteobacteria]       COG0030: Dimethyladenosine transferase (rRNA methylation) [
. . . Proteus mirabilis HI4320 .................................................   89  3 hits [enterobacteria]         dimethyladenosine transferase [Proteus mirabilis HI4320] >g
. . . Proteus mirabilis ATCC 29906 .............................................   89  2 hits [enterobacteria]         dimethyladenosine transferase [Proteus mirabilis HI4320] >g
. . . Clostridium botulinum B str. Eklund 17B ..................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum B str.
. . . Geobacter lovleyi SZ .....................................................   89  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter lovleyi SZ] >gi|18
. . . Bartonella bacilliformis KC583 ...........................................   89  3 hits [a-proteobacteria]       dimethyladenosine transferase [Bartonella bacilliformis KC5
. . . Veillonella sp. 3_1_44 ...................................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Veillonella sp. 3_1_44] >gi|
. . . Roseobacter litoralis Och 149 ............................................   89  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter litoralis Och 14
. . . Aeromicrobium marinum DSM 15272 ..........................................   89  2 hits [high GC Gram+]          dimethyladenosine transferase [Aeromicrobium marinum DSM 15
. . . Prevotella melaninogenica ATCC 25845 .....................................   89  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella melaninogenica AT
. . . Eubacterium eligens ATCC 27750 ...........................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Eubacterium eligens ATCC 277
. . . Roseobacter sp. GAI101 ...................................................   89  2 hits [a-proteobacteria]       dimethyladenosine transferase [Roseobacter sp. GAI101] >gi|
. . . Shewanella pealeana ATCC 700345 ..........................................   89  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella pealeana ATCC 700
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................   89  3 hits [g-proteobacteria]       dimethyladenosine transferase [Actinobacillus pleuropneumon
. . . Campylobacter jejuni subsp. jejuni 414 ...................................   89  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Rhodobacteraceae bacterium KLH11 .........................................   89  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacteraceae bacterium K
. . . Acidothermus cellulolyticus 11B ..........................................   89  3 hits [high GC Gram+]          dimethyladenosine transferase [Acidothermus cellulolyticus 
. . . Butyrivibrio crossotus DSM 2876 ..........................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Butyrivibrio crossotus DSM 2
. . . Bacteroides ovatus ATCC 8483 .............................................   89  2 hits [CFB group bacteria]     hypothetical protein BACOVA_04832 [Bacteroides ovatus ATCC 
. . . beta proteobacterium KB13 ................................................   89  2 hits [b-proteobacteria]       dimethyladenosine transferase [beta proteobacterium KB13] >
. . . Acidithiobacillus ferrooxidans ATCC 53993 ................................   89  3 hits [g-proteobacteria]       dimethyladenosine transferase [Acidithiobacillus ferrooxida
. . . Acidithiobacillus ferrooxidans ATCC 23270 ................................   89  3 hits [g-proteobacteria]       dimethyladenosine transferase [Acidithiobacillus ferrooxida
. . . Psychromonas sp. CNPT3 ...................................................   89  2 hits [g-proteobacteria]       KsgA [Psychromonas sp. CNPT3] >gi|90309789|gb|EAS37952.1| K
. . . Corynebacterium tuberculostearicum SK141 .................................   89  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium tuberculoste
. . . Campylobacter jejuni RM1221 ..............................................   89  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni RM1221]
. . . Campylobacter jejuni subsp. jejuni CG8421 ................................   89  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni RM1221]
. . . Granulicatella elegans ATCC 700633 .......................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Granulicatella elegans ATCC 
. . . unidentified eubacterium SCB49 ...........................................   89  2 hits [CFB group bacteria]     dimethyladenosine transferase [unidentified eubacterium SCB
. . . Campylobacter jejuni subsp. jejuni CG8486 ................................   89  2 hits [e-proteobacteria]       putative dimethyladenosine transferase (16S rRNA dimethylas
. . . Syntrophus aciditrophicus SB .............................................   89  3 hits [d-proteobacteria]       dimethyladenosine transferase [Syntrophus aciditrophicus SB
. . . Bacteroides intestinalis DSM 17393 .......................................   89  2 hits [CFB group bacteria]     hypothetical protein BACINT_04510 [Bacteroides intestinalis
. . . Thalassiobium sp. R2A62 ..................................................   89  2 hits [a-proteobacteria]       dimethyladenosine transferase [Thalassiobium sp. R2A62] >gi
. . . Laribacter hongkongensis HLHK9 ...........................................   89  3 hits [b-proteobacteria]       KsgA [Laribacter hongkongensis HLHK9] >gi|254807871|sp|C1D9
. . . Alteromonas macleodii 'Deep ecotype' .....................................   89  2 hits [g-proteobacteria]       dimethyladenosine transferase [Alteromonas macleodii 'Deep 
. . . Rhizobium sp. NGR234 .....................................................   89  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhizobium sp. NGR234] >gi|25
. . . Aerococcus viridans ATCC 11563 ...........................................   89  2 hits [firmicutes]             dimethyladenosine transferase [Aerococcus viridans ATCC 115
. . . Peptostreptococcus anaerobius 653-L ......................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Peptostreptococcus anaerobiu
. . . Bartonella henselae str. Houston-1 .......................................   88  2 hits [a-proteobacteria]       dimethyladenosine transferase [Bartonella henselae str. Hou
. . . Bartonella henselae ......................................................   88  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Bartonella henselae str. Hou
. . . Coprococcus catus GD/7 ...................................................   88  1 hit  [firmicutes]             dimethyladenosine transferase [Coprococcus catus GD/7]
. . . Pantoea sp. At-9b ........................................................   88  2 hits [enterobacteria]         dimethyladenosine transferase [Pantoea sp. At-9b] >gi|25853
. . . Prochlorococcus marinus str. MIT 9313 ....................................   88  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Dokdonia donghaensis MED134 ..............................................   88  2 hits [CFB group bacteria]     dimethyladenosine transferase [Dokdonia donghaensis MED134]
. . . Allochromatium vinosum DSM 180 ...........................................   88  2 hits [g-proteobacteria]       dimethyladenosine transferase [Allochromatium vinosum DSM 1
. . . Clostridium botulinum E3 str. Alaska E43 .................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum E3 str
. . . Lactococcus lactis subsp. cremoris SK11 ..................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Lactococcus lactis subsp. cr
. . . Dickeya zeae Ech1591 .....................................................   88  2 hits [enterobacteria]         dimethyladenosine transferase [Dickeya zeae Ech1591] >gi|24
. . . Clostridium botulinum E1 str. 'BoNT E Beluga' ............................   88  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum E1 str
. . . Roseburia intestinalis M50/1 .............................................   88  1 hit  [firmicutes]             dimethyladenosine transferase [Roseburia intestinalis M50/1
. . . Roseburia intestinalis XB6B4 .............................................   88  1 hit  [firmicutes]             dimethyladenosine transferase [Roseburia intestinalis M50/1
. . . Janibacter sp. HTCC2649 ..................................................   88  2 hits [high GC Gram+]          dimethyladenosine transferase [Janibacter sp. HTCC2649] >gi
. . . Shewanella halifaxensis HAW-EB4 ..........................................   88  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella halifaxensis HAW-
. . . Campylobacter jejuni subsp. jejuni 81-176 ................................   88  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Roseburia intestinalis L1-82 .............................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Roseburia intestinalis L1-82
. . . Salinibacter ruber .......................................................   88  2 hits [CFB group bacteria]     Dimethyladenosine transferase [Salinibacter ruber] >gi|2943
. . . Bacteroides coprophilus DSM 18228 ........................................   88  2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_02456 [Bacteroides coprophilu
. . . Prevotella buccalis ATCC 35310 ...........................................   88  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella buccalis ATCC 353
. . . Mycoplasma agalactiae ....................................................   88  2 hits [mycoplasmas]            Dimethyladenosine transferase(S adenosylmethionine 6 N', N'
. . . Shuttleworthia satelles DSM 14600 ........................................   88  2 hits [firmicutes]             hypothetical protein GCWU000342_00858 [Shuttleworthia satel
. . . Dorea formicigenerans ATCC 27755 .........................................   88  2 hits [firmicutes]             hypothetical protein DORFOR_01028 [Dorea formicigenerans AT
. . . Streptococcus pyogenes MGAS315 ...........................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS3
. . . Streptococcus pyogenes SSI-1 .............................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS3
. . . Streptococcus pyogenes serotype M3 .......................................   88  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus pyogenes MGAS3
. . . Microcoleus chthonoplastes PCC 7420 ......................................   88  2 hits [cyanobacteria]          dimethyladenosine transferase [Microcoleus chthonoplastes P
. . . Streptomyces sp. ACTE ....................................................   88  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces sp. ACTE] >gi|2
. . . Lactobacillus iners DSM 13335 ............................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus iners DSM 1333
. . . Nitrosomonas eutropha C91 ................................................   88  3 hits [b-proteobacteria]       dimethyladenosine transferase [Nitrosomonas eutropha C91] >
. . . uncultured bacterium .....................................................   88  2 hits [bacteria]               hypothetical protein [uncultured bacterium]
. . . Salinibacter ruber DSM 13855 .............................................   88  3 hits [CFB group bacteria]     dimethyladenosine transferase [Salinibacter ruber DSM 13855
. . . Magnetospirillum gryphiswaldense MSR-1 ...................................   88  1 hit  [a-proteobacteria]       Ribosomal RNA adenine methylase transferase [Magnetospirill
. . . Leeuwenhoekiella blandensis MED217 .......................................   88  2 hits [CFB group bacteria]     dimethyladenosine transferase [Leeuwenhoekiella blandensis 
. . . Vibrio sp. RC586 .........................................................   88  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio sp. RC586] >gi|262349
. . . Lactobacillus helveticus DSM 20075 .......................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus helveticus DSM
. . . Flavobacteriales bacterium ALC-1 .........................................   88  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteriales bacterium A
. . . Rhodobacter capsulatus SB1003 ............................................   88  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacter capsulatus SB100
. . . Actinomyces coleocanis DSM 15436 .........................................   88  2 hits [high GC Gram+]          possible dimethyladenosine transferase [Actinomyces coleoca
. . . Corynebacterium accolens ATCC 49725 ......................................   88  2 hits [high GC Gram+]          dimethyladenosine transferase [Corynebacterium accolens ATC
. . . Lactococcus lactis subsp. cremoris MG1363 ................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Lactococcus lactis subsp. cr
. . . Prochlorococcus marinus str. MIT 9303 ....................................   88  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Campylobacter jejuni subsp. jejuni 1336 ..................................   88  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Dethiobacter alkaliphilus AHT 1 ..........................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Dethiobacter alkaliphilus AH
. . . Anabaena variabilis ATCC 29413 ...........................................   88  3 hits [cyanobacteria]          dimethyladenosine transferase [Anabaena variabilis ATCC 294
. . . Clostridium botulinum D str. 1873 ........................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum D str.
. . . Bacillus cytotoxicus NVH 391-98 ..........................................   88  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus subsp. cytot
. . . Collinsella stercoris DSM 13279 ..........................................   88  2 hits [high GC Gram+]          hypothetical protein COLSTE_00071 [Collinsella stercoris DS
. . . Paracoccus denitrificans PD1222 ..........................................   88  5 hits [a-proteobacteria]       dimethyladenosine transferase [Paracoccus denitrificans PD1
. . . Cyanothece sp. ATCC 51142 ................................................   88  3 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. ATCC 51142] >
. . . Faecalibacterium prausnitzii A2-165 ......................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Faecalibacterium prausnitzii
. . . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ............   88  2 hits [CFB group bacteria]     dimethyladenosine transferase [Candidatus Azobacteroides ps
. . . Mycobacterium kansasii ATCC 12478 ........................................   88  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium kansasii ATCC 
. . . Streptomyces sviceus ATCC 29083 ..........................................   88  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces sviceus ATCC 29
. . . Streptomyces viridochromogenes DSM 40736 .................................   88  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces viridochromogen
. . . Actinobacillus succinogenes 130Z .........................................   88  2 hits [g-proteobacteria]       dimethyladenosine transferase [Actinobacillus succinogenes 
. . . Phaeobacter gallaeciensis BS107 ..........................................   88  2 hits [a-proteobacteria]       dimethyladenosine transferase [Phaeobacter gallaeciensis BS
. . . Phaeobacter gallaeciensis 2.10 ...........................................   88  2 hits [a-proteobacteria]       dimethyladenosine transferase [Phaeobacter gallaeciensis BS
. . . Xanthobacter autotrophicus Py2 ...........................................   88  3 hits [a-proteobacteria]       dimethyladenosine transferase [Xanthobacter autotrophicus P
. . . Enhydrobacter aerosaccus SK60 ............................................   88  2 hits [g-proteobacteria]       dimethyladenosine transferase [Enhydrobacter aerosaccus SK6
. . . Salinispora arenicola CNS-205 ............................................   88  2 hits [high GC Gram+]          dimethyladenosine transferase [Salinispora arenicola CNS-20
. . . Bacillus thuringiensis str. Al Hakam .....................................   88  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus thuringiensis str. 
. . . Bacillus cereus 03BB108 ..................................................   88  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus thuringiensis str. 
. . . Bacillus cereus 03BB102 ..................................................   88  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus thuringiensis str. 
. . . Pseudoalteromonas haloplanktis TAC125 ....................................   88  3 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudoalteromonas haloplankt
. . . Grimontia hollisae CIP 101886 ............................................   88  2 hits [g-proteobacteria]       dimethyladenosine transferase [Grimontia hollisae CIP 10188
. . . Bacteroides eggerthii DSM 20697 ..........................................   88  2 hits [CFB group bacteria]     hypothetical protein BACEGG_00819 [Bacteroides eggerthii DS
. . . Campylobacter lari RM2100 ................................................   88  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter lari RM2100] >
. . . Arthrobacter sp. FB24 ....................................................   88  3 hits [high GC Gram+]          dimethyladenosine transferase [Arthrobacter sp. FB24] >gi|1
. . . Anaplasma phagocytophilum HZ .............................................   88  3 hits [a-proteobacteria]       dimethyladenosine transferase [Anaplasma phagocytophilum HZ
. . . Lyngbya sp. PCC 8106 .....................................................   88  2 hits [cyanobacteria]          dimethyladenosine transferase [Lyngbya sp. PCC 8106] >gi|11
. . . Polaribacter sp. MED152 ..................................................   87  2 hits [CFB group bacteria]     ribosomal RNA adenine dimethylase [Polaribacter sp. MED152]
. . . Methylovorus sp. SIP3-4 ..................................................   87  2 hits [b-proteobacteria]       dimethyladenosine transferase [Methylovorus sp. SIP3-4] >gi
. . . Cyanobium sp. PCC 7001 ...................................................   87  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanobium sp. PCC 7001] >gi|
. . . Wolinella succinogenes DSM 1740 ..........................................   87  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Wolinella succinogenes DSM 1
. . . Wolinella succinogenes ...................................................   87  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Wolinella succinogenes DSM 1
. . . Clostridium beijerinckii NCIMB 8052 ......................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium beijerinckii NCI
. . . Campylobacter hominis ATCC BAA-381 .......................................   87  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter hominis ATCC B
. . . Clostridium botulinum Bf .................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum Bf] >g
. . . Clostridium botulinum Ba4 str. 657 .......................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum Bf] >g
. . . Lactobacillus crispatus ST1 ..............................................   87  1 hit  [firmicutes]             Dimethyladenosine transferase [Lactobacillus crispatus ST1]
. . . Bacillus cereus BGSC 6E1 .................................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus BGSC 6E1] >g
. . . Campylobacter jejuni subsp. jejuni CF93-6 ................................   87  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni subsp. jejuni 84-25 .................................   87  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni subsp. jejuni NCTC 11168 ............................   87  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni .....................................................   87  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Campylobacter jejuni subsp. jejuni IA3902 ................................   87  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . cyanobacterium UCYN-A ....................................................   87  2 hits [cyanobacteria]          dimethyladenosine transferase [cyanobacterium UCYN-A] >gi|2
. . . Blautia hansenii DSM 20583 ...............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Blautia hansenii DSM 20583] 
. . . Pediococcus acidilactici 7_4 .............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Pediococcus acidilactici 7_4
. . . Cytophaga hutchinsonii ATCC 33406 ........................................   87  3 hits [CFB group bacteria]     dimethyladenosine transferase [Cytophaga hutchinsonii ATCC 
. . . Heliobacillus mobilis ....................................................   87  1 hit  [firmicutes]             Dimethyladenosine transferase [Heliobacillus mobilis]
. . . Pseudoalteromonas atlantica T6c ..........................................   87  2 hits [g-proteobacteria]       dimethyladenosine transferase [Pseudoalteromonas atlantica 
. . . Coprococcus comes ATCC 27758 .............................................   87  2 hits [firmicutes]             hypothetical protein COPCOM_03619 [Coprococcus comes ATCC 2
. . . Lactobacillus fermentum 28-3-CHN .........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus fermentum 28-3
. . . Faecalibacterium prausnitzii L2-6 ........................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Faecalibacterium prausnitzii
. . . Desulfovibrio magneticus RS-1 ............................................   87  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio magneticus RS-
. . . Bacillus megaterium DSM319 ...............................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus megaterium DSM319]
. . . Clostridium botulinum B1 str. Okra .......................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum B1 str
. . . Clostridium botulinum A str. ATCC 3502 ...................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum A str.
. . . Pelobacter propionicus DSM 2379 ..........................................   87  2 hits [d-proteobacteria]       dimethyladenosine transferase [Pelobacter propionicus DSM 2
. . . Flavobacterium johnsoniae UW101 ..........................................   87  3 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacterium johnsoniae UW
. . . Oceanibulbus indolifex HEL-45 ............................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Oceanibulbus indolifex HEL-4
. . . Clostridium botulinum A3 str. Loch Maree .................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum A3 str
. . . Clostridium botulinum A str. ATCC 19397 ..................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum A str.
. . . Clostridium botulinum A str. Hall ........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum A str.
. . . Bacillus sp. NRRL B-14911 ................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus sp. NRRL B-14911] >
. . . Bacillus pseudofirmus OF4 ................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus pseudofirmus OF4] >
. . . Candidatus Pelagibacter sp. HTCC7211 .....................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Candidatus Pelagibacter sp. 
. . . Clostridium botulinum NCTC 2916 ..........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum NCTC 2
. . . Clostridium botulinum F str. Langeland ...................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum F str.
. . . Clostridium botulinum F str. 230613 ......................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium botulinum F str.
. . . Deinococcus radiodurans ..................................................   87  1 hit  [bacteria]               RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ...................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Sphingopyxis alaskensis RB2256 ...........................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sphingopyxis alaskensis RB22
. . . Sphingopyxis alaskensis ..................................................   87  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Sphingopyxis alaskensis RB22
. . . Bacteroides pectinophilus ATCC 43243 .....................................   87  2 hits [CFB group bacteria]     hypothetical protein BACPEC_00573 [Bacteroides pectinophilu
. . . Eubacterium cylindroides T2-87 ...........................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Eubacterium cylindroides T2-
. . . Bacillus cereus AH1272 ...................................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus AH1272] >gi|
. . . Kribbella flavida DSM 17836 ..............................................   87  2 hits [high GC Gram+]          dimethyladenosine transferase [Kribbella flavida DSM 17836]
. . . Campylobacter showae RM3277 ..............................................   87  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter showae RM3277]
. . . Deinococcus radiodurans R1 ...............................................   87  2 hits [bacteria]               dimethyladenosine transferase [Deinococcus radiodurans R1] 
. . . Faecalibacterium prausnitzii SL3/3 .......................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Faecalibacterium prausnitzii
. . . Lactococcus lactis subsp. lactis Il1403 ..................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Lactococcus lactis subsp. la
. . . Lactococcus lactis subsp. lactis KF147 ...................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Lactococcus lactis subsp. la
. . . Lactococcus lactis subsp. lactis .........................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Lactococcus lactis subsp. la
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ............   87  2 hits [firmicutes]             dimethyladenosine transferase [Alicyclobacillus acidocaldar
. . . Clostridium sp. 7_2_43FAA ................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium sp. 7_2_43FAA] >
. . . Campylobacter jejuni subsp. doylei 269.97 ................................   87  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter jejuni subsp. 
. . . Anaplasma marginale str. St. Maries ......................................   87  3 hits [a-proteobacteria]       dimethyladenosine transferase [Anaplasma marginale str. St.
. . . Anaplasma marginale str. Florida .........................................   87  3 hits [a-proteobacteria]       dimethyladenosine transferase [Anaplasma marginale str. St.
. . . Anaplasma marginale str. Puerto Rico .....................................   87  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Anaplasma marginale str. St.
. . . Anaplasma marginale str. Virginia ........................................   87  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Anaplasma marginale str. St.
. . . Mannheimia succiniciproducens MBEL55E ....................................   87  3 hits [g-proteobacteria]       dimethyladenosine transferase [Mannheimia succiniciproducen
. . . Sulfitobacter sp. NAS-14.1 ...............................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sulfitobacter sp. NAS-14.1] 
. . . Bacillus cereus R309803 ..................................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus R309803] >gi
. . . Xylanimonas cellulosilytica DSM 15894 ....................................   87  2 hits [high GC Gram+]          dimethyladenosine transferase [Xylanimonas cellulosilytica 
. . . Prevotella timonensis CRIS 5C-B1 .........................................   87  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella timonensis CRIS 5
. . . Clostridium perfringens E str. JGS1987 ...................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens E st
. . . Clostridium perfringens B str. ATCC 3626 .................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens E st
. . . Clostridium perfringens NCTC 8239 ........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens E st
. . . Sinorhizobium meliloti 1021 ..............................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sinorhizobium meliloti 1021]
. . . Sinorhizobium meliloti ...................................................   87  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Sinorhizobium meliloti 1021]
. . . Faecalibacterium prausnitzii M21/2 .......................................   87  2 hits [firmicutes]             hypothetical protein FAEPRAM212_00712 [Faecalibacterium pra
. . . Ruegeria pomeroyi DSS-3 ..................................................   87  2 hits [a-proteobacteria]       dimethyladenosine transferase [Ruegeria pomeroyi DSS-3] >gi
. . . Ruegeria pomeroyi ........................................................   87  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Ruegeria pomeroyi DSS-3] >gi
. . . Anaerotruncus colihominis DSM 17241 ......................................   87  2 hits [firmicutes]             hypothetical protein ANACOL_00490 [Anaerotruncus colihomini
. . . Streptococcus suis 05ZYH33 ...............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis 05ZYH33] 
. . . Streptococcus suis 98HAH33 ...............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis 05ZYH33] 
. . . Streptococcus suis GZ1 ...................................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus suis 05ZYH33] 
. . . Bacillus cereus ATCC 14579 ...............................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus ATCC 14579] 
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ....................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus ATCC 14579] 
. . . Bacillus cereus B4264 ....................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus ATCC 14579] 
. . . Bacillus cereus G9842 ....................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus ATCC 14579] 
. . . Bacillus anthracis str. Ames .............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus ATCC 10987 ...............................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. 'Ames Ancestor' ..................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus G9241 ....................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. Sterne ...........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ......................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus E33L .....................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A2012 ............................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0488 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0442 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0193 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0465 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0389 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0174 ............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis Tsiankovskii-I ........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus W ........................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus NVH0597-99 ...............................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus H3081.97 .................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus AH187 ....................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus AH820 ....................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus Q1 .......................................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. CDC 684 ..........................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A0248 ............................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. CNEVA-9066 .......................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. A1055 ............................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. Western North America USA6153 ....................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. Kruger B .........................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. Vollum ...........................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis str. Australia 94 .....................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus anthracis (anthrax) .............................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus thuringiensis serovar konkukian .................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Bacillus anthracis str. Ames
. . . Bacillus cereus AH1134 ...................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus cereus AH1134] >gi|
. . . Geobacillus kaustophilus HTA426 ..........................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Geobacillus kaustophilus HTA
. . . Geobacillus kaustophilus .................................................   87  1 hit  [firmicutes]             dimethyladenosine transferase [Geobacillus kaustophilus HTA
. . . Crocosphaera watsonii WH 8501 ............................................   87  2 hits [cyanobacteria]          RRNA 16S rRNA dimethylase [Crocosphaera watsonii WH 8501] >
. . . Bacillus weihenstephanensis KBAB4 ........................................   87  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus weihenstephanensis 
. . . Catenulispora acidiphila DSM 44928 .......................................   87  4 hits [high GC Gram+]          dimethyladenosine transferase [Catenulispora acidiphila DSM
. . . Streptococcus suis SC84 ..................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis SC84] >gi
. . . Streptococcus suis P1/7 ..................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis SC84] >gi
. . . Streptococcus suis BM407 .................................................   87  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis SC84] >gi
. . . Bacillus mycoides DSM 2048 ...............................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides DSM 2048] 
. . . Bacillus cereus AH603 ....................................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides DSM 2048] 
. . . Bacillus cereus BDRD-ST196 ...............................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides DSM 2048] 
. . . Bacillus cereus AH621 ....................................................   87  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides DSM 2048] 
. . . Xanthomonas albilineans ..................................................   87  2 hits [g-proteobacteria]       probable dimethyladenosine transferase protein [Xanthomonas
. . . Bacillus thuringiensis IBL 4222 ..........................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis IBL 200 ...........................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis serovar berliner ATCC 10792 .......................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 .....................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis serovar pakistani str. T13001 .....................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis serovar sotto str. T04001 .........................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 .................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus thuringiensis Bt407 .............................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus AH676 ....................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus F65185 ...................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus Rock1-15 .................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus BDRD-Cer4 ................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus m1550 ....................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus 172560W ..................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Bacillus cereus ATCC 10876 ...............................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis IBL 4
. . . Mycoplasma agalactiae PG2 ................................................   86  2 hits [mycoplasmas]            dimethyladenosine transferase(S-adenosylmethionine-6-N', N'
. . . Bacillus cereus MM3 ......................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus MM3] >gi|228
. . . Clostridium difficile QCD-23m63 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile QCD-23
. . . Clostridium difficile 630 ................................................   86  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile QCD-32g58 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile QCD-66c26 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile CIP 107932 .........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile QCD-76w55 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile QCD-97b34 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile QCD-37x79 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile CD196 ..............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Clostridium difficile R20291 .............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium difficile 630] >
. . . Bradyrhizobium sp. BTAi1 .................................................   86  3 hits [a-proteobacteria]       dimethyladenosine transferase [Bradyrhizobium sp. BTAi1] >g
. . . Bacillus cereus AH1271 ...................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus AH1271] >gi|
. . . Clostridium difficile QCD-63q42 ..........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile QCD-63
. . . Clostridium difficile ATCC 43255 .........................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium difficile QCD-63
. . . Filifactor alocis ATCC 35896 .............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Filifactor alocis ATCC 35896
. . . Bacillus cereus BDRD-ST24 ................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus BDRD-ST24] >
. . . Clostridium sp. L2-50 ....................................................   86  2 hits [firmicutes]             hypothetical protein CLOL250_02012 [Clostridium sp. L2-50] 
. . . Campylobacter concisus 13826 .............................................   86  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter concisus 13826
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ......................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ..................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 .......................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 .....................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus cereus Rock3-42 .................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus cereus 95/8201 ..................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus cereus BDRD-ST26 ................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus cereus ATCC 4342 ................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Bacillus cereus m1293 ....................................................   86  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus thuringiensis serov
. . . Mycobacterium abscessus ATCC 19977 .......................................   86  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium abscessus ATCC
. . . Mycobacterium abscessus ..................................................   86  1 hit  [high GC Gram+]          dimethyladenosine transferase [Mycobacterium abscessus ATCC
. . . Nocardioides sp. JS614 ...................................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Nocardioides sp. JS614] >gi|
. . . Thioalkalivibrio sp. K90mix ..............................................   86  2 hits [g-proteobacteria]       dimethyladenosine transferase [Thioalkalivibrio sp. K90mix]
. . . Slackia exigua ATCC 700122 ...............................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Slackia exigua ATCC 700122] 
. . . Nitrococcus mobilis Nb-231 ...............................................   86  2 hits [g-proteobacteria]       dimethyladenosine transferase [Nitrococcus mobilis Nb-231] 
. . . Thermoanaerobacter italicus Ab9 ..........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter italicus 
. . . Oceanobacillus iheyensis HTE831 ..........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Oceanobacillus iheyensis HTE
. . . Oceanobacillus iheyensis .................................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Oceanobacillus iheyensis HTE
. . . Rhodobacterales bacterium HTCC2654 .......................................   86  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacterales bacterium HT
. . . Cyanothece sp. PCC 7424 ..................................................   86  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. PCC 7424] >gi
. . . Thermus thermophilus HB8 .................................................   86 13 hits [bacteria]               dimethyladenosine transferase [Thermus thermophilus HB8] >g
. . . Streptomyces coelicolor A3(2) ............................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces coelicolor A3(2
. . . Streptomyces lividans TK24 ...............................................   86  3 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces coelicolor A3(2
. . . Streptomyces coelicolor ..................................................   86  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces coelicolor A3(2
. . . Zunongwangia profunda SM-A87 .............................................   86  2 hits [CFB group bacteria]     dimethyladenosine transferase [Zunongwangia profunda SM-A87
. . . Micrococcus luteus NCTC 2665 .............................................   86  3 hits [high GC Gram+]          ksgA dimethyladenosine transferase [Micrococcus luteus NCTC
. . . Prevotella copri DSM 18205 ...............................................   86  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella copri DSM 18205] 
. . . Ruminococcus sp. 18P13 ...................................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus sp. 18P13]
. . . Kordia algicida OT-1 .....................................................   86  2 hits [CFB group bacteria]     dimethyladenosine transferase [Kordia algicida OT-1] >gi|16
. . . Azorhizobium caulinodans ORS 571 .........................................   86  3 hits [a-proteobacteria]       rRNA 16S rRNA dimethylase [Azorhizobium caulinodans ORS 571
. . . Bacillus megaterium QM B1551 .............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus megaterium QM B1551
. . . Thermoanaerobacter mathranii subsp. mathranii str. A3 ....................   86  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter mathranii
. . . Dictyoglomus turgidum DSM 6724 ...........................................   86  2 hits [bacteria]               dimethyladenosine transferase [Dictyoglomus turgidum DSM 67
. . . Spirosoma linguale DSM 74 ................................................   86  2 hits [CFB group bacteria]     dimethyladenosine transferase [Spirosoma linguale DSM 74] >
. . . Streptococcus gordonii str. Challis substr. CH1 ..........................   86  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus gordonii str. 
. . . Streptococcus gordonii str. Challis ......................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Streptococcus gordonii str. 
. . . Helicobacter pullorum MIT 98-5489 ........................................   86  2 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pullorum MIT 98
. . . Sulfurihydrogenibium sp. YO3AOP1 .........................................   86  3 hits [aquificales]            dimethyladenosine transferase [Sulfurihydrogenibium sp. YO3
. . . Streptococcus suis 89/1591 ...............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus suis 89/1591] 
. . . Lactobacillus crispatus 214-1 ............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus crispatus 214-
. . . Actinomyces sp. oral taxon 848 str. F0332 ................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Actinomyces sp. oral taxon 8
. . . Catonella morbi ATCC 51271 ...............................................   86  2 hits [firmicutes]             hypothetical protein GCWU000282_00837 [Catonella morbi ATCC
. . . Chlorobium phaeobacteroides BS1 ..........................................   86  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium phaeobacteroides 
. . . Candidatus Koribacter versatilis Ellin345 ................................   86  3 hits [bacteria]               dimethyladenosine transferase [Candidatus Koribacter versat
. . . Streptococcus sp. 2_1_36FAA ..............................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus sp. 2_1_36FAA]
. . . Alkaliphilus metalliredigens QYMF ........................................   86  3 hits [firmicutes]             dimethyladenosine transferase [Alkaliphilus metalliredigens
. . . Stackebrandtia nassauensis DSM 44728 .....................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Stackebrandtia nassauensis D
. . . Sulfitobacter sp. EE-36 ..................................................   86  2 hits [a-proteobacteria]       dimethyladenosine transferase [Sulfitobacter sp. EE-36] >gi
. . . Lactobacillus crispatus JV-V01 ...........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus crispatus JV-V
. . . Lactobacillus crispatus 125-2-CHN ........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus crispatus JV-V
. . . Lactobacillus crispatus MV-1A-US .........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus crispatus JV-V
. . . Clostridium perfringens str. 13 ..........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens ATCC 13124 .......................................   86  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens SM101 ............................................   86  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens CPE str. F4969 ...................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens C str. JGS1495 ...................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens D str. JGS1721 ...................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Clostridium perfringens ..................................................   86  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium perfringens str.
. . . Chlorobaculum parvum NCIB 8327 ...........................................   86  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobaculum parvum NCIB 83
. . . Ethanoligenens harbinense YUAN-3 .........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Ethanoligenens harbinense YU
. . . Lactobacillus crispatus MV-3A-US .........................................   86  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus crispatus MV-3
. . . Micrococcus luteus SK58 ..................................................   86  2 hits [high GC Gram+]          dimethyladenosine transferase [Micrococcus luteus SK58] >gi
. . . Bacteroides cellulosilyticus DSM 14838 ...................................   85  2 hits [CFB group bacteria]     hypothetical protein BACCELL_03003 [Bacteroides cellulosily
. . . marine actinobacterium PHSC20C1 ..........................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [marine actinobacterium PHSC2
. . . Clostridium sporogenes ATCC 15579 ........................................   85  2 hits [firmicutes]             hypothetical protein CLOSPO_00879 [Clostridium sporogenes A
. . . Cyanothece sp. CCY0110 ...................................................   85  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. CCY0110] >gi|
. . . Pantoea ananatis LMG 20103 ...............................................   85  2 hits [enterobacteria]         KsgA [Pantoea ananatis LMG 20103] >gi|291151266|gb|ADD75850
. . . Prevotella oris F0302 ....................................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella oris F0302] >gi|2
. . . Pedobacter heparinus DSM 2366 ............................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Pedobacter heparinus DSM 236
. . . Bacillus mycoides Rock3-17 ...............................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides Rock3-17] 
. . . Bacillus mycoides Rock1-4 ................................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus mycoides Rock3-17] 
. . . Prevotella sp. oral taxon 299 str. F0039 .................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella sp. oral taxon 29
. . . Borrelia valaisiana VS116 ................................................   85  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia valaisiana VS116] >
. . . Bacillus pseudomycoides DSM 12442 ........................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus pseudomycoides DSM 
. . . Campylobacter upsaliensis RM3195 .........................................   85  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter upsaliensis RM
. . . Meiothermus ruber DSM 1279 ...............................................   85  2 hits [bacteria]               dimethyladenosine transferase [Meiothermus ruber DSM 1279] 
. . . Prevotella buccae D17 ....................................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella buccae D17] >gi|2
. . . Alicyclobacillus acidocaldarius LAA1 .....................................   85  2 hits [firmicutes]             dimethyladenosine transferase [Alicyclobacillus acidocaldar
. . . Geobacillus sp. Y412MC52 .................................................   85  2 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. Y412MC52] >g
. . . Geobacillus sp. Y412MC61 .................................................   85  2 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. Y412MC52] >g
. . . Selenomonas sputigena ATCC 35185 .........................................   85  2 hits [firmicutes]             dimethyladenosine transferase [Selenomonas sputigena ATCC 3
. . . Frankia sp. EAN1pec ......................................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Frankia sp. EAN1pec] >gi|158
. . . Xylella fastidiosa Temecula1 .............................................   85  3 hits [g-proteobacteria]       dimethyladenosine transferase [Xylella fastidiosa Temecula1
. . . Chryseobacterium gleum ATCC 35910 ........................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Chryseobacterium gleum ATCC 
. . . Mycoplasma synoviae 53 ...................................................   85  3 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma synoviae 53] >gi|
. . . Anaerococcus vaginalis ATCC 51170 ........................................   85  2 hits [firmicutes]             dimethyladenosine transferase [Anaerococcus vaginalis ATCC 
. . . Helicobacter mustelae 12198 ..............................................   85  2 hits [e-proteobacteria]       putative dimethyladenosine transferase (16S rRNA dimethylas
. . . Helicobacter winghamensis ATCC BAA-430 ...................................   85  2 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter winghamensis AT
. . . Pseudovibrio sp. JE062 ...................................................   85  2 hits [a-proteobacteria]       dimethyladenosine transferase [Pseudovibrio sp. JE062] >gi|
. . . Synechococcus sp. WH 5701 ................................................   85  2 hits [cyanobacteria]          putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechoc
. . . Streptomyces scabiei 87.22 ...............................................   85  2 hits [high GC Gram+]          putative SAM-binding methyltransferase [Streptomyces scabie
. . . Micromonospora aurantiaca ATCC 27029 .....................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Micromonospora aurantiaca AT
. . . Prevotella bergensis DSM 17361 ...........................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella bergensis DSM 173
. . . Streptomyces sp. Mg1 .....................................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase dimethyltransferase) [Strepto
. . . Micromonospora sp. L5 ....................................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Micromonospora sp. L5] >gi|2
. . . Parabacteroides johnsonii DSM 18315 ......................................   85  2 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_00287 [Parabacteroides joh
. . . Flavobacteria bacterium BBFL7 ............................................   85  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteria bacterium BBFL
. . . Xylella fastidiosa M12 ...................................................   85  2 hits [g-proteobacteria]       rRNA (adenine-N(6)-)-methyltransferase [Xylella fastidiosa 
. . . Xylella fastidiosa M23 ...................................................   85  2 hits [g-proteobacteria]       rRNA (adenine-N(6)-)-methyltransferase [Xylella fastidiosa 
. . . Geobacillus sp. WCH70 ....................................................   85  3 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. WCH70] >gi|2
. . . Frankia symbiont of Datisca glomerata ....................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Frankia symbiont of Datisca 
. . . Salinispora tropica CNB-440 ..............................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Salinispora tropica CNB-440]
. . . Xylella fastidiosa subsp. sandyi Ann-1 ...................................   85  4 hits [g-proteobacteria]       RRNA 16S rRNA dimethylase [Xylella fastidiosa Ann-1] >gi|71
. . . Lactobacillus brevis ATCC 367 ............................................   85  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus brevis ATCC 36
. . . Shewanella frigidimarina NCIMB 400 .......................................   85  3 hits [g-proteobacteria]       dimethyladenosine transferase [Shewanella frigidimarina NCI
. . . Gallionella capsiferriformans ES-2 .......................................   85  2 hits [b-proteobacteria]       dimethyladenosine transferase [Gallionella ferruginea ES-2]
. . . Bacillus cereus Rock4-18 .................................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus Rock4-18] >g
. . . Bacillus cereus Rock3-29 .................................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus Rock4-18] >g
. . . Bacillus cereus Rock3-28 .................................................   85  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus Rock4-18] >g
. . . Burkholderia dolosa AUO158 ...............................................   85  2 hits [b-proteobacteria]       Dimethyladenosine transferase [Burkholderia dolosa AUO158] 
. . . Gluconobacter oxydans 621H ...............................................   85  2 hits [a-proteobacteria]       dimethyladenosine transferase [Gluconobacter oxydans 621H] 
. . . Gluconobacter oxydans ....................................................   85  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Gluconobacter oxydans 621H] 
. . . Micromonospora sp. ATCC 39149 ............................................   85  2 hits [high GC Gram+]          dimethyladenosine transferase [Micromonospora sp. ATCC 3914
. . . Thermus thermophilus HB27 ................................................   85  3 hits [bacteria]               dimethyladenosine transferase [Thermus thermophilus HB27] >
. . . Arthrobacter aurescens TC1 ...............................................   85  3 hits [high GC Gram+]          dimethyladenosine transferase [Arthrobacter aurescens TC1] 
. . . Nautilia profundicola AmH ................................................   85  2 hits [e-proteobacteria]       dimethyladenosine transferase (S-adenosylmethionine-6-N',N'
. . . Verrucomicrobiae bacterium DG1235 ........................................   85  2 hits [verrucomicrobia]        dimethyladenosine transferase [Verrucomicrobiae bacterium D
. . . Lactobacillus vaginalis ATCC 49540 .......................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus vaginalis ATCC
. . . Geobacter sulfurreducens PCA .............................................   84  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter sulfurreducens PCA
. . . Geobacter sulfurreducens .................................................   84  1 hit  [d-proteobacteria]       dimethyladenosine transferase [Geobacter sulfurreducens PCA
. . . Bradyrhizobium sp. ORS278 ................................................   84  3 hits [a-proteobacteria]       dimethyladenosine transferase [Bradyrhizobium sp. ORS278] >
. . . Trichodesmium erythraeum IMS101 ..........................................   84  2 hits [cyanobacteria]          dimethyladenosine transferase [Trichodesmium erythraeum IMS
. . . Colwellia psychrerythraea 34H ............................................   84  3 hits [g-proteobacteria]       dimethyladenosine transferase [Colwellia psychrerythraea 34
. . . Cupriavidus metallidurans CH34 ...........................................   84  3 hits [b-proteobacteria]       dimethyladenosine transferase [Cupriavidus metallidurans CH
. . . Eikenella corrodens ATCC 23834 ...........................................   84  2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_00383 [Eikenella corrodens AT
. . . Ralstonia eutropha JMP134 ................................................   84  3 hits [b-proteobacteria]       dimethyladenosine transferase [Ralstonia eutropha JMP134] >
. . . Renibacterium salmoninarum ATCC 33209 ....................................   84  2 hits [high GC Gram+]          dimethyladenosine transferase [Renibacterium salmoninarum A
. . . Halothermothrix orenii H 168 .............................................   84  3 hits [firmicutes]             dimethyladenosine transferase [Halothermothrix orenii H 168
. . . Eggerthella lenta DSM 2243 ...............................................   84  2 hits [high GC Gram+]          ribosomal RNA adenine methylase transferase [Eggerthella le
. . . Xylella fastidiosa Dixon .................................................   84  2 hits [g-proteobacteria]       RRNA 16S rRNA dimethylase [Xylella fastidiosa Dixon] >gi|71
. . . Sideroxydans lithotrophicus ES-1 .........................................   84  2 hits [b-proteobacteria]       dimethyladenosine transferase [Sideroxydans lithotrophicus 
. . . Deinococcus geothermalis DSM 11300 .......................................   84  3 hits [bacteria]               dimethyladenosine transferase [Deinococcus geothermalis DSM
. . . Streptomyces griseoflavus Tu4000 .........................................   84  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces griseoflavus Tu
. . . Streptomyces sp. C .......................................................   84  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces sp. C]
. . . Lactobacillus fermentum IFO 3956 .........................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus fermentum IFO 
. . . Lactobacillus fermentum ATCC 14931 .......................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus fermentum IFO 
. . . Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 ...................   84  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus delbrueckii su
. . . Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 .................   84  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus delbrueckii su
. . . Dichelobacter nodosus VCS1703A ...........................................   84  3 hits [g-proteobacteria]       rRNA adenine dimethylase [Dichelobacter nodosus VCS1703A] >
. . . Streptomyces sp. e14 .....................................................   84  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces sp. e14] >gi|29
. . . Eubacterium siraeum 70/3 .................................................   84  1 hit  [firmicutes]             dimethyladenosine transferase [Eubacterium siraeum 70/3]
. . . Xylella fastidiosa .......................................................   84  1 hit  [g-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Lactobacillus acidophilus NCFM ...........................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus acidophilus NC
. . . Lactobacillus acidophilus ATCC 4796 ......................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus acidophilus NC
. . . Lactobacillus acidophilus ................................................   84  1 hit  [firmicutes]             dimethyladenosine transferase [Lactobacillus acidophilus NC
. . . Ruminococcus bromii L2-63 ................................................   84  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus bromii L2-63]
. . . Clostridium botulinum A2 str. Kyoto ......................................   84  3 hits [firmicutes]             dimethyladenosine transferase [Clostridium botulinum A2 str
. . . Nodularia spumigena CCY9414 ..............................................   84  2 hits [cyanobacteria]          16S rRNA dimethylase [Nodularia spumigena CCY9414] >gi|1194
. . . Geobacillus sp. G11MC16 ..................................................   84  2 hits [firmicutes]             dimethyladenosine transferase [Geobacillus sp. G11MC16] >gi
. . . Parabacteroides distasonis ATCC 8503 .....................................   84  3 hits [CFB group bacteria]     dimethyladenosine transferase [Parabacteroides distasonis A
. . . Limnobacter sp. MED105 ...................................................   84  2 hits [b-proteobacteria]       dimethyladenosine transferase [Limnobacter sp. MED105] >gi|
. . . Bacteroides sp. 2_1_7 ....................................................   84  1 hit  [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 2_1_7] >gi|2
. . . Parabacteroides sp. D13 ..................................................   84  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 2_1_7] >gi|2
. . . Bacteroides sp. 2_1_33B ..................................................   84  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 2_1_7] >gi|2
. . . Alistipes putredinis DSM 17216 ...........................................   84  2 hits [CFB group bacteria]     hypothetical protein ALIPUT_00071 [Alistipes putredinis DSM
. . . Nitrosomonas europaea ATCC 19718 .........................................   84  2 hits [b-proteobacteria]       dimethyladenosine transferase [Nitrosomonas europaea ATCC 1
. . . Nitrosomonas europaea ....................................................   84  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Nitrosomonas europaea ATCC 1
. . . Frankia alni ACN14a ......................................................   83  2 hits [high GC Gram+]          dimethyladenosine transferase [Frankia alni ACN14a] >gi|111
. . . Geobacillus thermodenitrificans NG80-2 ...................................   83  3 hits [firmicutes]             dimethyladenosine transferase [Geobacillus thermodenitrific
. . . Lactobacillus brevis subsp. gravesensis ATCC 27305 .......................   83  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus brevis subsp. 
. . . Lactobacillus buchneri ATCC 11577 ........................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus brevis subsp. 
. . . Psychrobacter cryohalolentis K5 ..........................................   83  3 hits [g-proteobacteria]       dimethyladenosine transferase [Psychrobacter cryohalolentis
. . . Bacillus cereus Rock3-44 .................................................   83  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus Rock3-44] >g
. . . Xylella fastidiosa 9a5c ..................................................   83  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xylella fastidiosa 9a5c] >gi
. . . Streptomyces ghanaensis ATCC 14672 .......................................   83  3 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces ghanaensis ATCC
. . . Polaribacter irgensii 23-P ...............................................   83  2 hits [CFB group bacteria]     dimethyladenosine transferase [Polaribacter irgensii 23-P] 
. . . Mesoplasma florum L1 .....................................................   83  2 hits [mycoplasmas]            dimethyladenosine transferase [Mesoplasma florum L1] >gi|62
. . . Mesoplasma florum ........................................................   83  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mesoplasma florum L1] >gi|62
. . . Prevotella veroralis F0319 ...............................................   83  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella veroralis F0319] 
. . . Halothiobacillus neapolitanus c2 .........................................   83  2 hits [g-proteobacteria]       dimethyladenosine transferase [Halothiobacillus neapolitanu
. . . Persephonella marina EX-H1 ...............................................   83  3 hits [aquificales]            dimethyladenosine transferase [Persephonella marina EX-H1] 
. . . Rhodopseudomonas palustris BisB18 ........................................   83  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris B
. . . Finegoldia magna ATCC 53516 ..............................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Finegoldia magna ATCC 53516]
. . . Clostridium methylpentosum DSM 5476 ......................................   83  2 hits [firmicutes]             hypothetical protein CLOSTMETH_00719 [Clostridium methylpen
. . . Streptomyces avermitilis MA-4680 .........................................   83  2 hits [high GC Gram+]          dimethyladenosine transferase [Streptomyces avermitilis MA-
. . . Streptomyces avermitilis .................................................   83  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces avermitilis MA-
. . . Bacillus licheniformis ATCC 14580 ........................................   83  5 hits [firmicutes]             dimethyladenosine transferase [Bacillus licheniformis ATCC 
. . . Psychrobacter arcticus 273-4 .............................................   83  3 hits [g-proteobacteria]       dimethyladenosine transferase [Psychrobacter arcticus 273-4
. . . Arthrobacter chlorophenolicus A6 .........................................   83  2 hits [high GC Gram+]          dimethyladenosine transferase [Arthrobacter chlorophenolicu
. . . Algoriphagus sp. PR1 .....................................................   83  2 hits [CFB group bacteria]     dimethyladenosine transferase [Algoriphagus sp. PR1] >gi|12
. . . Mycoplasma hyopneumoniae J ...............................................   83  3 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma hyopneumoniae J]
. . . Paenibacillus larvae subsp. larvae BRL-230010 ............................   83  1 hit  [firmicutes]             dimethyladenosine transferase [Paenibacillus larvae subsp. 
. . . Prevotella sp. oral taxon 317 str. F0108 .................................   83  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella sp. oral taxon 31
. . . Geobacter uraniireducens Rf4 .............................................   83  2 hits [d-proteobacteria]       dimethyladenosine transferase [Geobacter uraniireducens Rf4
. . . Borrelia garinii PBi .....................................................   83  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia garinii PBi] >gi|62
. . . Borrelia garinii .........................................................   83  1 hit  [spirochetes]            dimethyladenosine transferase [Borrelia garinii PBi] >gi|62
. . . Microcystis aeruginosa NIES-843 ..........................................   83  2 hits [cyanobacteria]          dimethyladenosine transferase [Microcystis aeruginosa NIES-
. . . Fusobacterium gonidiaformans ATCC 25563 ..................................   83  1 hit  [fusobacteria]           dimethyladenosine transferase [Fusobacterium gonidiaformans
. . . Lactobacillus ultunensis DSM 16047 .......................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus ultunensis DSM
. . . Nostoc punctiforme PCC 73102 .............................................   83  3 hits [cyanobacteria]          dimethyladenosine transferase [Nostoc punctiforme PCC 73102
. . . Lactobacillus plantarum WCFS1 ............................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus plantarum WCFS
. . . Lactobacillus plantarum ..................................................   83  1 hit  [firmicutes]             dimethyladenosine transferase [Lactobacillus plantarum WCFS
. . . Lactobacillus hilgardii ATCC 8290 ........................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus hilgardii ATCC
. . . Dyadobacter fermentans DSM 18053 .........................................   83  2 hits [CFB group bacteria]     dimethyladenosine transferase [Dyadobacter fermentans DSM 1
. . . Chromohalobacter salexigens DSM 3043 .....................................   83  3 hits [g-proteobacteria]       dimethyladenosine transferase [Chromohalobacter salexigens 
. . . Thermoanaerobacter pseudethanolicus ATCC 33223 ...........................   83  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter pseudetha
. . . Thermoanaerobacter brockii subsp. finnii Ako-1 ...........................   83  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter pseudetha
. . . Thermoanaerobacter ethanolicus CCSD1 .....................................   83  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter pseudetha
. . . Thermosynechococcus elongatus BP-1 .......................................   83  3 hits [cyanobacteria]          dimethyladenosine transferase [Thermosynechococcus elongatu
. . . Cupriavidus taiwanensis ..................................................   83  3 hits [b-proteobacteria]       dimethyladenosine transferase [Cupriavidus taiwanensis] >gi
. . . Natranaerobius thermophilus JW/NM-WN-LF ..................................   83  3 hits [firmicutes]             dimethyladenosine transferase [Natranaerobius thermophilus 
. . . Achromobacter piechaudii ATCC 43553 ......................................   83  4 hits [b-proteobacteria]       dimethyladenosine transferase [Achromobacter piechaudii ATC
. . . Ruminococcus flavefaciens FD-1 ...........................................   83  1 hit  [firmicutes]             dimethyladenosine transferase [Ruminococcus flavefaciens FD
. . . Parabacteroides merdae ATCC 43184 ........................................   83  2 hits [CFB group bacteria]     hypothetical protein PARMER_03416 [Parabacteroides merdae A
. . . Plesiocystis pacifica SIR-1 ..............................................   82  2 hits [d-proteobacteria]       dimethyladenosine transferase [Plesiocystis pacifica SIR-1]
. . . Mycoplasma hominis .......................................................   82  2 hits [mycoplasmas]            Dimethyladenosine transferase [Mycoplasma hominis] >gi|2683
. . . 'Nostoc azollae' 0708 ....................................................   82  2 hits [cyanobacteria]          dimethyladenosine transferase ['Nostoc azollae' 0708] >gi|2
. . . uncultured bacterium BAC13K9BAC ..........................................   82  1 hit  [bacteria]               predicted dimethyladenosine transferase NMA0902 [uncultured
. . . Thermoanaerobacter sp. X514 ..............................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter sp. X514]
. . . Thermoanaerobacter sp. X513 ..............................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter sp. X514]
. . . Thermoanaerobacter sp. X561 ..............................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Thermoanaerobacter sp. X514]
. . . Bacteroides sp. 2_1_16 ...................................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides sp. 2_1_16] >gi|
. . . Weissella paramesenteroides ATCC 33313 ...................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Weissella paramesenteroides 
. . . Xanthomonas oryzae pv. oryzae KACC10331 ..................................   82  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas oryzae pv. oryza
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................   82  3 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas oryzae pv. oryza
. . . Xanthomonas oryzae pv. oryzae PXO99A .....................................   82  3 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas oryzae pv. oryza
. . . Xanthomonas oryzae pv. oryzae ............................................   82  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas oryzae pv. oryza
. . . Eubacterium siraeum DSM 15702 ............................................   82  2 hits [firmicutes]             hypothetical protein EUBSIR_01273 [Eubacterium siraeum DSM 
. . . Hydrogenivirga sp. 128-5-R1-1 ............................................   82  4 hits [aquificales]            dimethyladenosine transferase [Hydrogenivirga sp. 128-5-R1-
. . . Vibrio metschnikovii CIP 69.14 ...........................................   82  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio metschnikovii CIP 69.
. . . candidate division TM7 single-cell isolate TM7c ..........................   82  1 hit  [bacteria]               dimethyladenosine transferase [candidate division TM7 singl
. . . Eubacterium siraeum V10Sc8a ..............................................   82  1 hit  [firmicutes]             dimethyladenosine transferase [Eubacterium siraeum V10Sc8a]
. . . Bacteroides fragilis YCH46 ...............................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides fragilis YCH46] 
. . . Bacteroides fragilis NCTC 9343 ...........................................   82  3 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides fragilis YCH46] 
. . . Bacteroides sp. 3_2_5 ....................................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Bacteroides fragilis YCH46] 
. . . Bacteroides fragilis .....................................................   82  1 hit  [CFB group bacteria]     dimethyladenosine transferase [Bacteroides fragilis YCH46] 
. . . Fusobacterium sp. 3_1_5R .................................................   82  1 hit  [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 3_1_5R]
. . . Sulfurihydrogenibium yellowstonense SS-5 .................................   82  2 hits [aquificales]            dimethyladenosine transferase [Sulfurihydrogenibium yellows
. . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................   82  2 hits [b-proteobacteria]       dimethyladenosine transferase [Candidatus Accumulibacter ph
. . . Mycoplasma mobile 163K ...................................................   82  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma mobile 163K] >gi|
. . . Mycoplasma mobile ........................................................   82  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma mobile 163K] >gi|
. . . Borrelia spielmanii A14S .................................................   82  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia spielmanii A14S] >g
. . . Candidatus Riesia pediculicola USDA ......................................   82  1 hit  [enterobacteria]         dimethyladenosine transferase [Candidatus Riesia pediculico
. . . Halorhodospira halophila SL1 .............................................   82  3 hits [g-proteobacteria]       dimethyladenosine transferase [Halorhodospira halophila SL1
. . . Lactobacillus plantarum subsp. plantarum ATCC 14917 ......................   82  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus plantarum subs
. . . Lactobacillus plantarum JDM1 .............................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus plantarum subs
. . . Microcystis aeruginosa PCC 7806 ..........................................   82  1 hit  [cyanobacteria]          unnamed protein product [Microcystis aeruginosa PCC 7806]
. . . Bordetella petrii DSM 12804 ..............................................   82  2 hits [b-proteobacteria]       dimethyladenosine transferase [Bordetella petrii DSM 12804]
. . . Bordetella petrii ........................................................   82  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Bordetella petrii DSM 12804]
. . . Nitratiruptor sp. SB155-2 ................................................   82  2 hits [e-proteobacteria]       dimethyladenosine transferase [Nitratiruptor sp. SB155-2] >
. . . Mobiluncus curtisii ATCC 43063 ...........................................   82  2 hits [high GC Gram+]          possible dimethyladenosine transferase [Mobiluncus curtisii
. . . Anaerococcus lactolyticus ATCC 51172 .....................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Anaerococcus lactolyticus AT
. . . Cyanothece sp. PCC 8802 ..................................................   82  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. PCC 8802] >gi
. . . Cyanothece sp. PCC 8801 ..................................................   82  3 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. PCC 8801] >gi
. . . Prevotella sp. oral taxon 472 str. F0295 .................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Prevotella sp. oral taxon 47
. . . Clostridium acetobutylicum ATCC 824 ......................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium acetobutylicum A
. . . Clostridium acetobutylicum ...............................................   82  1 hit  [firmicutes]             dimethyladenosine transferase [Clostridium acetobutylicum A
. . . Treponema denticola ATCC 35405 ...........................................   82  2 hits [spirochetes]            dimethyladenosine transferase [Treponema denticola ATCC 354
. . . Treponema denticola ......................................................   82  1 hit  [spirochetes]            dimethyladenosine transferase [Treponema denticola ATCC 354
. . . Clostridium cellulovorans 743B ...........................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium cellulovorans 74
. . . Xanthomonas campestris pv. campestris str. B100 ..........................   82  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. c
. . . Xanthomonas campestris pv. campestris ....................................   82  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. c
. . . Bacillus subtilis subsp. subtilis str. 168 ...............................   82  4 hits [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 .........................   82  1 hit  [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Bacillus subtilis subsp. subtilis str. JH642 .............................   82  1 hit  [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Bacillus subtilis subsp. subtilis str. SMY ...............................   82  1 hit  [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Bacillus subtilis ........................................................   82  8 hits [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Bacillus subtilis subsp. natto BEST195 ...................................   82  1 hit  [firmicutes]             dimethyladenosine 16S ribosomal RNA transferase [Bacillus s
. . . Nitrobacter winogradskyi Nb-255 ..........................................   82  3 hits [a-proteobacteria]       dimethyladenosine transferase [Nitrobacter winogradskyi Nb-
. . . Borrelia garinii PBr .....................................................   82  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia garinii PBr] >gi|21
. . . Candidatus Sulcia muelleri SMDSEM ........................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Candidatus Sulcia muelleri S
. . . Carnobacterium sp. AT7 ...................................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Carnobacterium sp. AT7] >gi|
. . . Petrotoga mobilis SJ95 ...................................................   82  2 hits [thermotogales]          dimethyladenosine transferase [Petrotoga mobilis SJ95] >gi|
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................   82  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. c
. . . Xanthomonas campestris pv. campestris str. 8004 ..........................   82  3 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. c
. . . Propionibacterium acnes J139 .............................................   82  2 hits [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes J139
. . . Flavobacteria bacterium MS024-3C .........................................   82  2 hits [CFB group bacteria]     dimethyladenosine transferase [Flavobacteria bacterium MS02
. . . Lactobacillus ruminis ATCC 25644 .........................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus ruminis ATCC 2
. . . Mycoplasma hyopneumoniae 7448 ............................................   82  3 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma hyopneumoniae 744
. . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ..................   82  2 hits [high GC Gram+]          dimethyladenosine transferase [Nocardiopsis dassonvillei su
. . . Sulfurovum sp. NBC37-1 ...................................................   82  2 hits [e-proteobacteria]       dimethyladenosine transferase [Sulfurovum sp. NBC37-1] >gi|
. . . Mycoplasma pulmonis UAB CTIP .............................................   82  1 hit  [mycoplasmas]            dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Mycoplasma pulmonis ......................................................   82  2 hits [mycoplasmas]            dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Lactobacillus salivarius UCC118 ..........................................   82  3 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus salivarius UCC
. . . Lactobacillus salivarius ATCC 11741 ......................................   82  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus salivarius ATC
. . . Burkholderia vietnamiensis G4 ............................................   81  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia vietnamiensis G
. . . Cylindrospermopsis raciborskii CS-505 ....................................   81  2 hits [cyanobacteria]          16S rRNA dimethylase [Cylindrospermopsis raciborskii CS-505
. . . Methylotenera mobilis JLW8 ...............................................   81  2 hits [b-proteobacteria]       dimethyladenosine transferase [Methylotenera mobilis JLW8] 
. . . Rhodobacterales bacterium HTCC2083 .......................................   81  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodobacterales bacterium HT
. . . Porphyromonas gingivalis W83 .............................................   81  2 hits [CFB group bacteria]     dimethyladenosine transferase [Porphyromonas gingivalis W83
. . . Porphyromonas gingivalis ATCC 33277 ......................................   81  3 hits [CFB group bacteria]     dimethyladenosine transferase [Porphyromonas gingivalis W83
. . . Porphyromonas gingivalis .................................................   81  1 hit  [CFB group bacteria]     dimethyladenosine transferase [Porphyromonas gingivalis W83
. . . uncultured SUP05 cluster bacterium .......................................   81  1 hit  [g-proteobacteria]       dimethyladenosine transferase, rRNA methylation [uncultured
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............   81  2 hits [g-proteobacteria]       dimethyladenosine transferase [Candidatus Ruthia magnifica 
. . . Helicobacter hepaticus ATCC 51449 ........................................   81  2 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter hepaticus ATCC 
. . . Helicobacter hepaticus ...................................................   81  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter hepaticus ATCC 
. . . Fibrobacter succinogenes subsp. succinogenes S85 .........................   81  2 hits [bacteria]               dimethyladenosine transferase [Fibrobacter succinogenes sub
. . . Sulfurihydrogenibium azorense Az-Fu1 .....................................   81  2 hits [aquificales]            dimethyladenosine transferase [Sulfurihydrogenibium azorens
. . . Mycoplasma hyopneumoniae 232 .............................................   81  3 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma hyopneumoniae 232
. . . Gemella haemolysans ATCC 10379 ...........................................   81  2 hits [firmicutes]             dimethyladenosine transferase [Gemella haemolysans ATCC 103
. . . Arcobacter butzleri RM4018 ...............................................   81  3 hits [e-proteobacteria]       dimethyladenosine transferase [Arcobacter butzleri RM4018] 
. . . Vibrio harveyi ...........................................................   81  1 hit  [g-proteobacteria]       KsgA [Vibrio harveyi]
. . . Bacillus cereus Rock1-3 ..................................................   81  2 hits [firmicutes]             Dimethyladenosine transferase [Bacillus cereus Rock1-3] >gi
. . . Acholeplasma laidlawii PG-8A .............................................   81  2 hits [mycoplasmas]            dimethyladenosine transferase [Acholeplasma laidlawii PG-8A
. . . Xanthomonas oryzae pv. oryzicola BLS256 ..................................   81  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas oryzae pv. oryzi
. . . Propionibacterium acnes KPA171202 ........................................   81  2 hits [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes KPA1
. . . Propionibacterium acnes SK187 ............................................   81  2 hits [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes KPA1
. . . Propionibacterium acnes J165 .............................................   81  2 hits [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes KPA1
. . . Propionibacterium acnes SK137 ............................................   81  2 hits [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes KPA1
. . . Propionibacterium acnes ..................................................   81  1 hit  [high GC Gram+]          dimethyladenosine transferase [Propionibacterium acnes KPA1
. . . Finegoldia magna ATCC 29328 ..............................................   81  2 hits [firmicutes]             dimethyladenosine transferase [Finegoldia magna ATCC 29328]
. . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................   81  2 hits [b-proteobacteria]       dimethyladenosine transferase [Polynucleobacter necessarius
. . . Dictyoglomus thermophilum H-6-12 .........................................   80  2 hits [bacteria]               dimethyladenosine transferase [Dictyoglomus thermophilum H-
. . . Listeria grayi DSM 20601 .................................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria grayi DSM 20601] >g
. . . Xanthomonas campestris pv. vasculorum NCPPB702 ...........................   80  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. v
. . . Fusobacterium ulcerans ATCC 49185 ........................................   80  1 hit  [fusobacteria]           dimethyladenosine transferase [Fusobacterium ulcerans ATCC 
. . . Prosthecochloris aestuarii DSM 271 .......................................   80  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Prosthecochloris aestuarii D
. . . Synechococcus sp. RCC307 .................................................   80  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. RCC307] >g
. . . Frankia sp. CcI3 .........................................................   80  2 hits [high GC Gram+]          dimethyladenosine transferase [Frankia sp. CcI3] >gi|865695
. . . Anoxybacillus flavithermus WK1 ...........................................   80  3 hits [firmicutes]             dimethyladenosine transferase [Anoxybacillus flavithermus W
. . . Mycoplasma arthritidis 158L3-1 ...........................................   80  3 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma arthritidis 158L3
. . . Chlorobium chlorochromatii CaD3 ..........................................   80  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium chlorochromatii C
. . . Myxococcus xanthus DK 1622 ...............................................   80  3 hits [d-proteobacteria]       dimethyladenosine transferase [Myxococcus xanthus DK 1622] 
. . . Bordetella pertussis Tohama I ............................................   80  2 hits [b-proteobacteria]       dimethyladenosine transferase [Bordetella pertussis Tohama 
. . . Bordetella pertussis .....................................................   80  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Bordetella pertussis Tohama 
. . . Borrelia afzelii ACA-1 ...................................................   80  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia afzelii ACA-1] >gi|
. . . Chlorobium phaeobacteroides DSM 266 ......................................   80  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium phaeobacteroides 
. . . Borrelia garinii Far04 ...................................................   80  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia garinii Far04] >gi|
. . . Burkholderia ambifaria AMMD ..............................................   80  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia ambifaria AMMD]
. . . Chlorobium phaeovibrioides DSM 265 .......................................   80  2 hits [green sulfur bacteria]  dimethyladenosine transferase [Prosthecochloris vibrioformi
. . . Fusobacterium nucleatum subsp. nucleatum ATCC 25586 ......................   80  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium nucleatum subs
. . . Fusobacterium nucleatum subsp. nucleatum .................................   80  1 hit  [fusobacteria]           dimethyladenosine transferase [Fusobacterium nucleatum subs
. . . Nitrobacter hamburgensis X14 .............................................   80  3 hits [a-proteobacteria]       dimethyladenosine transferase [Nitrobacter hamburgensis X14
. . . Listeria monocytogenes FSL J2-003 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes FSL J
. . . Bordetella bronchiseptica RB50 ...........................................   80  2 hits [b-proteobacteria]       dimethyladenosine transferase [Bordetella bronchiseptica RB
. . . Bordetella bronchiseptica ................................................   80  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Bordetella bronchiseptica RB
. . . Listeria monocytogenes str. 4b H7858 .....................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes FSL J1-194 ........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes FSL F2-515 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes FSL F
. . . Anaerococcus hydrogenalis DSM 7454 .......................................   80  2 hits [firmicutes]             hypothetical protein ANHYDRO_00588 [Anaerococcus hydrogenal
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................   80  3 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. v
. . . Listeria monocytogenes str. 4b F2365 .....................................   80  3 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes Clip80459 .........................................   80  3 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes FSL R2-503 ........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes HPB2262 ...........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes FSL J2-064 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Listeria monocytogenes FSL J1-175 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes str. 
. . . Flavobacteriaceae bacterium 3519-10 ......................................   80  2 hits [CFB group bacteria]     Dimethyladenosine transferase [Flavobacteriaceae bacterium 
. . . Burkholderia cenocepacia PC184 ...........................................   80  2 hits [b-proteobacteria]       Dimethyladenosine transferase [Burkholderia cenocepacia PC1
. . . Listeria monocytogenes 08-5578 ...........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes 08-55
. . . Listeria monocytogenes 08-5923 ...........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes 08-55
. . . Listeria monocytogenes EGD-e .............................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes str. 1/2a F6854 ...................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes Finland 1988 ......................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes FSL R2-561 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes FSL N3-165 ........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes 10403S ............................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes J0161 .............................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes J2818 .............................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes F6900 .............................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes LO28 ..............................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Listeria monocytogenes ...................................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes EGD-e
. . . Bordetella parapertussis 12822 ...........................................   80  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Bordetella parapertussis 128
. . . Bordetella parapertussis .................................................   80  2 hits [b-proteobacteria]       dimethyladenosine transferase [Bordetella parapertussis 128
. . . Listeria monocytogenes FSL N1-017 ........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes FSL N
. . . Listeria monocytogenes FSL J2-071 ........................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes FSL N
. . . Listeria monocytogenes HCC23 .............................................   80  3 hits [firmicutes]             dimethyladenosine transferase [Listeria monocytogenes HCC23
. . . Mariprofundus ferrooxydans PV-1 ..........................................   80  2 hits [proteobacteria]         dimethyladenosine transferase [Mariprofundus ferrooxydans P
. . . gamma proteobacterium HTCC2207 ...........................................   80  2 hits [g-proteobacteria]       dimethyladenosine transferase [marine gamma proteobacterium
. . . Burkholderia multivorans ATCC 17616 ......................................   80  5 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia multivorans ATC
. . . Raphidiopsis brookii D9 ..................................................   80  2 hits [cyanobacteria]          16S rRNA dimethylase [Raphidiopsis brookii D9] >gi|28119871
. . . Desulfovibrio sp. FW1012B ................................................   80  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfovibrio sp. FW1012B] >
. . . Ammonifex degensii KC4 ...................................................   80  2 hits [firmicutes]             dimethyladenosine transferase [Ammonifex degensii KC4] >gi|
. . . Rhodopseudomonas palustris DX-1 ..........................................   80  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris D
. . . Denitrovibrio acetiphilus DSM 12809 ......................................   80  2 hits [bacteria]               dimethyladenosine transferase [Denitrovibrio acetiphilus DS
. . . Chlorobium luteolum DSM 273 ..............................................   80  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium luteolum DSM 273]
. . . Brevibacterium linens BL2 ................................................   80  1 hit  [high GC Gram+]          dimethyladenosine transferase [Brevibacterium linens BL2]
. . . Thermoanaerobacter tengcongensis MB4 .....................................   80  2 hits [firmicutes]             dimethyladenosine transferase (rRNA methylation) [Thermoana
. . . Thermoanaerobacter tengcongensis .........................................   80  1 hit  [firmicutes]             dimethyladenosine transferase (rRNA methylation) [Thermoana
. . . Ralstonia eutropha H16 ...................................................   80  3 hits [b-proteobacteria]       dimethyladenosine transferase [Ralstonia eutropha H16] >gi|
. . . Burkholderia cenocepacia J2315 ...........................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia cenocepacia J23
. . . Abiotrophia defectiva ATCC 49176 .........................................   79  2 hits [firmicutes]             hypothetical protein GCWU000182_01086 [Abiotrophia defectiv
. . . Porphyromonas uenonis 60-3 ...............................................   79  2 hits [CFB group bacteria]     dimethyladenosine transferase [Porphyromonas uenonis 60-3] 
. . . Synechococcus sp. WH 8102 ................................................   79  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. WH 8102] >
. . . Ralstonia pickettii 12J ..................................................   79  2 hits [b-proteobacteria]       dimethyladenosine transferase [Ralstonia pickettii 12J] >gi
. . . Borrelia afzelii PKo .....................................................   79  3 hits [spirochetes]            dimethyladenosine transferase [Borrelia afzelii PKo] >gi|12
. . . Parvimonas micra ATCC 33270 ..............................................   79  2 hits [firmicutes]             hypothetical protein PEPMIC_01686 [Parvimonas micra ATCC 33
. . . Burkholderia cenocepacia AU 1054 .........................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia cenocepacia AU 
. . . Burkholderia cenocepacia HI2424 ..........................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia cenocepacia AU 
. . . Burkholderia cenocepacia MC0-3 ...........................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia cenocepacia AU 
. . . Methylobacterium radiotolerans JCM 2831 ..................................   79  3 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium radiotolera
. . . Fusobacterium nucleatum subsp. polymorphum ATCC 10953 ....................   79  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium nucleatum subs
. . . Lactobacillus gasseri JV-V03 .............................................   79  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus gasseri JV-V03
. . . Candidatus Vesicomyosocius okutanii HA ...................................   79  2 hits [g-proteobacteria]       dimethyladenosine transferase [Candidatus Vesicomyosocius o
. . . Listeria seeligeri serovar 1/2b str. SLCC3954 ............................   79  2 hits [firmicutes]             dimethyladenosine transferase [Listeria seeligeri serovar 1
. . . Campylobacter gracilis RM3268 ............................................   79  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter gracilis RM326
. . . Burkholderia sp. 383 .....................................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia sp. 383] >gi|11
. . . Burkholderia ambifaria MC40-6 ............................................   79  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia ambifaria MC40-
. . . Fusobacterium sp. 7_1 ....................................................   79  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 7_1] >gi|2
. . . Fusobacterium sp. D11 ....................................................   79  3 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. D11] >gi|2
. . . Rhodopseudomonas palustris CGA009 ........................................   79  2 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris C
. . . Rhodopseudomonas palustris TIE-1 .........................................   79  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris C
. . . Rhodopseudomonas palustris ...............................................   79  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris C
. . . Listeria welshimeri serovar 6b str. SLCC5334 .............................   79  3 hits [firmicutes]             dimethyladenosine transferase [Listeria welshimeri serovar 
. . . Sanguibacter keddieii DSM 10542 ..........................................   79  2 hits [high GC Gram+]          dimethyladenosine transferase [Sanguibacter keddieii DSM 10
. . . Borrelia burgdorferi B31 .................................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi 80a .................................................   79  1 hit  [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi 156a ................................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi ZS7 .................................................   79  3 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi 64b .................................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi WI91-23 .............................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi 94a .................................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi Bol26 ...............................................   79  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Borrelia burgdorferi .....................................................   79  1 hit  [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi B31] >g
. . . Erysipelotrichaceae bacterium 5_2_54FAA ..................................   79  2 hits [firmicutes]             dimethyladenosine transferase [Erysipelotrichaceae bacteriu
. . . Fusobacterium sp. 4_1_13 .................................................   78  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 4_1_13] >g
. . . Holdemania filiformis DSM 12042 ..........................................   78  2 hits [firmicutes]             hypothetical protein HOLDEFILI_00853 [Holdemania filiformis
. . . Burkholderia ambifaria MEX-5 .............................................   78  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia ambifaria MEX-5
. . . Burkholderia ambifaria IOP40-10 ..........................................   78  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia ambifaria IOP40
. . . Burkholderia pseudomallei 91 .............................................   78  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 91]
. . . Fusobacterium varium ATCC 27725 ..........................................   78  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium varium ATCC 27
. . . Acidimicrobium ferrooxidans DSM 10331 ....................................   78  2 hits [high GC Gram+]          ribosomal RNA adenine methylase transferase [Acidimicrobium
. . . Xanthomonas axonopodis pv. citri str. 306 ................................   78  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas axonopodis pv. c
. . . Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122 ..................   78  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas axonopodis pv. c
. . . Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535 ..................   78  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas axonopodis pv. c
. . . Xanthomonas axonopodis pv. citri .........................................   78  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas axonopodis pv. c
. . . Rhodopseudomonas palustris BisA53 ........................................   78  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris B
. . . Acidobacterium capsulatum ATCC 51196 .....................................   78  3 hits [bacteria]               dimethyladenosine transferase [Acidobacterium capsulatum AT
. . . Desulfotalea psychrophila LSv54 ..........................................   78  2 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfotalea psychrophila LS
. . . Desulfotalea psychrophila ................................................   78  1 hit  [d-proteobacteria]       dimethyladenosine transferase [Desulfotalea psychrophila LS
. . . Rhodopseudomonas palustris BisB5 .........................................   78  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris B
. . . Listeria innocua Clip11262 ...............................................   78  1 hit  [firmicutes]             dimethyladenosine transferase [Listeria innocua Clip11262] 
. . . Listeria innocua .........................................................   78  2 hits [firmicutes]             dimethyladenosine transferase [Listeria innocua Clip11262] 
. . . Fusobacterium sp. D12 ....................................................   78  1 hit  [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. D12]
. . . Clostridium carboxidivorans P7 ...........................................   78  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium carboxidivorans 
. . . Chloroherpeton thalassium ATCC 35110 .....................................   78  2 hits [green sulfur bacteria]  dimethyladenosine transferase [Chloroherpeton thalassium AT
. . . Paenibacillus popilliae ..................................................   78  1 hit  [firmicutes]             dimethyl adenosine transferase [Paenibacillus popilliae]
. . . Caminibacter mediatlanticus TB-2 .........................................   78  2 hits [e-proteobacteria]       dimethyladenosine transferase [Caminibacter mediatlanticus 
. . . Bacillus amyloliquefaciens FZB42 .........................................   78  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus amyloliquefaciens F
. . . Fusobacterium sp. 1_1_41FAA ..............................................   78  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 1_1_41FAA]
. . . Gluconacetobacter diazotrophicus PAl 5 ...................................   78  4 hits [a-proteobacteria]       dimethyladenosine transferase [Gluconacetobacter diazotroph
. . . Borrelia sp. SV1 .........................................................   78  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia sp. SV1] >gi|225370
. . . Bradyrhizobium japonicum USDA 110 ........................................   78  2 hits [a-proteobacteria]       dimethyladenosine transferase [Bradyrhizobium japonicum USD
. . . Bradyrhizobium japonicum .................................................   78  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Bradyrhizobium japonicum USD
. . . Candidatus Phytoplasma australiense ......................................   78  3 hits [mycoplasmas]            Dimethyladenosine transferase (S-adenosylmethionine-6-N',N'
. . . Cyanothece sp. PCC 7822 ..................................................   78  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. PCC 7822] >gi
. . . Borrelia burgdorferi 72a .................................................   78  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi 72a] >g
. . . Borrelia burgdorferi CA-11.2a ............................................   78  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi 72a] >g
. . . Borrelia burgdorferi 118a ................................................   78  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi 72a] >g
. . . Borrelia burgdorferi 29805 ...............................................   78  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia burgdorferi 72a] >g
. . . Bacillus pumilus ATCC 7061 ...............................................   78  2 hits [firmicutes]             dimethyladenosine transferase [Bacillus pumilus ATCC 7061] 
. . . Fusobacterium periodonticum ATCC 33693 ...................................   78  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium periodonticum 
. . . Thiobacillus denitrificans ATCC 25259 ....................................   78  3 hits [b-proteobacteria]       dimethyladenosine transferase [Thiobacillus denitrificans A
. . . Pelodictyon phaeoclathratiforme BU-1 .....................................   78  2 hits [green sulfur bacteria]  dimethyladenosine transferase [Pelodictyon phaeoclathratifo
. . . Oligotropha carboxidovorans OM5 ..........................................   77  3 hits [a-proteobacteria]       dimethyladenosine transferase [Oligotropha carboxidovorans 
. . . Porphyromonas endodontalis ATCC 35406 ....................................   77  2 hits [CFB group bacteria]     dimethyladenosine transferase [Porphyromonas endodontalis A
. . . Chlorobium tepidum TLS ...................................................   77  2 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium tepidum TLS] >gi|
. . . Chlorobaculum tepidum ....................................................   77  1 hit  [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium tepidum TLS] >gi|
. . . Hirschia baltica ATCC 49814 ..............................................   77  2 hits [a-proteobacteria]       dimethyladenosine transferase [Hirschia baltica ATCC 49814]
. . . Candidatus Kuenenia stuttgartiensis ......................................   77  1 hit  [planctomycetes]         similar to dimethyladenosine transferase KsgA [Candidatus K
. . . NC10 bacterium 'Dutch sediment' ..........................................   77  1 hit  [bacteria]               Dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Leuconostoc citreum KM20 .................................................   77  3 hits [firmicutes]             dimethyladenosine transferase [Leuconostoc citreum KM20] >g
. . . Burkholderia graminis C4D1M ..............................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia graminis C4D1M]
. . . Bdellovibrio bacteriovorus HD100 .........................................   77  2 hits [d-proteobacteria]       dimethyladenosine transferase [Bdellovibrio bacteriovorus H
. . . Bdellovibrio bacteriovorus ...............................................   77  1 hit  [d-proteobacteria]       dimethyladenosine transferase [Bdellovibrio bacteriovorus H
. . . Nitrobacter sp. Nb-311A ..................................................   77  2 hits [a-proteobacteria]       dimethyladenosine transferase [Nitrobacter sp. Nb-311A] >gi
. . . Fusobacterium sp. 3_1_33 .................................................   77  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 3_1_33] >g
. . . Burkholderia pseudomallei 668 ............................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei 1106a ..........................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei B7210 ..........................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei 1106b ..........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei S13 ............................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei 1655 ...........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 16
. . . Lactobacillus amylolyticus DSM 11664 .....................................   77  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus amylolyticus D
. . . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ....................   77  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus subs
. . . Burkholderia pseudomallei K96243 .........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei ATCC 23344 ...........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei GB8 horse 4 ..........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 1710b ..........................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei SAVP1 ................................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei NCTC 10229 ...........................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei NCTC 10247 ...........................................   77  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 305 ............................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei PRL-20 ...............................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei DM98 ...........................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 14 .............................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 112 ............................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei BCC215 .........................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 576 ............................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei MSHR346 ........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei ATCC 10399 ...........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei FMH ..................................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei JHU ..................................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 1710a ..........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei 2002721280 ...........................................   77  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia mallei ......................................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei ................................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei K9
. . . Geodermatophilus obscurus DSM 43160 ......................................   77  2 hits [high GC Gram+]          dimethyladenosine transferase [Geodermatophilus obscurus DS
. . . Borrelia recurrentis A1 ..................................................   77  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia recurrentis A1] >gi
. . . Synechococcus sp. JA-2-3B'a(2-13) ........................................   77  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. JA-2-3B'a(
. . . Cardiobacterium hominis ATCC 15826 .......................................   77  2 hits [g-proteobacteria]       dimethyladenosine transferase [Cardiobacterium hominis ATCC
. . . Fusobacterium sp. 3_1_27 .................................................   77  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 3_1_27] >g
. . . Burkholderia ubonensis Bu ................................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia ubonensis Bu]
. . . Vibrio furnissii CIP 102972 ..............................................   77  2 hits [g-proteobacteria]       dimethyladenosine transferase [Vibrio furnissii CIP 102972]
. . . Fusobacterium sp. 2_1_31 .................................................   77  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 2_1_31] >g
. . . Onion yellows phytoplasma OY-M ...........................................   77  2 hits [mycoplasmas]            dimethyladenosine transferase [Onion yellows phytoplasma OY
. . . Onion yellows phytoplasma ................................................   77  1 hit  [mycoplasmas]            dimethyladenosine transferase [Onion yellows phytoplasma OY
. . . Sebaldella termitidis ATCC 33386 .........................................   77  2 hits [fusobacteria]           dimethyladenosine transferase [Sebaldella termitidis ATCC 3
. . . Burkholderia pseudomallei NCTC 13177 .....................................   77  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei NC
. . . Sulfurimonas denitrificans DSM 1251 ......................................   77  3 hits [e-proteobacteria]       dimethyladenosine transferase [Sulfurimonas denitrificans D
. . . Fusobacterium sp. 3_1_36A2 ...............................................   76  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium sp. 3_1_36A2] 
. . . Aminobacterium colombiense DSM 12261 .....................................   76  2 hits [bacteria]               dimethyladenosine transferase [Aminobacterium colombiense D
. . . Mycoplasma conjunctivae HRC/581 ..........................................   76  1 hit  [mycoplasmas]            Dimethyladenosine transferase [Mycoplasma conjunctivae HRC/
. . . Mycoplasma conjunctivae ..................................................   76  1 hit  [mycoplasmas]            Dimethyladenosine transferase [Mycoplasma conjunctivae HRC/
. . . Burkholderia pseudomallei 9 ..............................................   76  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 9]
. . . Burkholderia pseudomallei 7894 ...........................................   76  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 9]
. . . Burkholderia pseudomallei Pakistan 9 .....................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 9]
. . . Burkholderia pseudomallei Pasteur 52237 ..................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 9]
. . . Burkholderia pseudomallei 406e ...........................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia pseudomallei 9]
. . . Bacillus pumilus SAFR-032 ................................................   76  3 hits [firmicutes]             dimethyladenosine transferase [Bacillus pumilus SAFR-032] >
. . . Acetobacter pasteurianus IFO 3283-01 .....................................   76  2 hits [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-03 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-07 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-22 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-26 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-32 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-01-42C .................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Acetobacter pasteurianus IFO 3283-12 .....................................   76  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Acetobacter pasteurianus IFO
. . . Pelotomaculum thermopropionicum SI .......................................   76  3 hits [firmicutes]             dimethyladenosine transferase [Pelotomaculum thermopropioni
. . . Brachyspira murdochii DSM 12563 ..........................................   76  2 hits [spirochetes]            dimethyladenosine transferase [Brachyspira murdochii DSM 12
. . . Aster yellows witches'-broom phytoplasma AYWB ............................   76  3 hits [mycoplasmas]            dimethyladenosine transferase [Aster yellows witches'-broom
. . . Conexibacter woesei DSM 14684 ............................................   76  4 hits [high GC Gram+]          dimethyladenosine transferase [Conexibacter woesei DSM 1468
. . . Dehalogenimonas lykanthroporepellens BL-DC-9 .............................   76  2 hits [GNS bacteria]           dimethyladenosine transferase [Dehalogenimonas lykanthropor
. . . Gemmata obscuriglobus UQM 2246 ...........................................   76  3 hits [planctomycetes]         dimethyladenosine transferase [Gemmata obscuriglobus UQM 22
. . . Mycoplasma genitalium G37 ................................................   76  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma genitalium G37] >
. . . Mycoplasma genitalium ....................................................   76  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma genitalium G37] >
. . . Burkholderia multivorans CGD2M ...........................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia multivorans CGD
. . . Burkholderia multivorans CGD2 ............................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia multivorans CGD
. . . Deinococcus deserti VCD115 ...............................................   76  2 hits [bacteria]               putative dimethyladenosine transferase [Deinococcus deserti
. . . Burkholderia multivorans CGD1 ............................................   76  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia multivorans CGD
. . . Lactobacillus jensenii 269-3 .............................................   75  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 269-3
. . . Lactobacillus jensenii 1153 ..............................................   75  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 269-3
. . . Lactobacillus jensenii SJ-7A-US ..........................................   75  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 269-3
. . . Lactobacillus jensenii 208-1 .............................................   75  4 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 269-3
. . . Fusobacterium nucleatum subsp. vincentii ATCC 49256 ......................   75  2 hits [fusobacteria]           Dimethyladenosine transferase [Fusobacterium nucleatum subs
. . . Mycoplasma gallisepticum str. R(low) .....................................   75  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma gallisepticum str
. . . Mycoplasma gallisepticum str. R(high) ....................................   75  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma gallisepticum str
. . . Mycoplasma gallisepticum .................................................   75  1 hit  [mycoplasmas]            RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Pyramidobacter piscolens W5455 ...........................................   75  2 hits [bacteria]               dimethyladenosine transferase [Pyramidobacter piscolens W54
. . . Bordetella avium 197N ....................................................   75  3 hits [b-proteobacteria]       dimethyladenosine transferase [Bordetella avium 197N] >gi|1
. . . Lactobacillus johnsonii FI9785 ...........................................   75  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus johnsonii FI97
. . . Burkholderia oklahomensis EO147 ..........................................   75  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia oklahomensis EO
. . . Burkholderia oklahomensis C6786 ..........................................   75  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia oklahomensis EO
. . . Candidatus Cloacamonas acidaminovorans ...................................   75  2 hits [bacteria]               Dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Mycoplasma gallisepticum str. F ..........................................   75  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma gallisepticum str
. . . Burkholderia phytofirmans PsJN ...........................................   75  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia phytofirmans Ps
. . . Campylobacterales bacterium GD 1 .........................................   75  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacterales bacterium 
. . . Mycoplasma mycoides subsp. mycoides SC str. PG1 ..........................   75  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma mycoides subsp. m
. . . Mycoplasma mycoides subsp. mycoides SC ...................................   75  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma mycoides subsp. m
. . . delta proteobacterium MLMS-1 .............................................   75  4 hits [d-proteobacteria]       16S rRNA dimethylase [delta proteobacterium MLMS-1] >gi|934
. . . Campylobacter fetus subsp. fetus 82-40 ...................................   75  3 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter fetus subsp. f
. . . Streptomyces sp. SPB78 ...................................................   75  1 hit  [high GC Gram+]          dimethyladenosine transferase [Streptomyces sp. SPB78]
. . . Elusimicrobium minutum Pei191 ............................................   75  2 hits [bacteria]               ribosomal RNA adenine methylase transferase [Elusimicrobium
. . . Candidatus Phytoplasma mali ..............................................   74  2 hits [mycoplasmas]            dimethyladenosine transferase [Candidatus Phytoplasma mali]
. . . Synechococcus elongatus PCC 6301 .........................................   74  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus elongatus PCC 
. . . Synechococcus elongatus PCC 7942 .........................................   74  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus elongatus PCC 
. . . Lactobacillus johnsonii NCC 533 ..........................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus johnsonii NCC 
. . . Lactobacillus johnsonii ..................................................   74  1 hit  [firmicutes]             dimethyladenosine transferase [Lactobacillus johnsonii NCC 
. . . Gemmatimonas aurantiaca T-27 .............................................   74  2 hits [bacteria]               dimethyladenosine transferase [Gemmatimonas aurantiaca T-27
. . . Blastopirellula marina DSM 3645 ..........................................   74  2 hits [planctomycetes]         dimethyladenosine transferase [Blastopirellula marina DSM 3
. . . Lactobacillus gasseri ATCC 33323 .........................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus gasseri ATCC 3
. . . Lactobacillus jensenii JV-V16 ............................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii JV-V1
. . . Cellulomonas flavigena DSM 20109 .........................................   74  2 hits [high GC Gram+]          dimethyladenosine transferase [Cellulomonas flavigena DSM 2
. . . Lactobacillus jensenii 27-2-CHN ..........................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 27-2-
. . . Lactobacillus jensenii 115-3-CHN .........................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus jensenii 27-2-
. . . Fusobacterium mortiferum ATCC 9817 .......................................   74  2 hits [fusobacteria]           dimethyladenosine transferase [Fusobacterium mortiferum ATC
. . . Eubacterium dolichum DSM 3991 ............................................   74  2 hits [firmicutes]             hypothetical protein EUBDOL_00691 [Eubacterium dolichum DSM
. . . Lactobacillus gasseri MV-22 ..............................................   74  1 hit  [firmicutes]             dimethyladenosine transferase [Lactobacillus gasseri MV-22]
. . . Lactobacillus gasseri 202-4 ..............................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus gasseri MV-22]
. . . Lactobacillus gasseri 224-1 ..............................................   74  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus gasseri MV-22]
. . . Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata) ...............   73  2 hits [CFB group bacteria]     dimethyladenosine transferase [Candidatus Sulcia muelleri s
. . . Candidatus Sulcia muelleri GWSS ..........................................   73  2 hits [CFB group bacteria]     dimethyladenosine transferase [Candidatus Sulcia muelleri s
. . . Candidatus Sulcia muelleri DMIN ..........................................   73  2 hits [CFB group bacteria]     dimethyladenosine transferase [Candidatus Sulcia muelleri s
. . . Mycoplasma capricolum subsp. capricolum ATCC 27343 .......................   73  4 hits [mycoplasmas]            kasugamycin dimethyltransferase [Mycoplasma capricolum subs
. . . Ralstonia pickettii 12D ..................................................   73  2 hits [b-proteobacteria]       dimethyladenosine transferase [Ralstonia pickettii 12D] >gi
. . . Burkholderia xenovorans LB400 ............................................   73  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia xenovorans LB40
. . . Borrelia duttonii Ly .....................................................   73  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia duttonii Ly] >gi|20
. . . Sulfurospirillum deleyianum DSM 6946 .....................................   73  2 hits [e-proteobacteria]       dimethyladenosine transferase [Sulfurospirillum deleyianum 
. . . Burkholderia thailandensis E264 ..........................................   73  4 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia thailandensis E
. . . Burkholderia thailandensis TXDOH .........................................   73  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia thailandensis E
. . . Burkholderia thailandensis Bt4 ...........................................   73  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia thailandensis E
. . . Campylobacter coli RM2228 ................................................   73  2 hits [e-proteobacteria]       dimethyladenosine transferase [Campylobacter coli RM2228] >
. . . bacterium S5 .............................................................   73  2 hits [bacteria]               dimethyladenosine transferase [bacterium S5] >gi|288326049|
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............   73  2 hits [b-proteobacteria]       dimethyladenosine transferase [Polynucleobacter necessarius
. . . Brachyspira hyodysenteriae WA1 ...........................................   73  2 hits [spirochetes]            putative dimethyladenosine transferase [Brachyspira hyodyse
. . . Acaryochloris marina MBIC11017 ...........................................   73  3 hits [cyanobacteria]          dimethyladenosine transferase [Acaryochloris marina MBIC110
. . . Kineococcus radiotolerans SRS30216 .......................................   73  3 hits [high GC Gram+]          dimethyladenosine transferase [Kineococcus radiotolerans SR
. . . Lactobacillus johnsonii ATCC 33200 .......................................   73  2 hits [firmicutes]             dimethyladenosine transferase [Lactobacillus johnsonii ATCC
. . . alpha proteobacterium HIMB114 ............................................   73  2 hits [a-proteobacteria]       dimethyladenosine transferase [alpha proteobacterium HIMB11
. . . Sorangium cellulosum 'So ce 56' ..........................................   73  2 hits [d-proteobacteria]       dimethyladenosine transferase [Sorangium cellulosum 'So ce 
. . . Leptothrix cholodnii SP-6 ................................................   73  3 hits [b-proteobacteria]       dimethyladenosine transferase [Leptothrix cholodnii SP-6] >
. . . Burkholderia thailandensis MSMB43 ........................................   73  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Burkholderia thailandensis M
. . . Anaeromyxobacter sp. K ...................................................   73  3 hits [d-proteobacteria]       dimethyladenosine transferase [Anaeromyxobacter sp. K] >gi|
. . . Anaeromyxobacter dehalogenans 2CP-1 ......................................   73  3 hits [d-proteobacteria]       dimethyladenosine transferase [Anaeromyxobacter sp. K] >gi|
. . . Rhodopseudomonas palustris HaA2 ..........................................   73  3 hits [a-proteobacteria]       dimethyladenosine transferase [Rhodopseudomonas palustris H
. . . Mycoplasma mycoides subsp. capri str. GM12 ...............................   73  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma mycoides subsp. c
. . . Francisella philomiragia subsp. philomiragia ATCC 25015 ..................   72  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella philomiragia sub
. . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................   72  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella philomiragia sub
. . . Chlorobium ferrooxidans DSM 13031 ........................................   72  2 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium ferrooxidans DSM 
. . . Mycoplasma fermentans PG18 ...............................................   72  1 hit  [mycoplasmas]            hypothetical protein [Mycoplasma fermentans PG18]
. . . Anaeromyxobacter sp. Fw109-5 .............................................   72  2 hits [d-proteobacteria]       dimethyladenosine transferase [Anaeromyxobacter sp. Fw109-5
. . . Burkholderia sp. .........................................................   72  2 hits [b-proteobacteria]       RecName: Full=Ribosomal RNA small subunit methyltransferase
. . . Borrelia hermsii DAH .....................................................   72  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia hermsii DAH] >gi|11
. . . Clostridium kluyveri DSM 555 .............................................   72  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium kluyveri DSM 555
. . . Clostridium kluyveri NBRC 12016 ..........................................   72  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium kluyveri DSM 555
. . . Catenibacterium mitsuokai DSM 15897 ......................................   72  2 hits [firmicutes]             hypothetical protein CATMIT_00240 [Catenibacterium mitsuoka
. . . Erysipelothrix rhusiopathiae ATCC 19414 ..................................   72  2 hits [firmicutes]             dimethyladenosine transferase [Erysipelothrix rhusiopathiae
. . . Synechococcus sp. PCC 7335 ...............................................   72  2 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. PCC 7335] 
. . . Prochlorococcus marinus str. MIT 9515 ....................................   72  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Chlorobium limicola DSM 245 ..............................................   72  3 hits [green sulfur bacteria]  dimethyladenosine transferase [Chlorobium limicola DSM 245]
. . . Desulfococcus oleovorans Hxd3 ............................................   72  3 hits [d-proteobacteria]       dimethyladenosine transferase [Desulfococcus oleovorans Hxd
. . . Arthrospira maxima CS-328 ................................................   72  2 hits [cyanobacteria]          dimethyladenosine transferase [Arthrospira maxima CS-328] >
. . . Thermobifida fusca YX ....................................................   72  3 hits [high GC Gram+]          dimethyladenosine transferase [Thermobifida fusca YX] >gi|1
. . . Dethiosulfovibrio peptidovorans DSM 11002 ................................   72  2 hits [bacteria]               dimethyladenosine transferase [Dethiosulfovibrio peptidovor
. . . Methylobacterium nodulans ORS 2060 .......................................   72  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium nodulans OR
. . . Arthrospira platensis str. Paraca ........................................   72  1 hit  [cyanobacteria]          dimethyladenosine transferase [Arthrospira platensis str. P
. . . Arthrospira platensis NIES-39 ............................................   72  1 hit  [cyanobacteria]          dimethyladenosine transferase [Arthrospira platensis NIES-3
. . . Akkermansia muciniphila ATCC BAA-835 .....................................   72  2 hits [verrucomicrobia]        dimethyladenosine transferase [Akkermansia muciniphila ATCC
. . . Burkholderia glumae BGR1 .................................................   71  2 hits [b-proteobacteria]       Dimethyladenosine transferase [Burkholderia glumae BGR1] >g
. . . Leptotrichia goodfellowii F0264 ..........................................   71  2 hits [fusobacteria]           dimethyladenosine transferase [Leptotrichia goodfellowii F0
. . . Spiroplasma citri ........................................................   71  1 hit  [mycoplasmas]            putative dimethyladenosine transferase protein [Spiroplasma
. . . Deferribacter desulfuricans SSM1 .........................................   71  2 hits [bacteria]               dimethyladenosine transferase [Deferribacter desulfuricans 
. . . Burkholderia sp. CCGE1001 ................................................   71  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia sp. CCGE1001] >
. . . Comamonas testosteroni CNB-2 .............................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Comamonas testosteroni CNB-2
. . . Burkholderia sp. CCGE1003 ................................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia sp. CCGE1003] >
. . . Campylobacter fetus subsp. venerealis str. Azul-94 .......................   70  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Campylobacter fetus subsp. v
. . . Jonquetella anthropi E3_33 E1 ............................................   70  2 hits [bacteria]               dimethyladenosine transferase [Jonquetella anthropi E3_33 E
. . . Cyanothece sp. PCC 7425 ..................................................   70  2 hits [cyanobacteria]          dimethyladenosine transferase [Cyanothece sp. PCC 7425] >gi
. . . Borrelia turicatae 91E135 ................................................   70  2 hits [spirochetes]            dimethyladenosine transferase [Borrelia turicatae 91E135] >
. . . Methylacidiphilum infernorum V4 ..........................................   70  2 hits [verrucomicrobia]        Dimethyladenosine transferase (rRNA methylation) [Methylaci
. . . Rhizobium etli Brasil 5 ..................................................   70  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rhizobium etli Brasil 5]
. . . Ralstonia solanacearum UW551 .............................................   70  2 hits [b-proteobacteria]       Dimethyladenosine transferase [Ralstonia solanacearum UW551
. . . Burkholderia sp. CCGE1002 ................................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia sp. CCGE1002] >
. . . Fervidobacterium nodosum Rt17-B1 .........................................   70  2 hits [thermotogales]          dimethyladenosine transferase [Fervidobacterium nodosum Rt1
. . . Leuconostoc mesenteroides subsp. cremoris ATCC 19254 .....................   70  2 hits [firmicutes]             dimethyladenosine transferase [Leuconostoc mesenteroides su
. . . Ralstonia solanacearum GMI1000 ...........................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Ralstonia solanacearum GMI10
. . . Ralstonia solanacearum ...................................................   70  1 hit  [b-proteobacteria]       dimethyladenosine transferase [Ralstonia solanacearum GMI10
. . . Thiomonas intermedia K12 .................................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Thiomonas intermedia K12] >g
. . . Comamonas testosteroni KF-1 ..............................................   70  2 hits [b-proteobacteria]       dimethyladenosine transferase [Comamonas testosteroni KF-1]
. . . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 .................   70  3 hits [firmicutes]             dimethyladenosine transferase [Leuconostoc mesenteroides su
. . . Polaromonas naphthalenivorans CJ2 ........................................   70  3 hits [b-proteobacteria]       dimethyladenosine transferase [Polaromonas naphthalenivoran
. . . Treponema pallidum subsp. pallidum str. Nichols ..........................   70  2 hits [spirochetes]            dimethyladenosine transferase [Treponema pallidum subsp. pa
. . . Treponema pallidum subsp. pallidum SS14 ..................................   70  3 hits [spirochetes]            dimethyladenosine transferase [Treponema pallidum subsp. pa
. . . Treponema pallidum .......................................................   70  1 hit  [spirochetes]            dimethyladenosine transferase [Treponema pallidum subsp. pa
. . . Treponema pallidum subsp. pallidum str. Chicago ..........................   70  1 hit  [spirochetes]            dimethyladenosine transferase [Treponema pallidum subsp. pa
. . . Clostridiales genomosp. BVAB3 str. UPII9-5 ...............................   70  2 hits [firmicutes]             putative dimethyladenosine transferase [Clostridiales genom
. . . Methylobacterium chloromethanicum CM4 ....................................   69  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium chlorometha
. . . Burkholderia sp. H160 ....................................................   69  2 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia sp. H160] >gi|2
. . . Thermus aquaticus Y51MC23 ................................................   69  4 hits [bacteria]               ribosomal RNA adenine methylase transferase [Thermus aquati
. . . Candidatus Solibacter usitatus Ellin6076 .................................   69  2 hits [bacteria]               dimethyladenosine transferase [Solibacter usitatus Ellin607
. . . Methylobacterium sp. 4-46 ................................................   69  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium sp. 4-46] >
. . . Burkholderia phymatum STM815 .............................................   69  3 hits [b-proteobacteria]       dimethyladenosine transferase [Burkholderia phymatum STM815
. . . Anaeromyxobacter dehalogenans 2CP-C ......................................   69  3 hits [d-proteobacteria]       dimethyladenosine transferase [Anaeromyxobacter dehalogenan
. . . Dehalococcoides sp. VS ...................................................   69  2 hits [GNS bacteria]           dimethyladenosine transferase [Dehalococcoides sp. VS] >gi|
. . . Acidovorax citrulli AAC00-1 ..............................................   68  3 hits [b-proteobacteria]       dimethyladenosine transferase [Acidovorax avenae subsp. cit
. . . Synechococcus sp. PCC 7002 ...............................................   68  3 hits [cyanobacteria]          S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransf
. . . Leptotrichia hofstadii F0254 .............................................   68  2 hits [fusobacteria]           dimethyladenosine transferase [Leptotrichia hofstadii F0254
. . . Methylibium petroleiphilum PM1 ...........................................   68  3 hits [b-proteobacteria]       dimethyladenosine transferase [Methylibium petroleiphilum P
. . . Leptotrichia buccalis C-1013-b ...........................................   68  2 hits [fusobacteria]           dimethyladenosine transferase [Leptotrichia buccalis DSM 11
. . . Francisella novicida GA99-3548 ...........................................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella novicida GA99-35
. . . Francisella novicida U112 ................................................   68  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella novicida FTE .................................................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella novicida FTG .................................................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella novicida FTG] >g
. . . Chthoniobacter flavus Ellin428 ...........................................   68  2 hits [verrucomicrobia]        dimethyladenosine transferase [Chthoniobacter flavus Ellin4
. . . Opitutus terrae PB90-1 ...................................................   68  3 hits [verrucomicrobia]        ribosomal RNA adenine methylase transferase [Opitutus terra
. . . Francisella tularensis subsp. holarctica .................................   68  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica OSU18 ...........................   68  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis WY96-3418 .......................   68  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica FTNF002-00 ......................   68  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica FSC200 ..........................   68  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. mediasiatica FSC147 ........................   68  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica 257 .............................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica FSC022 ..........................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica URFT1 ...........................   68  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. holarctica LVS .............................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella novicida GA99-3549 ...........................................   68  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Chloroflexus aggregans DSM 9485 ..........................................   68  2 hits [GNS bacteria]           dimethyladenosine transferase [Chloroflexus aggregans DSM 9
. . . Verminephrobacter eiseniae EF01-2 ........................................   68  3 hits [b-proteobacteria]       dimethyladenosine transferase [Verminephrobacter eiseniae E
. . . Opitutaceae bacterium TAV2 ...............................................   68  2 hits [verrucomicrobia]        ribosomal RNA adenine methylase transferase [Opitutaceae ba
. . . Polaromonas sp. JS666 ....................................................   68  3 hits [b-proteobacteria]       dimethyladenosine transferase [Polaromonas sp. JS666] >gi|1
. . . Synechococcus sp. JA-3-3Ab ...............................................   68  3 hits [cyanobacteria]          dimethyladenosine transferase [Synechococcus sp. JA-3-3Ab] 
. . . Thermanaerovibrio acidaminovorans DSM 6589 ...............................   67  2 hits [bacteria]               dimethyladenosine transferase [Thermanaerovibrio acidaminov
. . . Oenococcus oeni AWRIB429 .................................................   67  2 hits [firmicutes]             hypothetical protein AWRIB429_1576 [Oenococcus oeni AWRIB42
. . . Methylobacterium extorquens DM4 ..........................................   67  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium extorquens 
. . . Oenococcus oeni ATCC BAA-1163 ............................................   67  2 hits [firmicutes]             dimethyladenosine transferase [Oenococcus oeni ATCC BAA-116
. . . Methylobacterium populi BJ001 ............................................   67  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium populi BJ00
. . . Treponema vincentii ATCC 35580 ...........................................   67  2 hits [spirochetes]            dimethyladenosine transferase [Treponema vincentii ATCC 355
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........   67  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Oenococcus oeni PSU-1 ....................................................   67  3 hits [firmicutes]             dimethyladenosine transferase [Oenococcus oeni PSU-1] >gi|1
. . . Dehalococcoides sp. CBDB1 ................................................   67  3 hits [GNS bacteria]           dimethyladenosine transferase [Dehalococcoides sp. CBDB1] >
. . . Acidovorax delafieldii 2AN ...............................................   67  2 hits [b-proteobacteria]       dimethyladenosine transferase [Acidovorax delafieldii 2AN] 
. . . Dehalococcoides sp. BAV1 .................................................   67  3 hits [GNS bacteria]           dimethyladenosine transferase [Dehalococcoides sp. BAV1] >g
. . . Methylobacterium extorquens AM1 ..........................................   67  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium extorquens 
. . . Methylobacterium extorquens PA1 ..........................................   67  2 hits [a-proteobacteria]       dimethyladenosine transferase [Methylobacterium extorquens 
. . . Acidovorax avenae subsp. avenae ATCC 19860 ...............................   67  2 hits [b-proteobacteria]       dimethyladenosine transferase [Acidovorax avenae subsp. ave
. . . Prochlorococcus marinus str. MIT 9301 ....................................   67  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Thermosipho africanus TCF52B .............................................   66  2 hits [thermotogales]          dimethyladenosine transferase [Thermosipho africanus TCF52B
. . . Rhodopirellula baltica SH 1 ..............................................   66  2 hits [planctomycetes]         dimethyladenosine transferase [Rhodopirellula baltica SH 1]
. . . Rhodopirellula baltica ...................................................   66  1 hit  [planctomycetes]         dimethyladenosine transferase [Rhodopirellula baltica SH 1]
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........   66  2 hits [enterobacteria]         dimethyladenosine transferase [Salmonella enterica subsp. e
. . . Streptobacillus moniliformis DSM 12112 ...................................   66  2 hits [fusobacteria]           dimethyladenosine transferase [Streptobacillus moniliformis
. . . Coraliomargarita akajimensis DSM 45221 ...................................   65  2 hits [verrucomicrobia]        ribosomal RNA adenine methylase transferase [Coraliomargari
. . . Chloroflexus aurantiacus J-10-fl .........................................   65  2 hits [GNS bacteria]           dimethyladenosine transferase [Chloroflexus aurantiacus J-1
. . . Chloroflexus sp. Y-400-fl ................................................   65  2 hits [GNS bacteria]           dimethyladenosine transferase [Chloroflexus aurantiacus J-1
. . . Prochlorococcus marinus str. MIT 9312 ....................................   65  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Victivallis vadensis ATCC BAA-548 ........................................   65  2 hits [bacteria]               dimethyladenosine transferase [Victivallis vadensis ATCC BA
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ................   65  2 hits [spirochetes]            putative dimethyladenosine transferase [Leptospira biflexa 
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .................   65  2 hits [spirochetes]            Dimethyladenosine transferase [Leptospira biflexa serovar P
. . . Prochlorococcus marinus str. AS9601 ......................................   65  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Dehalococcoides sp. GT ...................................................   65  2 hits [GNS bacteria]           dimethyladenosine transferase [Dehalococcoides sp. GT] >gi|
. . . Variovorax paradoxus S110 ................................................   65  3 hits [b-proteobacteria]       dimethyladenosine transferase [Variovorax paradoxus S110] >
. . . Helicobacter bilis ATCC 43879 ............................................   65  2 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter bilis ATCC 4387
. . . Francisella tularensis subsp. tularensis SCHU S4 .........................   65  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis FSC198 ..........................   65  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis MA00-2987 .......................   65  3 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis FSC033 ..........................   65  2 hits [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis .................................   65  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Francisella tularensis subsp. tularensis NE061598 ........................   65  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Francisella tularensis subsp
. . . Acidovorax sp. JS42 ......................................................   65  3 hits [b-proteobacteria]       dimethyladenosine transferase [Acidovorax sp. JS42] >gi|226
. . . Acidovorax ebreus TPSY ...................................................   64  3 hits [b-proteobacteria]       dimethyladenosine transferase [Acidovorax ebreus TPSY] >gi|
. . . Delftia acidovorans SPH-1 ................................................   64  2 hits [b-proteobacteria]       dimethyladenosine transferase [Delftia acidovorans SPH-1] >
. . . Rhodoferax ferrireducens T118 ............................................   64  3 hits [b-proteobacteria]       dimethyladenosine transferase [Rhodoferax ferrireducens T11
. . . Pirellula staleyi DSM 6068 ...............................................   64  2 hits [planctomycetes]         dimethyladenosine transferase [Pirellula staleyi DSM 6068] 
. . . Dehalococcoides ethenogenes 195 ..........................................   63  3 hits [GNS bacteria]           dimethyladenosine transferase [Dehalococcoides ethenogenes 
. . . Leptospira borgpetersenii serovar Hardjo-bovis JB197 .....................   63  2 hits [spirochetes]            dimethyladenosine transferase [Leptospira borgpetersenii se
. . . Planctomyces limnophilus DSM 3776 ........................................   63  2 hits [planctomycetes]         dimethyladenosine transferase [Planctomyces limnophilus DSM
. . . Prochlorococcus marinus str. MIT 9215 ....................................   63  3 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Prochlorococcus marinus str. MIT 9202 ....................................   63  2 hits [cyanobacteria]          dimethyladenosine transferase [Prochlorococcus marinus str.
. . . Leptospira borgpetersenii serovar Hardjo-bovis L550 ......................   63  2 hits [spirochetes]            dimethyladenosine transferase [Leptospira borgpetersenii se
. . . Curvibacter putative symbiont of Hydra magnipapillata ....................   62  1 hit  [b-proteobacteria]       hypothetical protein [Curvibacter putative symbiont of Hydr
. . . Aquifex aeolicus VF5 .....................................................   62  6 hits [aquificales]            Chain A, Crystal Structure Of A. Aeolicus Ksga At 1.72-Angs
. . . Aquifex aeolicus .........................................................   62  1 hit  [aquificales]            dimethyladenosine transferase [Aquifex aeolicus VF5] >gi|27
. . . Helicobacter pylori 51 ...................................................   62  1 hit  [e-proteobacteria]       16S rRNA (adenosine-N6,N6-)-dimethyltransferase [Helicobact
. . . Helicobacter pylori 98-10 ................................................   62  2 hits [e-proteobacteria]       hypothetical protein HP9810_874g13 [Helicobacter pylori 98-
. . . Thermosipho melanesiensis BI429 ..........................................   62  2 hits [thermotogales]          dimethyladenosine transferase [Thermosipho melanesiensis BI
. . . Hydrogenobaculum sp. Y04AAS1 .............................................   61  3 hits [aquificales]            ribosomal RNA adenine methylase transferase [Hydrogenobacul
. . . Rhizobium etli Kim 5 .....................................................   61  1 hit  [a-proteobacteria]       dimethyladenosine transferase [Rhizobium etli Kim 5]
. . . Clostridium spiroforme DSM 1552 ..........................................   61  2 hits [firmicutes]             hypothetical protein CLOSPI_02279 [Clostridium spiroforme D
. . . Hydrogenobaculum sp. SN ..................................................   60  2 hits [aquificales]            ribosomal RNA adenine methylase transferase [Hydrogenobacul
. . . Verrucomicrobium spinosum DSM 4136 .......................................   60  1 hit  [verrucomicrobia]        dimethyladenosine transferase [Verrucomicrobium spinosum DS
. . . Helicobacter pylori 52 ...................................................   60  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori 52]
. . . Clostridium tetani E88 ...................................................   60  2 hits [firmicutes]             dimethyladenosine transferase [Clostridium tetani E88] >gi|
. . . Helicobacter pylori Shi470 ...............................................   60  3 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori Shi470] 
. . . Roseiflexus castenholzii DSM 13941 .......................................   60  2 hits [GNS bacteria]           dimethyladenosine transferase [Roseiflexus castenholzii DSM
. . . Helicobacter canadensis MIT 98-5491 ......................................   60  3 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter canadensis MIT 
. . . Helicobacter pylori HPAG1 ................................................   59  3 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori HPAG1] >
. . . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ...........   59  2 hits [spirochetes]            dimethyladenosine transferase [Leptospira interrogans serov
. . . Leptospira interrogans serovar Lai str. 56601 ............................   59  2 hits [spirochetes]            dimethyladenosine transferase [Leptospira interrogans serov
. . . Helicobacter pylori B128 .................................................   59  2 hits [e-proteobacteria]       hypothetical protein HPB128_16g81 [Helicobacter pylori B128
. . . Herpetosiphon aurantiacus ATCC 23779 .....................................   59  2 hits [GNS bacteria]           dimethyladenosine transferase [Herpetosiphon aurantiacus AT
. . . Clostridium ramosum DSM 1402 .............................................   59  2 hits [firmicutes]             hypothetical protein CLORAM_00477 [Clostridium ramosum DSM 
. . . Mollicutes bacterium D7 ..................................................   59  2 hits [mycoplasmas]            hypothetical protein CLORAM_00477 [Clostridium ramosum DSM 
. . . Streptococcus pneumoniae SP14-BS69 .......................................   59  2 hits [firmicutes]             dimethyladenosine transferase [Streptococcus pneumoniae SP1
. . . Helicobacter pylori B38 ..................................................   58  2 hits [e-proteobacteria]       Dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . . Helicobacter pylori J99 ..................................................   58  3 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori J99] >gi
. . . Helicobacter pylori HPKX_438_AG0C1 .......................................   58  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori HPKX_438
. . . Thermobaculum terrenum ATCC BAA-798 ......................................   58  2 hits [bacteria]               dimethyladenosine transferase [Thermobaculum terrenum ATCC 
. . . Roseiflexus sp. RS-1 .....................................................   58  2 hits [GNS bacteria]           dimethyladenosine transferase [Roseiflexus sp. RS-1] >gi|14
. . . Helicobacter pylori G27 ..................................................   58  3 hits [e-proteobacteria]       16S rRNA (adenosine-N6,N6-)-dimethyltransferase [Helicobact
. . . Helicobacter pylori 26695 ................................................   58  2 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori 26695] >
. . . Helicobacter pylori ......................................................   58  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori 26695] >
. . . Helicobacter acinonychis str. Sheeba .....................................   58  3 hits [e-proteobacteria]       dimethyladenosine transferase [Helicobacter acinonychis str
. . . Thermocrinis albus DSM 14484 .............................................   56  2 hits [aquificales]            dimethyladenosine transferase [Thermocrinis albus DSM 14484
. . . Helicobacter pylori P12 ..................................................   56  3 hits [e-proteobacteria]       16S rRNA (adenosine-n6,n6)-dimethyltransferase [Helicobacte
. . . Mycoplasma pneumoniae M129 ...............................................   56  2 hits [mycoplasmas]            dimethyladenosine transferase [Mycoplasma pneumoniae M129] 
. . . Mycoplasma pneumoniae ....................................................   56  1 hit  [mycoplasmas]            dimethyladenosine transferase [Mycoplasma pneumoniae M129] 
. . . Thermotoga lettingae TMO .................................................   53  2 hits [thermotogales]          ribosomal RNA adenine methylase transferase [Thermotoga let
. . . Hydrogenobacter thermophilus TK-6 ........................................   53  2 hits [aquificales]            dimethyladenosine transferase [Hydrogenobacter thermophilus
. . . Planctomyces maris DSM 8797 ..............................................   53  2 hits [planctomycetes]         dimethyladenosine transferase [Planctomyces maris DSM 8797]
. . . Yersinia pestis FV-1 .....................................................   50  2 hits [enterobacteria]         dimethyladenosine transferase [Yersinia pestis FV-1]
. . . Helicobacter pylori HPKX_438_CA4C1 .......................................   49  1 hit  [e-proteobacteria]       dimethyladenosine transferase [Helicobacter pylori HPKX_438
. . . Mycobacterium fortuitum ..................................................   48  1 hit  [high GC Gram+]          Erm(39) [Mycobacterium fortuitum]
. . . Anaerobaculum hydrogeniformans ATCC BAA-1850 .............................   46  2 hits [bacteria]               dimethyladenosine transferase [Anaerobaculum hydrogeniforma
. . . candidate division TM7 single-cell isolate TM7a ..........................   46  2 hits [bacteria]               dimethyladenosine transferase [candidate division TM7 singl
. . . Lentisphaera araneosa HTCC2155 ...........................................   46  2 hits [bacteria]               Dimethyladenosine transferase [Lentisphaera araneosa HTCC21
. . . Rhizobium etli IE4771 ....................................................   43  1
. . . Haemophilus influenzae HK1212 ............................................   43  2 hits [g-proteobacteria]       dimethyladenosine transferase [Haemophilus influenzae HK121
. . . Streptomyces lincolnensis ................................................   42  4 hits [high GC Gram+]          methyltransferase [Streptomyces lincolnensis]
. . . Xanthomonas campestris pv. musacearum NCPPB4381 ..........................   41  2 hits [g-proteobacteria]       dimethyladenosine transferase [Xanthomonas campestris pv. m
. . . Bacillus clausii .........................................................   40  2 hits [firmicutes]             ribosomal methylase Erm34 [Bacillus clausii]
. . . Staphylococcus saprophyticus .............................................   40  2 hits [firmicutes]             rRNA methylase [Staphylococcus saprophyticus] >gi|82653299|
. . . Micromonospora griseorubida ..............................................   39  2 hits [high GC Gram+]          RecName: Full=Mycinamicin-resistance protein myrB >gi|28605
. . . Endoriftia persephone 'Hot96_1+Hot96_2' ..................................   38  1 hit  [g-proteobacteria]       dimethyladenosine transferase [Endoriftia persephone 'Hot96
. . . Bacillus licheniformis ...................................................   37  4 hits [firmicutes]             RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. . . Arcanobacterium pyogenes .................................................   36  2 hits [high GC Gram+]          Erm(X) [Arcanobacterium pyogenes] >gi|37993856|gb|AAR07014.
. . . Streptomyces ambofaciens .................................................   36  1 hit  [high GC Gram+]          23S rRNA methyltransferase [Streptomyces ambofaciens]
. . . Bifidobacterium thermophilum .............................................   36  5 hits [high GC Gram+]          ErmX protein [Bifidobacterium thermophilum] >gi|188593353|e
. . . Bifidobacterium animalis .................................................   36  1 hit  [high GC Gram+]          ErmX protein [Bifidobacterium animalis]
. . . Corynebacterium jeikeium .................................................   35  2 hits [high GC Gram+]          ErmX [Corynebacterium jeikeium]
. . . Lactobacillus reuteri ....................................................   35  2 hits [firmicutes]             erythromycin resistance protein [Lactobacillus reuteri]
. . . Aeromicrobium erythreum (NRRL B-3381) ....................................   35  1 hit  [high GC Gram+]          RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. . . Arthrobacter sp. .........................................................   35  2 hits [high GC Gram+]          RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. . . Aeromicrobium erythreum ..................................................   35  1 hit  [high GC Gram+]          RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. . . Staphylococcus epidermidis ...............................................   35  1 hit  [firmicutes]             macrolide-lincosamide-streptogramin B-resistance protein [P
. . . Staphylococcus hyicus ....................................................   35  1 hit  [firmicutes]             adenine methylase [Staphylococcus hyicus]
. . . Citreicella sp. SE45 .....................................................   34  2 hits [a-proteobacteria]       dimethyladenosine transferase [Citreicella sp. SE45] >gi|26
. . . Staphylococcus lentus ....................................................   34  2 hits [firmicutes]             macrolide-lincosamide-streptogramin B-resistance protein [P
. . . Staphylococcus aureus ....................................................   34 16 hits [firmicutes]             macrolide-lincosamide-streptogramin B-resistance protein [P
. . . Neisseria meningitidis ...................................................   34  1 hit  [b-proteobacteria]       macrolide-lincosamide-streptogramin B-resistance protein [P
. . . Staphylococcus haemolyticus ..............................................   34  1 hit  [firmicutes]             adenine methylase [Staphylococcus haemolyticus]
. . . Staphylococcus hominis ...................................................   34  1 hit  [firmicutes]             adenine methylase [Staphylococcus hominis]
. . . Staphylococcus equorum subsp. equorum ....................................   34  1 hit  [firmicutes]             hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. . . Streptococcus pasteurianus ...............................................   33  1 hit  [firmicutes]             erythromycin ribosome methylase [Streptococcus pasteurianus
. . . Enterococcus faecium .....................................................   33  1 hit  [firmicutes]             erythromycin ribosome methylase [Enterococcus faecium]
. . . Streptococcus pyogenes ...................................................   33  2 hits [firmicutes]             hypothetical protein pRW35_1 [Streptococcus pyogenes] >gi|1
. . . Pediococcus acidilactici .................................................   33  2 hits [firmicutes]             putative erythromycin methylase B protein [Pediococcus acid
. . . Synergistetes bacterium SGP1 .............................................   33  1 hit  [bacteria]               aspartyl-tRNA synthetase [Synergistetes bacterium SGP1]
. . . Lactobacillus crispatus ..................................................   33  1 hit  [firmicutes]             erythromycin resistance protein [Lactobacillus crispatus]
. . Ixodes scapularis (shoulder tick) ------------------------------------------  114  4 hits [mites & ticks]          ribosomal RNA adenine dimethylase, putative [Ixodes scapula
. . Plasmodium yoelii yoelii str. 17XNL ........................................   90  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium yoelii yoelii str
. . Plasmodium yoelii yoelii ...................................................   90  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium yoelii yoelii str
. . Babesia bovis T2Bo .........................................................   90  2 hits [apicomplexans]          dimethyladenosine transferase [Babesia bovis T2Bo] >gi|1547
. . Babesia bovis ..............................................................   90  2 hits [apicomplexans]          dimethyladenosine transferase [Babesia bovis T2Bo] >gi|1547
. . Plasmodium berghei str. ANKA ...............................................   88  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium berghei strain AN
. . Plasmodium berghei .........................................................   88  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium berghei strain AN
. . Paulinella chromatophora ...................................................   88  2 hits [cercozoans]             putative rRNA (adenine-N6,N6)- dimethyltransferase [Pauline
. . Methanosaeta thermophila PT ................................................   86  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanosaeta thermophila PT]
. . Phaeodactylum tricornutum CCAP 1055/1 ......................................   83  4 hits [diatoms]                predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. . Heterocapsa triquetra ......................................................   82  1 hit  [dinoflagellates]        chloroplast dimethyladenosine synthase [Heterocapsa triquet
. . Theileria parva strain Muguga ..............................................   81  2 hits [apicomplexans]          hypothetical protein [Theileria parva strain Muguga] >gi|68
. . Theileria parva ............................................................   81  2 hits [apicomplexans]          hypothetical protein [Theileria parva strain Muguga] >gi|68
. . Plasmodium knowlesi strain H ...............................................   81  4 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium knowlesi strain H
. . Haloterrigena turkmenica DSM 5511 ..........................................   80  2 hits [euryarchaeotes]         dimethyladenosine transferase [Haloterrigena turkmenica DSM
. . Trichomonas vaginalis G3 ...................................................   79  2 hits [trichomonads]           dimethyladenosine transferase family protein [Trichomonas v
. . Staphylothermus hellenicus DSM 12710 .......................................   79  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Staphylothermu
. . Staphylothermus marinus F1 .................................................   78  2 hits [crenarchaeotes]         dimethyladenosine transferase [Staphylothermus marinus F1] 
. . Haloquadratum walsbyi DSM 16790 ............................................   78  3 hits [euryarchaeotes]         dimethyladenosine transferase [Haloquadratum walsbyi DSM 16
. . Natronomonas pharaonis DSM 2160 ............................................   78  3 hits [euryarchaeotes]         dimethyladenosine transferase [Natronomonas pharaonis DSM 2
. . Physcomitrella patens subsp. patens ........................................   77  6 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. . Methanospirillum hungatei JF-1 .............................................   77  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanospirillum hungatei JF
. . Candidatus Korarchaeum cryptofilum OPF8 ....................................   76  2 hits [archaea]                ribosomal RNA adenine methylase transferase [Candidatus Kor
. . Ferroplasma acidarmanus fer1 ...............................................   76  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Ferroplasma acidarmanus fer1]
. . Polysphondylium pallidum PN500 .............................................   76  2 hits [cellular slime molds]   Dimethyladenosine transferase [Polysphondylium pallidum PN5
. . Thermofilum pendens Hrk 5 ..................................................   76  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Thermofilum pe
. . Natrialba magadii ATCC 43099 ...............................................   75  4 hits [euryarchaeotes]         dimethyladenosine transferase [Natrialba magadii ATCC 43099
. . Acanthamoeba castellanii ...................................................   75  1 hit  [eukaryotes]             mitochondrial transcription factor B-like protein [Acantham
. . Aciduliprofundum boonei T469 ...............................................   75  6 hits [euryarchaeotes]         dimethyladenosine transferase [Aciduliprofundum boonei T469
. . Ferroglobus placidus DSM 10642 .............................................   75  2 hits [euryarchaeotes]         dimethyladenosine transferase [Ferroglobus placidus DSM 106
. . Strongylocentrotus purpuratus (purple urchin) ..............................   74  4 hits [sea urchins]            PREDICTED: hypothetical protein [Strongylocentrotus purpura
. . Leishmania braziliensis MHOM/BR/75/M2904 ...................................   74  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Leishmania braziliensis ....................................................   74  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Picea sitchensis ...........................................................   74  3 hits [conifers]               unknown [Picea sitchensis]
. . Trypanosoma cruzi strain CL Brener .........................................   74  4 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Trypanoso
. . Trypanosoma cruzi ..........................................................   74  4 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Trypanoso
. . Leishmania infantum JPCM5 ..................................................   73  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Leishmania infantum ........................................................   73  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Halorhabdus utahensis DSM 12940 ............................................   73  2 hits [euryarchaeotes]         dimethyladenosine transferase [Halorhabdus utahensis DSM 12
. . Theileria annulata strain Ankara ...........................................   73  3 hits [apicomplexans]          rDNA dimethyladenosine transferase [Theileria annulata stra
. . Theileria annulata .........................................................   73  3 hits [apicomplexans]          rDNA dimethyladenosine transferase [Theileria annulata stra
. . Plasmodium vivax SaI-1 .....................................................   73  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium vivax SaI-1] >gi|
. . Plasmodium vivax ...........................................................   73  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium vivax SaI-1] >gi|
. . Methanosarcina acetivorans C2A .............................................   72  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanosarcina acetivorans C
. . Methanosarcina acetivorans .................................................   72  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Methanosarcina acetivorans C
. . Leishmania major strain Friedlin ...........................................   72  3 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Leishmania major ...........................................................   72  1 hit  [kinetoplastids]         ribosomal RNA adenine dimethylase family protein [Leishmani
. . Perkinsus marinus ATCC 50983 ...............................................   72  6 hits [eukaryotes]             dimethyladenosine transferase, putative [Perkinsus marinus 
. . Methanohalophilus mahii DSM 5219 ...........................................   72  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanohalophilus mahii DSM 
. . Glossina morsitans morsitans ...............................................   72  2 hits [flies]                  ribosomal RNA adenine dimethylase [Glossina morsitans morsi
. . Picrophilus torridus DSM 9790 ..............................................   72  2 hits [euryarchaeotes]         dimethyladenosine transferase [Picrophilus torridus DSM 979
. . Vitis vinifera (wine grape) ................................................   72  9 hits [eudicots]               PREDICTED: hypothetical protein [Vitis vinifera]
. . Desulfurococcus kamchatkensis 1221n ........................................   72  2 hits [crenarchaeotes]         Probable dimethyladenosine transferase [Desulfurococcus kam
. . Drosophila yakuba ..........................................................   72  6 hits [flies]                  GE23825 [Drosophila yakuba] >gi|194184741|gb|EDW98352.1| GE
. . Nasonia vitripennis ........................................................   72  2 hits [wasps &c.]              PREDICTED: similar to ENSANGP00000016944 [Nasonia vitripenn
. . Drosophila pseudoobscura pseudoobscura .....................................   72  5 hits [flies]                  GA11224 [Drosophila pseudoobscura pseudoobscura] >gi|195145
. . Drosophila persimilis ......................................................   72  4 hits [flies]                  GA11224 [Drosophila pseudoobscura pseudoobscura] >gi|195145
. . Drosophila erecta ..........................................................   71  4 hits [flies]                  GG11635 [Drosophila erecta] >gi|190656042|gb|EDV53274.1| GG
. . Zea mays (maize) ...........................................................   71  6 hits [monocots]               LOC100284053 [Zea mays] >gi|195639144|gb|ACG39040.1| dimeth
. . Drosophila sechellia .......................................................   71  4 hits [flies]                  GM12757 [Drosophila sechellia] >gi|194131262|gb|EDW53305.1|
. . Drosophila melanogaster ....................................................   71  8 hits [flies]                  CG11837 [Drosophila melanogaster] >gi|195574637|ref|XP_0021
. . Drosophila simulans ........................................................   71  4 hits [flies]                  CG11837 [Drosophila melanogaster] >gi|195574637|ref|XP_0021
. . Sorghum bicolor (milo) .....................................................   71  8 hits [monocots]               hypothetical protein SORBIDRAFT_04g005150 [Sorghum bicolor]
. . Drosophila ananassae .......................................................   71  4 hits [flies]                  GF16271 [Drosophila ananassae] >gi|190628407|gb|EDV43931.1|
. . uncultured methanogenic archaeon RC-I ......................................   71  2 hits [euryarchaeotes]         putative dimethyladenosine rRNA methyltransferase [uncultur
. . Trypanosoma brucei TREU927 .................................................   71  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein, conserved
. . Trypanosoma brucei .........................................................   71  4 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein, conserved
. . Ricinus communis ...........................................................   71  8 hits [eudicots]               dimethyladenosine transferase, putative [Ricinus communis] 
. . Trypanosoma brucei gambiense DAL972 ........................................   71  2 hits [kinetoplastids]         ribosomal RNA adenine dimethylase family protein, conserved
. . Arabidopsis thaliana (thale-cress) .........................................   71 19 hits [eudicots]               ribosomal RNA adenine dimethylase family protein [Arabidops
. . Drosophila grimshawi .......................................................   71  4 hits [flies]                  GH18676 [Drosophila grimshawi] >gi|193893849|gb|EDV92715.1|
. . Methanopyrus kandleri AV19 .................................................   70  2 hits [euryarchaeotes]         dimethyladenosine transferase (rRNA methylase) [Methanopyru
. . Methanopyrus kandleri ......................................................   70  1 hit  [euryarchaeotes]         dimethyladenosine transferase (rRNA methylase) [Methanopyru
. . Dictyostelium discoideum AX4 ...............................................   70  4 hits [cellular slime molds]   hypothetical protein DDB_G0286199 [Dictyostelium discoideum
. . Enterocytozoon bieneusi H348 ...............................................   70  2 hits [microsporidians]        dimethyladenosine transferase [Enterocytozoon bieneusi H348
. . Nematostella vectensis .....................................................   70  6 hits [sea anemones]           predicted protein [Nematostella vectensis] >gi|156223536|gb
. . Methanosarcina barkeri str. Fusaro .........................................   70  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanosarcina barkeri str. 
. . Drosophila willistoni ......................................................   70  4 hits [flies]                  GK22567 [Drosophila willistoni] >gi|194168061|gb|EDW82962.1
. . Halobacterium sp. NRC-1 ....................................................   70  2 hits [euryarchaeotes]         dimethyladenosine transferase [Halobacterium sp. NRC-1] >gi
. . Halobacterium salinarum R1 .................................................   70  3 hits [euryarchaeotes]         dimethyladenosine transferase [Halobacterium sp. NRC-1] >gi
. . Halobacterium salinarum ....................................................   70  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Halobacterium sp. NRC-1] >gi
. . Hartmannella vermiformis ...................................................   70  2 hits [eukaryotes]             RecName: Full=Dimethyladenosine transferase 1, mitochondria
. . Naegleria gruberi strain NEG-M .............................................   70  2 hits [eukaryotes]             predicted protein [Naegleria gruberi] >gi|284094556|gb|EFC4
. . Naegleria gruberi ..........................................................   70  2 hits [eukaryotes]             predicted protein [Naegleria gruberi] >gi|284094556|gb|EFC4
. . Drosophila mojavensis ......................................................   70  4 hits [flies]                  GI24187 [Drosophila mojavensis] >gi|193915431|gb|EDW14298.1
. . Halorubrum lacusprofundi ATCC 49239 ........................................   70  2 hits [euryarchaeotes]         dimethyladenosine transferase [Halorubrum lacusprofundi ATC
. . Toxoplasma gondii GT1 ......................................................   70  2 hits [apicomplexans]          ribosomal RNA adenine dimethylase domain-containing protein
. . Methanoculleus marisnigri JR1 ..............................................   70  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanoculleus marisnigri JR
. . Taeniopygia guttata (zebra finch) ..........................................   70  2 hits [birds]                  PREDICTED: putative putative dimethyladenosine transferase 
. . Caligus clemensi ...........................................................   70  1 hit  [crustaceans]            Probable dimethyladenosine transferase [Caligus clemensi]
. . Cryptococcus neoformans var. neoformans JEC21 ..............................   70  2 hits [basidiomycetes]         rRNA (adenine-N6,N6-)-dimethyltransferase [Cryptococcus neo
. . Cryptococcus neoformans var. neoformans B-3501A ............................   70  2 hits [basidiomycetes]         rRNA (adenine-N6,N6-)-dimethyltransferase [Cryptococcus neo
. . Drosophila virilis .........................................................   70  4 hits [flies]                  GJ10534 [Drosophila virilis] >gi|194142572|gb|EDW58975.1| G
. . Lepeophtheirus salmonis ....................................................   70  3 hits [crustaceans]            Probable dimethyladenosine transferase [Lepeophtheirus salm
. . Paramecium tetraurelia strain d4-2 .........................................   70  3 hits [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Paramecium tetraurelia .....................................................   70  3 hits [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Branchiostoma floridae .....................................................   70  4 hits [lancelets]              hypothetical protein BRAFLDRAFT_225323 [Branchiostoma flori
. . Thalassiosira pseudonana CCMP1335 ..........................................   70  4 hits [diatoms]                predicted protein [Thalassiosira pseudonana CCMP1335] >gi|2
. . Oryza sativa Japonica Group (Japanese rice) ................................   69 18 hits [monocots]               Os10g0183900 [Oryza sativa (japonica cultivar-group)] >gi|1
. . Oryza sativa Indica Group (Indian rice) ....................................   69  3 hits [monocots]               Os10g0183900 [Oryza sativa (japonica cultivar-group)] >gi|1
. . Saccoglossus kowalevskii ...................................................   69  2 hits [hemichordates]          PREDICTED: Probable dimethyladenosine transferase-like [Sac
. . Gallus gallus (bantam) .....................................................   69  2 hits [birds]                  PREDICTED: similar to DIMT1L protein [Gallus gallus]
. . Tribolium castaneum (rust-red flour beetle) ................................   69  3 hits [beetles]                PREDICTED: similar to dimethyladenosine transferase [Tribol
. . Plasmodium falciparum 3D7 ..................................................   69  4 hits [apicomplexans]          apicoplast dimethyladenosine synthase, putative [Plasmodium
. . Aedes aegypti ..............................................................   69  7 hits [flies]                  AAEL010575-PA [Aedes aegypti]
. . Populus trichocarpa (black cottonwood) .....................................   69  4 hits [eudicots]               predicted protein [Populus trichocarpa] >gi|222866344|gb|EE
. . Candidatus Methanoregula boonei 6A8 ........................................   69  2 hits [euryarchaeotes]         dimethyladenosine transferase [Candidatus Methanoregula boo
. . Paracoccidioides brasiliensis Pb03 .........................................   69  1 hit  [ascomycetes]            dimethyladenosine transferase [Paracoccidioides brasiliensi
. . Penicillium chrysogenum Wisconsin 54-1255 ..................................   69  2 hits [ascomycetes]            Pc22g08040 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. . Coccidioides posadasii C735 delta SOWgp ....................................   69  1 hit  [ascomycetes]            dimethyladenosine transferase, putative [Coccidioides posad
. . Anopheles gambiae str. PEST ................................................   69  4 hits [flies]                  AGAP004465-PA [Anopheles gambiae str. PEST] >gi|55240843|gb
. . Xenopus (Silurana) tropicalis ..............................................   69 10 hits [frogs & toads]          hypothetical protein LOC779588 [Xenopus (Silurana) tropical
. . Coccidioides immitis RS ....................................................   69  1 hit  [ascomycetes]            hypothetical protein CIMG_00988 [Coccidioides immitis RS]
. . Esox lucius ................................................................   69  1 hit  [bony fishes]            Probable dimethyladenosine transferase [Esox lucius]
. . Oncorhynchus mykiss ........................................................   69  3 hits [bony fishes]            Probable dimethyladenosine transferase [Oncorhynchus mykiss]
. . Toxoplasma gondii ME49 .....................................................   68  4 hits [apicomplexans]          dimethyladenosine synthase, putative [Toxoplasma gondii ME4
. . Haloferax volcanii DS2 .....................................................   68  2 hits [euryarchaeotes]         dimethyladenosine transferase [Haloferax volcanii DS2] >gi|
. . Danio rerio (zebra fish) ...................................................   68  6 hits [bony fishes]            dimethyladenosine transferase [Danio rerio] >gi|50417873|gb
. . Chlamydomonas reinhardtii ..................................................   68  4 hits [green algae]            dimethyladenosine transferase [Chlamydomonas reinhardtii] >
. . Toxoplasma gondii VEG ......................................................   68  2 hits [apicomplexans]          riboxomal RNA adenine dimethylase domain-containing protein
. . Glycine max (soybeans) .....................................................   68  1 hit  [eudicots]               unknown [Glycine max]
. . Xenopus laevis (common platanna) ...........................................   68  5 hits [frogs & toads]          DIM1 dimethyladenosine transferase 1-like [Xenopus laevis] 
. . Apis mellifera (bee) .......................................................   68  2 hits [bees]                   PREDICTED: similar to CG11837-PA [Apis mellifera]
. . Methanosarcina mazei Go1 ...................................................   68  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanosarcina mazei Go1] >g
. . Salmo salar ................................................................   68  2 hits [bony fishes]            Probable dimethyladenosine transferase [Salmo salar] >gi|20
. . Methanocella paludicola SANAE ..............................................   68  2 hits [euryarchaeotes]         probable dimethyladenosine transferase [Methanocella paludi
. . Hydra magnipapillata .......................................................   68  2 hits [hydrozoans]             PREDICTED: similar to predicted protein, partial [Hydra mag
. . Methanosarcina mazei .......................................................   68  1 hit  [euryarchaeotes]         RecName: Full=Probable ribosomal RNA small subunit methyltr
. . Halogeometricum borinquense DSM 11551 ......................................   68  2 hits [euryarchaeotes]         dimethyladenosine transferase [Halogeometricum borinquense 
. . Culex quinquefasciatus .....................................................   68  8 hits [flies]                  dimethyladenosine transferase [Culex quinquefasciatus] >gi|
. . Aspergillus terreus NIH2624 ................................................   68  2 hits [ascomycetes]            hypothetical protein ATEG_06802 [Aspergillus terreus NIH262
. . Podospora anserina S mat+ ..................................................   68  1 hit  [ascomycetes]            unnamed protein product [Podospora anserina] >gi|170947164|
. . Podospora anserina .........................................................   68  1 hit  [ascomycetes]            unnamed protein product [Podospora anserina] >gi|170947164|
. . Plasmodium falciparum ......................................................   68  2 hits [apicomplexans]          Chain A, Crystal Structure Of A Dimethyladenosine Transfera
. . Thellungiella halophila ....................................................   68  1 hit  [eudicots]               hypothetical protein [Thellungiella halophila]
. . Dictyostelium discoideum ...................................................   68  1 hit  [cellular slime molds]   dimethyladenosine transferase [Dictyostelium discoideum AX4
. . Methanothermobacter thermautotrophicus str. Delta H ........................   68  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanothermobacter thermaut
. . Plasmodium chabaudi chabaudi ...............................................   67  2 hits [apicomplexans]          dimethyladenosine transferase [Plasmodium chabaudi chabaudi
. . Caligus rogercresseyi ......................................................   67  3 hits [crustaceans]            Probable dimethyladenosine transferase [Caligus rogercresse
. . Pediculus humanus corporis (human body lice) ...............................   67  4 hits [lice]                   dimethyladenosine transferase, putative [Pediculus humanus 
. . Uncinocarpus reesii 1704 ...................................................   67  2 hits [ascomycetes]            dimethyladenosine transferase [Uncinocarpus reesii 1704] >g
. . Antonospora locustae .......................................................   67  1 hit  [microsporidians]        putative dimethyladenosine transferase-like protein [Antono
. . Ciona intestinalis .........................................................   67  2 hits [tunicates]              PREDICTED: similar to GF16271, partial [Ciona intestinalis]
. . Ajellomyces capsulatus G186AR ..............................................   67  1 hit  [ascomycetes]            dimethyladenosine transferase dimethyltransferase [Ajellomy
. . Ajellomyces capsulatus H143 ................................................   67  1 hit  [ascomycetes]            dimethyladenosine transferase dimethyltransferase [Ajellomy
. . Ostreococcus tauri .........................................................   67  2 hits [green algae]            Ribosomal RNA adenine dimethylase (ISS) [Ostreococcus tauri]
. . Macaca fascicularis (cynomolgus monkey) ....................................   67  4 hits [primates]               RecName: Full=Probable dimethyladenosine transferase; AltNa
. . Postia placenta Mad-698-R ..................................................   67  2 hits [basidiomycetes]         predicted protein [Postia placenta Mad-698-R] >gi|220729783
. . Penicillium marneffei ATCC 18224 ...........................................   67  2 hits [ascomycetes]            dimethyladenosine transferase [Penicillium marneffei ATCC 1
. . Trichoplax adhaerens .......................................................   67  4 hits [placozoans]             hypothetical protein TRIADDRAFT_29342 [Trichoplax adhaerens
. . Mus musculus (mouse) .......................................................   67 16 hits [rodents]                RIKEN cDNA 1500031M22, isoform CRA_a [Mus musculus] >gi|148
. . Pyrobaculum arsenaticum DSM 13514 ..........................................   67  2 hits [crenarchaeotes]         dimethyladenosine transferase [Pyrobaculum arsenaticum DSM 
. . Equus caballus (equine) ....................................................   67  2 hits [odd-toed ungulates]     PREDICTED: similar to Dimethyladenosine transferase [Equus 
. . Bos taurus (cow) ...........................................................   67  7 hits [even-toed ungulates]    probable dimethyladenosine transferase [Bos taurus] >gi|114
. . Pyrobaculum calidifontis JCM 11548 .........................................   67  2 hits [crenarchaeotes]         dimethyladenosine transferase [Pyrobaculum calidifontis JCM
. . Oryctolagus cuniculus (domestic rabbit) ....................................   67  2 hits [rabbits & hares]        PREDICTED: dimethyladenosine transferase [Oryctolagus cunic
. . Giardia lamblia ATCC 50803 .................................................   66  2 hits [diplomonads]            Dimethyladenosine transferase [Giardia lamblia ATCC 50803] 
. . Acyrthosiphon pisum ........................................................   66  2 hits [aphids]                 hypothetical protein LOC100164336 [Acyrthosiphon pisum] >gi
. . Ailuropoda melanoleuca .....................................................   66  2 hits [carnivores]             hypothetical protein PANDA_004390 [Ailuropoda melanoleuca]
. . Monosiga brevicollis MX1 ...................................................   66  2 hits [choanoflagellates]      hypothetical protein [Monosiga brevicollis MX1] >gi|1637733
. . Micromonas sp. RCC299 ......................................................   66  4 hits [green algae]            predicted protein [Micromonas sp. RCC299] >gi|226521314|gb|
. . Talaromyces stipitatus ATCC 10500 ..........................................   66  2 hits [ascomycetes]            dimethyladenosine transferase [Talaromyces stipitatus ATCC 
. . Ignicoccus hospitalis KIN4/I ...............................................   66  2 hits [crenarchaeotes]         dimethyladenosine transferase [Ignicoccus hospitalis KIN4/I
. . Rattus norvegicus (brown rat) ..............................................   66  8 hits [rodents]                DIM1 dimethyladenosine transferase 1-like [Rattus norvegicu
. . Homo sapiens (man) .........................................................   66 20 hits [primates]               Chain A, Crystal Structure Of Human Dimethyladenosine Trans
. . Ajellomyces dermatitidis SLH14081 ..........................................   66  2 hits [ascomycetes]            dimethyladenosine transferase [Ajellomyces dermatitidis SLH
. . Giardia intestinalis ATCC 50581 ............................................   66  1 hit  [diplomonads]            Dimethyladenosine transferase [Giardia intestinalis ATCC 50
. . Ajellomyces dermatitidis ER-3 ..............................................   66  1 hit  [ascomycetes]            dimethyladenosine transferase [Ajellomyces dermatitidis ER-
. . Microsporum canis CBS 113480 ...............................................   66  1 hit  [ascomycetes]            dimethyladenosine transferase dimethyltransferase [Microspo
. . Laccaria bicolor S238N-H82 .................................................   66  2 hits [basidiomycetes]         predicted protein [Laccaria bicolor S238N-H82] >gi|16464521
. . Pan troglodytes ............................................................   66  6 hits [primates]               probable dimethyladenosine transferase [Homo sapiens] >gi|1
. . Monodelphis domestica ......................................................   66  2 hits [marsupials]             PREDICTED: similar to Dimethyladenosine transferase [Monode
. . Macaca mulatta (rhesus macaque) ............................................   66  4 hits [primates]               PREDICTED: dimethyladenosine transferase [Macaca mulatta]
. . Ostreococcus lucimarinus CCE9901 ...........................................   66  4 hits [green algae]            predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. . Schizosaccharomyces japonicus yFS275 .......................................   66  2 hits [ascomycetes]            dimethyladenosine transferase [Schizosaccharomyces japonicu
. . Aspergillus niger CBS 513.88 ...............................................   65  1 hit  [ascomycetes]            hypothetical protein An02g14660 [Aspergillus niger] >gi|134
. . Aspergillus niger ..........................................................   65  1 hit  [ascomycetes]            hypothetical protein An02g14660 [Aspergillus niger] >gi|134
. . Encephalitozoon cuniculi GB-M1 .............................................   65  2 hits [microsporidians]        DIMETHYLADENOSINE TRANSFERASE [Encephalitozoon cuniculi GB-
. . Lodderomyces elongisporus NRRL YB-4239 .....................................   65  2 hits [ascomycetes]            dimethyladenosine transferase [Lodderomyces elongisporus NR
. . Halomicrobium mukohataei DSM 12286 .........................................   65  2 hits [euryarchaeotes]         dimethyladenosine transferase [Halomicrobium mukohataei DSM
. . Brugia malayi (agent of lymphatic fil...) ..................................   65  4 hits [nematodes]              Probable dimethyladenosine transferase [Brugia malayi] >gi|
. . Methanobrevibacter ruminantium M1 ..........................................   65  2 hits [euryarchaeotes]         dimethyladenosine transferase KsgA [Methanobrevibacter rumi
. . Pyrobaculum aerophilum str. IM2 ............................................   65  2 hits [crenarchaeotes]         dimethyladenosine transferase [Pyrobaculum aerophilum str. 
. . Pyrobaculum aerophilum .....................................................   65  1 hit  [crenarchaeotes]         dimethyladenosine transferase [Pyrobaculum aerophilum str. 
. . Tetraodon nigroviridis .....................................................   65  1 hit  [bony fishes]            unnamed protein product [Tetraodon nigroviridis]
. . Malassezia globosa CBS 7966 ................................................   65  2 hits [basidiomycetes]         hypothetical protein MGL_3848 [Malassezia globosa CBS 7966]
. . Micromonas pusilla CCMP1545 ................................................   65  2 hits [green algae]            hypothetical protein MICPUCDRAFT_58407 [Micromonas pusilla 
. . Sordaria macrospora ........................................................   65  1 hit  [ascomycetes]            unnamed protein product [Sordaria macrospora]
. . Coprinopsis cinerea okayama7#130 ...........................................   65  2 hits [basidiomycetes]         hypothetical protein CC1G_08766 [Coprinopsis cinerea okayam
. . Phytophthora infestans T30-4 ...............................................   64  2 hits [oomycetes]              dimethyladenosine transferase [Phytophthora infestans T30-4]
. . Neurospora crassa OR74A ....................................................   64  2 hits [ascomycetes]            dimethyladenosine transferase [Neurospora crassa OR74A] >gi
. . Kluyveromyces lactis .......................................................   64  3 hits [ascomycetes]            dimethylase [Kluyveromyces lactis]
. . Candida albicans SC5314 ....................................................   64  4 hits [ascomycetes]            likely dimethyladenosine transferase [Candida albicans SC53
. . Candida albicans WO-1 ......................................................   64  1 hit  [ascomycetes]            likely dimethyladenosine transferase [Candida albicans SC53
. . Pyrococcus furiosus DSM 3638 ...............................................   64  2 hits [euryarchaeotes]         dimethyladenosine transferase [Pyrococcus furiosus DSM 3638
. . Pyrococcus furiosus ........................................................   64  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Pyrococcus furiosus DSM 3638
. . Ustilago maydis 521 ........................................................   64  2 hits [basidiomycetes]         hypothetical protein UM02444.1 [Ustilago maydis 521] >gi|46
. . Schizosaccharomyces pombe ..................................................   64  4 hits [ascomycetes]            18S rRNA dimethylase [Schizosaccharomyces pombe] >gi|265569
. . Saccharomyces cerevisiae AWRI1631 ..........................................   64  1 hit  [ascomycetes]            YPL266Wp-like protein [Saccharomyces cerevisiae AWRI1631]
. . Thermococcus barophilus MP .................................................   64  2 hits [euryarchaeotes]         dimethyladenosine transferase [Thermococcus barophilus MP] 
. . Kluyveromyces lactis NRRL Y-1140 ...........................................   63  1 hit  [ascomycetes]            DIM1_KLULA [Kluyveromyces lactis] >gi|52788270|sp|P78697.3|
. . Entamoeba dispar SAW760 ....................................................   63  2 hits [eukaryotes]             dimethyladenosine transferase [Entamoeba dispar SAW760] >gi
. . Candida tropicalis MYA-3404 ................................................   63  2 hits [ascomycetes]            dimethyladenosine transferase [Candida tropicalis MYA-3404]
. . Pichia pastoris GS115 ......................................................   63  2 hits [ascomycetes]            Essential 18S rRNA dimethylase (dimethyladenosine transfera
. . Caenorhabditis briggsae ....................................................   63  4 hits [nematodes]              Hypothetical protein CBG00961 [Caenorhabditis briggsae] >gi
. . Entamoeba histolytica HM-1:IMSS ............................................   63  2 hits [eukaryotes]             dimethyladenosine transferase [Entamoeba histolytica HM-1:I
. . Caenorhabditis elegans (nematode) ..........................................   63  6 hits [nematodes]              hypothetical protein E02H1.1 [Caenorhabditis elegans] >gi|2
. . Candida dubliniensis CD36 ..................................................   63  2 hits [ascomycetes]            18S rRNA dimethylase, putative; S-adenosylmethionine-6-N', 
. . Pyrococcus horikoshii ......................................................   63  1 hit  [euryarchaeotes]         RecName: Full=Probable ribosomal RNA small subunit methyltr
. . Pyrococcus horikoshii OT3 ..................................................   63  2 hits [euryarchaeotes]         dimethyladenosine transferase [Pyrococcus horikoshii OT3] >
. . Pichia stipitis CBS 6054 ...................................................   63  2 hits [ascomycetes]            Dimethyladenosine transferase (S-adenosylmethionine-6-N', N
. . Nosema ceranae BRL01 .......................................................   63  1 hit  [microsporidians]        hypothetical protein NCER_100912 [Nosema ceranae BRL01]
. . Thermococcus gammatolerans EJ3 .............................................   63  3 hits [euryarchaeotes]         Ribosomal RNA adenine methylase transferase (Dimethyladenos
. . Methanosphaerula palustris E1-9c ...........................................   62  2 hits [euryarchaeotes]         dimethyladenosine transferase [Candidatus Methanosphaerula 
. . Thermococcus kodakarensis KOD1 .............................................   62  2 hits [euryarchaeotes]         dimethyladenosine transferase [Thermococcus kodakarensis KO
. . Thermococcus kodakarensis ..................................................   62  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Thermococcus kodakarensis KO
. . Vanderwaltozyma polyspora DSM 70294 ........................................   62  2 hits [ascomycetes]            hypothetical protein Kpol_449p12 [Vanderwaltozyma polyspora
. . Saccharomyces cerevisiae (yeast) ...........................................   62  5 hits [ascomycetes]            Dim1p [Saccharomyces cerevisiae] >gi|1169344|sp|P41819.1|DI
. . Saccharomyces cerevisiae YJM789 ............................................   62  1 hit  [ascomycetes]            Dim1p [Saccharomyces cerevisiae] >gi|1169344|sp|P41819.1|DI
. . Saccharomyces cerevisiae RM11-1a ...........................................   62  1 hit  [ascomycetes]            Dim1p [Saccharomyces cerevisiae] >gi|1169344|sp|P41819.1|DI
. . Saccharomyces cerevisiae JAY291 ............................................   62  1 hit  [ascomycetes]            Dim1p [Saccharomyces cerevisiae] >gi|1169344|sp|P41819.1|DI
. . Saccharomyces cerevisiae EC1118 ............................................   62  1 hit  [ascomycetes]            Dim1p [Saccharomyces cerevisiae] >gi|1169344|sp|P41819.1|DI
. . Aspergillus oryzae RIB40 ...................................................   62  1 hit  [ascomycetes]            hypothetical protein [Aspergillus oryzae RIB40] >gi|2384825
. . Aspergillus flavus NRRL3357 ................................................   62  2 hits [ascomycetes]            hypothetical protein [Aspergillus oryzae RIB40] >gi|2384825
. . Aspergillus oryzae .........................................................   62  1 hit  [ascomycetes]            hypothetical protein [Aspergillus oryzae RIB40] >gi|2384825
. . Pyrococcus abyssi GE5 ......................................................   62  2 hits [euryarchaeotes]         dimethyladenosine transferase [Pyrococcus abyssi GE5] >gi|2
. . Pyrococcus abyssi ..........................................................   62  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Pyrococcus abyssi GE5] >gi|2
. . Ashbya gossypii ATCC 10895 .................................................   62  2 hits [ascomycetes]            ACR026Wp [Ashbya gossypii ATCC 10895] >gi|52782780|sp|Q75C9
. . Eremothecium gossypii ......................................................   62  1 hit  [ascomycetes]            ACR026Wp [Ashbya gossypii ATCC 10895] >gi|52782780|sp|Q75C9
. . Zygosaccharomyces rouxii CBS 732 ...........................................   62  1 hit  [ascomycetes]            ZYRO0F00308p [Zygosaccharomyces rouxii] >gi|238940108|emb|C
. . Zygosaccharomyces rouxii ...................................................   62  1 hit  [ascomycetes]            ZYRO0F00308p [Zygosaccharomyces rouxii] >gi|238940108|emb|C
. . Verticillium albo-atrum VaMs.102 ...........................................   62  1 hit  [ascomycetes]            dimethyladenosine transferase [Verticillium albo-atrum VaMs
. . Methanocorpusculum labreanum Z .............................................   62  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocorpusculum labreanum
. . Aspergillus clavatus NRRL 1 ................................................   61  2 hits [ascomycetes]            dimethyladenosine transferase [Aspergillus clavatus NRRL 1]
. . Lachancea thermotolerans CBS 6340 ..........................................   61  1 hit  [ascomycetes]            KLTH0C11704p [Lachancea thermotolerans] >gi|238934103|emb|C
. . Lachancea thermotolerans ...................................................   61  1 hit  [ascomycetes]            KLTH0C11704p [Lachancea thermotolerans] >gi|238934103|emb|C
. . Clavispora lusitaniae ATCC 42720 ...........................................   61  2 hits [ascomycetes]            dimethyladenosine transferase [Clavispora lusitaniae ATCC 4
. . Candida glabrata CBS 138 ...................................................   61  1 hit  [ascomycetes]            unnamed protein product [Candida glabrata] >gi|52782776|sp|
. . Candida glabrata ...........................................................   61  2 hits [ascomycetes]            unnamed protein product [Candida glabrata] >gi|52782776|sp|
. . Sclerotinia sclerotiorum 1980 UF-70 ........................................   61  2 hits [ascomycetes]            hypothetical protein SS1G_05101 [Sclerotinia sclerotiorum 1
. . Neosartorya fischeri NRRL 181 ..............................................   61  2 hits [ascomycetes]            dimethyladenosine transferase [Neosartorya fischeri NRRL 18
. . Pyrobaculum islandicum DSM 4184 ............................................   61  3 hits [crenarchaeotes]         dimethyladenosine transferase [Pyrobaculum islandicum DSM 4
. . Cryptosporidium parvum Iowa II .............................................   61  2 hits [apicomplexans]          Dim1p-like ERMB/KSGA methylase [Cryptosporidium parvum Iowa
. . Cryptosporidium parvum .....................................................   61  1 hit  [apicomplexans]          Dim1p-like ERMB/KSGA methylase [Cryptosporidium parvum Iowa
. . Methanococcus voltae A3 ....................................................   61  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus voltae A3] >gi
. . Aspergillus fumigatus Af293 ................................................   61  2 hits [ascomycetes]            dimethyladenosine transferase [Aspergillus fumigatus Af293]
. . Aspergillus fumigatus A1163 ................................................   61  1 hit  [ascomycetes]            dimethyladenosine transferase [Aspergillus fumigatus Af293]
. . Debaryomyces hansenii CBS767 ...............................................   60  1 hit  [ascomycetes]            DEHA2D05038p [Debaryomyces hansenii CBS767] >gi|52782772|sp
. . Debaryomyces hansenii ......................................................   60  2 hits [ascomycetes]            DEHA2D05038p [Debaryomyces hansenii CBS767] >gi|52782772|sp
. . Tigriopus californicus (tidepool copepod) ..................................   60 10 hits [crustaceans]            mitochondrial transcription factor B1 [Tigriopus californic
. . Nectria haematococca mpVI 77-13-4 ..........................................   60  1 hit  [ascomycetes]            hypothetical protein NECHADRAFT_41763 [Nectria haematococca
. . Methanococcoides burtonii DSM 6242 .........................................   60  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcoides burtonii DS
. . Hyperthermus butylicus DSM 5456 ............................................   60  2 hits [crenarchaeotes]         dimethyladenosine transferase [Hyperthermus butylicus DSM 5
. . Methanococcus maripaludis S2 ...............................................   60  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus maripaludis S2
. . Methanococcus maripaludis ..................................................   60  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Methanococcus maripaludis S2
. . Aspergillus nidulans FGSC A4 ...............................................   60  3 hits [ascomycetes]            hypothetical protein AN3313.2 [Aspergillus nidulans FGSC A4
. . Candidatus Micrarchaeum acidiphilum ARMAN-2 ................................   60  1 hit  [euryarchaeotes]         ribosomal RNA adenine methylase transferase [Candidatus Mic
. . Phaeosphaeria nodorum SN15 .................................................   60  2 hits [ascomycetes]            hypothetical protein SNOG_15844 [Phaeosphaeria nodorum SN15
. . Chaetomium globosum CBS 148.51 .............................................   60  2 hits [ascomycetes]            hypothetical protein CHGG_06968 [Chaetomium globosum CBS 14
. . Medicago truncatula ........................................................   60  3 hits [eudicots]               unknown [Medicago truncatula]
. . Pichia guilliermondii ATCC 6260 ............................................   60  2 hits [ascomycetes]            dimethyladenosine transferase [Pichia guilliermondii ATCC 6
. . Thermococcus sibiricus MM 739 ..............................................   60  3 hits [euryarchaeotes]         Probable dimethyladenosine transferase [Thermococcus sibiri
. . Cryptosporidium muris RN66 .................................................   60  4 hits [apicomplexans]          dimethyladenosine transferase protein [Cryptosporidium muri
. . Archaeoglobus profundus DSM 5631 ...........................................   60  2 hits [euryarchaeotes]         dimethyladenosine transferase [Archaeoglobus profundus DSM 
. . uncultured archaeon ........................................................   60  1 hit  [archaea]                Probable dimethyladenosine transferase [uncultured archaeon]
. . Methanococcus maripaludis C7 ...............................................   59  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus maripaludis C7
. . Methanocaldococcus fervens AG86 ............................................   59  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus fervens A
. . Paracoccidioides brasiliensis Pb18 .........................................   59  1 hit  [ascomycetes]            dimethyladenosine transferase [Paracoccidioides brasiliensi
. . Paracoccidioides brasiliensis Pb01 .........................................   59  1 hit  [ascomycetes]            dimethyladenosine transferase [Paracoccidioides brasiliensi
. . Thermoproteus neutrophilus V24Sta ..........................................   58  2 hits [crenarchaeotes]         dimethyladenosine transferase [Thermoproteus neutrophilus V
. . Pyrenophora tritici-repentis Pt-1C-BFP .....................................   58  2 hits [ascomycetes]            dimethyladenosine transferase dimethyltransferase [Pyrenoph
. . Haloarcula marismortui ATCC 43049 ..........................................   58  2 hits [euryarchaeotes]         dimethyladenosine transferase [Haloarcula marismortui ATCC 
. . Haloarcula marismortui .....................................................   58  1 hit  [euryarchaeotes]         dimethyladenosine transferase [Haloarcula marismortui ATCC 
. . Moniliophthora perniciosa FA553 ............................................   58  2 hits [basidiomycetes]         hypothetical protein MPER_07142 [Moniliophthora perniciosa 
. . Methanococcus maripaludis C6 ...............................................   58  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus maripaludis C6
. . Aeropyrum pernix K1 ........................................................   58  2 hits [crenarchaeotes]         S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransfe
. . Aeropyrum pernix ...........................................................   58  1 hit  [crenarchaeotes]         S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransfe
. . Candidatus Parvarchaeum acidophilus ARMAN-5 ................................   58  1 hit  [euryarchaeotes]         ribosomal RNA adenine methylase transferase [Candidatus Par
. . Schistosoma japonicum ......................................................   58  2 hits [flatworms]              DIM1 dimethyladenosine transferase 1-like protein [Schistos
. . Methanocaldococcus vulcanius M7 ............................................   58  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus vulcanius
. . Yarrowia lipolytica CLIB122 ................................................   58  1 hit  [ascomycetes]            YALI0E00770p [Yarrowia lipolytica] >gi|52782774|sp|Q6C7H6.1
. . Yarrowia lipolytica ........................................................   58  2 hits [ascomycetes]            YALI0E00770p [Yarrowia lipolytica] >gi|52782774|sp|Q6C7H6.1
. . Methanocaldococcus sp. FS406-22 ............................................   58  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus sp. FS406
. . Methanococcus aeolicus Nankai-3 ............................................   58  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus aeolicus Nanka
. . Methanosphaera stadtmanae DSM 3091 .........................................   57  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanosphaera stadtmanae DS
. . Methanocaldococcus jannaschii DSM 2661 .....................................   57  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus jannaschi
. . Methanocaldococcus jannaschii ..............................................   57  8 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus jannaschi
. . Methanococcus maripaludis C5 ...............................................   56  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus maripaludis C5
. . Nitrosopumilus maritimus SCM1 ..............................................   56  2 hits [archaea]                ribosomal RNA adenine methylase transferase [Nitrosopumilus
. . Arthroderma benhamiae CBS 112371 ...........................................   56  1 hit  [ascomycetes]            hypothetical protein ARB_05072 [Arthroderma benhamiae CBS 1
. . Caldivirga maquilingensis IC-167 ...........................................   56  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Caldivirga maq
. . Methanococcus vannielii SB .................................................   56  3 hits [euryarchaeotes]         dimethyladenosine transferase [Methanococcus vannielii SB] 
. . Trichophyton verrucosum HKI 0517 ...........................................   56  1 hit  [ascomycetes]            hypothetical protein TRV_06678 [Trichophyton verrucosum HKI
. . Schistosoma mansoni ........................................................   55  4 hits [flatworms]              dimethyladenosine transferase [Schistosoma mansoni] >gi|238
. . Candidatus Parvarchaeum acidiphilum ARMAN-4 ................................   54  2 hits [euryarchaeotes]         ribosomal RNA adenine methylase transferase [Candidatus Par
. . Methanocaldococcus infernus ME .............................................   53  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanocaldococcus infernus 
. . Methanobrevibacter smithii DSM 2374 ........................................   53  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanobrevibacter smithii D
. . Methanobrevibacter smithii DSM 2375 ........................................   53  2 hits [euryarchaeotes]         hypothetical protein METSMIALI_01317 [Methanobrevibacter sm
. . Methanobrevibacter smithii ATCC 35061 ......................................   53  2 hits [euryarchaeotes]         dimethyladenosine transferase [Methanobrevibacter smithii A
. . Thermococcus onnurineus NA1 ................................................   53  3 hits [euryarchaeotes]         dimethyladenosine transferase [Thermococcus onnurineus NA1]
. . Canis lupus familiaris (dogs) ..............................................   53  2 hits [carnivores]             PREDICTED: similar to transcription factor B1, mitochondria
. . Pongo abelii (Orang-utan) ..................................................   51  3 hits [primates]               dimethyladenosine transferase 1, mitochondrial [Pongo abeli
. . Botryotinia fuckeliana B05.10 ..............................................   51  2 hits [ascomycetes]            hypothetical protein BC1G_07171 [Botryotinia fuckeliana B05
. . Gibberella zeae PH-1 .......................................................   51  1 hit  [ascomycetes]            hypothetical protein FG05049.1 [Gibberella zeae PH-1]
. . Sus scrofa (wild boar) .....................................................   50  3 hits [even-toed ungulates]    transcription factor B1, mitochondrial [Sus scrofa] >gi|186
. . Thermoplasma acidophilum DSM 1728 ..........................................   48  1 hit  [euryarchaeotes]         rRNA dimethyladenosine transferase [Thermoplasma acidophilu
. . Thermoplasma acidophilum ...................................................   48  1 hit  [euryarchaeotes]         rRNA (adenine-N6, N6-)-dimethyltransferase (DIM1, yeast) re
. . uncultured marine crenarchaeote HF4000_ANIW133O4 ...........................   47  1 hit  [archaea]                putative ribosomal RNA adenine dimethylase [uncultured mari
. . Archaeoglobus fulgidus DSM 4304 ............................................   47  2 hits [euryarchaeotes]         dimethyladenosine transferase (ksgA) [Archaeoglobus fulgidu
. . Archaeoglobus fulgidus .....................................................   47  1 hit  [euryarchaeotes]         dimethyladenosine transferase (ksgA) [Archaeoglobus fulgidu
. . uncultured marine crenarchaeote HF4000_APKG8D22 ............................   47  1 hit  [archaea]                putative ribosomal RNA adenine dimethylase [uncultured mari
. . Tetrahymena thermophila ....................................................   45  1 hit  [ciliates]               dimethyladenosine transferase family protein [Tetrahymena t
. . Tetrahymena thermophila SB210 ..............................................   45  1 hit  [ciliates]               dimethyladenosine transferase family protein [Tetrahymena t
. . Cenarchaeum symbiosum A ....................................................   40  2 hits [archaea]                dimethyladenosine transferase (rRNA methylation) [Cenarchae
. . Magnaporthe oryzae 70-15 ...................................................   38  2 hits [ascomycetes]            hypothetical protein MGG_00251 [Magnaporthe grisea 70-15] >
. . Thermoplasma volcanium GSS1 ................................................   36  2 hits [euryarchaeotes]         rRNA dimethyladenosine transferase [Thermoplasma volcanium 
. . Metallosphaera sedula DSM 5348 .............................................   35  2 hits [crenarchaeotes]         dimethyladenosine transferase [Metallosphaera sedula DSM 53
. . Sulfolobus islandicus L.S.2.15 .............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus L.D.8.5 ..............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus M.14.25 ..............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus M.16.27 ..............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus M.16.4 ...............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus Y.G.57.14 ............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus islandicus Y.N.15.51 ............................................   34  2 hits [crenarchaeotes]         ribosomal RNA adenine methylase transferase [Sulfolobus isl
. . Sulfolobus solfataricus P2 .................................................   33  3 hits [crenarchaeotes]         dimethyladenosine transferase [Sulfolobus solfataricus P2] 
. . Sulfolobus solfataricus 98/2 ...............................................   33  2 hits [crenarchaeotes]         dimethyladenosine transferase [Sulfolobus solfataricus P2] 
. . Sulfolobus tokodaii str. 7 .................................................   33  2 hits [crenarchaeotes]         dimethyladenosine transferase [Sulfolobus tokodaii str. 7] 
. synthetic construct ----------------------------------------------------------  100 13 hits [other sequences]        PA0592 [synthetic construct]
. synthetic Mycoplasma genitalium JCVI-1.0 .....................................   76  1 hit  [other sequences]        dimethyladenosine transferase [Mycoplasma genitalium G37] >
. uncultured marine microorganism HF4000_010I05 ................................   55  1 hit  [unclassified]           putative ribosomal RNA adenine dimethylase [uncultured mari
. uncultured marine microorganism HF4000_ANIW133F6 .............................   49  1 hit  [unclassified]           putative ribosomal RNA adenine dimethylase [uncultured mari
. uncultured marine microorganism HF4000_ANIW141C7 .............................   49  1 hit  [unclassified]           putative ribosomal RNA adenine dimethylase [uncultured mari
. Cloning vector pJL-ES ........................................................   35  1 hit  [other sequences]        ErmC [Cloning vector pJL-ES] >gi|157058879|gb|ABV03167.1| E
. Cloning vector pJL-proES .....................................................   35  1 hit  [other sequences]        ErmC [Cloning vector pJL-ES] >gi|157058879|gb|ABV03167.1| E
. Plasmid p121BS ...............................................................   35  2 hits [other sequences]        methylase ermT [Plasmid p121BS] >gi|11527994|gb|AAG37071.1|
. Plasmid pNE131 ...............................................................   35  2 hits [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Plasmid pIM13 ................................................................   34  2 hits [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Cloning vector pIDN4 .........................................................   34  1 hit  [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Shuttle vector pSOS96 ........................................................   34  1 hit  [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Shuttle vector pSOS94 ........................................................   34  1 hit  [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Shuttle vector pSOS95 ........................................................   34  1 hit  [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Reporter vector pGUSA ........................................................   34  1 hit  [other sequences]        macrolide-lincosamide-streptogramin B-resistance protein [P
. Plasmid pT48 .................................................................   34  2 hits [other sequences]        23S RNA methylase [Plasmid pT48] >gi|253730996|ref|ZP_04865
. Transposon mutagenesis vector pRL692 .........................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. unidentified cloning vector ..................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pDG1728 .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pDG1730 .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pDG1729 .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pDG1731 .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Tn10 delivery vector pHV1248 .................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Tn10 delivery vector pHV1249 .................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pUvBBAC .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Anabaena transfer vector pRL2665b ............................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pGID052 .......................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pHP13 .........................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Cloning vector pHB518 ........................................................   34  1 hit  [other sequences]        hypothetical protein pE194p5 [Staphylococcus aureus] >gi|12
. Promoter screenings vector pMM223 ............................................   34  1 hit  [other sequences]        adenine methylase [Promoter screenings vector pMM223] >gi|5
. Promoter screenings vector pMM225 ............................................   34  1 hit  [other sequences]        adenine methylase [Promoter screenings vector pMM223] >gi|5
. Plasmid pGT633 ...............................................................   34  1 hit  [other sequences]        RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. Integrative vector pNLE1 .....................................................   33  1 hit  [other sequences]        RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 
. Plasmid pE5 ..................................................................   33  1 hit  [other sequences]        RecName: Full=rRNA adenine N-6-methyltransferase; AltName: 

BLAST

PROTOCOLE:

Nous avons fait un test BLASTP afin de trouver des similarités entre notre séquence et des sequences protéiques connues.


Sur NCBI:

1)réalisation d'un blastp swissprot(petite banque mais trés précise) pour déterminer la fonction putative de la protéine


2)réalisation d'un blastp contre nr


3)Nous avons ensuite determine la valeur seuil de score qui nous a permit d`identifier les sequences homologues et les non-homologues.


ANALYSE DES RÉSULTATS:


1-BLASTp contre SWISSPROT :

Le meilleur score obtenu est de 120 avec une E-value de 3e-27. Il est obtenu pour Ribosomal RNA small subunit methyltransferase A.

Le moins bon score obtenu est de 99.0, avec une E-value de 1e-20. Il est obtenu pour Ribosomal RNA small subunit methyltransferase A.


Il n'y a pas une grande variation des scores et des E-value.

On va réitérer l'expérience, mais contre nr, pour voir si on obtient plus de résultats car swissprot est une banque restreinte.Ainsi on va pouvoir classer notre séquence dans un groupe taxonomique.



2-BLASTp contre Nr;

Le meilleur score obtenu est de 129 avec une E-value de 1e-28. Il est obtenu pour la dimethyladenosine transferase.

Le moins bon score obtenu est de 107 , avec une E-value de 5e-22. Il est obtenu pour la dimethyladenosine transferase.


Les alignements 2 a 2 sur swissprot et sur nr nous montre que les sequences potentiellement homologues s'alignent avec notre sequence au niveau de leurs 100eme aa environ.Ce qui renforce notre idée que probablement notre sequence représente une partie seulement d'une sequence proteique complete qui commencerait donc en amont.On peut donc en deduire que notre sequence est imcomplete en 5`.


On determine le seuil sur les critères de longueur de la séquence comparée, du pourcentage de gaps qui augmente significativement aprés le seuil, et le pourcentage d'identité qui devient inférieur à 30%.


Pour définir cette valeure seuil il nous a fallut faire de nouveau un BLASTp contre nr mais en changeant les parametres afin d'obtenir 1000 alignements. Nous avons définis notre seuil pour un score 60.8 bits et une E-value de 4e-08


RÉSULTATS BRUTS:

1)Blast contre swissprot:

Accession Description                                                                                                                                                                                         Max score          Total score          Query coverage        E value  
Q823V2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 120 120 96% 3e-27  
A1VD65.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 120 120 92% 5e-27  
Q72B41.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 119 119 92% 6e-27  
Q253R6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 119 119 99% 1e-26  
Q1RK29.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 118 118 95% 1e-26  
A8GXS7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 118 118 95% 1e-26  
Q68W66.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 117 117 91% 3e-26  
O05952.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 115 115 91% 9e-26  
A8GPG7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 115 115 98% 9e-26  
A8EZN3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 115 115 89% 1e-25  
Q5L6H5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 115 115 96% 1e-25  
A0LA32.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 113 113 97% 5e-25  
A8GT85.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 113 113 97% 5e-25  
Q1MR01.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 97% 8e-25  
Q92GV0.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 91% 9e-25  
C4K2J5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 91% 1e-24  
O84358.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q3KM04.1|RSMA_CHLTA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0B7S3.1|RSMA_CHLT2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0BBY8.1|RSMA_CHLTB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 96% 1e-24  
Q1AXL9.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 111 111 99% 2e-24  
Q9Z6K0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 111 111 89% 2e-24  
C3PPC3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 110 110 91% 3e-24  
Q9K0B7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 110 110 98% 5e-24  
A1KSW0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 110 110 98% 5e-24  
Q984S7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 109 109 91% 7e-24  
Q9JVC2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 108 108 98% 1e-23  
B4RJV5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 108 108 98% 1e-23  
Q493R7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 108 108 99% 1e-23  
Q6F8A0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 108 108 98% 1e-23  
Q8EU92.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 108 108 97% 1e-23  
Q60B77.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 95% 2e-23  
Q5F9W4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 98% 2e-23  
A1U6F8.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 98% 3e-23  
Q0HS06.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 97% 3e-23  
A0L064.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 97% 3e-23  
Q3A8X5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 94% 4e-23  
Q6ME80.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 91% 4e-23  
Q9PK40.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 106 106 98% 6e-23  
C0R5G4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 106 106 96% 6e-23  
Q4L3F0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 106 106 89% 7e-23  
Q5FH30.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 106 106 91% 8e-23  
Q5HBC6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 91% 8e-23  
Q7N8V7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 98% 8e-23  
Q8EB93.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 97% 1e-22  
Q0HLT2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 97% 1e-22  
A9M352.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 98% 1e-22  
C4L9L4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 98% 1e-22  
Q3JAF3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 105 105 97% 2e-22  
Q5GSM9.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 104 104 96% 2e-22  
B4RBS4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 94% 3e-22  
Q4JU23.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 91% 4e-22  
Q11HG9.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 98% 4e-22  
A4Y435.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A1RMU8.1|RSMA_SHESW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 98% 4e-22  
Q9A7N5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 97% 5e-22  
P57241.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 91% 6e-22  
B3CPY6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 91% 6e-22  
Q1LSS2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 91% 6e-22  
Q9I5U5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 103 103 98% 6e-22  
C1AXY5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 96% 8e-22  
Q7VQK3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 92% 8e-22  
Q03HF6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 94% 8e-22  
B1LBH5.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 89% 9e-22  
Q5YPY6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 89% 9e-22  
Q2G9Z2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 93% 1e-21  
A1A3W3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 93% 1e-21  
B6EL48.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 102 102 99% 1e-21  
A3D188.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B8EB35.1|RSMA_SHEB2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 101 101 97% 1e-21  
A6WK59.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9L438.1|RSMA_SHEB9 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 101 101 97% 2e-21  
Q9X1F1.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 101 101 89% 2e-21  
Q0VMV2.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 101 101 90% 2e-21  
C1CMT3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 91% 3e-21  
Q5WSM3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 97% 3e-21  
Q56016.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 95% 3e-21  
P59524.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 90% 3e-21  
A8ALP9.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 98% 3e-21  
Q5E865.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5FGG5.1|RSMA_VIBFM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 99% 3e-21  
Q49V02.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 92% 4e-21  
Q5ZRF4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 97% 4e-21  
Q8KA00.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 97% 4e-21  
Q8D3I1.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 91% 4e-21  
Q5X0V1.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5IIC0.1|RSMA_LEGPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 97% 4e-21  
Q73IR3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 96% 5e-21  
A1JJF4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 100 100 98% 5e-21  
Q2GE45.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 89% 6e-21  
B5Y1Z4.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 95% 6e-21  
Q8DND3.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q04II4.1|RSMA_STRP2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 91% 6e-21  
B2IM67.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 91% 6e-21  
A4QCP0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 91% 7e-21  
Q8NRY1.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 91% 7e-21  
Q7NJ41.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.8 99.8 92% 7e-21  
Q3YS70.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 91% 7e-21  
A5IME8.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 89% 8e-21  
Q0S4T6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 96% 8e-21  
B4T6L6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 95% 9e-21  
Q83AC2.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B6J3A6.1|RSMA_COXB2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 99% 9e-21  
Q88QT6.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 98% 9e-21  
A9N9I7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.4 99.4 99% 9e-21  
Q6GJH8.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 89% 1e-20  
A9B9Y0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 92% 1e-20  
Q57TH0.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 95% 1e-20  
A9KGZ8.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 99% 1e-20  
Q8Z9J7.1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q5PDD9.1|RSMA_SALPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9MYM4.1|RSMA_SALPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5F771.1|RSMA_SALA4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5FI34.1|RSMA_SALDC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5R1S8.1|RSMA_SALEP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5RGC2.1|RSMA_SALG2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B4TJ47.1|RSMA_SALHS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5BL27.1|RSMA_SALPK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C0Q5E7.1|RSMA_SALPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 95% 1e-20  



Alignement 2 a 2 entre notre sequence et les 10 sequences trouvees ayant les scores les plus elevees:


>sp|Q823V2.1|RSMA_CHLCV  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=278

 Score =  120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 102/172 (59%), Gaps = 11/172 (6%)

Query  1    YDYSQLTGRWW----ILVSNLPYNIGTRLLVKLITEVPVIHRYV-VMVQKEVAERITAQP  55
            Y  SQL  + W     +V+NLPY+I T LL KL  EVP   + V VM+Q EVA RITAQP
Sbjct  99   YPLSQLEEKGWQGKGRVVANLPYHITTPLLTKLFLEVPNQWKTVTVMMQDEVARRITAQP  158

Query  56   GTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEA--FR  113
            G KEYG+L++    FA  ++ F VS  CF P P+++S+V+ +  +  F  E  L    F 
Sbjct  159  GGKEYGSLTIFLQFFADVRYAFKVSPGCFFPKPQVSSAVVHMTVKETFPLETSLHQKFFS  218

Query  114  LSKIAFQQKRKKVKSALQDFFSVE----ELEQLGINPDDRPQNLSPEQYLEL  161
            L++ AF Q+RK + +AL+D +  E     L QL  +   RP+ LS  +YL+L
Sbjct  219  LTRAAFGQRRKLLANALKDLYPKELVFSALNQLNFSEKTRPETLSLNEYLQL  270


>sp|A1VD65.1|RSMA_DESVV  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=266

 GENE ID: 4664727 ksgA | dimethyladenosine transferase
[Desulfovibrio vulgaris subsp. vulgaris DP4]

 Score =  120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 98/161 (60%), Gaps = 8/161 (4%)

Query  11   WILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLF  70
            W ++ NLPYN+ + L+  + +  P + R   M+QKEV ERI A PG+++YGALSV    F
Sbjct  102  WKVIGNLPYNVASPLMWDICSRAPGLVRASFMIQKEVGERIVAAPGSRQYGALSVWLQCF  161

Query  71   ATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLS---KIAFQQKRKKVK  127
              P+  F V  H F+P PK+ S+V+     T  D  D +++ RL+   ++ FQQ+RK+++
Sbjct  162  TKPEWCFVVPPHVFTPRPKVDSAVLAFTPRT--DRPDAVQSKRLAHVLRLCFQQRRKQLQ  219

Query  128  SALQDFFSVEE---LEQLGINPDDRPQNLSPEQYLELAKSL  165
              L+     +    L +LGI+P  RP+ LSPE+++ L +++
Sbjct  220  GILRPHVGGDASALLAELGIDPAARPETLSPERFIALGEAV  260


>sp|Q72B41.1|RSMA_DESVH  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=266

 GENE ID: 2796706 ksgA | dimethyladenosine transferase
[Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough]
(10 or fewer PubMed links)

 Score =  119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 97/161 (60%), Gaps = 8/161 (4%)

Query  11   WILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLF  70
            W ++ NLPYN+ + L+  + +  P + R   M+QKEV ERI A PG+++YGALSV    F
Sbjct  102  WKVIGNLPYNVASPLMWDICSRAPGLLRASFMIQKEVGERIVAAPGSRQYGALSVWLQCF  161

Query  71   ATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLSKI---AFQQKRKKVK  127
              P+  F V  H F+P PK+ S+V+     T  D  D +++ RL+++    FQQ+RK+++
Sbjct  162  TKPEWCFVVPPHVFTPRPKVDSAVLAFTPRT--DRPDAVQSKRLARVLRLCFQQRRKQLQ  219

Query  128  SALQDFFSVEE---LEQLGINPDDRPQNLSPEQYLELAKSL  165
              L+     +    L  LGI+P  RP+ LSPE+++ L +++
Sbjct  220  GILRPHVGGDASALLAGLGIDPAARPETLSPERFIALGEAV  260


>sp|Q253R6.1|RSMA_CHLFF  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=284

 GENE ID: 3958706 ksgA | dimethyladenosine transferase
[Chlamydophila felis Fe/C-56] (10 or fewer PubMed links)

 Score =  119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 11/177 (6%)

Query  1    YDYSQLTGRWW----ILVSNLPYNIGTRLLVKLITEVPVIHRYV-VMVQKEVAERITAQP  55
            Y  SQL  + W     +V+NLPY+I T LL KL  EVP   + + VM+Q EVA RITAQP
Sbjct  105  YPLSQLQEKGWQGKGRVVANLPYHITTPLLTKLFLEVPNQWKTITVMMQDEVARRITAQP  164

Query  56   GTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEA--FR  113
            G KEYG+L++    FA  ++ F VS  CF P P+++S+V+ +  +  F  E+ L    F 
Sbjct  165  GGKEYGSLTIFLQFFADVRYAFKVSSGCFFPKPQVSSAVVHMTVKDTFPLEESLHKKFFS  224

Query  114  LSKIAFQQKRKKVKSALQDFFSVE----ELEQLGINPDDRPQNLSPEQYLELAKSLN  166
            L++ AF Q+RK + +AL++ +  +     L QL  +   RP+ LS ++YL+L + L+
Sbjct  225  LTRAAFGQRRKLLANALKNLYPKDLVFSALNQLNFSEKTRPETLSLDEYLKLFQLLS  281


>sp|Q1RK29.1|RSMA_RICBR  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=268

 GENE ID: 3995968 ksgA | dimethyladenosine transferase
[Rickettsia bellii RML369-C] (10 or fewer PubMed links)

 Score =  118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 97/162 (59%), Gaps = 3/162 (1%)

Query  4    SQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGAL  63
            S L      ++SNLPY+IGT L+++ + E  ++    +M+QKEV ERI A+P TK YG L
Sbjct  104  SDLNTNKITIISNLPYHIGTELVIRWLKESSLVASMTLMLQKEVVERICAKPSTKAYGRL  163

Query  64   SVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRL-SKIAFQQK  122
            SV+CSL AT +  FDV+   F P PK+ S+++ L         D +    L +K+AF  +
Sbjct  164  SVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLTPLENIPNSDLISKVELITKMAFAGR  223

Query  123  RKKVKSALQDFFS--VEELEQLGINPDDRPQNLSPEQYLELA  162
            RK +KS+L++      E L +L I+ + R +NL+P  YL LA
Sbjct  224  RKMIKSSLKNLAPNISELLAKLNISDNCRAENLTPNDYLSLA  265


>sp|A8GXS7.1|RSMA_RICB8  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=268

 GENE ID: 5646385 ksgA | dimethyladenosine transferase
[Rickettsia bellii OSU 85-389]

 Score =  118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 97/162 (59%), Gaps = 3/162 (1%)

Query  4    SQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGAL  63
            S L      ++SNLPY+IGT L+++ + E  ++    +M+QKEV ERI A+P TK YG L
Sbjct  104  SDLNTNKITIISNLPYHIGTELVIRWLKESSLVASMTLMLQKEVVERICAKPSTKAYGRL  163

Query  64   SVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRL-SKIAFQQK  122
            SV+CSL AT +  FDV+   F P PK+ S+++ L         D +    L +K+AF  +
Sbjct  164  SVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLTPLENIPNSDLISKVELITKMAFAGR  223

Query  123  RKKVKSALQDFFS--VEELEQLGINPDDRPQNLSPEQYLELA  162
            RK +KS+L++      E L +L I+ + R +NL+P  YL LA
Sbjct  224  RKMIKSSLKNLAPNISELLAKLNISNNCRAENLTPNDYLSLA  265


>sp|Q68W66.1|RSMA_RICTY  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=268

 Score =  117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 100/158 (63%), Gaps = 7/158 (4%)

Query  13   LVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLFAT  72
            ++SNLPY+IGT L+++L+ E  +I   ++M+QKEV ERI A P TK YG LSV+C + A 
Sbjct  113  VISNLPYHIGTELVIRLLKEAKLITNMILMLQKEVVERICAMPSTKAYGRLSVICQIVAK  172

Query  73   PKHQFDVSKHCFSPVPKITSS---VITLQRETLFDEEDRLEAFRLSKIAFQQKRKKVKSA  129
             +  FDV+   F P PK+ S+   +I L+        +++E  +++K+ F  +RK +KS+
Sbjct  173  VEKCFDVAPTAFYPHPKVYSAIVKIIPLENPPSIALINKVE--QITKLVFAGRRKMIKSS  230

Query  130  LQDFFSV--EELEQLGINPDDRPQNLSPEQYLELAKSL  165
            L++      E L QL IN +DR +NL+P+ YL +A  L
Sbjct  231  LRNLVPNIHEVLTQLKINNNDRAENLTPKDYLRIAMQL  268


>sp|O05952.1|RSMA_RICPR  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=268

 Score =  115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 100/158 (63%), Gaps = 7/158 (4%)

Query  13   LVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLFAT  72
            ++SNLPY+IGT L+++L+ EV +I    +M+QKEV ERI A P TK YG LSV+C + A 
Sbjct  113  VISNLPYHIGTELVIRLLKEVKLITNMTLMLQKEVVERICAIPSTKAYGRLSVICQILAK  172

Query  73   PKHQFDVSKHCFSPVPKITSS---VITLQRETLFDEEDRLEAFRLSKIAFQQKRKKVKSA  129
             +  F+V+   F P PK+ S+   +I L+        +++E  +++K+ F  +RK +KS+
Sbjct  173  VEKCFNVAPTAFYPHPKVYSAIVKIIPLENPPSIALINKVE--QITKLVFAGRRKMIKSS  230

Query  130  LQDFFSV--EELEQLGINPDDRPQNLSPEQYLELAKSL  165
            L++      E L QL IN +DR +NL+P+ YL +A  L
Sbjct  231  LRNLIPNIHEVLTQLKINCNDRAENLTPKDYLRIAMKL  268


>sp|A8GPG7.1|RSMA_RICAH  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=273

 GENE ID: 5645394 ksgA | dimethyladenosine transferase
[Rickettsia akari str. Hartford]

 Score =  115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 102/170 (60%), Gaps = 12/170 (7%)

Query  2    DYSQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYG  61
            DY ++T     ++SNLPY+IGT L+++ + E  +I    +M+QKEV ERI A P TK YG
Sbjct  107  DYDKVT-----IISNLPYHIGTELVIRWLKEARLITDMTLMLQKEVVERICAMPSTKAYG  161

Query  62   ALSVVCSLFATPKHQFDVSKHCFSPVPKITSSV---ITLQRETLFDEEDRLEAFRLSKIA  118
             LSV+C L A  +  FDVS   F P PK+ S++   I L         +R+E  +++  A
Sbjct  162  RLSVICQLIAKVEKCFDVSPTAFYPPPKVYSAIVKLIPLANPPSIALINRVE--KITTFA  219

Query  119  FQQKRKKVKSALQDFFSV--EELEQLGINPDDRPQNLSPEQYLELAKSLN  166
            F  +RK +KS+L++      E L QL IN + R +NL+P+ YL +A SL+
Sbjct  220  FAGRRKMIKSSLKNLVPNIHEVLTQLKINDNYRAENLAPQDYLRIAMSLS  269


>sp|A8EZN3.1|RSMA_RICCK  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
Length=270

 GENE ID: 5626389 ksgA | dimethyladenosine transferase
[Rickettsia canadensis str. McKiel]

 Score =  115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 97/153 (63%), Gaps = 3/153 (1%)

Query  13   LVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLFAT  72
            ++SNLPY+IGT L+++ + E  +I    +M+QKE+ ERI A P TK YG LSV+C L A 
Sbjct  113  IISNLPYHIGTELVIRWLKEARLITSMTLMLQKELVERICAMPSTKAYGRLSVICQLIAK  172

Query  73   PKHQFDVSKHCFSPVPKITSSVITLQ-RETLFDEEDRLEAFRLSKIAFQQKRKKVKSALQ  131
             +  F+V+   F P PK+ S+++ L   E L       +  +++K+AF  +RK +KS+L+
Sbjct  173  VEKCFEVAPTAFYPPPKVYSAIVKLTPLENLPSIALITKVEQITKLAFAGRRKMIKSSLK  232

Query  132  DFFSV--EELEQLGINPDDRPQNLSPEQYLELA  162
            +F  V  E L QL IN + R +NL+P+ YL +A
Sbjct  233  NFVPVKNEVLTQLNINDNYRAENLTPQDYLMIA  265



2)Blast contre Nr:

Accession Description Max score  Total score  Query coverage  E value  Links 
EES53737.1 dimethyladenosine transferase [Leptospirillum ferrodiazotrophum] 129 129 95% 1e-28  
NP_829174.1 dimethyladenosine transferase [Chlamydophila caviae GPIC] >sp|Q823V2.1|RSMA_CHLCV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAP05052.1| dimethyladenosine transferase [Chlamydophila caviae GPIC] 120 120 96% 5e-26  
ZP_04791089.1 dimethyladenosine transferase [Desulfovibrio vulgaris RCH1] >gb|EER80545.1| dimethyladenosine transferase [Desulfovibrio vulgaris RCH1] 120 120 92% 7e-26  
YP_966808.1 dimethyladenosine transferase [Desulfovibrio vulgaris subsp. vulgaris DP4] >sp|A1VD65.1|RSMA_DESVV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM28381.1| dimethyladenosine transferase [Desulfovibrio vulgaris DP4] 120 120 92% 7e-26  
YP_011015.1 dimethyladenosine transferase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >sp|Q72B41.1|RSMA_DESVH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAS96274.1| dimethyladenosine transferase [Desulfovibrio vulgaris str. Hildenborough] 119 119 92% 8e-26  
YP_515617.1 dimethyladenosine transferase [Chlamydophila felis Fe/C-56] >sp|Q253R6.1|RSMA_CHLFF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE81472.1| dimethyladenosine transferase [Chlamydophila felis Fe/C-56] 119 119 99% 1e-25  
YP_537374.1 dimethyladenosine transferase [Rickettsia bellii RML369-C] >sp|Q1RK29.1|RSMA_RICBR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABE04285.1| Dimethyladenosine transferase [Rickettsia bellii RML369-C] 118 118 95% 2e-25  
YP_001496714.1 dimethyladenosine transferase [Rickettsia bellii OSU 85-389] >sp|A8GXS7.1|RSMA_RICB8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV79677.1| dimethyladenosine transferase [Rickettsia bellii OSU 85-389] 118 118 95% 2e-25  
ACT68006.1 dimethyladenosine transferase [Chlamydophila psittaci 6BC] 117 117 99% 3e-25  
YP_067608.1 dimethyladenosine transferase [Rickettsia typhi str. Wilmington] >sp|Q68W66.1|RSMA_RICTY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAU04126.1| dimethyladenosine transferase [Rickettsia typhi str. Wilmington] 117 117 91% 4e-25  
YP_002434926.1 dimethyladenosine transferase [Desulfovibrio vulgaris str. 'Miyazaki F'] >gb|ACL07458.1| dimethyladenosine transferase [Desulfovibrio vulgaris str. 'Miyazaki F'] 117 117 99% 5e-25  
NP_221033.1 dimethyladenosine transferase [Rickettsia prowazekii str. Madrid E] >sp|O05952.1|RSMA_RICPR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAA72482.1| dimethyladenosine transferase [Rickettsia prowazekii] >emb|CAA15109.1| DIMETHYLADENOSINE TRANSFERASE (ksgA) [Rickettsia prowazekii] >gb|ADE30218.1| Dimethyladenosine transferase [Rickettsia prowazekii Rp22] 115 115 91% 1e-24  
YP_001493800.1 dimethyladenosine transferase [Rickettsia akari str. Hartford] >sp|A8GPG7.1|RSMA_RICAH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV75292.1| dimethyladenosine transferase [Rickettsia akari str. Hartford] 115 115 98% 1e-24  
ZP_03736278.1 dimethyladenosine transferase [Desulfonatronospira thiodismutans ASO3-1] >gb|EEG82044.1| dimethyladenosine transferase [Desulfonatronospira thiodismutans ASO3-1] 115 115 98% 2e-24  
YP_001492601.1 dimethyladenosine transferase [Rickettsia canadensis str. McKiel] >sp|A8EZN3.1|RSMA_RICCK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV73816.1| dimethyladenosine transferase [Rickettsia canadensis str. McKiel] 115 115 89% 2e-24  
YP_219717.1 dimethyladenosine transferase [Chlamydophila abortus S26/3] >sp|Q5L6H5.1|RSMA_CHLAB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH63750.1| dimethyladenosine transferase [Chlamydophila abortus S26/3] 115 115 96% 2e-24  
XP_002408487.1 ribosomal RNA adenine dimethylase, putative [Ixodes scapularis] >gb|EEC02116.1| ribosomal RNA adenine dimethylase, putative [Ixodes scapularis] 114 114 91% 3e-24  
ZP_04698771.1 dimethyladenosine transferase [Rickettsia endosymbiont of Ixodes scapularis] >gb|EER21318.1| dimethyladenosine transferase [Rickettsia endosymbiont of Ixodes scapularis] 114 114 91% 4e-24  
ZP_06300350.1 hypothetical protein pah_c200o016 [Parachlamydia acanthamoebae str. Hall's coccus] >gb|EFB40471.1| hypothetical protein pah_c200o016 [Parachlamydia acanthamoebae str. Hall's coccus] 113 113 92% 7e-24  
YP_866231.1 dimethyladenosine transferase [Magnetococcus sp. MC-1] >sp|A0LA32.1|RSMA_MAGSM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK44825.1| dimethyladenosine transferase [Magnetococcus sp. MC-1] 113 113 97% 7e-24  
YP_001495118.1 dimethyladenosine transferase [Rickettsia rickettsii str. 'Sheila Smith'] >sp|A8GT85.1|RSMA_RICRS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV76610.1| dimethyladenosine transferase [Rickettsia rickettsii str. 'Sheila Smith'] 113 113 97% 8e-24  
YP_002887973.1 dimethyladenosine transferase [Chlamydia trachomatis B/Jali20/OT] >emb|CAX10806.1| dimethyladenosine transferase [Chlamydia trachomatis B/Jali20/OT] 113 113 96% 8e-24  
YP_001650392.1 dimethyladenosine transferase [Rickettsia rickettsii str. Iowa] >gb|ABY72986.1| dimethyladenosine transferase [Rickettsia rickettsii str. Iowa] 113 113 97% 8e-24  
NP_360659.1 dimethyladenosine transferase [Rickettsia conorii str. Malish 7] >gb|AAL03560.1| dimethyladenosine transferase [Rickettsia conorii str. Malish 7] 113 113 91% 9e-24  
ZP_05826333.1 dimethyladenosine transferase [Acinetobacter sp. RUH2624] >gb|EEW98316.1| dimethyladenosine transferase [Acinetobacter sp. RUH2624] 112 112 98% 9e-24  
YP_594897.1 dimethyladenosine transferase [Lawsonia intracellularis PHE/MN1-00] >sp|Q1MR01.1|RSMA_LAWIP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAJ54575.1| rRNA (adenine-N6,N6)-dimethyltransferase [Lawsonia intracellularis PHE/MN1-00] 112 112 97% 1e-23  
YP_001499644.1 dimethyladenosine transferase [Rickettsia massiliae MTU5] >gb|ABV85097.1| Dimethyladenosine transferase [Rickettsia massiliae MTU5] 112 112 91% 1e-23  
YP_001086001.1 S-adenosylmethionine-6-N'N'-adenosyl [Acinetobacter baumannii ATCC 17978] 112 112 98% 1e-23  
Q92GV0.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 91% 1e-23  
ZP_00142835.1 dimethyladenosine transferase [Rickettsia sibirica 246] >gb|EAA26244.1| dimethyladenosine transferase [Rickettsia sibirica 246] 112 112 91% 1e-23  
YP_001708028.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii SDF] >ref|YP_001712466.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii AYE] >ref|YP_001847856.1| dimethyladenosine transferase (rRNA methylation) [Acinetobacter baumannii ACICU] >ref|YP_002320753.1| dimethyladenosine transferase [Acinetobacter baumannii AB0057] >ref|ZP_04663438.1| dimethyladenosine transferase [Acinetobacter baumannii AB900] >ref|ZP_05830330.1| dimethyladenosine transferase [Acinetobacter baumannii ATCC 19606] >emb|CAM85461.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii] >emb|CAP02154.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii] >gb|ACC58509.1| Dimethyladenosine transferase (rRNA methylation) [Acinetobacter baumannii ACICU] >gb|ABO13399.2| S-adenosylmethionine-6-N'N'-adenosyl [Acinetobacter baumannii ATCC 17978] >gb|ACJ42017.1| dimethyladenosine transferase [Acinetobacter baumannii AB0057] >gb|EEX01701.1| dimethyladenosine transferase [Acinetobacter baumannii ATCC 19606] 112 112 98% 2e-23  
NP_877372.1 dimethyladenosine transferase [Chlamydophila pneumoniae TW-183] >gb|AAP99029.1| dimethyladenosine transferase [Chlamydophila pneumoniae TW-183] 112 112 89% 2e-23  
ACZ32958.1 dimethyladenosine transferase [Chlamydophila pneumoniae LPCoLN] 112 112 89% 2e-23  
YP_002916844.1 dimethyladenosine transferase [Rickettsia peacockii str. Rustic] >sp|C4K2J5.1|RSMA_RICPU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACR47792.1| dimethyladenosine transferase [Rickettsia peacockii str. Rustic] 112 112 91% 2e-23  
ZP_06059366.1 dimethyladenosine transferase [Acinetobacter calcoaceticus RUH2202] >gb|EEY75704.1| dimethyladenosine transferase [Acinetobacter calcoaceticus RUH2202] 112 112 98% 2e-23  
ZP_05353729.1 dimethyladenosine transferase [Chlamydia trachomatis 6276] >ref|ZP_05358706.1| dimethyladenosine transferase [Chlamydia trachomatis 6276s] 112 112 96% 2e-23  
NP_219862.1 dimethyladenosine transferase [Chlamydia trachomatis D/UW-3/CX] >ref|YP_328166.1| dimethyladenosine transferase [Chlamydia trachomatis A/HAR-13] >ref|YP_001654684.1| dimethyladenosine transferase [Chlamydia trachomatis 434/Bu] >ref|YP_001653696.1| dimethyladenosine transferase [Chlamydia trachomatis L2b/UCH-1/proctitis] >sp|O84358.1|RSMA_CHLTR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q3KM04.1|RSMA_CHLTA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0B7S3.1|RSMA_CHLT2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0BBY8.1|RSMA_CHLTB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAC67949.1| Dimethyladenosine Transferase [Chlamydia trachomatis D/UW-3/CX] >gb|AAX50618.1| dimethyladenosine transferase [Chlamydia trachomatis A/HAR-13] >emb|CAP04049.1| dimethyladenosine transferase [Chlamydia trachomatis 434/Bu] >emb|CAP07003.1| dimethyladenosine transferase [Chlamydia trachomatis L2b/UCH-1/proctitis] 112 112 96% 2e-23  
ZP_05382575.1 dimethyladenosine transferase [Chlamydia trachomatis D(s)2923] >emb|CBJ14872.1| dimethyladenosine transferase [Chlamydia trachomatis Sweden2] 111 111 96% 2e-23  
ZP_05380725.1 dimethyladenosine transferase [Chlamydia trachomatis 70] >ref|ZP_05381648.1| dimethyladenosine transferase [Chlamydia trachomatis 70s] 111 111 96% 2e-23  
YP_643671.1 dimethyladenosine transferase [Rubrobacter xylanophilus DSM 9941] >sp|Q1AXL9.1|RSMA_RUBXD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG03859.1| dimethyladenosine transferase [Rubrobacter xylanophilus DSM 9941] 111 111 99% 3e-23  
NP_225253.1 dimethyladenosine transferase [Chlamydophila pneumoniae CWL029] >ref|NP_301114.1| dimethyladenosine transferase [Chlamydophila pneumoniae J138] >ref|NP_445330.1| dimethyladenosine transferase [Chlamydophila pneumoniae AR39] >sp|Q9Z6K0.1|RSMA_CHLPN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAD19196.1| Dimethyladenosine Transferase [Chlamydophila pneumoniae CWL029] >gb|AAF38590.1| dimethyladenosine transferase [Chlamydophila pneumoniae AR39] >dbj|BAA99266.1| dimethyladenosine transferase [Chlamydophila pneumoniae J138] 111 111 89% 3e-23  
ZP_03936706.1 possible dimethyladenosine transferase [Gardnerella vaginalis ATCC 14019] >gb|EEJ44482.1| possible dimethyladenosine transferase [Gardnerella vaginalis ATCC 14019] 110 110 92% 4e-23  
YP_003467708.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Xenorhabdus bovienii SS-2004] >emb|CBJ80928.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Xenorhabdus bovienii SS-2004] 110 110 98% 4e-23  
ZP_04722563.1 dimethyladenosine transferase [Neisseria gonorrhoeae FA6140] 110 110 98% 4e-23  
EFF84600.1 conserved hypothetical protein [Acinetobacter sp. SH024] 110 110 98% 4e-23  
ZP_03319325.1 hypothetical protein PROVALCAL_02269 [Providencia alcalifaciens DSM 30120] >gb|EEB45893.1| hypothetical protein PROVALCAL_02269 [Providencia alcalifaciens DSM 30120] 110 110 98% 5e-23  
YP_002845526.1 Dimethyladenosine transferase [Rickettsia africae ESF-5] >sp|C3PPC3.1|RSMA_RICAE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACP53783.1| Dimethyladenosine transferase [Rickettsia africae ESF-5] 110 110 91% 5e-23  
ZP_05320141.1 dimethyladenosine transferase [Neisseria sicca ATCC 29256] >gb|EET42942.1| dimethyladenosine transferase [Neisseria sicca ATCC 29256] 110 110 98% 5e-23  
ZP_06124799.1 dimethyladenosine transferase [Providencia rettgeri DSM 1131] >gb|EFE54419.1| dimethyladenosine transferase [Providencia rettgeri DSM 1131] 110 110 98% 5e-23  
YP_847420.1 dimethyladenosine transferase [Syntrophobacter fumaroxidans MPOB] >gb|ABK18985.1| dimethyladenosine transferase [Syntrophobacter fumaroxidans MPOB] 110 110 98% 6e-23  
ZP_05976598.1 dimethyladenosine transferase [Neisseria mucosa ATCC 25996] >gb|EFC89841.1| dimethyladenosine transferase [Neisseria mucosa ATCC 25996] 110 110 98% 6e-23  
ZP_06070692.1 dimethyladenosine transferase [Acinetobacter lwoffii SH145] >gb|EEY88667.1| dimethyladenosine transferase [Acinetobacter lwoffii SH145] 110 110 98% 6e-23  
NP_273739.1 dimethyladenosine transferase [Neisseria meningitidis MC58] >sp|Q9K0B7.1|RSMA_NEIMB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAF41114.1| dimethyladenosine transferase [Neisseria meningitidis MC58] 110 110 98% 7e-23  
YP_974740.1 dimethyladenosine transferase [Neisseria meningitidis FAM18] >sp|A1KSW0.1|RSMA_NEIMF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAM09941.1| putative dimethyladenosine transferase [Neisseria meningitidis FAM18] 110 110 98% 7e-23  
ZP_05109537.1 dimethyladenosine transferase [Legionella drancourtii LLAP12] >gb|EET12774.1| dimethyladenosine transferase [Legionella drancourtii LLAP12] 109 109 97% 9e-23  
NP_108091.1 dimethyladenosine transferase [Mesorhizobium loti MAFF303099] >sp|Q984S7.1|RSMA_RHILO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB54236.1| dimethyladenosine transferase [Mesorhizobium loti MAFF303099] 109 109 91% 1e-22  
CBA09163.1 dimethyladenosine transferase [Neisseria meningitidis serogroup W135] 109 109 98% 1e-22  
YP_003198763.1 dimethyladenosine transferase [Desulfohalobium retbaense DSM 5692] >gb|ACV69185.1| dimethyladenosine transferase [Desulfohalobium retbaense DSM 5692] 109 109 91% 1e-22  
ZP_06230954.1 dimethyladenosine transferase [Desulfovibrio aespoeensis Aspo-2] >gb|EFA67610.1| dimethyladenosine transferase [Desulfovibrio aespoeensis Aspo-2] 109 109 89% 1e-22  
ZP_05496061.1 dimethyladenosine transferase [Clostridium papyrosolvens DSM 2782] >gb|EEU58980.1| dimethyladenosine transferase [Clostridium papyrosolvens DSM 2782] 109 109 89% 1e-22  
ZP_03718812.1 hypothetical protein NEIFLAOT_00629 [Neisseria flavescens NRL30031/H210] >gb|EEG34244.1| hypothetical protein NEIFLAOT_00629 [Neisseria flavescens NRL30031/H210] 109 109 98% 1e-22  
ZP_05104558.1 dimethyladenosine transferase [Methylophaga thiooxidans DMS010] >gb|EEF79127.1| dimethyladenosine transferase [Methylophaga thiooxidans DMS010] 109 109 98% 1e-22  
ZP_06186932.1 dimethyladenosine transferase [Legionella longbeachae D-4968] >ref|YP_003453607.1| dimethyladenosine transferase (16S rRNA dimethylase) [Legionella longbeachae NSW150] >gb|EEZ96554.1| dimethyladenosine transferase [Legionella longbeachae D-4968] >emb|CBJ10453.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Legionella longbeachae NSW150] 109 109 97% 1e-22  
YP_002888855.1 dimethyladenosine transferase [Chlamydia trachomatis B/TZ1A828/OT] >emb|CAX09913.1| dimethyladenosine transferase [Chlamydia trachomatis B/TZ1A828/OT] 108 108 96% 1e-22  
YP_001223113.1 dimethyladenosine transferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >emb|CAN02443.1| putative dimethyladenosine transferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] 108 108 96% 1e-22  
EFE49659.1 hypothetical protein NEIELOOT_01401 [Neisseria elongata subsp. glycolytica ATCC 29315] 108 108 98% 1e-22  
YP_002342332.1 dimethyladenosine transferase [Neisseria meningitidis Z2491] >ref|YP_003082802.1| dimethyladenosine transferase [Neisseria meningitidis alpha14] >sp|Q9JVC2.1|RSMA_NEIMA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAM08134.1| putative dimethyladenosine transferase [Neisseria meningitidis Z2491] >emb|CBA04707.1| dimethyladenosine transferase [Neisseria meningitidis] 108 108 98% 2e-22  
YP_003361637.1 KsgA Dimethyladenosine transferase [Bifidobacterium dentium Bd1] >gb|ADB10813.1| KsgA Dimethyladenosine transferase [Bifidobacterium dentium Bd1] 108 108 93% 2e-22  
ZP_05982467.1 dimethyladenosine transferase [Neisseria cinerea ATCC 14685] >gb|EEZ72166.1| dimethyladenosine transferase [Neisseria cinerea ATCC 14685] 108 108 98% 2e-22  
CBA06283.1 dimethyladenosine transferase [Neisseria meningitidis alpha153] 108 108 98% 2e-22  
YP_002001040.1 dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11945] >ref|ZP_04718383.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >ref|ZP_04720497.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI18] >ref|ZP_04724707.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >ref|ZP_04729180.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID18] >ref|ZP_04731463.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID1] >ref|ZP_04733615.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID24-1] >ref|ZP_04735914.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID332] >ref|ZP_04738095.1| dimethyladenosine transferase [Neisseria gonorrhoeae SK-92-679] >ref|ZP_04740325.1| dimethyladenosine transferase [Neisseria gonorrhoeae SK-93-1035] >ref|ZP_05794881.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] >ref|ZP_06128487.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >ref|ZP_06130482.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >ref|ZP_06134960.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID18] >ref|ZP_06137265.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID1] >ref|ZP_06148441.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID332] >ref|ZP_06150669.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-92-679] >ref|ZP_06152911.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-93-1035] >ref|ZP_06570107.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] >sp|B4RJV5.1|RSMA_NEIG2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACF29106.1| putative dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11945] >gb|ACJ23027.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23028.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23029.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23030.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23031.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23032.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23034.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23035.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23036.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23037.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23038.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23039.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23040.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23041.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23042.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23043.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23044.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23045.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23046.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23047.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23048.1| KsgA [Neisseria gonorrhoeae] >gb|EEZ43127.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >gb|EEZ45122.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >gb|EEZ49600.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID18] >gb|EEZ51905.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID1] >gb|EEZ54263.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID332] >gb|EEZ56491.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-92-679] >gb|EEZ58733.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-93-1035] >gb|EFE03288.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] 108 108 98% 2e-22  
YP_752782.1 rRNA (adenine-N(6)-)-methyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gb|ABI67411.1| dimethyladenosine transferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] 108 108 92% 2e-22  
ZP_04758011.1 dimethyladenosine transferase [Neisseria flavescens SK114] >gb|EER56315.1| dimethyladenosine transferase [Neisseria flavescens SK114] 108 108 98% 2e-22  
YP_277643.1 dimethyladenosine transferase [Candidatus Blochmannia pennsylvanicus str. BPEN] >sp|Q493R7.1|RSMA_BLOPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ40770.1| dimethyladenosine transferase [Candidatus Blochmannia pennsylvanicus str. BPEN] 108 108 99% 2e-22  
ZP_02917557.1 hypothetical protein BIFDEN_00841 [Bifidobacterium dentium ATCC 27678] >gb|EDT45025.1| hypothetical protein BIFDEN_00841 [Bifidobacterium dentium ATCC 27678] 108 108 93% 2e-22  
YP_001710974.1 dimethyladenosine transferase [Clavibacter michiganensis subsp. sepedonicus] >emb|CAQ02393.1| putative dimethyladenosine transferase (drug resistance) [Clavibacter michiganensis subsp. sepedonicus] 108 108 96% 2e-22  
ZP_06607867.1 dimethyladenosine transferase [Actinomyces odontolyticus F0309] >gb|EFF80919.1| dimethyladenosine transferase [Actinomyces odontolyticus F0309] 108 108 91% 2e-22  
ZP_05360849.1 dimethyladenosine transferase [Acinetobacter radioresistens SK82] >ref|ZP_06072170.1| dimethyladenosine transferase [Acinetobacter radioresistens SH164] >gb|EET82530.1| dimethyladenosine transferase [Acinetobacter radioresistens SK82] >gb|EEY88210.1| dimethyladenosine transferase [Acinetobacter radioresistens SH164] 108 108 98% 2e-22  
YP_047537.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter sp. ADP1] >sp|Q6F8A0.1|RSMA_ACIAD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAG69715.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter sp. ADP1] 108 108 98% 2e-22  
NP_758420.1 dimethyladenosine transferase [Mycoplasma penetrans HF-2] >sp|Q8EU92.1|RSMA_MYCPE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC44824.1| dimethyladenosine transferase [Mycoplasma penetrans HF-2] 108 108 97% 2e-22  
YP_003180103.1 dimethyladenosine transferase [Atopobium parvulum DSM 20469] >gb|ACV51512.1| dimethyladenosine transferase [Atopobium parvulum DSM 20469] 108 108 91% 2e-22  
ACJ23053.1 KsgA [Neisseria gonorrhoeae] 108 108 98% 3e-22  
ACJ23051.1 KsgA [Neisseria gonorrhoeae] 107 107 98% 3e-22  
YP_003135044.1 dimethyladenosine transferase [Saccharomonospora viridis DSM 43017] >gb|ACU98217.1| dimethyladenosine transferase [Saccharomonospora viridis DSM 43017] 107 107 91% 3e-22  
ABU50801.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Acinetobacter venetianus] 107 107 98% 3e-22  
YP_113120.1 dimethyladenosine transferase [Methylococcus capsulatus str. Bath] >sp|Q60B77.1|RSMA_METCA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAU93125.1| dimethyladenosine transferase [Methylococcus capsulatus str. Bath] 107 107 95% 3e-22  
ACJ23050.1 KsgA [Neisseria gonorrhoeae] 107 107 98% 3e-22  
YP_207435.1 dimethyladenosine transferase [Neisseria gonorrhoeae FA 1090] >ref|ZP_06643731.1| dimethyladenosine transferase [Neisseria gonorrhoeae F62] >sp|Q5F9W4.1|RSMA_NEIG1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAW89023.1| putative dimethyladenosine transferase [Neisseria gonorrhoeae FA 1090] >gb|EFF39269.1| dimethyladenosine transferase [Neisseria gonorrhoeae F62] 107 107 98% 3e-22  
ACJ23049.1 KsgA [Neisseria gonorrhoeae] 107 107 98% 3e-22  
ZP_04726868.1 dimethyladenosine transferase [Neisseria gonorrhoeae MS11] >ref|ZP_05106350.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae 1291] >ref|ZP_06132606.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae MS11] >gb|ACJ23033.1| KsgA [Neisseria gonorrhoeae] >gb|EEH61564.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae 1291] >gb|EEZ47246.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae MS11] 107 107 98% 3e-22  
ACJ23052.1 KsgA [Neisseria gonorrhoeae] 107 107 98% 3e-22  
YP_960764.1 dimethyladenosine transferase [Marinobacter aquaeolei VT8] >sp|A1U6F8.1|RSMA_MARAV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM20577.1| dimethyladenosine transferase [Marinobacter aquaeolei VT8] 107 107 98% 4e-22  
YP_739156.1 dimethyladenosine transferase [Shewanella sp. MR-7] >sp|Q0HS06.1|RSMA_SHESR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI44099.1| dimethyladenosine transferase [Shewanella sp. MR-7] 107 107 97% 4e-22  
YP_870839.1 dimethyladenosine transferase [Shewanella sp. ANA-3] >sp|A0L064.1|RSMA_SHESA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK49433.1| dimethyladenosine transferase [Shewanella sp. ANA-3] 107 107 97% 4e-22  
ZP_05986505.1 dimethyladenosine transferase [Neisseria lactamica ATCC 23970] >gb|EEZ76271.1| dimethyladenosine transferase [Neisseria lactamica ATCC 23970] 107 107 98% 4e-22  
ZP_05707698.1 dimethyladenosine transferase [Corynebacterium genitalium ATCC 33030] >gb|EEV91063.1| dimethyladenosine transferase [Corynebacterium genitalium ATCC 33030] 107 107 96% 4e-22  
ZP_05845733.1 dimethyladenosine transferase [Corynebacterium jeikeium ATCC 43734] >gb|EEW17269.1| dimethyladenosine transferase [Corynebacterium jeikeium ATCC 43734] 107 107 91% 5e-22  
ZP_06064920.1 dimethyladenosine transferase [Acinetobacter junii SH205] >gb|EEY92751.1| dimethyladenosine transferase [Acinetobacter junii SH205] 107 107 98% 5e-22  
ZP_04446747.1 hypothetical protein COLINT_03499 [Collinsella intestinalis DSM 13280] >gb|EEP43789.1| hypothetical protein COLINT_03499 [Collinsella intestinalis DSM 13280] 107 107 96% 5e-22  
YP_003203824.1 dimethyladenosine transferase [Nakamurella multipartita DSM 44233] >gb|ACV80835.1| dimethyladenosine transferase [Nakamurella multipartita DSM 44233] 107 107 91% 5e-22  


Alignement 2 a 2 entre notre sequence et les 10 sequences trouvees ayant les scores les plus elevees:

>gb|EES53737.1|  dimethyladenosine transferase [Leptospirillum ferrodiazotrophum]
Length=284

 Score =  129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 101/167 (60%), Gaps = 7/167 (4%)

Query  6    LTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSV  65
            L G  ++++SNLPYNI   LL+K+I   P     V+M QKEVAERITA  G+K+YG+LSV
Sbjct  105  LEGSPYLVISNLPYNISVPLLLKIIGGTPPPLMAVLMFQKEVAERITAPAGSKDYGSLSV  164

Query  66   VCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLSKIAFQQKRKK  125
               L +TP+H FD+    F+P PK+ SSV++        +     AF L++ AF  +RK 
Sbjct  165  AARLLSTPRHLFDIRPGSFTPPPKVQSSVLSFVPAETRADPSLPGAFHLARAAFAYRRKT  224

Query  126  VKSALQDFFSVE-------ELEQLGINPDDRPQNLSPEQYLELAKSL  165
            +K+AL+   S E        +E L    D RP+NLSPE +L LA++L
Sbjct  225  LKNALKQGLSPEIVEAVSPLVEALPQGSDCRPENLSPEDWLFLARTL  271


>ref|NP_829174.1|  dimethyladenosine transferase [Chlamydophila caviae GPIC]
 sp|Q823V2.1|RSMA_CHLCV  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|AAP05052.1|  dimethyladenosine transferase [Chlamydophila caviae GPIC]
Length=278

 GENE ID: 1217988 ksgA | dimethyladenosine transferase
[Chlamydophila caviae GPIC] (10 or fewer PubMed links)

 Score =  120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 102/172 (59%), Gaps = 11/172 (6%)

Query  1    YDYSQLTGRWW----ILVSNLPYNIGTRLLVKLITEVPVIHRYV-VMVQKEVAERITAQP  55
            Y  SQL  + W     +V+NLPY+I T LL KL  EVP   + V VM+Q EVA RITAQP
Sbjct  99   YPLSQLEEKGWQGKGRVVANLPYHITTPLLTKLFLEVPNQWKTVTVMMQDEVARRITAQP  158

Query  56   GTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEA--FR  113
            G KEYG+L++    FA  ++ F VS  CF P P+++S+V+ +  +  F  E  L    F 
Sbjct  159  GGKEYGSLTIFLQFFADVRYAFKVSPGCFFPKPQVSSAVVHMTVKETFPLETSLHQKFFS  218

Query  114  LSKIAFQQKRKKVKSALQDFFSVE----ELEQLGINPDDRPQNLSPEQYLEL  161
            L++ AF Q+RK + +AL+D +  E     L QL  +   RP+ LS  +YL+L
Sbjct  219  LTRAAFGQRRKLLANALKDLYPKELVFSALNQLNFSEKTRPETLSLNEYLQL  270


>ref|ZP_04791089.1|  dimethyladenosine transferase [Desulfovibrio vulgaris RCH1]
 gb|EER80545.1|  dimethyladenosine transferase [Desulfovibrio vulgaris RCH1]
Length=300

 Score =  120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 97/161 (60%), Gaps = 8/161 (4%)

Query  11   WILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLF  70
            W ++ NLPYN+ + L+  + +  P + R   M+QKEV ERI A PG+++YGALSV    F
Sbjct  136  WKVIGNLPYNVASPLMWDICSRAPGLLRASFMIQKEVGERIVAAPGSRQYGALSVWLQCF  195

Query  71   ATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLSKI---AFQQKRKKVK  127
              P+  F V  H F+P PK+ S+V+     T  D  D +++ RL+++    FQQ+RK+++
Sbjct  196  TKPEWCFVVPPHVFTPRPKVDSAVLAFTPRT--DRPDAVQSKRLARVLRLCFQQRRKQLQ  253

Query  128  SALQDFFSVEE---LEQLGINPDDRPQNLSPEQYLELAKSL  165
              L+     +    L  LGI+P  RP+ LSPE+++ L +++
Sbjct  254  GILRPHVGGDASALLAGLGIDPAARPETLSPERFIALGEAV  294


>ref|YP_966808.1|  dimethyladenosine transferase [Desulfovibrio vulgaris subsp. 
vulgaris DP4]
 sp|A1VD65.1|RSMA_DESVV  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|ABM28381.1|  dimethyladenosine transferase [Desulfovibrio vulgaris DP4]
Length=266

 GENE ID: 4664727 ksgA | dimethyladenosine transferase
[Desulfovibrio vulgaris subsp. vulgaris DP4]

 Score =  120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 98/161 (60%), Gaps = 8/161 (4%)

Query  11   WILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLF  70
            W ++ NLPYN+ + L+  + +  P + R   M+QKEV ERI A PG+++YGALSV    F
Sbjct  102  WKVIGNLPYNVASPLMWDICSRAPGLVRASFMIQKEVGERIVAAPGSRQYGALSVWLQCF  161

Query  71   ATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLS---KIAFQQKRKKVK  127
              P+  F V  H F+P PK+ S+V+     T  D  D +++ RL+   ++ FQQ+RK+++
Sbjct  162  TKPEWCFVVPPHVFTPRPKVDSAVLAFTPRT--DRPDAVQSKRLAHVLRLCFQQRRKQLQ  219

Query  128  SALQDFFSVEE---LEQLGINPDDRPQNLSPEQYLELAKSL  165
              L+     +    L +LGI+P  RP+ LSPE+++ L +++
Sbjct  220  GILRPHVGGDASALLAELGIDPAARPETLSPERFIALGEAV  260


>ref|YP_011015.1|  dimethyladenosine transferase [Desulfovibrio vulgaris subsp. 
vulgaris str. Hildenborough]
 sp|Q72B41.1|RSMA_DESVH  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|AAS96274.1|  dimethyladenosine transferase [Desulfovibrio vulgaris str. Hildenborough]
Length=266

 GENE ID: 2796706 ksgA | dimethyladenosine transferase
[Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough]
(10 or fewer PubMed links)

 Score =  119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 97/161 (60%), Gaps = 8/161 (4%)

Query  11   WILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLF  70
            W ++ NLPYN+ + L+  + +  P + R   M+QKEV ERI A PG+++YGALSV    F
Sbjct  102  WKVIGNLPYNVASPLMWDICSRAPGLLRASFMIQKEVGERIVAAPGSRQYGALSVWLQCF  161

Query  71   ATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRLSKI---AFQQKRKKVK  127
              P+  F V  H F+P PK+ S+V+     T  D  D +++ RL+++    FQQ+RK+++
Sbjct  162  TKPEWCFVVPPHVFTPRPKVDSAVLAFTPRT--DRPDAVQSKRLARVLRLCFQQRRKQLQ  219

Query  128  SALQDFFSVEE---LEQLGINPDDRPQNLSPEQYLELAKSL  165
              L+     +    L  LGI+P  RP+ LSPE+++ L +++
Sbjct  220  GILRPHVGGDASALLAGLGIDPAARPETLSPERFIALGEAV  260


>ref|YP_515617.1|  dimethyladenosine transferase [Chlamydophila felis Fe/C-56]
 sp|Q253R6.1|RSMA_CHLFF  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 dbj|BAE81472.1|  dimethyladenosine transferase [Chlamydophila felis Fe/C-56]
Length=284

 GENE ID: 3958706 ksgA | dimethyladenosine transferase
[Chlamydophila felis Fe/C-56] (10 or fewer PubMed links)

 Score =  119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 11/177 (6%)

Query  1    YDYSQLTGRWW----ILVSNLPYNIGTRLLVKLITEVPVIHRYV-VMVQKEVAERITAQP  55
            Y  SQL  + W     +V+NLPY+I T LL KL  EVP   + + VM+Q EVA RITAQP
Sbjct  105  YPLSQLQEKGWQGKGRVVANLPYHITTPLLTKLFLEVPNQWKTITVMMQDEVARRITAQP  164

Query  56   GTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEA--FR  113
            G KEYG+L++    FA  ++ F VS  CF P P+++S+V+ +  +  F  E+ L    F 
Sbjct  165  GGKEYGSLTIFLQFFADVRYAFKVSSGCFFPKPQVSSAVVHMTVKDTFPLEESLHKKFFS  224

Query  114  LSKIAFQQKRKKVKSALQDFFSVE----ELEQLGINPDDRPQNLSPEQYLELAKSLN  166
            L++ AF Q+RK + +AL++ +  +     L QL  +   RP+ LS ++YL+L + L+
Sbjct  225  LTRAAFGQRRKLLANALKNLYPKDLVFSALNQLNFSEKTRPETLSLDEYLKLFQLLS  281


>ref|YP_537374.1|  dimethyladenosine transferase [Rickettsia bellii RML369-C]
 sp|Q1RK29.1|RSMA_RICBR  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|ABE04285.1|  Dimethyladenosine transferase [Rickettsia bellii RML369-C]
Length=268

 GENE ID: 3995968 ksgA | dimethyladenosine transferase
[Rickettsia bellii RML369-C] (10 or fewer PubMed links)

 Score =  118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 97/162 (59%), Gaps = 3/162 (1%)

Query  4    SQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGAL  63
            S L      ++SNLPY+IGT L+++ + E  ++    +M+QKEV ERI A+P TK YG L
Sbjct  104  SDLNTNKITIISNLPYHIGTELVIRWLKESSLVASMTLMLQKEVVERICAKPSTKAYGRL  163

Query  64   SVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRL-SKIAFQQK  122
            SV+CSL AT +  FDV+   F P PK+ S+++ L         D +    L +K+AF  +
Sbjct  164  SVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLTPLENIPNSDLISKVELITKMAFAGR  223

Query  123  RKKVKSALQDFFS--VEELEQLGINPDDRPQNLSPEQYLELA  162
            RK +KS+L++      E L +L I+ + R +NL+P  YL LA
Sbjct  224  RKMIKSSLKNLAPNISELLAKLNISDNCRAENLTPNDYLSLA  265


>ref|YP_001496714.1|  dimethyladenosine transferase [Rickettsia bellii OSU 85-389]
 sp|A8GXS7.1|RSMA_RICB8  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|ABV79677.1|  dimethyladenosine transferase [Rickettsia bellii OSU 85-389]
Length=268

 GENE ID: 5646385 ksgA | dimethyladenosine transferase
[Rickettsia bellii OSU 85-389]

 Score =  118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 97/162 (59%), Gaps = 3/162 (1%)

Query  4    SQLTGRWWILVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGAL  63
            S L      ++SNLPY+IGT L+++ + E  ++    +M+QKEV ERI A+P TK YG L
Sbjct  104  SDLNTNKITIISNLPYHIGTELVIRWLKESSLVASMTLMLQKEVVERICAKPSTKAYGRL  163

Query  64   SVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEEDRLEAFRL-SKIAFQQK  122
            SV+CSL AT +  FDV+   F P PK+ S+++ L         D +    L +K+AF  +
Sbjct  164  SVICSLIATVEKCFDVAPTAFYPPPKVYSAIVKLTPLENIPNSDLISKVELITKMAFAGR  223

Query  123  RKKVKSALQDFFS--VEELEQLGINPDDRPQNLSPEQYLELA  162
            RK +KS+L++      E L +L I+ + R +NL+P  YL LA
Sbjct  224  RKMIKSSLKNLAPNISELLAKLNISNNCRAENLTPNDYLSLA  265


>gb|ACT68006.1|  dimethyladenosine transferase [Chlamydophila psittaci 6BC]
Length=278

 Score =  117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 105/177 (59%), Gaps = 11/177 (6%)

Query  1    YDYSQLTGRWW----ILVSNLPYNIGTRLLVKLITEVPVIHRYV-VMVQKEVAERITAQP  55
            Y  SQL  + W     +V+NLPY++ T LL KL  EVP   + V VM+Q EVA RI AQP
Sbjct  99   YPLSQLQDKGWQGKGRVVANLPYHVTTPLLTKLFLEVPNQWKTVTVMIQDEVARRIKAQP  158

Query  56   GTKEYGALSVVCSLFATPKHQFDVSKHCFSPVPKITSSVITLQRETLFDEED--RLEAFR  113
            G KEYG+L++    F   ++ F VS  CF P P+++S+V+ +  +  F  E+  R + F 
Sbjct  159  GGKEYGSLTIFLQFFVDVRYAFKVSPGCFLPKPQVSSAVVHMTVKDRFPLEEPLRTKFFS  218

Query  114  LSKIAFQQKRKKVKSALQDFFS----VEELEQLGINPDDRPQNLSPEQYLELAKSLN  166
            L++ AF Q+RK + +AL+D +      E L QL  +   RP+ LS + YL+L + L+
Sbjct  219  LTRAAFGQRRKLLANALKDLYPKERVFEALSQLNFSDKTRPETLSLDDYLKLFELLS  275


>ref|YP_067608.1|  dimethyladenosine transferase [Rickettsia typhi str. Wilmington]
 sp|Q68W66.1|RSMA_RICTY  RecName: Full=Ribosomal RNA small subunit methyltransferase A; 
AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) 
dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine 
transferase; AltName: Full=16S rRNA dimethylase
 gb|AAU04126.1|  dimethyladenosine transferase [Rickettsia typhi str. Wilmington]
Length=268

 GENE ID: 2958653 ksgA | dimethyladenosine transferase
[Rickettsia typhi str. Wilmington] (10 or fewer PubMed links)

 Score =  117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 100/158 (63%), Gaps = 7/158 (4%)

Query  13   LVSNLPYNIGTRLLVKLITEVPVIHRYVVMVQKEVAERITAQPGTKEYGALSVVCSLFAT  72
            ++SNLPY+IGT L+++L+ E  +I   ++M+QKEV ERI A P TK YG LSV+C + A 
Sbjct  113  VISNLPYHIGTELVIRLLKEAKLITNMILMLQKEVVERICAMPSTKAYGRLSVICQIVAK  172

Query  73   PKHQFDVSKHCFSPVPKITSS---VITLQRETLFDEEDRLEAFRLSKIAFQQKRKKVKSA  129
             +  FDV+   F P PK+ S+   +I L+        +++E  +++K+ F  +RK +KS+
Sbjct  173  VEKCFDVAPTAFYPHPKVYSAIVKIIPLENPPSIALINKVE--QITKLVFAGRRKMIKSS  230

Query  130  LQDFFSV--EELEQLGINPDDRPQNLSPEQYLELAKSL  165
            L++      E L QL IN +DR +NL+P+ YL +A  L
Sbjct  231  LRNLVPNIHEVLTQLKINNNDRAENLTPKDYLRIAMQL  268
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
 BLASTp pour 1000 alignements 


EES53737.1 dimethyladenosine transferase [Leptospirillum ferrodiazotrophum] 129 129 96% 1e-28  
NP_829174.1 dimethyladenosine transferase [Chlamydophila caviae GPIC] >sp|Q823V2.1|RSMA_CHLCV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAP05052.1| dimethyladenosine transferase [Chlamydophila caviae GPIC] 120 120 96% 5e-26  
ZP_04791089.1 dimethyladenosine transferase [Desulfovibrio vulgaris RCH1] >gb|EER80545.1| dimethyladenosine transferase [Desulfovibrio vulgaris RCH1] 120 120 93% 7e-26  
YP_966808.1 dimethyladenosine transferase [Desulfovibrio vulgaris subsp. vulgaris DP4] >sp|A1VD65.1|RSMA_DESVV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM28381.1| dimethyladenosine transferase [Desulfovibrio vulgaris DP4] 120 120 93% 7e-26  
YP_011015.1 dimethyladenosine transferase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >sp|Q72B41.1|RSMA_DESVH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAS96274.1| dimethyladenosine transferase [Desulfovibrio vulgaris str. Hildenborough] 119 119 93% 8e-26  
YP_515617.1 dimethyladenosine transferase [Chlamydophila felis Fe/C-56] >sp|Q253R6.1|RSMA_CHLFF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE81472.1| dimethyladenosine transferase [Chlamydophila felis Fe/C-56] 119 119 100% 1e-25  
YP_537374.1 dimethyladenosine transferase [Rickettsia bellii RML369-C] >sp|Q1RK29.1|RSMA_RICBR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABE04285.1| Dimethyladenosine transferase [Rickettsia bellii RML369-C] 118 118 95% 2e-25  
YP_001496714.1 dimethyladenosine transferase [Rickettsia bellii OSU 85-389] >sp|A8GXS7.1|RSMA_RICB8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV79677.1| dimethyladenosine transferase [Rickettsia bellii OSU 85-389] 118 118 95% 2e-25  
ACT68006.1 dimethyladenosine transferase [Chlamydophila psittaci 6BC] 117 117 100% 3e-25  
YP_067608.1 dimethyladenosine transferase [Rickettsia typhi str. Wilmington] >sp|Q68W66.1|RSMA_RICTY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAU04126.1| dimethyladenosine transferase [Rickettsia typhi str. Wilmington] 117 117 92% 4e-25  
YP_002434926.1 dimethyladenosine transferase [Desulfovibrio vulgaris str. 'Miyazaki F'] >gb|ACL07458.1| dimethyladenosine transferase [Desulfovibrio vulgaris str. 'Miyazaki F'] 117 117 100% 5e-25  
NP_221033.1 dimethyladenosine transferase [Rickettsia prowazekii str. Madrid E] >sp|O05952.1|RSMA_RICPR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAA72482.1| dimethyladenosine transferase [Rickettsia prowazekii] >emb|CAA15109.1| DIMETHYLADENOSINE TRANSFERASE (ksgA) [Rickettsia prowazekii] >gb|ADE30218.1| Dimethyladenosine transferase [Rickettsia prowazekii Rp22] 115 115 92% 1e-24  
YP_001493800.1 dimethyladenosine transferase [Rickettsia akari str. Hartford] >sp|A8GPG7.1|RSMA_RICAH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV75292.1| dimethyladenosine transferase [Rickettsia akari str. Hartford] 115 115 99% 1e-24  
ZP_03736278.1 dimethyladenosine transferase [Desulfonatronospira thiodismutans ASO3-1] >gb|EEG82044.1| dimethyladenosine transferase [Desulfonatronospira thiodismutans ASO3-1] 115 115 98% 2e-24  
YP_001492601.1 dimethyladenosine transferase [Rickettsia canadensis str. McKiel] >sp|A8EZN3.1|RSMA_RICCK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV73816.1| dimethyladenosine transferase [Rickettsia canadensis str. McKiel] 115 115 90% 2e-24  
YP_219717.1 dimethyladenosine transferase [Chlamydophila abortus S26/3] >sp|Q5L6H5.1|RSMA_CHLAB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH63750.1| dimethyladenosine transferase [Chlamydophila abortus S26/3] 115 115 96% 2e-24  
XP_002408487.1 ribosomal RNA adenine dimethylase, putative [Ixodes scapularis] >gb|EEC02116.1| ribosomal RNA adenine dimethylase, putative [Ixodes scapularis] 114 114 92% 3e-24  
ZP_04698771.1 dimethyladenosine transferase [Rickettsia endosymbiont of Ixodes scapularis] >gb|EER21318.1| dimethyladenosine transferase [Rickettsia endosymbiont of Ixodes scapularis] 114 114 92% 4e-24  
ZP_06300350.1 hypothetical protein pah_c200o016 [Parachlamydia acanthamoebae str. Hall's coccus] >gb|EFB40471.1| hypothetical protein pah_c200o016 [Parachlamydia acanthamoebae str. Hall's coccus] 113 113 93% 7e-24  
YP_866231.1 dimethyladenosine transferase [Magnetococcus sp. MC-1] >sp|A0LA32.1|RSMA_MAGSM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK44825.1| dimethyladenosine transferase [Magnetococcus sp. MC-1] 113 113 98% 7e-24  
YP_001495118.1 dimethyladenosine transferase [Rickettsia rickettsii str. 'Sheila Smith'] >sp|A8GT85.1|RSMA_RICRS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV76610.1| dimethyladenosine transferase [Rickettsia rickettsii str. 'Sheila Smith'] 113 113 97% 8e-24  
YP_002887973.1 dimethyladenosine transferase [Chlamydia trachomatis B/Jali20/OT] >emb|CAX10806.1| dimethyladenosine transferase [Chlamydia trachomatis B/Jali20/OT] 113 113 96% 8e-24  
YP_001650392.1 dimethyladenosine transferase [Rickettsia rickettsii str. Iowa] >gb|ABY72986.1| dimethyladenosine transferase [Rickettsia rickettsii str. Iowa] 113 113 97% 8e-24  
NP_360659.1 dimethyladenosine transferase [Rickettsia conorii str. Malish 7] >gb|AAL03560.1| dimethyladenosine transferase [Rickettsia conorii str. Malish 7] 113 113 92% 8e-24  
ZP_05826333.1 dimethyladenosine transferase [Acinetobacter sp. RUH2624] >gb|EEW98316.1| dimethyladenosine transferase [Acinetobacter sp. RUH2624] 112 112 99% 9e-24  
YP_594897.1 dimethyladenosine transferase [Lawsonia intracellularis PHE/MN1-00] >sp|Q1MR01.1|RSMA_LAWIP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAJ54575.1| rRNA (adenine-N6,N6)-dimethyltransferase [Lawsonia intracellularis PHE/MN1-00] 112 112 98% 1e-23  
YP_001499644.1 dimethyladenosine transferase [Rickettsia massiliae MTU5] >gb|ABV85097.1| Dimethyladenosine transferase [Rickettsia massiliae MTU5] 112 112 92% 1e-23  
YP_001086001.1 S-adenosylmethionine-6-N'N'-adenosyl [Acinetobacter baumannii ATCC 17978] 112 112 99% 1e-23  
Q92GV0.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 112 112 92% 1e-23  
ZP_00142835.1 dimethyladenosine transferase [Rickettsia sibirica 246] >gb|EAA26244.1| dimethyladenosine transferase [Rickettsia sibirica 246] 112 112 92% 1e-23  
YP_001708028.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii SDF] >ref|YP_001712466.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii AYE] >ref|YP_001847856.1| dimethyladenosine transferase (rRNA methylation) [Acinetobacter baumannii ACICU] >ref|YP_002320753.1| dimethyladenosine transferase [Acinetobacter baumannii AB0057] >ref|ZP_04663438.1| dimethyladenosine transferase [Acinetobacter baumannii AB900] >ref|ZP_05830330.1| dimethyladenosine transferase [Acinetobacter baumannii ATCC 19606] >ref|ZP_06783199.1| dimethyladenosine transferase [Acinetobacter sp. 6013113] >ref|ZP_06785789.1| dimethyladenosine transferase [Acinetobacter sp. 6014059] >ref|ZP_06795331.1| dimethyladenosine transferase [Acinetobacter sp. 6013150] >emb|CAM85461.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii] >emb|CAP02154.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter baumannii] >gb|ACC58509.1| Dimethyladenosine transferase (rRNA methylation) [Acinetobacter baumannii ACICU] >gb|ABO13399.2| S-adenosylmethionine-6-N'N'-adenosyl [Acinetobacter baumannii ATCC 17978] >gb|ACJ42017.1| dimethyladenosine transferase [Acinetobacter baumannii AB0057] >gb|EEX01701.1| dimethyladenosine transferase [Acinetobacter baumannii ATCC 19606] 112 112 99% 1e-23  
NP_877372.1 dimethyladenosine transferase [Chlamydophila pneumoniae TW-183] >gb|AAP99029.1| dimethyladenosine transferase [Chlamydophila pneumoniae TW-183] 112 112 89% 2e-23  
ACZ32958.1 dimethyladenosine transferase [Chlamydophila pneumoniae LPCoLN] 112 112 89% 2e-23  
YP_002916844.1 dimethyladenosine transferase [Rickettsia peacockii str. Rustic] >sp|C4K2J5.1|RSMA_RICPU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACR47792.1| dimethyladenosine transferase [Rickettsia peacockii str. Rustic] 112 112 92% 2e-23  
ZP_06059366.1 dimethyladenosine transferase [Acinetobacter calcoaceticus RUH2202] >gb|EEY75704.1| dimethyladenosine transferase [Acinetobacter calcoaceticus RUH2202] 112 112 99% 2e-23  
ZP_05353729.1 dimethyladenosine transferase [Chlamydia trachomatis 6276] >ref|ZP_05358706.1| dimethyladenosine transferase [Chlamydia trachomatis 6276s] 112 112 96% 2e-23  
NP_219862.1 dimethyladenosine transferase [Chlamydia trachomatis D/UW-3/CX] >ref|YP_328166.1| dimethyladenosine transferase [Chlamydia trachomatis A/HAR-13] >ref|YP_001654684.1| dimethyladenosine transferase [Chlamydia trachomatis 434/Bu] >ref|YP_001653696.1| dimethyladenosine transferase [Chlamydia trachomatis L2b/UCH-1/proctitis] >sp|O84358.1|RSMA_CHLTR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q3KM04.1|RSMA_CHLTA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0B7S3.1|RSMA_CHLT2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0BBY8.1|RSMA_CHLTB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAC67949.1| Dimethyladenosine Transferase [Chlamydia trachomatis D/UW-3/CX] >gb|AAX50618.1| dimethyladenosine transferase [Chlamydia trachomatis A/HAR-13] >emb|CAP04049.1| dimethyladenosine transferase [Chlamydia trachomatis 434/Bu] >emb|CAP07003.1| dimethyladenosine transferase [Chlamydia trachomatis L2b/UCH-1/proctitis] 112 112 96% 2e-23  
ZP_05382575.1 dimethyladenosine transferase [Chlamydia trachomatis D(s)2923] >emb|CBJ14872.1| dimethyladenosine transferase [Chlamydia trachomatis Sweden2] 111 111 96% 2e-23  
ZP_05380725.1 dimethyladenosine transferase [Chlamydia trachomatis 70] >ref|ZP_05381648.1| dimethyladenosine transferase [Chlamydia trachomatis 70s] 111 111 96% 2e-23  
YP_643671.1 dimethyladenosine transferase [Rubrobacter xylanophilus DSM 9941] >sp|Q1AXL9.1|RSMA_RUBXD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG03859.1| dimethyladenosine transferase [Rubrobacter xylanophilus DSM 9941] 111 111 100% 3e-23  
NP_225253.1 dimethyladenosine transferase [Chlamydophila pneumoniae CWL029] >ref|NP_301114.1| dimethyladenosine transferase [Chlamydophila pneumoniae J138] >ref|NP_445330.1| dimethyladenosine transferase [Chlamydophila pneumoniae AR39] >sp|Q9Z6K0.1|RSMA_CHLPN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAD19196.1| Dimethyladenosine Transferase [Chlamydophila pneumoniae CWL029] >gb|AAF38590.1| dimethyladenosine transferase [Chlamydophila pneumoniae AR39] >dbj|BAA99266.1| dimethyladenosine transferase [Chlamydophila pneumoniae J138] 111 111 89% 3e-23  
ZP_03936706.1 possible dimethyladenosine transferase [Gardnerella vaginalis ATCC 14019] >gb|EEJ44482.1| possible dimethyladenosine transferase [Gardnerella vaginalis ATCC 14019] 110 110 92% 3e-23  
YP_003467708.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Xenorhabdus bovienii SS-2004] >emb|CBJ80928.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Xenorhabdus bovienii SS-2004] 110 110 99% 4e-23  
ZP_04722563.1 dimethyladenosine transferase [Neisseria gonorrhoeae FA6140] 110 110 99% 4e-23  
ZP_06693741.1 conserved hypothetical protein [Acinetobacter sp. SH024] >gb|EFF84600.1| conserved hypothetical protein [Acinetobacter sp. SH024] 110 110 99% 4e-23  
ZP_03319325.1 hypothetical protein PROVALCAL_02269 [Providencia alcalifaciens DSM 30120] >gb|EEB45893.1| hypothetical protein PROVALCAL_02269 [Providencia alcalifaciens DSM 30120] 110 110 98% 5e-23  
YP_002845526.1 Dimethyladenosine transferase [Rickettsia africae ESF-5] >sp|C3PPC3.1|RSMA_RICAE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACP53783.1| Dimethyladenosine transferase [Rickettsia africae ESF-5] 110 110 92% 5e-23  
ZP_05320141.1 dimethyladenosine transferase [Neisseria sicca ATCC 29256] >gb|EET42942.1| dimethyladenosine transferase [Neisseria sicca ATCC 29256] 110 110 99% 5e-23  
ZP_06124799.1 dimethyladenosine transferase [Providencia rettgeri DSM 1131] >gb|EFE54419.1| dimethyladenosine transferase [Providencia rettgeri DSM 1131] 110 110 99% 5e-23  
YP_847420.1 dimethyladenosine transferase [Syntrophobacter fumaroxidans MPOB] >gb|ABK18985.1| dimethyladenosine transferase [Syntrophobacter fumaroxidans MPOB] 110 110 99% 6e-23  
ZP_05976598.1 dimethyladenosine transferase [Neisseria mucosa ATCC 25996] >gb|EFC89841.1| dimethyladenosine transferase [Neisseria mucosa ATCC 25996] 110 110 99% 6e-23  
ZP_06070692.1 dimethyladenosine transferase [Acinetobacter lwoffii SH145] >gb|EEY88667.1| dimethyladenosine transferase [Acinetobacter lwoffii SH145] 110 110 99% 6e-23  
NP_273739.1 dimethyladenosine transferase [Neisseria meningitidis MC58] >sp|Q9K0B7.1|RSMA_NEIMB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAF41114.1| dimethyladenosine transferase [Neisseria meningitidis MC58] 110 110 99% 7e-23  
YP_974740.1 dimethyladenosine transferase [Neisseria meningitidis FAM18] >sp|A1KSW0.1|RSMA_NEIMF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAM09941.1| putative dimethyladenosine transferase [Neisseria meningitidis FAM18] 110 110 99% 7e-23  
ZP_05109537.1 dimethyladenosine transferase [Legionella drancourtii LLAP12] >gb|EET12774.1| dimethyladenosine transferase [Legionella drancourtii LLAP12] 109 109 97% 9e-23  
NP_108091.1 dimethyladenosine transferase [Mesorhizobium loti MAFF303099] >sp|Q984S7.1|RSMA_RHILO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB54236.1| dimethyladenosine transferase [Mesorhizobium loti MAFF303099] 109 109 92% 1e-22  
CBA09163.1 dimethyladenosine transferase [Neisseria meningitidis serogroup W135] 109 109 99% 1e-22  
YP_003198763.1 dimethyladenosine transferase [Desulfohalobium retbaense DSM 5692] >gb|ACV69185.1| dimethyladenosine transferase [Desulfohalobium retbaense DSM 5692] 109 109 92% 1e-22  
ZP_06230954.1 dimethyladenosine transferase [Desulfovibrio aespoeensis Aspo-2] >gb|EFA67610.1| dimethyladenosine transferase [Desulfovibrio aespoeensis Aspo-2] 109 109 90% 1e-22  
ZP_05496061.1 dimethyladenosine transferase [Clostridium papyrosolvens DSM 2782] >gb|EEU58980.1| dimethyladenosine transferase [Clostridium papyrosolvens DSM 2782] 109 109 89% 1e-22  
ZP_03718812.1 hypothetical protein NEIFLAOT_00629 [Neisseria flavescens NRL30031/H210] >gb|EEG34244.1| hypothetical protein NEIFLAOT_00629 [Neisseria flavescens NRL30031/H210] 109 109 99% 1e-22  
ZP_05104558.1 dimethyladenosine transferase [Methylophaga thiooxidans DMS010] >gb|EEF79127.1| dimethyladenosine transferase [Methylophaga thiooxidans DMS010] 109 109 98% 1e-22  
ZP_06186932.1 dimethyladenosine transferase [Legionella longbeachae D-4968] >ref|YP_003453607.1| dimethyladenosine transferase (16S rRNA dimethylase) [Legionella longbeachae NSW150] >gb|EEZ96554.1| dimethyladenosine transferase [Legionella longbeachae D-4968] >emb|CBJ10453.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Legionella longbeachae NSW150] 109 109 97% 1e-22  
YP_002888855.1 dimethyladenosine transferase [Chlamydia trachomatis B/TZ1A828/OT] >emb|CAX09913.1| dimethyladenosine transferase [Chlamydia trachomatis B/TZ1A828/OT] 108 108 96% 1e-22  
YP_001223113.1 dimethyladenosine transferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >emb|CAN02443.1| putative dimethyladenosine transferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] 108 108 96% 1e-22  
ZP_06734570.1 hypothetical protein NEIELOOT_01401 [Neisseria elongata subsp. glycolytica ATCC 29315] >gb|EFE49659.1| hypothetical protein NEIELOOT_01401 [Neisseria elongata subsp. glycolytica ATCC 29315] 108 108 99% 1e-22  
YP_002342332.1 dimethyladenosine transferase [Neisseria meningitidis Z2491] >ref|YP_003082802.1| dimethyladenosine transferase [Neisseria meningitidis alpha14] >sp|Q9JVC2.1|RSMA_NEIMA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAM08134.1| putative dimethyladenosine transferase [Neisseria meningitidis Z2491] >emb|CBA04707.1| dimethyladenosine transferase [Neisseria meningitidis] 108 108 99% 2e-22  
YP_003361637.1 KsgA Dimethyladenosine transferase [Bifidobacterium dentium Bd1] >gb|ADB10813.1| KsgA Dimethyladenosine transferase [Bifidobacterium dentium Bd1] 108 108 93% 2e-22  
ZP_05982467.1 dimethyladenosine transferase [Neisseria cinerea ATCC 14685] >gb|EEZ72166.1| dimethyladenosine transferase [Neisseria cinerea ATCC 14685] 108 108 99% 2e-22  
CBA06283.1 dimethyladenosine transferase [Neisseria meningitidis alpha153] 108 108 99% 2e-22  
YP_002001040.1 dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11945] >ref|ZP_04718383.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >ref|ZP_04720497.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI18] >ref|ZP_04724707.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >ref|ZP_04729180.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID18] >ref|ZP_04731463.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID1] >ref|ZP_04733615.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID24-1] >ref|ZP_04735914.1| dimethyladenosine transferase [Neisseria gonorrhoeae PID332] >ref|ZP_04738095.1| dimethyladenosine transferase [Neisseria gonorrhoeae SK-92-679] >ref|ZP_04740325.1| dimethyladenosine transferase [Neisseria gonorrhoeae SK-93-1035] >ref|ZP_05794881.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] >ref|ZP_06128487.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >ref|ZP_06130482.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >ref|ZP_06134960.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID18] >ref|ZP_06137265.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID1] >ref|ZP_06148441.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID332] >ref|ZP_06150669.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-92-679] >ref|ZP_06152911.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-93-1035] >ref|ZP_06570107.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] >sp|B4RJV5.1|RSMA_NEIG2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACF29106.1| putative dimethyladenosine transferase [Neisseria gonorrhoeae NCCP11945] >gb|ACJ23027.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23028.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23029.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23030.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23031.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23032.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23034.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23035.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23036.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23037.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23038.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23039.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23040.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23041.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23042.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23043.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23044.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23045.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23046.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23047.1| KsgA [Neisseria gonorrhoeae] >gb|ACJ23048.1| KsgA [Neisseria gonorrhoeae] >gb|EEZ43127.1| dimethyladenosine transferase [Neisseria gonorrhoeae 35/02] >gb|EEZ45122.1| dimethyladenosine transferase [Neisseria gonorrhoeae FA19] >gb|EEZ49600.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID18] >gb|EEZ51905.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID1] >gb|EEZ54263.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae PID332] >gb|EEZ56491.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-92-679] >gb|EEZ58733.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae SK-93-1035] >gb|EFE03288.1| dimethyladenosine transferase [Neisseria gonorrhoeae DGI2] 108 108 99% 2e-22  
YP_752782.1 rRNA (adenine-N(6)-)-methyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gb|ABI67411.1| dimethyladenosine transferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] 108 108 93% 2e-22  
ZP_04758011.1 dimethyladenosine transferase [Neisseria flavescens SK114] >gb|EER56315.1| dimethyladenosine transferase [Neisseria flavescens SK114] 108 108 99% 2e-22  
YP_277643.1 dimethyladenosine transferase [Candidatus Blochmannia pennsylvanicus str. BPEN] >sp|Q493R7.1|RSMA_BLOPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ40770.1| dimethyladenosine transferase [Candidatus Blochmannia pennsylvanicus str. BPEN] 108 108 100% 2e-22  
ZP_02917557.1 hypothetical protein BIFDEN_00841 [Bifidobacterium dentium ATCC 27678] >gb|EDT45025.1| hypothetical protein BIFDEN_00841 [Bifidobacterium dentium ATCC 27678] 108 108 93% 2e-22  
YP_001710974.1 dimethyladenosine transferase [Clavibacter michiganensis subsp. sepedonicus] >emb|CAQ02393.1| putative dimethyladenosine transferase (drug resistance) [Clavibacter michiganensis subsp. sepedonicus] 108 108 96% 2e-22  
ZP_06607867.1 dimethyladenosine transferase [Actinomyces odontolyticus F0309] >gb|EFF80919.1| dimethyladenosine transferase [Actinomyces odontolyticus F0309] 108 108 92% 2e-22  
ZP_05360849.1 dimethyladenosine transferase [Acinetobacter radioresistens SK82] >ref|ZP_06072170.1| dimethyladenosine transferase [Acinetobacter radioresistens SH164] >gb|EET82530.1| dimethyladenosine transferase [Acinetobacter radioresistens SK82] >gb|EEY88210.1| dimethyladenosine transferase [Acinetobacter radioresistens SH164] 108 108 99% 2e-22  
YP_047537.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter sp. ADP1] >sp|Q6F8A0.1|RSMA_ACIAD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAG69715.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Acinetobacter sp. ADP1] 108 108 99% 2e-22  
NP_758420.1 dimethyladenosine transferase [Mycoplasma penetrans HF-2] >sp|Q8EU92.1|RSMA_MYCPE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC44824.1| dimethyladenosine transferase [Mycoplasma penetrans HF-2] 108 108 97% 2e-22  
YP_003180103.1 dimethyladenosine transferase [Atopobium parvulum DSM 20469] >gb|ACV51512.1| dimethyladenosine transferase [Atopobium parvulum DSM 20469] 108 108 92% 2e-22  
ACJ23053.1 KsgA [Neisseria gonorrhoeae] 108 108 99% 3e-22  
ACJ23051.1 KsgA [Neisseria gonorrhoeae] 107 107 99% 3e-22  
YP_003135044.1 dimethyladenosine transferase [Saccharomonospora viridis DSM 43017] >gb|ACU98217.1| dimethyladenosine transferase [Saccharomonospora viridis DSM 43017] 107 107 91% 3e-22  
ABU50801.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Acinetobacter venetianus] 107 107 99% 3e-22  
YP_113120.1 dimethyladenosine transferase [Methylococcus capsulatus str. Bath] >sp|Q60B77.1|RSMA_METCA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAU93125.1| dimethyladenosine transferase [Methylococcus capsulatus str. Bath] 107 107 96% 3e-22  
ACJ23050.1 KsgA [Neisseria gonorrhoeae] 107 107 99% 3e-22  
YP_207435.1 dimethyladenosine transferase [Neisseria gonorrhoeae FA 1090] >ref|ZP_06643731.1| dimethyladenosine transferase [Neisseria gonorrhoeae F62] >sp|Q5F9W4.1|RSMA_NEIG1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAW89023.1| putative dimethyladenosine transferase [Neisseria gonorrhoeae FA 1090] >gb|EFF39269.1| dimethyladenosine transferase [Neisseria gonorrhoeae F62] 107 107 99% 3e-22  
ACJ23049.1 KsgA [Neisseria gonorrhoeae] 107 107 99% 3e-22  
ZP_04726868.1 dimethyladenosine transferase [Neisseria gonorrhoeae MS11] >ref|ZP_05106350.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae 1291] >ref|ZP_06132606.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae MS11] >gb|ACJ23033.1| KsgA [Neisseria gonorrhoeae] >gb|EEH61564.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae 1291] >gb|EEZ47246.1| dimethyladenosine transferase dimethyltransferase [Neisseria gonorrhoeae MS11] 107 107 99% 3e-22  
ACJ23052.1 KsgA [Neisseria gonorrhoeae] 107 107 99% 3e-22  
YP_960764.1 dimethyladenosine transferase [Marinobacter aquaeolei VT8] >sp|A1U6F8.1|RSMA_MARAV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM20577.1| dimethyladenosine transferase [Marinobacter aquaeolei VT8] 107 107 99% 4e-22  
YP_739156.1 dimethyladenosine transferase [Shewanella sp. MR-7] >sp|Q0HS06.1|RSMA_SHESR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI44099.1| dimethyladenosine transferase [Shewanella sp. MR-7] 107 107 98% 4e-22  
YP_870839.1 dimethyladenosine transferase [Shewanella sp. ANA-3] >sp|A0L064.1|RSMA_SHESA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK49433.1| dimethyladenosine transferase [Shewanella sp. ANA-3] 107 107 98% 4e-22  
ZP_05986505.1 dimethyladenosine transferase [Neisseria lactamica ATCC 23970] >gb|EEZ76271.1| dimethyladenosine transferase [Neisseria lactamica ATCC 23970] 107 107 99% 4e-22  
ZP_05707698.1 dimethyladenosine transferase [Corynebacterium genitalium ATCC 33030] >gb|EEV91063.1| dimethyladenosine transferase [Corynebacterium genitalium ATCC 33030] 107 107 96% 4e-22  
ZP_02045241.1 hypothetical protein ACTODO_02132 [Actinomyces odontolyticus ATCC 17982] >gb|EDN81653.1| hypothetical protein ACTODO_02132 [Actinomyces odontolyticus ATCC 17982] 107 107 92% 5e-22  
ZP_05845733.1 dimethyladenosine transferase [Corynebacterium jeikeium ATCC 43734] >gb|EEW17269.1| dimethyladenosine transferase [Corynebacterium jeikeium ATCC 43734] 107 107 91% 5e-22  
ZP_06064920.1 dimethyladenosine transferase [Acinetobacter junii SH205] >gb|EEY92751.1| dimethyladenosine transferase [Acinetobacter junii SH205] 107 107 99% 5e-22  
ZP_04446747.1 hypothetical protein COLINT_03499 [Collinsella intestinalis DSM 13280] >gb|EEP43789.1| hypothetical protein COLINT_03499 [Collinsella intestinalis DSM 13280] 107 107 96% 5e-22  
YP_003203824.1 dimethyladenosine transferase [Nakamurella multipartita DSM 44233] >gb|ACV80835.1| dimethyladenosine transferase [Nakamurella multipartita DSM 44233] 107 107 91% 5e-22  
YP_361409.1 dimethyladenosine transferase [Carboxydothermus hydrogenoformans Z-2901] >sp|Q3A8X5.1|RSMA_CARHZ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB14136.1| dimethyladenosine transferase [Carboxydothermus hydrogenoformans Z-2901] 107 107 95% 5e-22  
ZP_06062527.1 S-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [Acinetobacter johnsonii SH046] >gb|EEY96306.1| S-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [Acinetobacter johnsonii SH046] 107 107 99% 5e-22  
ZP_02959314.1 hypothetical protein PROSTU_01151 [Providencia stuartii ATCC 25827] >gb|EDU60617.1| hypothetical protein PROSTU_01151 [Providencia stuartii ATCC 25827] 107 107 98% 5e-22  
YP_007394.2 dimethyladenosine transferase [Candidatus Protochlamydia amoebophila UWE25] >sp|Q6ME80.2|RSMA_PARUW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 107 107 92% 6e-22  
ZP_03788137.1 dimethyladenosine transferase [Wolbachia endosymbiont of Muscidifurax uniraptor] >gb|EEH12033.1| dimethyladenosine transferase [Wolbachia endosymbiont of Muscidifurax uniraptor] 107 107 96% 6e-22  
YP_001038492.1 dimethyladenosine transferase [Clostridium thermocellum ATCC 27405] >ref|ZP_05429041.1| dimethyladenosine transferase [Clostridium thermocellum DSM 2360] >ref|ZP_06250124.1| dimethyladenosine transferase [Clostridium thermocellum JW20] >gb|ABN53299.1| dimethyladenosine transferase [Clostridium thermocellum ATCC 27405] >gb|EEU02076.1| dimethyladenosine transferase [Clostridium thermocellum DSM 2360] >gb|EFB37517.1| dimethyladenosine transferase [Clostridium thermocellum JW20] 107 107 92% 6e-22  
CAX50515.1 dimethyladenosine transferase (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; 16S rRNA dimethylase; high level kasugamycin resistance protein KsgA; kasugamycin dimethyltransferase) [Neisseria meningitidis 8013] 107 107 99% 6e-22  
CAF23119.1 putative dimethyladenosine transferase [Candidatus Protochlamydia amoebophila UWE25] 107 107 92% 6e-22  
CBA75122.1 dimethyladenosine transferase [Arsenophonus nasoniae] 106 106 90% 7e-22  
ZP_00373028.1 dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila ananassae] >gb|EAL59427.1| dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila ananassae] 106 106 96% 7e-22  
ZP_05972425.1 hypothetical protein PROVRUST_06046 [Providencia rustigianii DSM 4541] >gb|EFB72761.1| hypothetical protein PROVRUST_06046 [Providencia rustigianii DSM 4541] 106 106 99% 7e-22  
ZP_02964016.1 dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis HN019] >ref|YP_002470396.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis AD011] >ref|YP_002969012.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis Bl-04] >ref|YP_002970578.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis DSM 10140] >gb|EDT88717.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis HN019] >gb|ACL29820.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis AD011] >gb|ACS46950.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis Bl-04] >gb|ACS48516.1| dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis DSM 10140] 106 106 92% 8e-22  
NP_297007.1 dimethyladenosine transferase [Chlamydia muridarum Nigg] >ref|ZP_06194814.1| dimethyladenosine transferase [Chlamydia muridarum Nigg] >ref|ZP_06195736.1| dimethyladenosine transferase [Chlamydia muridarum Weiss] >sp|Q9PK40.1|RSMA_CHLMU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAF39462.1| dimethyladenosine transferase [Chlamydia muridarum Nigg] 106 106 99% 8e-22  
ZP_05985093.1 dimethyladenosine transferase [Neisseria subflava NJ9703] >gb|EFC52121.1| dimethyladenosine transferase [Neisseria subflava NJ9703] 106 106 99% 8e-22  
YP_002726797.1 dimethyladenosine transferase [Wolbachia sp. wRi] >sp|C0R5G4.1|RSMA_WOLWR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACN95006.1| dimethyladenosine transferase [Wolbachia sp. wRi] 106 106 96% 8e-22  
ZP_04447262.1 hypothetical protein BIFANG_02235 [Bifidobacterium angulatum DSM 20098] >gb|EEP21839.1| hypothetical protein BIFANG_02235 [Bifidobacterium angulatum DSM 20098] 106 106 95% 8e-22  
ZP_00372268.1 dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila simulans] >gb|EAL60211.1| dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila simulans] 106 106 96% 9e-22  
YP_254433.1 dimethyladenosine transferase [Staphylococcus haemolyticus JCSC1435] >sp|Q4L3F0.1|RSMA_STAHJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE05827.1| ksgA [Staphylococcus haemolyticus JCSC1435] 106 106 90% 9e-22  
ADC84999.1 Dimethyladenosine transferase [Bifidobacterium animalis subsp. lactis BB-12] 106 106 92% 1e-21  
ZP_01552544.1 dimethyladenosine transferase [Methylophilales bacterium HTCC2181] >gb|EAV47602.1| dimethyladenosine transferase [Methylophilales bacterium HTCC2181] 106 106 89% 1e-21  
YP_196337.1 dimethyladenosine transferase [Ehrlichia ruminantium str. Gardel] >sp|Q5FH30.1|RSMA_EHRRG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAI27863.1| Dimethyladenosine transferase [Ehrlichia ruminantium str. Gardel] 106 106 92% 1e-21  
ZP_02036526.1 hypothetical protein BACCAP_02129 [Bacteroides capillosus ATCC 29799] >gb|EDN00295.1| hypothetical protein BACCAP_02129 [Bacteroides capillosus ATCC 29799] 105 105 96% 1e-21  
YP_180268.1 dimethyladenosine transferase [Ehrlichia ruminantium str. Welgevonden] >ref|YP_197292.1| dimethyladenosine transferase [Ehrlichia ruminantium str. Welgevonden] >sp|Q5HBC6.1|RSMA_EHRRW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH58125.1| dimethyladenosine transferase [Ehrlichia ruminantium str. Welgevonden] >emb|CAI26910.1| Dimethyladenosine transferase [Ehrlichia ruminantium str. Welgevonden] 105 105 92% 1e-21  
NP_927955.1 dimethyladenosine transferase [Photorhabdus luminescens subsp. laumondii TTO1] >sp|Q7N8V7.1|RSMA_PHOLL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAE12904.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] 105 105 99% 1e-21  
ZP_03824944.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Acinetobacter sp. ATCC 27244] >ref|ZP_06728809.1| dimethyladenosine transferase [Acinetobacter haemolyticus ATCC 19194] >gb|EEH67212.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Acinetobacter sp. ATCC 27244] >gb|EFF81536.1| dimethyladenosine transferase [Acinetobacter haemolyticus ATCC 19194] 105 105 99% 1e-21  
ZP_03978293.1 dimethyladenosine transferase [Corynebacterium lipophiloflavum DSM 44291] >gb|EEI17630.1| dimethyladenosine transferase [Corynebacterium lipophiloflavum DSM 44291] 105 105 91% 1e-21  
YP_002468456.1 dimethyladenosine transferase [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] >gb|ACL29961.1| dimethyladenosine transferase [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] 105 105 92% 1e-21  
YP_003039404.1 dimethyladenosine transferase [Photorhabdus asymbiotica] >emb|CAQ82659.1| dimethyladenosine transferase [Photorhabdus asymbiotica] 105 105 99% 2e-21  
NP_719181.1 dimethyladenosine transferase [Shewanella oneidensis MR-1] >sp|Q8EB93.1|RSMA_SHEON RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN56625.1|AE015799_12 dimethyladenosine transferase [Shewanella oneidensis MR-1] 105 105 98% 2e-21  
YP_001936719.1 dimethyladenosine transferase [Orientia tsutsugamushi str. Ikeda] >dbj|BAG39485.1| dimethyladenosine transferase [Orientia tsutsugamushi str. Ikeda] 105 105 99% 2e-21  
YP_733042.1 dimethyladenosine transferase [Shewanella sp. MR-4] >sp|Q0HLT2.1|RSMA_SHESM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI37985.1| dimethyladenosine transferase [Shewanella sp. MR-4] 105 105 98% 2e-21  
YP_002834385.1 dimethyladenosine transferase [Corynebacterium aurimucosum ATCC 700975] >ref|ZP_06042257.1| dimethyladenosine transferase [Corynebacterium aurimucosum ATCC 700975] >gb|ACP32447.1| dimethyladenosine transferase [Corynebacterium aurimucosum ATCC 700975] 105 105 93% 2e-21  
ZP_05033809.1 dimethyladenosine transferase [Brevundimonas sp. BAL3] >gb|EDX81238.1| dimethyladenosine transferase [Brevundimonas sp. BAL3] 105 105 92% 2e-21  
ZP_04678453.1 dimethyladenosine transferase [Staphylococcus warneri L37603] >gb|EEQ79447.1| dimethyladenosine transferase [Staphylococcus warneri L37603] 105 105 93% 2e-21  
ZP_05635196.1 dimethyladenosine transferase [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)] 105 105 92% 2e-21  
YP_001598806.1 dimethyladenosine transferase [Neisseria meningitidis 053442] >sp|A9M352.1|RSMA_NEIM0 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX72852.1| dimethyladenosine transferase [Neisseria meningitidis 053442] 105 105 99% 2e-21  
YP_002893553.1 dimethyladenosine transferase [Tolumonas auensis DSM 9187] >sp|C4L9L4.1|RSMA_TOLAT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACQ93967.1| dimethyladenosine transferase [Tolumonas auensis DSM 9187] 105 105 99% 2e-21  
YP_343723.1 16S rRNA dimethylase [Nitrosococcus oceani ATCC 19707] >ref|ZP_05047842.1| dimethyladenosine transferase [Nitrosococcus oceani AFC27] >sp|Q3JAF3.1|RSMA_NITOC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA58193.1| dimethyladenosine transferase [Nitrosococcus oceani ATCC 19707] >gb|EDZ67938.1| dimethyladenosine transferase [Nitrosococcus oceani AFC27] 105 105 98% 2e-21  
ZP_02166217.1 dimethyladenosine transferase [Hoeflea phototrophica DFL-43] >gb|EDQ33820.1| dimethyladenosine transferase [Hoeflea phototrophica DFL-43] 104 104 92% 2e-21  
YP_002467901.1 dimethyladenosine transferase [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] >gb|ACL30514.1| dimethyladenosine transferase [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] 104 104 92% 3e-21  
YP_198237.1 dimethyladenosine transferase [Wolbachia endosymbiont strain TRS of Brugia malayi] >sp|Q5GSM9.1|RSMA_WOLTR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAW70995.1| Dimethyladenosine transferase [Wolbachia endosymbiont strain TRS of Brugia malayi] 104 104 96% 3e-21  
ZP_05813133.1 dimethyladenosine transferase [Mesorhizobium opportunistum WSM2075] >gb|EEW30542.1| dimethyladenosine transferase [Mesorhizobium opportunistum WSM2075] 104 104 89% 3e-21  
ZP_05042874.1 dimethyladenosine transferase [Alcanivorax sp. DG881] >gb|EDX90295.1| dimethyladenosine transferase [Alcanivorax sp. DG881] 104 104 90% 3e-21  
ZP_03918123.1 dimethyladenosine transferase [Corynebacterium glucuronolyticum ATCC 51867] >gb|EEI27621.1| dimethyladenosine transferase [Corynebacterium glucuronolyticum ATCC 51867] 104 104 90% 3e-21  
ZP_00957640.1 dimethyladenosine transferase [Oceanicaulis alexandrii HTCC2633] >gb|EAP89317.1| dimethyladenosine transferase [Oceanicaulis alexandrii HTCC2633] 104 104 92% 3e-21  
ADG04832.1 dimethyladenosine transferase [Bacillus tusciae DSM 2912] 104 104 92% 4e-21  
YP_003527575.1 dimethyladenosine transferase [Nitrosococcus halophilus Nc4] >gb|ADE15188.1| dimethyladenosine transferase [Nitrosococcus halophilus Nc4] 104 104 90% 4e-21  
ZP_04559829.1 dimethyladenosine transferase [Citrobacter sp. 30_2] >gb|EEH94995.1| dimethyladenosine transferase [Citrobacter sp. 30_2] 103 103 99% 4e-21  
YP_002130550.1 dimethyladenosine transferase [Phenylobacterium zucineum HLK1] >sp|B4RBS4.1|RSMA_PHEZH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACG78121.1| dimethyladenosine transferase [Phenylobacterium zucineum HLK1] 103 103 95% 4e-21  
YP_251302.1 dimethyladenosine transferase [Corynebacterium jeikeium K411] >sp|Q4JU23.1|RSMA_CORJK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAI37684.1| dimethyladenosine transferase [Corynebacterium jeikeium K411] 103 103 91% 5e-21  
ZP_05061055.1 dimethyladenosine transferase [gamma proteobacterium HTCC5015] >gb|EDY87211.1| dimethyladenosine transferase [gamma proteobacterium HTCC5015] 103 103 100% 5e-21  
YP_674321.1 dimethyladenosine transferase [Mesorhizobium sp. BNC1] >sp|Q11HG9.1|RSMA_MESSB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG63156.1| dimethyladenosine transferase [Chelativorans sp. BNC1] 103 103 98% 6e-21  
ZP_03310398.1 hypothetical protein DESPIG_00281 [Desulfovibrio piger ATCC 29098] >gb|EEB34816.1| hypothetical protein DESPIG_00281 [Desulfovibrio piger ATCC 29098] 103 103 98% 6e-21  
YP_964547.1 dimethyladenosine transferase [Shewanella sp. W3-18-1] >ref|ZP_01707671.1| dimethyladenosine transferase [Shewanella putrefaciens 200] >ref|YP_001182517.1| dimethyladenosine transferase [Shewanella putrefaciens CN-32] >sp|A4Y435.1|RSMA_SHEPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A1RMU8.1|RSMA_SHESW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM25993.1| dimethyladenosine transferase [Shewanella sp. W3-18-1] >gb|EAY51974.1| dimethyladenosine transferase [Shewanella putrefaciens 200] >gb|ABP74718.1| dimethyladenosine transferase [Shewanella putrefaciens CN-32] 103 103 99% 6e-21  
YP_003147392.1 dimethyladenosine transferase [Kangiella koreensis DSM 16069] >gb|ACV27624.1| dimethyladenosine transferase [Kangiella koreensis DSM 16069] 103 103 97% 6e-21  
ZP_04058518.1 dimethyladenosine transferase [Capnocytophaga gingivalis ATCC 33624] >gb|EEK13617.1| dimethyladenosine transferase [Capnocytophaga gingivalis ATCC 33624] 103 103 97% 6e-21  
NP_420495.1 dimethyladenosine transferase [Caulobacter crescentus CB15] >sp|Q9A7N5.1|RSMA_CAUCR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAK23663.1| dimethyladenosine transferase [Caulobacter crescentus CB15] 103 103 98% 7e-21  
ZP_03647258.1 dimethyladenosine transferase [Bifidobacterium bifidum NCIMB 41171] 103 103 93% 7e-21  
ZP_06751488.1 dimethyladenosine transferase [Parascardovia denticolens F0305] >gb|EFG32701.1| dimethyladenosine transferase [Parascardovia denticolens F0305] 103 103 91% 7e-21  
ZP_03972497.1 dimethyladenosine transferase [Corynebacterium glucuronolyticum ATCC 51866] >gb|EEI62618.1| dimethyladenosine transferase [Corynebacterium glucuronolyticum ATCC 51866] 103 103 90% 7e-21  
YP_002517130.1 dimethyladenosine transferase [Caulobacter crescentus NA1000] >gb|ACL95222.1| dimethyladenosine transferase [Caulobacter crescentus NA1000] 103 103 98% 8e-21  
NP_239973.1 dimethyladenosine transferase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >sp|P57241.1|RSMA_BUCAI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >pir||C84946 dimethyladenosine transferase [imported] - Buchnera sp. (strain APS) >dbj|BAB12859.1| dimethyladenosine transferase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] 103 103 92% 8e-21  
YP_002504539.1 dimethyladenosine transferase [Clostridium cellulolyticum H10] >gb|ACL74559.1| dimethyladenosine transferase [Clostridium cellulolyticum H10] 103 103 90% 8e-21  
YP_001975307.1 dimethyladenosine transferase [Wolbachia endosymbiont of Culex quinquefasciatus Pel] >ref|ZP_03335271.1| dimethyladenosine transferase [Wolbachia endosymbiont of Culex quinquefasciatus JHB] >sp|B3CPY6.1|RSMA_WOLPP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAQ54639.1| dimethyladenosine transferase [Wolbachia endosymbiont of Culex quinquefasciatus Pel] >gb|EEB55529.1| dimethyladenosine transferase [Wolbachia endosymbiont of Culex quinquefasciatus JHB] 103 103 92% 8e-21  
ZP_06415589.1 ribosomal RNA adenine methylase transferase [Frankia sp. EUN1f] >gb|EFC81576.1| ribosomal RNA adenine methylase transferase [Frankia sp. EUN1f] 103 103 90% 9e-21  
YP_588992.1 dimethyladenosine transferase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >sp|Q1LSS2.1|RSMA_BAUCH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABF14245.1| dimethyladenosine transferase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] 103 103 92% 9e-21  
NP_249283.1 dimethyladenosine transferase [Pseudomonas aeruginosa PAO1] >sp|Q9I5U5.1|RSMA_PSEAE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAG03981.1|AE004495_5 rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa PAO1] 103 103 99% 9e-21  
YP_788765.1 dimethyladenosine transferase [Pseudomonas aeruginosa UCBPP-PA14] >ref|YP_002438197.1| dimethyladenosine transferase [Pseudomonas aeruginosa LESB58] >ref|ZP_04930517.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa C3719] >gb|ABJ15556.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa UCBPP-PA14] >gb|EAZ54636.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa C3719] >emb|CAW25316.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa LESB58] 102 102 99% 9e-21  
YP_001414604.1 dimethyladenosine transferase [Parvibaculum lavamentivorans DS-1] >gb|ABS64947.1| dimethyladenosine transferase [Parvibaculum lavamentivorans DS-1] 102 102 91% 1e-20  
ZP_06171011.1 dimethyladenosine transferase [Brevundimonas subvibrioides ATCC 15264] >gb|EEZ70114.1| dimethyladenosine transferase [Brevundimonas subvibrioides ATCC 15264] 102 102 92% 1e-20  
YP_002782925.1 dimethyladenosine transferase [Rhodococcus opacus B4] >sp|C1AXY5.1|RSMA_RHOOB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAH53980.1| dimethyladenosine transferase [Rhodococcus opacus B4] 102 102 96% 1e-20  
NP_878432.1 dimethyladenosine transferase [Candidatus Blochmannia floridanus] >sp|Q7VQK3.1|RSMA_BLOFL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAD83647.1| dimethyladenosine transferase [Candidatus Blochmannia floridanus] 102 102 92% 1e-20  
ADF60412.1 dimethyladenosine transferase [Enterobacter cloacae subsp. cloacae ATCC 13047] 102 102 97% 1e-20  
YP_001248345.1 dimethyladenosine transferase [Orientia tsutsugamushi str. Boryong] >emb|CAM79504.1| dimethyladenosine transferase (rRNA methylation) [Orientia tsutsugamushi Boryong] 102 102 99% 1e-20  
YP_803808.1 dimethyladenosine transferase [Pediococcus pentosaceus ATCC 25745] >sp|Q03HF6.1|RSMA_PEDPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABJ67366.1| dimethyladenosine transferase [Pediococcus pentosaceus ATCC 25745] 102 102 95% 1e-20  
ZP_01735678.1 dimethyladenosine transferase [Marinobacter sp. ELB17] >gb|EBA01634.1| dimethyladenosine transferase [Marinobacter sp. ELB17] 102 102 99% 1e-20  
ZP_06354856.1 dimethyladenosine transferase [Citrobacter youngae ATCC 29220] >gb|EFE07523.1| dimethyladenosine transferase [Citrobacter youngae ATCC 29220] 102 102 99% 1e-20  
ZP_05674554.1 dimethyladenosine transferase [Enterococcus faecium 1,231,408] >gb|EEV57887.1| dimethyladenosine transferase [Enterococcus faecium 1,231,408] 102 102 92% 1e-20  
ZP_01306507.1 dimethyladenosine transferase [Oceanobacter sp. RED65] >gb|EAT12805.1| dimethyladenosine transferase [Oceanobacter sp. RED65] 102 102 90% 1e-20  
YP_001739356.1 dimethyladenosine transferase [Thermotoga sp. RQ2] >sp|B1LBH5.1|RSMA_THESQ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACB09673.1| dimethyladenosine transferase [Thermotoga sp. RQ2] 102 102 90% 1e-20  
YP_121119.1 dimethyladenosine transferase [Nocardia farcinica IFM 10152] >sp|Q5YPY6.1|RSMA_NOCFA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAD59755.1| putative ribosomal RNA small subunit dimethyltransferase [Nocardia farcinica IFM 10152] 102 102 90% 1e-20  
ZP_01772138.1 Hypothetical protein COLAER_01138 [Collinsella aerofaciens ATCC 25986] >gb|EBA39554.1| Hypothetical protein COLAER_01138 [Collinsella aerofaciens ATCC 25986] 102 102 95% 1e-20  
ZP_01227407.1 dimethyladenosine transferase [Aurantimonas manganoxydans SI85-9A1] >gb|EAS50175.1| dimethyladenosine transferase [Aurantimonas manganoxydans SI85-9A1] 102 102 92% 1e-20  
ZP_05922907.1 dimethyladenosine transferase [Enterococcus faecium TC 6] >ref|ZP_06446404.1| dimethyladenosine transferase [Enterococcus faecium D344SRF] >ref|ZP_06695800.1| dimethyladenosine transferase [Enterococcus faecium E1636] >ref|ZP_06697262.1| dimethyladenosine transferase [Enterococcus faecium E1679] >gb|EEW65209.1| dimethyladenosine transferase [Enterococcus faecium TC 6] >gb|EFD10110.1| dimethyladenosine transferase [Enterococcus faecium D344SRF] >gb|EFF22841.1| dimethyladenosine transferase [Enterococcus faecium E1636] >gb|EFF27363.1| dimethyladenosine transferase [Enterococcus faecium E1679] 102 102 92% 1e-20  
YP_496165.1 dimethyladenosine transferase [Novosphingobium aromaticivorans DSM 12444] >sp|Q2G9Z2.1|RSMA_NOVAD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABD25331.1| dimethyladenosine transferase [Novosphingobium aromaticivorans DSM 12444] 102 102 93% 1e-20  
ZP_05659747.1 dimethyladenosine transferase [Enterococcus faecium 1,230,933] >ref|ZP_05661979.1| dimethyladenosine transferase [Enterococcus faecium 1,231,502] >ref|ZP_05665176.1| dimethyladenosine transferase [Enterococcus faecium 1,231,501] >ref|ZP_05670838.1| dimethyladenosine transferase [Enterococcus faecium 1,231,410] >ref|ZP_05712343.1| dimethyladenosine transferase [Enterococcus faecium DO] >ref|ZP_05832473.1| dimethyladenosine transferase [Enterococcus faecium C68] >ref|ZP_06677565.1| dimethyladenosine transferase [Enterococcus faecium E1162] >ref|ZP_06678870.1| dimethyladenosine transferase [Enterococcus faecium E1071] >ref|ZP_06702238.1| dimethyladenosine transferase [Enterococcus faecium U0317] >gb|EEV43080.1| dimethyladenosine transferase [Enterococcus faecium 1,230,933] >gb|EEV45312.1| dimethyladenosine transferase [Enterococcus faecium 1,231,502] >gb|EEV48509.1| dimethyladenosine transferase [Enterococcus faecium 1,231,501] >gb|EEV54171.1| dimethyladenosine transferase [Enterococcus faecium 1,231,410] >gb|EEW61968.1| dimethyladenosine transferase [Enterococcus faecium C68] >gb|EFF21571.1| dimethyladenosine transferase [Enterococcus faecium E1071] >gb|EFF28418.1| dimethyladenosine transferase [Enterococcus faecium U0317] >gb|EFF34481.1| dimethyladenosine transferase [Enterococcus faecium E1162] 102 102 92% 1e-20  
YP_003256969.1 dimethyladenosine transferase [Blattabacterium sp. (Periplaneta americana) str. BPLAN] >gb|ACX83826.1| dimethyladenosine transferase [Blattabacterium sp. (Periplaneta americana) str. BPLAN] 102 102 93% 1e-20  
YP_910478.1 dimethyladenosine transferase [Bifidobacterium adolescentis ATCC 15703] >sp|A1A3W3.1|RSMA_BIFAA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAF40396.1| dimethyladenosine transferase [Bifidobacterium adolescentis ATCC 15703] 102 102 93% 1e-20  
ZP_01446555.1 dimethyladenosine transferase [alpha proteobacterium HTCC2255] >gb|EAU52727.1| dimethyladenosine transferase [alpha proteobacterium HTCC2255] 102 102 92% 2e-20  
YP_003445435.1 dimethyladenosine transferase [Streptococcus mitis B6] >emb|CBJ21567.1| dimethyladenosine transferase [Streptococcus mitis B6] 102 102 92% 2e-20  
ZP_03224825.1 dimethyladenosine transferase [Bacillus coahuilensis m4-4] 102 102 93% 2e-20  
ZP_02027733.1 hypothetical protein BIFADO_00135 [Bifidobacterium adolescentis L2-32] >gb|EDN83234.1| hypothetical protein BIFADO_00135 [Bifidobacterium adolescentis L2-32] 102 102 93% 2e-20  
YP_002936180.1 dimethyladenosine transferase [Eubacterium rectale ATCC 33656] >gb|ACR74046.1| dimethyladenosine transferase [Eubacterium rectale ATCC 33656] 102 102 94% 2e-20  
ZP_06595065.1 dimethyladenosine transferase [Bifidobacterium breve DSM 20213] >gb|EFE90121.1| dimethyladenosine transferase [Bifidobacterium breve DSM 20213] 102 102 93% 2e-20  
ZP_04817251.1 dimethyladenosine transferase [Staphylococcus epidermidis M23864:W1] >gb|EES42227.1| dimethyladenosine transferase [Staphylococcus epidermidis M23864:W1] 102 102 90% 2e-20  
ZP_05884422.1 dimethyladenosine transferase [Vibrio coralliilyticus ATCC BAA-450] >gb|EEX34871.1| dimethyladenosine transferase [Vibrio coralliilyticus ATCC BAA-450] 102 102 100% 2e-20  
YP_002261899.1 dimethyladenosine transferase [Aliivibrio salmonicida LFI1238] >sp|B6EL48.1|RSMA_ALISL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAQ78053.1| dimethyladenosine transferase [Aliivibrio salmonicida LFI1238] 102 102 100% 2e-20  
ZP_01363496.1 hypothetical protein PaerPA_01000591 [Pseudomonas aeruginosa PACS2] >ref|ZP_04937008.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa 2192] >gb|EAZ61127.1| rRNA (adenine-N6,N6)-dimethyltransferase [Pseudomonas aeruginosa 2192] 102 102 99% 2e-20  
ZP_05129436.1 dimethyladenosine transferase [gamma proteobacterium NOR5-3] >gb|EED30586.1| dimethyladenosine transferase [gamma proteobacterium NOR5-3] 102 102 92% 2e-20  
ACJ23055.1 truncated KsgA [Neisseria gonorrhoeae] 102 102 94% 2e-20  
ACJ23058.1 KsgA [Neisseria gonorrhoeae] 101 101 94% 2e-20  
ZP_04836160.1 dimethyladenosine transferase [Corynebacterium matruchotii ATCC 14266] >gb|EES80507.1| dimethyladenosine transferase [Corynebacterium matruchotii ATCC 14266] 101 101 91% 2e-20  
YP_001049370.1 dimethyladenosine transferase [Shewanella baltica OS155] >ref|YP_002359220.1| dimethyladenosine transferase [Shewanella baltica OS223] >sp|A3D188.1|RSMA_SHEB5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B8EB35.1|RSMA_SHEB2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABN60501.1| dimethyladenosine transferase [Shewanella baltica OS155] >gb|ACK47797.1| dimethyladenosine transferase [Shewanella baltica OS223] 101 101 98% 2e-20  
ZP_03743378.1 hypothetical protein BIFPSEUDO_03972 [Bifidobacterium pseudocatenulatum DSM 20438] >gb|EEG70231.1| hypothetical protein BIFPSEUDO_03972 [Bifidobacterium pseudocatenulatum DSM 20438] 101 101 93% 2e-20  
ZP_03712225.1 hypothetical protein CORMATOL_03081 [Corynebacterium matruchotii ATCC 33806] >gb|EEG25465.1| hypothetical protein CORMATOL_03081 [Corynebacterium matruchotii ATCC 33806] 101 101 91% 2e-20  
ACJ23057.1 KsgA [Neisseria gonorrhoeae] 101 101 94% 2e-20  
YP_001365261.1 dimethyladenosine transferase [Shewanella baltica OS185] >ref|YP_001553515.1| dimethyladenosine transferase [Shewanella baltica OS195] >sp|A6WK59.1|RSMA_SHEB8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9L438.1|RSMA_SHEB9 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS07198.1| dimethyladenosine transferase [Shewanella baltica OS185] >gb|ABX48255.1| dimethyladenosine transferase [Shewanella baltica OS195] 101 101 98% 2e-20  
ZP_03390770.1 dimethyladenosine transferase [Capnocytophaga sputigena Capno] >gb|EEB66154.1| dimethyladenosine transferase [Capnocytophaga sputigena Capno] 101 101 100% 2e-20  
CBK71425.1 dimethyladenosine transferase [Bifidobacterium pseudocatenulatum D2CA] 101 101 93% 2e-20  
NP_229237.1 dimethyladenosine transferase [Thermotoga maritima MSB8] >sp|Q9X1F1.1|RSMA_THEMA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAD36507.1|AE001795_10 dimethyladenosine transferase [Thermotoga maritima MSB8] 101 101 90% 2e-20  
ZP_02191479.1 16S rRNA dimethylase [alpha proteobacterium BAL199] >gb|EDP61836.1| 16S rRNA dimethylase [alpha proteobacterium BAL199] 101 101 99% 2e-20  
YP_693768.1 ribosomal RNA adenine dimethylase [Alcanivorax borkumensis SK2] >sp|Q0VMV2.1|RSMA_ALCBS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAL17496.1| Ribosomal RNA adenine dimethylase [Alcanivorax borkumensis SK2] 101 101 90% 3e-20  
YP_001235734.1 dimethyladenosine transferase [Acidiphilium cryptum JF-5] >gb|ABQ31815.1| dimethyladenosine transferase [Acidiphilium cryptum JF-5] 101 101 92% 3e-20  
ZP_06156248.1 dimethyladenosine transferase [Photobacterium damselae subsp. damselae CIP 102761] >gb|EEZ41945.1| dimethyladenosine transferase [Photobacterium damselae subsp. damselae CIP 102761] 101 101 92% 3e-20  
ZP_03702666.1 dimethyladenosine transferase [Flavobacteria bacterium MS024-2A] >gb|EEG41757.1| dimethyladenosine transferase [Flavobacteria bacterium MS024-2A] 101 101 93% 3e-20  
ZP_06637217.1 dimethyladenosine transferase [Serratia odorifera DSM 4582] >gb|EFE97646.1| dimethyladenosine transferase [Serratia odorifera DSM 4582] 101 101 99% 3e-20  
CBK87655.1 dimethyladenosine transferase [Enterobacter cloacae NCTC 9394] 101 101 97% 3e-20  
YP_003346872.1 dimethyladenosine transferase [Thermotoga naphthophila RKU-10] >gb|ADA67458.1| dimethyladenosine transferase [Thermotoga naphthophila RKU-10] 101 101 90% 3e-20  
ZP_06198303.1 dimethyladenosine transferase [Streptococcus sp. M143] >gb|EFA25458.1| dimethyladenosine transferase [Streptococcus sp. M143] 101 101 92% 3e-20  
ZP_06684093.1 dimethyladenosine transferase [Enterococcus faecium E980] >gb|EFF36179.1| dimethyladenosine transferase [Enterococcus faecium E980] 101 101 92% 3e-20  
ZP_06120330.1 dimethyladenosine transferase [Caulobacter segnis ATCC 21756] >gb|ADG10756.1| dimethyladenosine transferase [Caulobacter segnis ATCC 21756] 101 101 98% 3e-20  
YP_001346131.1 dimethyladenosine transferase [Pseudomonas aeruginosa PA7] >gb|ABR84846.1| dimethyladenosine transferase [Pseudomonas aeruginosa PA7] 100 100 92% 3e-20  
ZP_05679414.1 dimethyladenosine transferase [Enterococcus faecium Com15] >gb|EEV62747.1| dimethyladenosine transferase [Enterococcus faecium Com15] 100 100 92% 4e-20  
ZP_03982484.1 dimethyladenosine transferase [Enterococcus faecium TX1330] >ref|ZP_05667978.1| dimethyladenosine transferase [Enterococcus faecium 1,141,733] >ref|ZP_05676438.1| dimethyladenosine transferase [Enterococcus faecium Com12] >ref|ZP_06624746.1| dimethyladenosine transferase [Enterococcus faecalis PC1.1] >gb|EEI59419.1| dimethyladenosine transferase [Enterococcus faecium TX1330] >gb|EEV51311.1| dimethyladenosine transferase [Enterococcus faecium 1,141,733] >gb|EEV59771.1| dimethyladenosine transferase [Enterococcus faecium Com12] >gb|EFF61059.1| dimethyladenosine transferase [Enterococcus faecalis PC1.1] 100 100 92% 4e-20  
YP_002739071.1 dimethyladenosine transferase [Streptococcus pneumoniae P1031] >sp|C1CMT3.1|RSMA_STRZP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACO21814.1| dimethyladenosine transferase [Streptococcus pneumoniae P1031] 100 100 92% 4e-20  
YP_128180.1 dimethyladenosine transferase [Legionella pneumophila str. Lens] >sp|Q5WSM3.1|RSMA_LEGPL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH17099.1| hypothetical protein [Legionella pneumophila str. Lens] 100 100 97% 4e-20  
YP_001956705.1 dimethyladenosine transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >dbj|BAG14244.1| dimethyladenosine transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] 100 100 89% 4e-20  
NP_459095.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] >sp|Q56016.2|RSMA_SALTY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAL19054.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase; kasugamycin resistance [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] 100 100 95% 4e-20  
ZP_05966812.1 hypothetical protein ENTCAN_05155 [Enterobacter cancerogenus ATCC 35316] >gb|EFC57719.1| hypothetical protein ENTCAN_05155 [Enterobacter cancerogenus ATCC 35316] 100 100 97% 4e-20  
CBK92549.1 dimethyladenosine transferase [Eubacterium rectale M104/1] 100 100 94% 4e-20  
AAT50842.1 PA0592 [synthetic construct] 100 100 99% 4e-20  
NP_777760.1 dimethyladenosine transferase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >sp|P59524.1|RSMA_BUCBP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO26865.1| dimethyladenosine transferase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] 100 100 90% 4e-20  
CBK92053.1 dimethyladenosine transferase [Eubacterium rectale A1-86 (DSM 17629)] 100 100 94% 4e-20  
YP_003550962.1 dimethyladenosine transferase [alpha proteobacterium IMCC1322] >gb|ADE38878.1| dimethyladenosine transferase [alpha proteobacterium IMCC1322] 100 100 90% 4e-20  
YP_001454848.1 dimethyladenosine transferase [Citrobacter koseri ATCC BAA-895] >sp|A8ALP9.1|RSMA_CITK8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV14412.1| hypothetical protein CKO_03329 [Citrobacter koseri ATCC BAA-895] 100 100 99% 4e-20  
ZP_01075665.1 rRNA (adenine-N6,N6)-dimethyltransferase [Marinomonas sp. MED121] >gb|EAQ66512.1| rRNA (adenine-N6,N6)-dimethyltransferase [Marinomonas sp. MED121] 100 100 100% 5e-20  
YP_203669.1 dimethyladenosine transferase [Vibrio fischeri ES114] >ref|YP_002155045.1| dimethyladenosine transferase [Vibrio fischeri MJ11] >sp|Q5E865.1|RSMA_VIBF1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5FGG5.1|RSMA_VIBFM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAW84781.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Vibrio fischeri ES114] >gb|ACH65170.1| dimethyladenosine transferase [Vibrio fischeri MJ11] 100 100 100% 5e-20  
YP_003559693.1 dimethyladenosine transferase [Mycoplasma crocodyli MP145] >gb|ADE19999.1| dimethyladenosine transferase [Mycoplasma crocodyli MP145] 100 100 98% 5e-20  
YP_302353.1 dimethyladenosine transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >sp|Q49V02.1|RSMA_STAS1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE19408.1| dimethyladenosine transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] 100 100 92% 5e-20  
ZP_03323253.1 hypothetical protein BIFCAT_00011 [Bifidobacterium catenulatum DSM 16992] >gb|EEB22381.1| hypothetical protein BIFCAT_00011 [Bifidobacterium catenulatum DSM 16992] 100 100 93% 5e-20  
ZP_05404333.1 dimethyladenosine transferase [Mitsuokella multacida DSM 20544] >gb|EEX68881.1| dimethyladenosine transferase [Mitsuokella multacida DSM 20544] 100 100 92% 5e-20  
ZP_04620164.1 Dimethyladenosine transferase [Yersinia aldovae ATCC 35236] >gb|EEP95350.1| Dimethyladenosine transferase [Yersinia aldovae ATCC 35236] 100 100 99% 6e-20  
ZP_05094186.1 dimethyladenosine transferase [marine gamma proteobacterium HTCC2148] >gb|EEB79396.1| dimethyladenosine transferase [marine gamma proteobacterium HTCC2148] 100 100 100% 6e-20  
YP_096921.1 dimethyladenosine transferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >sp|Q5ZRF4.1|RSMA_LEGPH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAU28974.1| dimethyladenosine transferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] 100 100 97% 6e-20  
NP_660491.1 dimethyladenosine transferase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >sp|Q8KA00.1|RSMA_BUCAP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAM67702.1| dimethyladenosine transferase [Buchnera aphidicola str. Sg (Schizaphis graminum)] 100 100 97% 6e-20  
YP_002355112.1 dimethyladenosine transferase [Thauera sp. MZ1T] >gb|ACK54216.1| dimethyladenosine transferase [Thauera sp. MZ1T] 100 100 91% 6e-20  
YP_002886064.1 dimethyladenosine transferase [Exiguobacterium sp. AT1b] >gb|ACQ70619.1| dimethyladenosine transferase [Exiguobacterium sp. AT1b] 100 100 92% 6e-20  
NP_871023.1 hypothetical protein WGLp020 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >sp|Q8D3I1.1|RSMA_WIGBR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC24166.1| ksgA [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] 100 100 92% 6e-20  
YP_001171273.1 dimethyladenosine transferase [Pseudomonas stutzeri A1501] >gb|ABP78431.1| dimethyladenosine transferase [Pseudomonas stutzeri A1501] 100 100 99% 6e-20  
ZP_02061722.1 dimethyladenosine transferase [Rickettsiella grylli] >gb|EDP45727.1| dimethyladenosine transferase [Rickettsiella grylli] 100 100 91% 6e-20  
YP_125297.1 dimethyladenosine transferase [Legionella pneumophila str. Paris] >ref|YP_001252466.1| dimethyladenosine transferase [Legionella pneumophila str. Corby] >sp|Q5X0V1.1|RSMA_LEGPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5IIC0.1|RSMA_LEGPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH14148.1| hypothetical protein [Legionella pneumophila str. Paris] >gb|ABQ57120.1| dimethyladenosine transferase [Legionella pneumophila str. Corby] 100 100 97% 6e-20  
NP_965914.1 dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila melanogaster] >ref|ZP_01314444.1| hypothetical protein Wendoof_01000753 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >sp|Q73IR3.1|RSMA_WOLPM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAS13848.1| dimethyladenosine transferase [Wolbachia endosymbiont of Drosophila melanogaster] 100 100 96% 7e-20  
ZP_04640987.1 Dimethyladenosine transferase [Yersinia mollaretii ATCC 43969] >gb|EEQ10448.1| Dimethyladenosine transferase [Yersinia mollaretii ATCC 43969] 100 100 99% 7e-20  
ZP_05348033.1 dimethyladenosine transferase [Bryantella formatexigens DSM 14469] >gb|EET59140.1| dimethyladenosine transferase [Bryantella formatexigens DSM 14469] 100 100 95% 7e-20  
ZP_04626701.1 Dimethyladenosine transferase [Yersinia bercovieri ATCC 43970] >gb|EEQ08313.1| Dimethyladenosine transferase [Yersinia bercovieri ATCC 43970] 100 100 99% 7e-20  
ZP_06675834.1 dimethyladenosine transferase [Enterococcus faecium E1039] >gb|EFF30879.1| dimethyladenosine transferase [Enterococcus faecium E1039] 100 100 92% 8e-20  
ZP_03934216.1 dimethyladenosine transferase [Corynebacterium striatum ATCC 6940] >gb|EEI79259.1| dimethyladenosine transferase [Corynebacterium striatum ATCC 6940] 100 100 93% 8e-20  
YP_001004982.1 dimethyladenosine transferase [Yersinia enterocolitica subsp. enterocolitica 8081] >sp|A1JJF4.1|RSMA_YERE8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAL10742.1| dimethyladenosine transferase [Yersinia enterocolitica subsp. enterocolitica 8081] 100 100 99% 8e-20  
YP_506251.1 dimethyladenosine transferase [Neorickettsia sennetsu str. Miyayama] >sp|Q2GE45.1|RSMA_NEOSM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABD46348.1| dimethyladenosine transferase [Neorickettsia sennetsu str. Miyayama] 99.8 99.8 90% 8e-20  
YP_002240485.1 dimethyladenosine transferase [Klebsiella pneumoniae 342] >ref|YP_003441244.1| dimethyladenosine transferase [Klebsiella variicola At-22] >ref|ZP_06551972.1| dimethyladenosine transferase [Klebsiella sp. 1_1_55] >sp|B5Y1Z4.1|RSMA_KLEP3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACI09362.1| dimethyladenosine transferase [Klebsiella pneumoniae 342] >gb|ADC60212.1| dimethyladenosine transferase [Klebsiella variicola At-22] >gb|EFD82949.1| dimethyladenosine transferase [Klebsiella sp. 1_1_55] 99.8 99.8 95% 8e-20  
ZP_02709236.1 dimethyladenosine transferase [Streptococcus pneumoniae CDC1873-00] >gb|EDT50553.1| dimethyladenosine transferase [Streptococcus pneumoniae CDC1873-00] 99.8 99.8 92% 8e-20  
NP_359391.1 dimethyladenosine transferase [Streptococcus pneumoniae R6] >ref|YP_817204.1| dimethyladenosine transferase [Streptococcus pneumoniae D39] >ref|ZP_02716183.1| dimethyladenosine transferase [Streptococcus pneumoniae CDC0288-04] >sp|Q8DND3.1|RSMA_STRR6 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q04II4.1|RSMA_STRP2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAL00602.1| Dimethyladenosine transferase [Streptococcus pneumoniae R6] >gb|ABJ54063.1| dimethyladenosine transferase [Streptococcus pneumoniae D39] >gb|EDT94233.1| dimethyladenosine transferase [Streptococcus pneumoniae CDC0288-04] 99.8 99.8 92% 8e-20  
YP_002801763.1 dimethyladenosine transferase [Azotobacter vinelandii DJ] >gb|ACO80788.1| dimethyladenosine transferase [Azotobacter vinelandii DJ] 99.8 99.8 100% 8e-20  
ZP_06603851.1 dimethyladenosine transferase [Selenomonas noxia ATCC 43541] >gb|EFF65807.1| dimethyladenosine transferase [Selenomonas noxia ATCC 43541] 99.8 99.8 90% 9e-20  
YP_001836666.1 dimethyladenosine transferase [Streptococcus pneumoniae CGSP14] >sp|B2IM67.1|RSMA_STRPS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACB91201.1| dimethyladenosine transferase [Streptococcus pneumoniae CGSP14] 99.8 99.8 92% 9e-20  
YP_001137889.1 dimethyladenosine transferase [Corynebacterium glutamicum R] >sp|A4QCP0.1|RSMA_CORGB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAF53987.1| hypothetical protein [Corynebacterium glutamicum R] 99.8 99.8 92% 9e-20  
ZP_01219952.1 dimethyladenosine transferase [Photobacterium profundum 3TCK] >gb|EAS43574.1| dimethyladenosine transferase [Photobacterium profundum 3TCK] 99.8 99.8 100% 9e-20  
ZP_01821260.1 dimethyladenosine transferase [Streptococcus pneumoniae SP6-BS73] >gb|EDK75731.1| dimethyladenosine transferase [Streptococcus pneumoniae SP6-BS73] 99.8 99.8 92% 9e-20  
NP_600138.1 dimethyladenosine transferase [Corynebacterium glutamicum ATCC 13032] >ref|YP_225202.1| dimethyladenosine transferase [Corynebacterium glutamicum ATCC 13032] >sp|Q8NRY1.1|RSMA_CORGL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB98303.1| Dimethyladenosine transferase (rRNA methylation) [Corynebacterium glutamicum ATCC 13032] >emb|CAF19616.1| PUTATIVE DIMETHYLADENOSINE TRANSFERASE [Corynebacterium glutamicum ATCC 13032] 99.8 99.8 92% 9e-20  
NP_924937.1 rRNA (adenine-N6,N6)-dimethyltransferase [Gloeobacter violaceus PCC 7421] >sp|Q7NJ41.1|RSMA_GLOVI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC89932.1| rRNA (adenine-N6,N6)-dimethyltransferase [Gloeobacter violaceus PCC 7421] 99.8 99.8 92% 1e-19  
YP_003373331.1 dimethyladenosine transferase [Gardnerella vaginalis 409-05] >gb|ADB13573.1| dimethyladenosine transferase [Gardnerella vaginalis 409-05] 99.4 99.4 93% 1e-19  
YP_303033.1 dimethyladenosine transferase [Ehrlichia canis str. Jake] >sp|Q3YS70.1|RSMA_EHRCJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ68435.1| dimethyladenosine transferase [Ehrlichia canis str. Jake] 99.4 99.4 92% 1e-19  
ZP_05515302.1 dimethyladenosine transferase [Streptomyces hygroscopicus ATCC 53653] 99.4 99.4 90% 1e-19  
YP_001244947.1 dimethyladenosine transferase [Thermotoga petrophila RKU-1] >ref|ZP_05097257.1| dimethyladenosine transferase [Marinitoga piezophila KA3] >sp|A5IME8.1|RSMA_THEP1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABQ47371.1| dimethyladenosine transferase [Thermotoga petrophila RKU-1] >gb|EEB81809.1| dimethyladenosine transferase [Marinitoga piezophila KA3] 99.4 99.4 90% 1e-19  
YP_002297777.1 dimethyladenosine transferase [Rhodospirillum centenum SW] >gb|ACI98964.1| dimethyladenosine transferase [Rhodospirillum centenum SW] 99.4 99.4 92% 1e-19  
ZP_03344183.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] 99.4 99.4 95% 1e-19  
ABC97666.1 KsgA [Shigella boydii] 99.4 99.4 99% 1e-19  
YP_705608.1 dimethyladenosine transferase [Rhodococcus jostii RHA1] >sp|Q0S4T6.1|RSMA_RHOSR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG97450.1| probable rRNA dimethyladenosine transferase [Rhodococcus jostii RHA1] 99.4 99.4 96% 1e-19  
YP_001751646.1 dimethyladenosine transferase [Pseudomonas putida W619] >gb|ACA75277.1| dimethyladenosine transferase [Pseudomonas putida W619] 99.4 99.4 99% 1e-19  
ZP_02420134.1 hypothetical protein ANACAC_02744 [Anaerostipes caccae DSM 14662] >gb|EDR96713.1| hypothetical protein ANACAC_02744 [Anaerostipes caccae DSM 14662] 99.4 99.4 95% 1e-19  
ZP_01615208.1 dimethyladenosine transferase [marine gamma proteobacterium HTCC2143] >gb|EAW32291.1| dimethyladenosine transferase [marine gamma proteobacterium HTCC2143] 99.4 99.4 99% 1e-19  
YP_001265789.1 dimethyladenosine transferase [Pseudomonas putida F1] >gb|ABQ76605.1| dimethyladenosine transferase [Pseudomonas putida F1] 99.4 99.4 99% 1e-19  
ZP_04693831.1 dimethyladenosine transferase [Streptomyces roseosporus NRRL 15998] >ref|ZP_04709021.1| dimethyladenosine transferase [Streptomyces roseosporus NRRL 11379] >ref|ZP_06584734.1| dimethyladenosine transferase dimethyltransferase [Streptomyces roseosporus NRRL 15998] >gb|EFE75195.1| dimethyladenosine transferase dimethyltransferase [Streptomyces roseosporus NRRL 15998] 99.4 99.4 90% 1e-19  
YP_003142086.1 dimethyladenosine transferase [Capnocytophaga ochracea DSM 7271] >gb|ACU93525.1| dimethyladenosine transferase [Capnocytophaga ochracea DSM 7271] 99.4 99.4 100% 1e-19  
YP_002039320.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >sp|B4T6L6.1|RSMA_SALNS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACF65421.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Newport str. SL254] 99.4 99.4 95% 1e-19  
ZP_06315653.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus WW2703/97] >ref|ZP_06317937.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus WBG10049] >gb|EFB56285.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus WBG10049] >gb|EFB58566.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus WW2703/97] 99.4 99.4 90% 1e-19  
ZP_02218812.1 dimethyladenosine transferase [Coxiella burnetii RSA 334] >ref|YP_002304376.1| dimethyladenosine transferase [Coxiella burnetii CbuG_Q212] >ref|NP_820957.2| dimethyladenosine transferase [Coxiella burnetii RSA 493] >sp|Q83AC2.2|RSMA_COXBU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B6J3A6.1|RSMA_COXB2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EDR36158.1| dimethyladenosine transferase [Coxiella burnetii RSA 334] >gb|AAO91471.2| dimethyladenosine transferase [Coxiella burnetii RSA 493] >gb|ACJ19231.1| dimethyladenosine transferase [Coxiella burnetii CbuG_Q212] 99.4 99.4 100% 1e-19  
NP_742568.1 dimethyladenosine transferase [Pseudomonas putida KT2440] >sp|Q88QT6.1|RSMA_PSEPK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN66032.1|AE016232_5 dimethyladenosine transferase [Pseudomonas putida KT2440] 99.4 99.4 99% 1e-19  
YP_001595993.1 dimethyladenosine transferase [Coxiella burnetii RSA 331] >sp|A9N9I7.1|RSMA_COXBR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX77894.1| dimethyladenosine transferase [Coxiella burnetii RSA 331] 99.4 99.4 100% 1e-19  
ZP_01236602.1 dimethyladenosine transferase [Vibrio angustum S14] >gb|EAS63255.1| dimethyladenosine transferase [Vibrio angustum S14] 99.0 99.0 100% 1e-19  
YP_002522511.1 dimethyladenosine transferase [Thermomicrobium roseum DSM 5159] >gb|ACM04812.1| dimethyladenosine transferase [Thermomicrobium roseum DSM 5159] 99.0 99.0 99% 1e-19  
ZP_02902942.1 dimethyladenosine transferase [Escherichia albertii TW07627] >gb|EDS91524.1| dimethyladenosine transferase [Escherichia albertii TW07627] 99.0 99.0 99% 1e-19  
YP_002986235.1 dimethyladenosine transferase [Dickeya dadantii Ech703] >gb|ACS84413.1| dimethyladenosine transferase [Dickeya dadantii Ech703] 99.0 99.0 97% 1e-19  
ZP_02698269.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gb|EDX51195.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] 99.0 99.0 95% 1e-19  
ZP_02711630.1 dimethyladenosine transferase [Streptococcus pneumoniae CDC1087-00] >gb|EDT90491.1| dimethyladenosine transferase [Streptococcus pneumoniae CDC1087-00] 99.0 99.0 92% 1e-19  
YP_039944.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus MRSA252] >ref|ZP_05601032.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 55/2053] >ref|ZP_05603671.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 65-1322] >ref|ZP_05606293.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 68-397] >ref|ZP_05608972.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus E1410] >ref|ZP_05611564.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M876] >ref|ZP_06310970.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C160] >ref|ZP_06312728.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Btn1260] >ref|ZP_06321111.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M899] >ref|ZP_06326014.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C427] >ref|ZP_06330711.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C101] >ref|ZP_06374740.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus A017934/97] >ref|ZP_06666221.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus 58-424] >ref|ZP_06668023.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M809] >ref|ZP_06670586.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M1015] >ref|ZP_06819664.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus EMRSA16] >sp|Q6GJH8.1|RSMA_STAAR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAG39516.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus MRSA252] >gb|EEV04751.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 55/2053] >gb|EEV07389.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 65-1322] >gb|EEV10018.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus 68-397] >gb|EEV12608.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus E1410] >gb|EEV15268.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M876] >gb|EFB44931.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C101] >gb|EFB48209.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C427] >gb|EFB53111.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M899] >gb|EFB61494.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Btn1260] >gb|EFC01464.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus C160] >gb|EFC30016.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus A017934/97] >gb|EFD98362.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M1015] >gb|EFE26589.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus 58-424] >gb|EFF10362.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus M809] >gb|EFG58659.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus EMRSA16] 99.0 99.0 90% 1e-19  
ZP_04579548.1 dimethyladenosine transferase dimethyltransferase [Oxalobacter formigenes OXCC13] >gb|EEO30521.1| dimethyladenosine transferase dimethyltransferase [Oxalobacter formigenes OXCC13] 99.0 99.0 93% 1e-19  
YP_001550596.1 dimethyladenosine transferase [Prochlorococcus marinus str. MIT 9211] >sp|A9B9Y0.1|RSMA_PROM4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX08642.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Prochlorococcus marinus str. MIT 9211] 99.0 99.0 92% 1e-19  
YP_215072.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >sp|Q57TH0.1|RSMA_SALCH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAX63991.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase; kasugamycin resistance [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] 99.0 99.0 95% 1e-19  
YP_003154762.1 dimethyladenosine transferase [Brachybacterium faecium DSM 4810] >gb|ACU85172.1| dimethyladenosine transferase [Brachybacterium faecium DSM 4810] 99.0 99.0 91% 1e-19  
ZP_03986141.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus MN8] >ref|ZP_04018426.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH60] >gb|EEI97289.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus MN8] >gb|EEJ60886.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH60] 99.0 99.0 90% 1e-19  
YP_001103069.1 dimethyladenosine transferase [Saccharopolyspora erythraea NRRL 2338] >ref|ZP_06562575.1| dimethyladenosine transferase [Saccharopolyspora erythraea NRRL 2338] >emb|CAM00143.1| dimethyladenosine transferase (rRNA methylation) [Saccharopolyspora erythraea NRRL 2338] 99.0 99.0 91% 1e-19  
YP_001425385.1 dimethyladenosine transferase [Coxiella burnetii Dugway 5J108-111] >sp|A9KGZ8.1|RSMA_COXBN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS78047.1| dimethyladenosine transferase [Coxiella burnetii Dugway 5J108-111] 99.0 99.0 100% 1e-19  
NP_454702.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >ref|NP_803977.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >ref|YP_149436.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >ref|YP_001586391.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >ref|ZP_02344484.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >ref|ZP_02571053.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >ref|ZP_02655417.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >ref|ZP_02668435.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >ref|ZP_02684205.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >ref|ZP_02832928.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >ref|YP_002044058.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >ref|ZP_03076271.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >ref|YP_002145074.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >ref|ZP_03163084.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >ref|YP_002140933.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] >ref|YP_002214042.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >ref|ZP_03215884.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >ref|ZP_03217864.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >ref|YP_002225231.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] >ref|YP_002242254.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] >ref|ZP_03346739.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] >ref|ZP_03360283.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] >ref|ZP_03378953.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. J185] >ref|YP_002635730.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] >ref|ZP_04654985.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] >ref|ZP_06545295.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] >sp|Q8Z9J7.1|RSMA_SALTI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q5PDD9.1|RSMA_SALPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9MYM4.1|RSMA_SALPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5F771.1|RSMA_SALA4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5FI34.1|RSMA_SALDC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5R1S8.1|RSMA_SALEP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5RGC2.1|RSMA_SALG2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B4TJ47.1|RSMA_SALHS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5BL27.1|RSMA_SALPK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C0Q5E7.1|RSMA_SALPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >pir||AF0513 dimethyladenosine transferase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >emb|CAD01246.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi] >gb|AAO67826.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gb|AAV76124.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gb|ABX65558.1| hypothetical protein SPAB_00115 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gb|ACF68749.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gb|EDX45490.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >emb|CAR58198.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] >gb|ACH50298.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gb|EDY23885.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gb|ACH75946.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gb|EDZ04915.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gb|EDZ08522.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >emb|CAR35999.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] >gb|EDZ12172.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gb|EDZ18299.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gb|EDZ21805.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gb|EDZ24164.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gb|EDZ29279.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gb|EDZ35499.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >emb|CAR31679.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] >gb|ACN44289.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] >emb|CBG23111.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] >gb|ACY86646.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] 99.0 99.0 95% 1e-19  
ZP_05942783.1 dimethyladenosine transferase [Vibrio orientalis CIP 102891] >gb|EEX95309.1| dimethyladenosine transferase [Vibrio orientalis CIP 102891] 99.0 99.0 99% 2e-19  
ZP_04617069.1 Dimethyladenosine transferase [Yersinia ruckeri ATCC 29473] >gb|EEP98412.1| Dimethyladenosine transferase [Yersinia ruckeri ATCC 29473] 99.0 99.0 99% 2e-19  
Q6LV41.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 99.0 99.0 100% 2e-19  
ZP_01445152.1 dimethyladenosine transferase [Roseovarius sp. HTCC2601] >gb|EAU44650.1| dimethyladenosine transferase [Roseovarius sp. HTCC2601] 99.0 99.0 92% 2e-19  
NP_346412.1 dimethyladenosine transferase [Streptococcus pneumoniae TIGR4] >gb|AAK76052.1| dimethyladenosine transferase [Streptococcus pneumoniae TIGR4] 99.0 99.0 92% 2e-19  
YP_002741250.1 dimethyladenosine transferase [Streptococcus pneumoniae 70585] >sp|C1CA29.1|RSMA_STRP7 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACO16459.1| dimethyladenosine transferase [Streptococcus pneumoniae 70585] 99.0 99.0 92% 2e-19  
YP_388551.1 dimethyladenosine transferase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >sp|Q30ZP0.1|RSMA_DESDG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB38856.1| dimethyladenosine transferase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] 99.0 99.0 94% 2e-19  
YP_001855591.1 dimethyladenosine transferase [Kocuria rhizophila DC2201] >dbj|BAG30085.1| dimethyladenosine transferase [Kocuria rhizophila DC2201] 99.0 99.0 92% 2e-19  
ZP_02659903.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >ref|YP_002113107.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >sp|B4TWT6.1|RSMA_SALSV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACF89590.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gb|EDY31308.1| dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] 99.0 99.0 95% 2e-19  
YP_128636.1 dimethyladenosine transferase [Photobacterium profundum SS9] >emb|CAG18834.1| putative dimethyladenosine transferase [Photobacterium profundum SS9] 99.0 99.0 100% 2e-19  
YP_001695338.1 dimethyladenosine transferase [Streptococcus pneumoniae Hungary19A-6] >ref|YP_002038567.1| dimethyladenosine transferase [Streptococcus pneumoniae G54] >ref|ZP_04525254.1| dimethyladenosine transferase [Streptococcus pneumoniae CCRI 1974] >ref|ZP_04598405.1| dimethyladenosine transferase [Streptococcus pneumoniae CCRI 1974M2] >sp|B5E2H6.1|RSMA_STRP4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1I8T7.1|RSMA_STRPI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA37478.1| dimethyladenosine transferase [Streptococcus pneumoniae Hungary19A-6] >gb|ACF55240.1| dimethyladenosine transferase [Streptococcus pneumoniae G54] 99.0 99.0 92% 2e-19  
ZP_02718917.1 dimethyladenosine transferase [Streptococcus pneumoniae CDC3059-06] >ref|YP_002736986.1| dimethyladenosine transferase [Streptococcus pneumoniae JJA] >sp|C1CGR5.1|RSMA_STRZJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EDT95868.1| dimethyladenosine transferase [Streptococcus pneumoniae CDC3059-06] >gb|ACO18470.1| dimethyladenosine transferase [Streptococcus pneumoniae JJA] 99.0 99.0 92% 2e-19  
YP_002767807.1 dimethyladenosine transferase [Rhodococcus erythropolis PR4] >ref|ZP_04388709.1| dimethyladenosine transferase [Rhodococcus erythropolis SK121] >sp|C1A383.1|RSMA_RHOE4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAH35068.1| dimethyladenosine transferase [Rhodococcus erythropolis PR4] >gb|EEN84052.1| dimethyladenosine transferase [Rhodococcus erythropolis SK121] 99.0 99.0 96% 2e-19  
YP_001260914.1 dimethyladenosine transferase [Sphingomonas wittichii RW1] >gb|ABQ66776.1| dimethyladenosine transferase [Sphingomonas wittichii RW1] 99.0 99.0 92% 2e-19  
ZP_01825956.1 dimethyladenosine transferase [Streptococcus pneumoniae SP11-BS70] >ref|ZP_02722481.1| dimethyladenosine transferase [Streptococcus pneumoniae MLV-016] >gb|EDK62754.1| dimethyladenosine transferase [Streptococcus pneumoniae SP11-BS70] >gb|EDT98169.1| dimethyladenosine transferase [Streptococcus pneumoniae MLV-016] 98.6 98.6 92% 2e-19  
YP_001981369.1 dimethyladenosine transferase [Cellvibrio japonicus Ueda107] >gb|ACE85834.1| dimethyladenosine transferase [Cellvibrio japonicus Ueda107] 98.6 98.6 100% 2e-19  
ZP_01818754.1 dimethyladenosine transferase [Streptococcus pneumoniae SP3-BS71] >gb|EDK73406.1| dimethyladenosine transferase [Streptococcus pneumoniae SP3-BS71] 98.6 98.6 92% 2e-19  
ZP_04630485.1 Dimethyladenosine transferase [Yersinia frederiksenii ATCC 33641] >gb|EEQ16691.1| Dimethyladenosine transferase [Yersinia frederiksenii ATCC 33641] 98.6 98.6 99% 2e-19  
ZP_01409492.1 hypothetical protein SpneT_02000042 [Streptococcus pneumoniae TIGR4] >ref|ZP_01822719.1| dimethyladenosine transferase [Streptococcus pneumoniae SP9-BS68] >ref|ZP_01835922.1| dimethyladenosine transferase [Streptococcus pneumoniae SP23-BS72] >ref|ZP_02714189.1| dimethyladenosine transferase [Streptococcus pneumoniae SP195] >ref|YP_002511863.1| dimethyladenosine transferase [Streptococcus pneumoniae ATCC 700669] >ref|YP_002743311.1| dimethyladenosine transferase [Streptococcus pneumoniae Taiwan19F-14] >ref|ZP_04798733.1| dimethyladenosine transferase [Streptococcus pneumoniae TCH8431/19A] >sp|Q97NN5.2|RSMA_STRPN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B8ZNY9.1|RSMA_STRPJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C1CTN9.1|RSMA_STRZT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EDK79145.1| dimethyladenosine transferase [Streptococcus pneumoniae SP9-BS68] >gb|EDK80961.1| dimethyladenosine transferase [Streptococcus pneumoniae SP23-BS72] >gb|EDT92145.1| dimethyladenosine transferase [Streptococcus pneumoniae SP195] >emb|CAR69755.1| dimethyladenosine transferase [Streptococcus pneumoniae ATCC 700669] >gb|ACO23189.1| dimethyladenosine transferase [Streptococcus pneumoniae Taiwan19F-14] >gb|EES39536.1| dimethyladenosine transferase [Streptococcus pneumoniae TCH8431/19A] 98.6 98.6 92% 2e-19  
ZP_04638781.1 Dimethyladenosine transferase [Yersinia intermedia ATCC 29909] >gb|EEQ17048.1| Dimethyladenosine transferase [Yersinia intermedia ATCC 29909] 98.6 98.6 99% 2e-19  
ZP_01833457.1 dimethyladenosine transferase [Streptococcus pneumoniae SP19-BS75] >gb|EDK70418.1| dimethyladenosine transferase [Streptococcus pneumoniae SP19-BS75] 98.6 98.6 92% 2e-19  
YP_001955395.1 dimethyladenosine transferase [Bifidobacterium longum DJO10A] >sp|B3DP38.1|RSMA_BIFLD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACD98897.1| Dimethyladenosine transferase for rRNA methylation [Bifidobacterium longum DJO10A] 98.6 98.6 93% 2e-19  
ZP_03353166.1 dimethyladenosine transferase [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] 98.6 98.6 91% 2e-19  
NP_765845.1 dimethyladenosine transferase [Staphylococcus epidermidis ATCC 12228] >ref|YP_187727.1| dimethyladenosine transferase [Staphylococcus epidermidis RP62A] >ref|ZP_04824274.1| dimethyladenosine transferase [Staphylococcus epidermidis BCM-HMP0060] >ref|ZP_06284295.1| dimethyladenosine transferase [Staphylococcus epidermidis SK135] >ref|ZP_06612822.1| dimethyladenosine transferase [Staphylococcus epidermidis M23864:W2(grey)] >sp|Q8CQU5.1|RSMA_STAES RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q5HRR2.1|RSMA_STAEQ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO05932.1|AE016751_227 dimethyladenosine transferase [Staphylococcus epidermidis ATCC 12228] >gb|AAW53476.1| dimethyladenosine transferase [Staphylococcus epidermidis RP62A] >gb|EES59326.1| dimethyladenosine transferase [Staphylococcus epidermidis BCM-HMP0060] >gb|EFA88302.1| dimethyladenosine transferase [Staphylococcus epidermidis SK135] >gb|EFE60088.1| dimethyladenosine transferase [Staphylococcus epidermidis M23864:W2(grey)] 98.6 98.6 90% 2e-19  
YP_001684150.1 dimethyladenosine transferase [Caulobacter sp. K31] >gb|ABZ71652.1| dimethyladenosine transferase [Caulobacter sp. K31] 98.6 98.6 98% 2e-19  
ZP_00206545.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Bifidobacterium longum DJO10A] 98.6 98.6 93% 2e-19  
ZP_06611445.1 dimethyladenosine transferase [Streptococcus oralis ATCC 35037] >gb|EFE56614.1| dimethyladenosine transferase [Streptococcus oralis ATCC 35037] 98.6 98.6 92% 2e-19  
ZP_03931237.1 dimethyladenosine transferase [Anaerococcus tetradius ATCC 35098] >gb|EEI81993.1| dimethyladenosine transferase [Anaerococcus tetradius ATCC 35098] 98.6 98.6 96% 2e-19  
YP_002323916.1 dimethyladenosine transferase [Bifidobacterium longum subsp. infantis ATCC 15697] >ref|ZP_04665901.1| dimethyladenosine transferase [Bifidobacterium longum subsp. infantis CCUG 52486] >sp|B7GPE3.1|RSMA_BIFLI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACJ53538.1| dimethyladenosine transferase [Bifidobacterium longum subsp. infantis ATCC 15697] >gb|EEQ54734.1| dimethyladenosine transferase [Bifidobacterium longum subsp. infantis CCUG 52486] 98.6 98.6 93% 2e-19  
ABC97695.1 KsgA [Shigella flexneri] >gb|ABC97696.1| KsgA [Shigella flexneri] 98.6 98.6 99% 2e-19  
ZP_05700821.1 dimethyladenosine transferase [Staphylococcus aureus A5948] >gb|EEV82365.1| dimethyladenosine transferase [Staphylococcus aureus A5948] 98.6 98.6 90% 2e-19  
ZP_03977121.1 dimethyladenosine transferase [Bifidobacterium longum subsp. infantis ATCC 55813] >gb|EEI80378.1| dimethyladenosine transferase [Bifidobacterium longum subsp. infantis ATCC 55813] 98.6 98.6 93% 2e-19  
YP_286855.1 dimethyladenosine transferase [Dechloromonas aromatica RCB] >sp|Q479U6.1|RSMA_DECAR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ48385.1| dimethyladenosine transferase [Dechloromonas aromatica RCB] 98.6 98.6 100% 2e-19  
ZP_01066423.1 dimethyladenosine transferase [Vibrio sp. MED222] >ref|YP_002416029.1| dimethyladenosine transferase [Vibrio splendidus LGP32] >sp|B7VIE2.1|RSMA_VIBSL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EAQ52268.1| dimethyladenosine transferase [Vibrio sp. MED222] >emb|CAV17379.1| Dimethyladenosine transferase [Vibrio splendidus LGP32] 98.6 98.6 100% 2e-19  
ZP_06717441.1 putative dimethyladenosine transferase [Ruminococcus albus 8] >gb|EFF18463.1| putative dimethyladenosine transferase [Ruminococcus albus 8] 98.6 98.6 90% 2e-19  
ZP_05643245.1 dimethyladenosine transferase [Staphylococcus aureus A9781] >ref|ZP_05680361.1| dimethyladenosine transferase [Staphylococcus aureus A9763] >ref|ZP_05683753.1| dimethyladenosine transferase [Staphylococcus aureus A9719] >ref|ZP_05687351.1| dimethyladenosine transferase [Staphylococcus aureus A9635] >gb|EEV26578.1| dimethyladenosine transferase [Staphylococcus aureus A9781] >gb|EEV65623.1| dimethyladenosine transferase [Staphylococcus aureus A9763] >gb|EEV67622.1| dimethyladenosine transferase [Staphylococcus aureus A9719] >gb|EEV69376.1| dimethyladenosine transferase [Staphylococcus aureus A9635] 98.6 98.6 90% 2e-19  
ZP_04826725.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH70] >ref|ZP_04865125.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_TCH959] >ref|ZP_04869392.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH130] >gb|EES56897.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH70] >gb|EES94039.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_TCH959] >gb|EES95516.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus TCH130] 98.6 98.6 90% 2e-19  
YP_002381292.1 dimethyladenosine transferase [Escherichia fergusonii ATCC 35469] >sp|B7LVU5.1|RSMA_ESCF3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAQ87648.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia fergusonii ATCC 35469] 98.6 98.6 99% 2e-19  
YP_001571902.1 dimethyladenosine transferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >sp|A9MQG2.1|RSMA_SALAR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX22760.1| hypothetical protein SARI_02914 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] 98.6 98.6 95% 2e-19  
Q2YVV2.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 98.6 98.6 90% 2e-19  
YP_415941.1 dimethyladenosine transferase [Staphylococcus aureus RF122] >emb|CAI80130.1| dimethyladenosine transferase [Staphylococcus aureus RF122] 98.2 98.2 90% 2e-19  
YP_391923.1 dimethyladenosine transferase [Thiomicrospira crunogena XCL-2] >sp|Q31F24.1|RSMA_THICR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB42249.1| dimethyladenosine transferase [Thiomicrospira crunogena XCL-2] 98.2 98.2 97% 2e-19  
YP_425523.1 dimethyladenosine transferase [Rhodospirillum rubrum ATCC 11170] >sp|Q2RXA9.1|RSMA_RHORT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC21236.1| dimethyladenosine transferase [Rhodospirillum rubrum ATCC 11170] 98.2 98.2 87% 2e-19  
YP_001331490.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus str. Newman] >sp|A6QEE6.1|RSMA_STAAE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAF66728.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus str. Newman] 98.2 98.2 90% 2e-19  
NP_373703.1 dimethyladenosine transferase [Staphylococcus aureus subsp. aureus N315] >ref|NP_645265.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus MW2] >ref|YP_042578.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus MSSA476] >ref|NP_371017.2| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Mu50] >ref|YP_185424.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus COL] >ref|YP_493179.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >ref|YP_499043.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus NCTC 8325] >ref|YP_001245894.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus JH9] >ref|YP_001315672.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus JH1] >ref|YP_001441080.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Mu3] >ref|YP_001574398.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >ref|ZP_03563344.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus str. JKD6008] >ref|ZP_03566808.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus str. JKD6009] >ref|ZP_04839443.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus str. CF-Marseille] >ref|ZP_05143887.2| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Mu50-omega] >ref|ZP_05688283.1| ksgA protein [Staphylococcus aureus A9299] >ref|ZP_05694281.1| dimethyladenosine transferase [Staphylococcus aureus A6300] >ref|ZP_05696158.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus A6224] >ref|ZP_05701798.1| dimethyladenosine transferase [Staphylococcus aureus A5937] >ref|ZP_06022837.1| dimethyladenosine transferase [Staphylococcus aureus D30] >ref|ZP_06024719.1| dimethyladenosine transferase [Staphylococcus aureus 930918-3] >ref|YP_003281382.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus ED98] >ref|ZP_06303320.1| dimethyladenosine transferase [Staphylococcus aureus A8117] >ref|ZP_06323579.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus D139] >ref|ZP_06333220.1| dimethyladenosine transferase [Staphylococcus aureus A9765] >ref|ZP_06341837.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus H19] >ref|ZP_06377900.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus 132] >ref|ZP_06791085.1| dimethyladenosine transferase [Staphylococcus aureus A9754] >ref|ZP_06817179.1| dimethyladenosine transferase [Staphylococcus aureus A8819] >sp|Q932G1.3|RSMA_STAAM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|P66663.1|RSMA_STAAW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|P66662.1|RSMA_STAAN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q5HII3.1|RSMA_STAAC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q6GBZ5.1|RSMA_STAAS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q2FJE9.1|RSMA_STAA3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q2G0T0.1|RSMA_STAA8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A7WYP0.1|RSMA_STAA1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A6TYW7.1|RSMA_STAA2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5IQ45.1|RSMA_STAA9 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A8Z0Y8.1|RSMA_STAAT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB41681.1| ksgA [Staphylococcus aureus subsp. aureus N315] >dbj|BAB94313.1| ksgA [Staphylococcus aureus subsp. aureus MW2] >dbj|BAB56655.2| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Mu50] >emb|CAG42225.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus MSSA476] >gb|AAW37655.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus COL] >gb|ABD20962.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gb|ABD29619.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gb|ABQ48318.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus JH9] >gb|ABR51385.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus JH1] >dbj|BAF77373.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus Mu3] >gb|ABX28519.1| possible dimethyladenosine transferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gb|EEV73635.1| ksgA protein [Staphylococcus aureus A9299] >gb|EEV78039.1| dimethyladenosine transferase [Staphylococcus aureus A6300] >gb|EEV81591.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus A6224] >gb|EEV86751.1| dimethyladenosine transferase [Staphylococcus aureus A5937] >gb|EEW44616.1| dimethyladenosine transferase [Staphylococcus aureus 930918-3] >gb|EEW46496.1| dimethyladenosine transferase [Staphylococcus aureus D30] >gb|ACY10376.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus ED98] >emb|CBI48440.1| ribosomal RNA adenine dimethylase [Staphylococcus aureus subsp. aureus TW20] >gb|EFB50644.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus D139] >gb|EFB97483.1| dimethyladenosine transferase [Staphylococcus aureus A9765] >gb|EFC02658.1| dimethyladenosine transferase [Staphylococcus aureus A8117] >gb|EFC08195.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus H19] >emb|CAQ48996.1| dimethyladenosine transferase [Staphylococcus aureus subsp. aureus ST398] >gb|ADC36679.1| Dimethyladenosine transferase [Staphylococcus aureus 04-02981] >gb|EFG39212.1| dimethyladenosine transferase [Staphylococcus aureus A9754] >gb|EFG43771.1| dimethyladenosine transferase [Staphylococcus aureus A8819] 98.2 98.2 90% 2e-19  
YP_001175338.1 dimethyladenosine transferase [Enterobacter sp. 638] >sp|A4W6F7.1|RSMA_ENT38 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABP59287.1| dimethyladenosine transferase [Enterobacter sp. 638] 98.2 98.2 97% 2e-19  
ZP_01945756.1 dimethyladenosine transferase [Coxiella burnetii 'MSU Goat Q177'] >ref|YP_002306277.1| dimethyladenosine transferase [Coxiella burnetii CbuK_Q154] >sp|B6J641.1|RSMA_COXB1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EAX33635.1| dimethyladenosine transferase [Coxiella burnetii 'MSU Goat Q177'] >gb|ACJ21132.1| dimethyladenosine transferase [Coxiella burnetii CbuK_Q154] 98.2 98.2 100% 2e-19  
YP_001439344.1 dimethyladenosine transferase [Cronobacter sakazakii ATCC BAA-894] >sp|A7MIA7.1|RSMA_ENTS8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABU78508.1| hypothetical protein ESA_03287 [Cronobacter sakazakii ATCC BAA-894] 98.2 98.2 98% 3e-19  
ABC97664.1 KsgA [Shigella boydii] >gb|ABC97667.1| KsgA [Shigella boydii] >gb|ABC97668.1| KsgA [Shigella boydii] >gb|ABC97669.1| KsgA [Shigella boydii] >gb|ABC97670.1| KsgA [Shigella boydii] >gb|ABC97672.1| KsgA [Shigella boydii] >gb|ABC97674.1| KsgA [Shigella boydii] >gb|ABC97676.1| KsgA [Shigella boydii] >gb|ABC97678.1| KsgA [Shigella boydii] >gb|ABC97679.1| KsgA [Shigella dysenteriae] >gb|ABC97680.1| KsgA [Shigella dysenteriae] >gb|ABC97681.1| KsgA [Shigella dysenteriae] >gb|ABC97682.1| KsgA [Shigella dysenteriae] >gb|ABC97683.1| KsgA [Shigella dysenteriae] >gb|ABC97684.1| KsgA [Shigella dysenteriae] >gb|ABC97685.1| KsgA [Shigella dysenteriae] >gb|ABC97687.1| KsgA [Shigella dysenteriae] >gb|ABC97688.1| KsgA [Shigella dysenteriae] >gb|ABC97689.1| KsgA [Shigella dysenteriae] >gb|ABC97690.1| KsgA [Shigella dysenteriae] >gb|ABC97691.1| KsgA [Shigella flexneri] >gb|ABC97692.1| KsgA [Shigella flexneri] >gb|ABC97693.1| KsgA [Shigella flexneri] >gb|ABC97694.1| KsgA [Shigella flexneri] >gb|ABC97697.1| KsgA [Shigella flexneri] >gb|ABC97699.1| KsgA [Shigella flexneri] >gb|ABC97701.1| KsgA [Escherichia coli] >gb|ABC97702.1| KsgA [Escherichia coli] >gb|ABC97703.1| KsgA [Escherichia coli] 98.2 98.2 99% 3e-19  
ZP_00992445.1 dimethyladenosine transferase [Vibrio splendidus 12B01] >gb|EAP92591.1| dimethyladenosine transferase [Vibrio splendidus 12B01] 98.2 98.2 99% 3e-19  
NP_752016.1 dimethyladenosine transferase [Escherichia coli CFT073] >ref|YP_539099.1| dimethyladenosine transferase [Escherichia coli UTI89] >ref|YP_667994.1| dimethyladenosine transferase [Escherichia coli 536] >ref|YP_851254.1| dimethyladenosine transferase [Escherichia coli APEC O1] >ref|ZP_03035619.1| dimethyladenosine transferase [Escherichia coli F11] >ref|YP_002327646.1| dimethyladenosine transferase [Escherichia coli O127:H6 str. E2348/69] >ref|YP_002389905.1| dimethyladenosine transferase [Escherichia coli S88] >ref|ZP_04002853.1| rRNA (adenine-N6,N6-)-dimethyltransferase [Escherichia coli 83972] >ref|ZP_04534678.1| dimethyladenosine transferase [Escherichia sp. 3_2_53FAA] >sp|Q8FL96.1|RSMA_ECOL6 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q0TLT6.1|RSMA_ECOL5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q1RGE6.1|RSMA_ECOUT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A1A7A0.1|RSMA_ECOK1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B7MAH6.1|RSMA_ECO45 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B7UI99.1|RSMA_ECO27 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN78560.1|AE016755_60 Dimethyladenosine transferase [Escherichia coli CFT073] >gb|ABE05568.1| dimethyladenosine transferase [Escherichia coli UTI89] >gb|ABG68095.1| dimethyladenosine transferase [Escherichia coli 536] >gb|ABI99539.1| dimethyladenosine transferase [Escherichia coli APEC O1] >gb|EDV65224.1| dimethyladenosine transferase [Escherichia coli F11] >emb|CAS07602.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O127:H6 str. E2348/69] >emb|CAR01422.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli S88] >gb|EEH88368.1| dimethyladenosine transferase [Escherichia sp. 3_2_53FAA] >gb|EEJ48343.1| rRNA (adenine-N6,N6-)-dimethyltransferase [Escherichia coli 83972] >dbj|BAI53598.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli SE15] >gb|ADE92722.1| dimethyladenosine transferase [Escherichia coli IHE3034] 98.2 98.2 99% 3e-19  
YP_003294658.1 dimethyladenosine transferase (rRNA methylation) [Edwardsiella tarda EIB202] >gb|ACY83447.1| dimethyladenosine transferase (rRNA methylation) [Edwardsiella tarda EIB202] 98.2 98.2 98% 3e-19  
ZP_03030905.1 dimethyladenosine transferase [Escherichia coli B7A] >gb|EDV60611.1| dimethyladenosine transferase [Escherichia coli B7A] 98.2 98.2 99% 3e-19  
NP_414593.1 16S rRNA dimethyladenosine transferase, SAM-dependent [Escherichia coli str. K-12 substr. MG1655] >ref|YP_309089.1| dimethyladenosine transferase [Shigella sonnei Ss046] >ref|YP_406604.1| dimethyladenosine transferase [Shigella boydii Sb227] >ref|AP_000715.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli str. K-12 substr. W3110] >ref|YP_687637.1| dimethyladenosine transferase [Shigella flexneri 5 str. 8401] >ref|YP_001456840.1| dimethyladenosine transferase [Escherichia coli HS] >ref|YP_001726545.1| dimethyladenosine transferase [Escherichia coli ATCC 8739] >ref|YP_001729034.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli str. K-12 substr. DH10B] >ref|YP_001742172.1| dimethyladenosine transferase [Escherichia coli SMS-3-5] >ref|ZP_03000053.1| dimethyladenosine transferase [Escherichia coli 53638] >ref|ZP_03047278.1| dimethyladenosine transferase [Escherichia coli E22] >ref|ZP_03051910.1| dimethyladenosine transferase [Escherichia coli E110019] >ref|ZP_03062371.1| dimethyladenosine transferase [Escherichia coli B171] >ref|ZP_03066814.1| dimethyladenosine transferase [Shigella dysenteriae 1012] >ref|ZP_03071770.1| dimethyladenosine transferase [Escherichia coli 101-1] >ref|YP_002385549.1| dimethyladenosine transferase [Escherichia coli IAI1] >ref|YP_002406102.1| dimethyladenosine transferase [Escherichia coli IAI39] >ref|YP_002925252.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli BW2952] >ref|YP_003037748.1| dimethyladenosine transferase [Escherichia coli BL21(DE3)] >ref|ZP_04871545.1| methyltransferase [Escherichia sp. 1_1_43] >ref|YP_003043284.1| dimethyladenosine transferase [Escherichia coli B str. REL606] >ref|ZP_05433974.1| dimethyladenosine transferase [Shigella sp. D9] >ref|ZP_05439233.1| dimethyladenosine transferase [Escherichia sp. 4_1_40B] >ref|YP_003220066.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O103:H2 str. 12009] >ref|YP_003227156.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O26:H11 str. 11368] >ref|YP_003232607.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O111:H- str. 11128] >ref|ZP_06651986.1| dimethyladenosine transferase [Escherichia coli B354] >ref|ZP_06660551.1| dimethyladenosine transferase [Escherichia coli B185] >ref|ZP_06665123.1| dimethyladenosine transferase [Escherichia coli B088] >sp|P06992.1|RSMA_ECOLI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase; AltName: Full=High level kasugamycin resistance protein ksgA; AltName: Full=Kasugamycin dimethyltransferase >sp|Q326I2.1|RSMA_SHIBS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q3Z5V8.1|RSMA_SHISS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q0T8E4.1|RSMA_SHIF8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A7ZW03.1|RSMA_ECOHS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1IRC5.1|RSMA_ECOLC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B7NHF7.1|RSMA_ECO7I RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B7M0E8.1|RSMA_ECO8A RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1XC52.1|RSMA_ECODH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1LFY7.1|RSMA_ECOSM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C4ZPX7.1|RSMA_ECOBW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAA28417.1| unnamed protein product [Escherichia coli] >gb|AAA24049.1| methyltransferase (ksgA) [Escherichia coli] >gb|AAC73162.1| 16S rRNA dimethyladenosine transferase, SAM-dependent [Escherichia coli str. K-12 substr. MG1655] >gb|AAZ86854.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Shigella sonnei Ss046] >gb|ABB64776.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Shigella boydii Sb227] >dbj|BAE76038.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli str. K12 substr. W3110] >gb|ABF02332.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Shigella flexneri 5 str. 8401] >gb|ABV04457.1| dimethyladenosine transferase [Escherichia coli HS] >gb|ACA79218.1| dimethyladenosine transferase [Escherichia coli ATCC 8739] >gb|ACB01256.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli str. K-12 substr. DH10B] >gb|ACB19151.1| dimethyladenosine transferase [Escherichia coli SMS-3-5] >gb|EDU63085.1| dimethyladenosine transferase [Escherichia coli 53638] >gb|EDV80791.1| dimethyladenosine transferase [Escherichia coli E22] >gb|EDV86185.1| dimethyladenosine transferase [Escherichia coli E110019] >gb|EDX28388.1| dimethyladenosine transferase [Escherichia coli B171] >gb|EDX33320.1| dimethyladenosine transferase [Shigella dysenteriae 1012] >gb|EDX37402.1| dimethyladenosine transferase [Escherichia coli 101-1] >emb|CAQ96943.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli IAI1] >emb|CAR16195.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli IAI39] >gb|EEH72576.1| methyltransferase [Escherichia sp. 1_1_43] >gb|ACR65508.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli BW2952] >emb|CAQ30571.1| ksgA [Escherichia coli BL21(DE3)] >gb|ACT30563.1| dimethyladenosine transferase [Escherichia coli BL21(DE3)] >gb|ACT37748.1| dimethyladenosine transferase [Escherichia coli B str. REL606] >gb|ACT41956.1| dimethyladenosine transferase [Escherichia coli BL21(DE3)] >dbj|BAI23416.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O26:H11 str. 11368] >dbj|BAI28932.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O103:H2 str. 12009] >dbj|BAI34056.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O111:H- str. 11128] >gb|ACX41162.1| dimethyladenosine transferase [Escherichia coli DH1] >emb|CBG32889.1| dimethyladenosine transferase (S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase) [Escherichia coli 042] >gb|EFE60610.1| dimethyladenosine transferase [Escherichia coli B088] >gb|EFF03645.1| dimethyladenosine transferase [Escherichia coli B185] >gb|EFF14879.1| dimethyladenosine transferase [Escherichia coli B354] >prf||1112172A methyltransferase 98.2 98.2 99% 3e-19  
YP_003363705.1 dimethyladenosine transferase (S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase) [Citrobacter rodentium ICC168] >emb|CBG86839.1| dimethyladenosine transferase (S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase) [Citrobacter rodentium ICC168] 98.2 98.2 95% 3e-19  
1QYR_A Chain A, 2.1 Angstrom Crystal Structure Of Ksga: A Universally Conserved Adenosine Dimethyltransferase >pdb|1QYR|B Chain B, 2.1 Angstrom Crystal Structure Of Ksga: A Universally Conserved Adenosine Dimethyltransferase 98.2 98.2 99% 3e-19  
YP_001461223.1 dimethyladenosine transferase [Escherichia coli E24377A] >ref|ZP_06647223.1| dimethyladenosine transferase [Escherichia coli FVEC1412] >sp|A7ZHE4.1|RSMA_ECO24 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV18336.1| dimethyladenosine transferase [Escherichia coli E24377A] >gb|EFF03055.1| dimethyladenosine transferase [Escherichia coli FVEC1412] 98.2 98.2 99% 3e-19  
YP_002291327.1 dimethyladenosine transferase [Escherichia coli SE11] >sp|B6HZ32.1|RSMA_ECOSE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAG75576.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli SE11] 98.2 98.2 99% 3e-19  
ZP_00055388.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Magnetospirillum magnetotacticum MS-1] 98.2 98.2 92% 3e-19  
YP_003335109.1 dimethyladenosine transferase [Dickeya dadantii Ech586] >gb|ACZ78403.1| dimethyladenosine transferase [Dickeya dadantii Ech586] 98.2 98.2 97% 3e-19  
YP_396268.1 dimethyladenosine transferase [Lactobacillus sakei subsp. sakei 23K] >sp|Q38V22.1|RSMA_LACSS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAI55962.1| Dimethyladenosine transferase (S-adenosylmethionine-6-N, N-adenosyl(rRNA) dimethyltransferase) [Lactobacillus sakei subsp. sakei 23K] 98.2 98.2 92% 3e-19  
YP_002410831.1 dimethyladenosine transferase [Escherichia coli UMN026] >sp|B7N7S6.1|RSMA_ECOLU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAR11276.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli UMN026] 98.2 98.2 99% 3e-19  
ABC97665.1 KsgA [Shigella boydii] 98.2 98.2 99% 3e-19  
ZP_01895682.1 dimethyladenosine transferase [Marinobacter algicola DG893] >gb|EDM46226.1| dimethyladenosine transferase [Marinobacter algicola DG893] 98.2 98.2 99% 3e-19  
NP_285748.1 dimethyladenosine transferase [Escherichia coli O157:H7 EDL933] >ref|NP_308083.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. Sakai] >ref|ZP_02776711.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4113] >ref|ZP_02781889.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4401] >ref|ZP_02787825.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4501] >ref|ZP_02791753.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4486] >ref|ZP_02801981.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4196] >ref|ZP_02806762.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4076] >ref|ZP_02810116.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC869] >ref|ZP_02826946.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC508] >ref|ZP_03083109.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4024] >ref|ZP_03250262.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4206] >ref|ZP_03255084.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4045] >ref|ZP_03259337.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4042] >ref|YP_002268661.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4115] >ref|ZP_03442529.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. TW14588] >ref|YP_003076027.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O157:H7 str. TW14359] >ref|ZP_05941092.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O157:H7 str. FRIK2000] >ref|ZP_05947747.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O157:H7 str. FRIK966] >ref|YP_003497695.1| Dimethyladenosine transferase (S-adenosylmethionine-6-N, N-adenosyl(rRNA) dimethyltransferase) [Escherichia coli O55:H7 str. CB9615] >sp|Q8XA14.1|RSMA_ECO57 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B5YZ89.1|RSMA_ECO5E RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAG54356.1|AE005182_5 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O157:H7 EDL933] >dbj|BAB33479.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. Sakai] >gb|EDU31563.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4196] >gb|EDU52425.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4113] >gb|EDU69707.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4076] >gb|EDU74501.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4401] >gb|EDU82516.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4486] >gb|EDU85405.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4501] >gb|EDU93150.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC869] >gb|EDU94407.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC508] >gb|EDZ77327.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4206] >gb|EDZ83719.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4045] >gb|EDZ86822.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4042] >gb|ACI36216.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. EC4115] >gb|ACI71754.1| dimethyladenosine transferase [Escherichia coli] >gb|ACI71755.1| dimethyladenosine transferase [Escherichia coli] >gb|ACI71756.1| dimethyladenosine transferase [Escherichia coli] >gb|ACI71757.1| dimethyladenosine transferase [Escherichia coli] >gb|ACI71758.1| dimethyladenosine transferase [Escherichia coli] >gb|EEC31090.1| dimethyladenosine transferase [Escherichia coli O157:H7 str. TW14588] >gb|ACT69951.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli O157:H7 str. TW14359] >gb|ADD54711.1| Dimethyladenosine transferase (S-adenosylmethionine-6-N, N-adenosyl(rRNA) dimethyltransferase) [Escherichia coli O55:H7 str. CB9615] 98.2 98.2 99% 3e-19  
YP_741112.1 dimethyladenosine transferase [Alkalilimnicola ehrlichii MLHE-1] >gb|ABI55622.1| dimethyladenosine transferase [Alkalilimnicola ehrlichii MLHE-1] 98.2 98.2 98% 3e-19  
ZP_05805530.1 dimethyladenosine transferase [Streptomyces flavogriseus ATCC 33331] >gb|EEW70858.1| dimethyladenosine transferase [Streptomyces flavogriseus ATCC 33331] 98.2 98.2 91% 3e-19  
ZP_06713492.1 dimethyladenosine transferase [Edwardsiella tarda ATCC 23685] >gb|EFE24135.1| dimethyladenosine transferase [Edwardsiella tarda ATCC 23685] 97.8 97.8 98% 3e-19  
YP_001825868.1 dimethyladenosine transferase [Streptomyces griseus subsp. griseus NBRC 13350] >ref|ZP_06282603.1| dimethyladenosine transferase [Streptomyces sp. ACT-1] >sp|B1VUF9.1|RSMA_STRGG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAG21185.1| putative dimethyladenosine transferase [Streptomyces griseus subsp. griseus NBRC 13350] >gb|EFB78430.1| dimethyladenosine transferase [Streptomyces sp. ACT-1] 97.8 97.8 90% 3e-19  
NP_706007.1 dimethyladenosine transferase [Shigella flexneri 2a str. 301] >ref|NP_835789.1| dimethyladenosine transferase [Shigella flexneri 2a str. 2457T] >sp|Q83MG8.1|RSMA_SHIFL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN41714.1| S-adenosylmethionine-6-N,N-adenosyl (rRNA) dimethyltransferase [Shigella flexneri 2a str. 301] >gb|AAP15594.1| S-adenosylmethionine-6-N,N-adenosyl (rRNA) dimethyltransferase [Shigella flexneri 2a str. 2457T] >gb|ADA72396.1| Dimethyladenosine transferase [Shigella flexneri 2002017] 97.8 97.8 99% 3e-19  
ABC97700.1 KsgA [Shigella flexneri] 97.8 97.8 99% 3e-19  
YP_002932153.1 dimethyladenosine transferase, putative [Edwardsiella ictaluri 93-146] >gb|ACR67918.1| dimethyladenosine transferase, putative [Edwardsiella ictaluri 93-146] 97.8 97.8 98% 3e-19  
ZP_01741187.1 dimethyladenosine transferase [Rhodobacterales bacterium HTCC2150] >gb|EBA03640.1| dimethyladenosine transferase [Rhodobacterales bacterium HTCC2150] 97.8 97.8 92% 3e-19  
ZP_02432773.1 hypothetical protein CLOSCI_03028 [Clostridium scindens ATCC 35704] >gb|EDS05901.1| hypothetical protein CLOSCI_03028 [Clostridium scindens ATCC 35704] 97.8 97.8 95% 3e-19  
Q2GGH6.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 97.8 97.8 92% 3e-19  
ZP_01113177.1 dimethyladenosine transferase [Reinekea sp. MED297] >gb|EAR10946.1| dimethyladenosine transferase [Reinekea sp. MED297] 97.8 97.8 100% 3e-19  
ZP_00545205.1 RRNA 16S rRNA dimethylase [Ehrlichia chaffeensis str. Sapulpa] >ref|YP_507457.1| dimethyladenosine transferase [Ehrlichia chaffeensis str. Arkansas] >gb|EAM85426.1| RRNA 16S rRNA dimethylase [Ehrlichia chaffeensis str. Sapulpa] >gb|ABD45262.1| dimethyladenosine transferase [Ehrlichia chaffeensis str. Arkansas] 97.8 97.8 92% 3e-19  
YP_001812540.1 dimethyladenosine transferase [Exiguobacterium sibiricum 255-15] >gb|ACB59523.1| dimethyladenosine transferase [Exiguobacterium sibiricum 255-15] 97.8 97.8 92% 3e-19  
ZP_04673454.1 dimethyladenosine transferase dimethyltransferase [Lactobacillus paracasei subsp. paracasei 8700:2] >gb|EEQ65707.1| dimethyladenosine transferase dimethyltransferase [Lactobacillus paracasei subsp. paracasei 8700:2] 97.8 97.8 92% 3e-19  
ZP_03963047.1 dimethyladenosine transferase (S-adenosylmethionine-6-N , N-adenosyl(rRNA) dimethyltransferase) [Lactobacillus paracasei subsp. paracasei ATCC 25302] >gb|EEI69466.1| dimethyladenosine transferase (S-adenosylmethionine-6-N , N-adenosyl(rRNA) dimethyltransferase) [Lactobacillus paracasei subsp. paracasei ATCC 25302] 97.8 97.8 92% 4e-19  
ZP_02196556.1 dimethyladenosine transferase [Vibrio sp. AND4] >gb|EDP58373.1| dimethyladenosine transferase [Vibrio sp. AND4] 97.8 97.8 99% 4e-19  
YP_002475330.1 dimethyladenosine transferase [Haemophilus parasuis SH0165] >gb|ACL32382.1| dimethyladenosine transferase [Haemophilus parasuis SH0165] 97.8 97.8 99% 4e-19  
YP_001476958.1 dimethyladenosine transferase [Serratia proteamaculans 568] >sp|A8G9P0.1|RSMA_SERP5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV39830.1| dimethyladenosine transferase [Serratia proteamaculans 568] 97.8 97.8 99% 4e-19  
ZP_05744805.1 dimethyladenosine transferase [Lactobacillus antri DSM 16041] >gb|EEW54575.1| dimethyladenosine transferase [Lactobacillus antri DSM 16041] 97.8 97.8 92% 4e-19  
YP_003021746.1 dimethyladenosine transferase [Geobacter sp. M21] >gb|ACT17988.1| dimethyladenosine transferase [Geobacter sp. M21] 97.8 97.8 97% 4e-19  
YP_001988668.1 Dimethyladenosine transferase (S-adenosylmethionine-6-N , N-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) [Lactobacillus casei BL23] >emb|CAQ67810.1| Dimethyladenosine transferase (S-adenosylmethionine-6-N , N-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) [Lactobacillus casei BL23] 97.8 97.8 92% 4e-19  
YP_001225089.1 dimethyladenosine transferase [Synechococcus sp. WH 7803] >sp|A5GLH7.1|RSMA_SYNPW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAK23792.1| Dimethyladenosine transferase [Synechococcus sp. WH 7803] 97.8 97.8 92% 4e-19  
YP_221437.1 dimethyladenosine transferase [Brucella abortus bv. 1 str. 9-941] >sp|Q57E58.1|RSMA_BRUAB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAX74076.1| KsgA, dimethyladenosine transferase [Brucella abortus bv. 1 str. 9-941] 97.4 97.4 91% 4e-19  
YP_001799957.1 dimethyladenosine transferase [Corynebacterium urealyticum DSM 7109] >emb|CAQ04523.1| dimethyladenosine transferase [Corynebacterium urealyticum DSM 7109] 97.4 97.4 87% 4e-19  
ZP_01627056.1 dimethyladenosine transferase [marine gamma proteobacterium HTCC2080] >gb|EAW40363.1| dimethyladenosine transferase [marine gamma proteobacterium HTCC2080] 97.4 97.4 98% 4e-19  
YP_069175.1 dimethyladenosine transferase [Yersinia pseudotuberculosis IP 32953] >ref|YP_001402399.1| dimethyladenosine transferase [Yersinia pseudotuberculosis IP 31758] >ref|YP_001722293.1| dimethyladenosine transferase [Yersinia pseudotuberculosis YPIII] >ref|YP_001871097.1| dimethyladenosine transferase [Yersinia pseudotuberculosis PB1/+] >sp|Q66EQ8.1|RSMA_YERPS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A7FMC1.1|RSMA_YERP3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B2K487.1|RSMA_YERPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1JKY3.1|RSMA_YERPY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAH19873.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase; kasugamycin resistance [Yersinia pseudotuberculosis IP 32953] >gb|ABS47340.1| dimethyladenosine transferase [Yersinia pseudotuberculosis IP 31758] >gb|ACA69840.1| dimethyladenosine transferase [Yersinia pseudotuberculosis YPIII] >gb|ACC87640.1| dimethyladenosine transferase [Yersinia pseudotuberculosis PB1/+] 97.4 97.4 99% 4e-19  
YP_001472703.1 dimethyladenosine transferase [Shewanella sediminis HAW-EB3] >sp|A8FRV2.1|RSMA_SHESH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV35575.1| dimethyladenosine transferase [Shewanella sediminis HAW-EB3] 97.4 97.4 97% 4e-19  
ZP_01102308.1 Dimethyladenosine transferase [Congregibacter litoralis KT71] >gb|EAQ98022.1| Dimethyladenosine transferase [Congregibacter litoralis KT71] 97.4 97.4 92% 4e-19  
ZP_01167116.1 dimethyladenosine transferase [Oceanospirillum sp. MED92] >gb|EAR60877.1| dimethyladenosine transferase [Oceanospirillum sp. MED92] 97.4 97.4 100% 4e-19  
ZP_05645186.1 dimethyladenosine transferase [Enterococcus casseliflavus EC30] >ref|ZP_05651523.1| dimethyladenosine transferase [Enterococcus casseliflavus EC10] >ref|ZP_05654802.1| dimethyladenosine transferase [Enterococcus casseliflavus EC20] >gb|EEV28519.1| dimethyladenosine transferase [Enterococcus casseliflavus EC30] >gb|EEV34856.1| dimethyladenosine transferase [Enterococcus casseliflavus EC10] >gb|EEV38135.1| dimethyladenosine transferase [Enterococcus casseliflavus EC20] 97.4 97.4 92% 4e-19  
ZP_01878812.1 dimethyladenosine transferase [Roseovarius sp. TM1035] >gb|EDM32915.1| dimethyladenosine transferase [Roseovarius sp. TM1035] 97.4 97.4 92% 4e-19  
NP_670980.1 dimethyladenosine transferase [Yersinia pestis KIM 10] >ref|NP_994958.1| dimethyladenosine transferase [Yersinia pestis biovar Microtus str. 91001] >ref|YP_653992.1| dimethyladenosine transferase [Yersinia pestis Antiqua] >ref|YP_646298.1| dimethyladenosine transferase [Yersinia pestis Nepal516] >ref|YP_001164473.1| dimethyladenosine transferase [Yersinia pestis Pestoides F] >ref|ZP_01917199.1| dimethyladenosine transferase [Yersinia pestis CA88-4125] >ref|YP_001605347.1| dimethyladenosine transferase [Yersinia pestis Angola] >ref|ZP_02223913.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. F1991016] >ref|ZP_02226338.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. IP275] >ref|ZP_02229648.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. E1979001] >ref|ZP_02238143.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. B42003004] >ref|ZP_02307077.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. UG05-0454] >ref|ZP_02313773.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. MG05-1020] >ref|ZP_02317784.1| dimethyladenosine transferase [Yersinia pestis biovar Mediaevalis str. K1973002] >ref|YP_002345565.1| dimethyladenosine transferase [Yersinia pestis CO92] >ref|ZP_04457090.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis Pestoides A] >ref|ZP_04460539.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis biovar Orientalis str. PEXU2] >ref|ZP_04462615.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis biovar Orientalis str. India 195] >ref|ZP_04515843.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis Nepal516] >ref|ZP_06204984.1| dimethyladenosine transferase [Yersinia pestis KIM D27] >ref|YP_003566649.1| dimethyladenosine transferase [Yersinia pestis Z176003] >sp|Q8ZIK5.1|RSMA_YERPE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q1C0H5.1|RSMA_YERPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q1CMT2.1|RSMA_YERPN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A4TQD8.1|RSMA_YERPP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9QZZ0.1|RSMA_YERPG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAM87231.1|AE013971_7 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis KIM 10] >gb|AAS63835.1| dimethyladenosine transferase [Yersinia pestis biovar Microtus str. 91001] >gb|ABG16698.1| dimethyladenosine transferase [Yersinia pestis Nepal516] >gb|ABG16047.1| dimethyladenosine transferase [Yersinia pestis Antiqua] >emb|CAL19172.1| dimethyladenosine transferase [Yersinia pestis CO92] >gb|ABP41500.1| dimethyladenosine transferase [Yersinia pestis Pestoides F] >gb|EDM39956.1| dimethyladenosine transferase [Yersinia pestis CA88-4125] >gb|ABX87946.1| dimethyladenosine transferase [Yersinia pestis Angola] >gb|EDR32805.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. IP275] >gb|EDR37243.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. F1991016] >gb|EDR44390.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. E1979001] >gb|EDR51334.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. B42003004] >gb|EDR56178.1| dimethyladenosine transferase [Yersinia pestis biovar Orientalis str. MG05-1020] >gb|EDR60373.1| dimethyladenosine transferase [Yersinia pestis biovar Antiqua str. UG05-0454] >gb|EDR64754.1| dimethyladenosine transferase [Yersinia pestis biovar Mediaevalis str. K1973002] >gb|EEO78150.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis Nepal516] >gb|EEO82824.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis biovar Orientalis str. India 195] >gb|EEO86793.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis biovar Orientalis str. PEXU2] >gb|EEO91877.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Yersinia pestis Pestoides A] >gb|ACY57338.1| dimethyladenosine transferase [Yersinia pestis D106004] >gb|ACY61120.1| dimethyladenosine transferase [Yersinia pestis D182038] >gb|EFA47191.1| dimethyladenosine transferase [Yersinia pestis KIM D27] >gb|ADE63387.1| dimethyladenosine transferase [Yersinia pestis Z176003] 97.4 97.4 99% 4e-19  
YP_163049.1 dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis ZM4] >ref|ZP_04759804.1| dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis ATCC 10988] >sp|Q5NMX2.1|RSMA_ZYMMO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAV89938.1| dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis ZM4] >gb|EER63558.1| dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis ATCC 10988] 97.4 97.4 90% 4e-19  
YP_001098722.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Herminiimonas arsenicoxydans] >sp|A4G256.1|RSMA_HERAR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAL60593.1| Dimethyladenosine transferase (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) [Herminiimonas arsenicoxydans] 97.4 97.4 99% 4e-19  
ZP_04060923.1 dimethyladenosine transferase [Staphylococcus hominis SK119] >gb|EEK11204.1| dimethyladenosine transferase [Staphylococcus hominis SK119] 97.4 97.4 90% 5e-19  
YP_401803.1 dimethyladenosine transferase [Shigella dysenteriae Sd197] >sp|Q32K43.1|RSMA_SHIDS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB60314.1| S-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [Shigella dysenteriae Sd197] 97.4 97.4 99% 5e-19  
YP_001189492.1 dimethyladenosine transferase [Pseudomonas mendocina ymp] >gb|ABP86760.1| dimethyladenosine transferase [Pseudomonas mendocina ymp] 97.4 97.4 99% 5e-19  
YP_077075.1 dimethyladenosine transferase [Symbiobacterium thermophilum IAM 14863] >sp|Q67JB9.1|RSMA_SYMTH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAD42231.1| dimethyladenosine transferase [Symbiobacterium thermophilum IAM 14863] 97.4 97.4 95% 5e-19  
ZP_04858342.1 conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] >gb|EES75588.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] 97.1 97.1 95% 5e-19  
ZP_05966446.2 dimethyladenosine transferase [Bifidobacterium gallicum DSM 20093] >gb|EFA22438.1| dimethyladenosine transferase [Bifidobacterium gallicum DSM 20093] 97.1 97.1 95% 5e-19  
ZP_04625597.1 Dimethyladenosine transferase [Yersinia kristensenii ATCC 33638] >gb|EEP89916.1| Dimethyladenosine transferase [Yersinia kristensenii ATCC 33638] 97.1 97.1 99% 5e-19  
YP_002633241.1 ribosomal RNA adenine dimethylase [Staphylococcus carnosus subsp. carnosus TM300] >sp|B9DLD0.1|RSMA_STACT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAL27056.1| ribosomal RNA adenine dimethylase [Staphylococcus carnosus subsp. carnosus TM300] 97.1 97.1 92% 5e-19  
ZP_05225389.1 dimethyladenosine transferase [Mycobacterium intracellulare ATCC 13950] 97.1 97.1 89% 6e-19  
ZP_06349109.1 dimethyladenosine transferase [Rhodomicrobium vannielii ATCC 17100] >gb|EFC11800.1| dimethyladenosine transferase [Rhodomicrobium vannielii ATCC 17100] 97.1 97.1 92% 6e-19  
ABC97662.1 KsgA [Shigella boydii] >gb|ABC97663.1| KsgA [Shigella boydii] >gb|ABC97671.1| KsgA [Shigella boydii] >gb|ABC97673.1| KsgA [Shigella boydii] >gb|ABC97675.1| KsgA [Shigella boydii] >gb|ABC97677.1| KsgA [Shigella boydii] >gb|ABC97686.1| KsgA [Shigella dysenteriae] 97.1 97.1 99% 6e-19  
ZP_04796023.1 dimethyladenosine transferase [Staphylococcus epidermidis W23144] >gb|EES37270.1| dimethyladenosine transferase [Staphylococcus epidermidis W23144] 97.1 97.1 90% 6e-19  
NP_759648.1 dimethyladenosine transferase [Vibrio vulnificus CMCP6] >ref|NP_933271.1| dimethyladenosine transferase [Vibrio vulnificus YJ016] >sp|Q8DED2.1|RSMA_VIBVU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q7MP86.1|RSMA_VIBVY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO09175.1|AE016799_73 Dimethyladenosine transferase [Vibrio vulnificus CMCP6] >dbj|BAC93242.1| dimethyladenosine transferase [Vibrio vulnificus YJ016] 97.1 97.1 100% 6e-19  
ZP_06192190.1 dimethyladenosine transferase [Serratia odorifera 4Rx13] >gb|EFA15211.1| dimethyladenosine transferase [Serratia odorifera 4Rx13] 97.1 97.1 99% 6e-19  
ZP_04958682.1 dimethyladenosine transferase [gamma proteobacterium NOR51-B] >gb|EED36266.1| dimethyladenosine transferase [gamma proteobacterium NOR51-B] 97.1 97.1 97% 6e-19  
ZP_01037431.1 dimethyladenosine transferase [Roseovarius sp. 217] >gb|EAQ23977.1| dimethyladenosine transferase [Roseovarius sp. 217] 97.1 97.1 92% 6e-19  
NP_939239.1 dimethyladenosine transferase [Corynebacterium diphtheriae NCTC 13129] >sp|Q6NIA2.1|RSMA_CORDI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAE49392.1| Putative dimethyladenosine transferase [Corynebacterium diphtheriae] 97.1 97.1 90% 6e-19  
YP_001878864.1 dimethyladenosine transferase [Shigella boydii CDC 3083-94] >sp|B2U259.1|RSMA_SHIB3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACD09046.1| dimethyladenosine transferase [Shigella boydii CDC 3083-94] 97.1 97.1 99% 6e-19  
ZP_03715858.1 hypothetical protein EUBHAL_00918 [Eubacterium hallii DSM 3353] >gb|EEG37245.1| hypothetical protein EUBHAL_00918 [Eubacterium hallii DSM 3353] 97.1 97.1 95% 6e-19  
YP_003081573.1 dimethyladenosine transferase [Neorickettsia risticii str. Illinois] >gb|ACT69346.1| dimethyladenosine transferase [Neorickettsia risticii str. Illinois] 96.7 96.7 90% 7e-19  
YP_003272682.1 dimethyladenosine transferase [Gordonia bronchialis DSM 43247] >gb|ACY20789.1| dimethyladenosine transferase [Gordonia bronchialis DSM 43247] 96.7 96.7 91% 7e-19  
ZP_01261592.1 dimethyladenosine transferase [Vibrio alginolyticus 12G01] >ref|ZP_04923147.1| dimethyladenosine transferase [Vibrio sp. Ex25] >ref|YP_003284293.1| dimethyladenosine transferase [Vibrio sp. Ex25] >ref|ZP_06178902.1| dimethyladenosine transferase [Vibrio alginolyticus 40B] >gb|EAS75047.1| dimethyladenosine transferase [Vibrio alginolyticus 12G01] >gb|EDN56556.1| dimethyladenosine transferase [Vibrio sp. Ex25] >gb|ACY49828.1| dimethyladenosine transferase [Vibrio sp. Ex25] >gb|EEZ84784.1| dimethyladenosine transferase [Vibrio alginolyticus 40B] 96.7 96.7 99% 7e-19  
NP_695843.1 dimethyladenosine transferase [Bifidobacterium longum NCC2705] >sp|Q8G6I3.1|RSMA_BIFLO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN24479.1| dimethyladenosine transferase ribosomal RNA adenine dimethylase [Bifidobacterium longum NCC2705] 96.7 96.7 93% 7e-19  
YP_807756.1 dimethyladenosine transferase (rRNA methylation) [Lactobacillus casei ATCC 334] >gb|ABJ71314.1| dimethyladenosine transferase [Lactobacillus casei ATCC 334] 96.7 96.7 92% 7e-19  
YP_002396141.1 dimethyladenosine transferase [Escherichia coli ED1a] >sp|B7MNR0.1|RSMA_ECO81 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAR06275.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli ED1a] 96.7 96.7 99% 7e-19  
ZP_05011617.1 dimethyladenosine transferase dimethyltransferase [Streptomyces pristinaespiralis ATCC 25486] >gb|EDY64181.1| dimethyladenosine transferase dimethyltransferase [Streptomyces pristinaespiralis ATCC 25486] 96.7 96.7 91% 8e-19  
ZP_00999220.1 dimethyladenosine transferase [Oceanicola batsensis HTCC2597] >gb|EAQ03470.1| dimethyladenosine transferase [Oceanicola batsensis HTCC2597] 96.7 96.7 92% 8e-19  
ZP_02477458.1 dimethyladenosine transferase [Haemophilus parasuis 29755] >gb|EDS25449.1| dimethyladenosine transferase [Haemophilus parasuis 29755] 96.7 96.7 99% 8e-19  
ZP_01869874.1 dimethyladenosine transferase [Vibrio shilonii AK1] >gb|EDL51523.1| dimethyladenosine transferase [Vibrio shilonii AK1] 96.7 96.7 100% 8e-19  
ZP_01105375.1 dimethyladenosine transferase [Flavobacteriales bacterium HTCC2170] >gb|EAR02460.1| dimethyladenosine transferase [Flavobacteriales bacterium HTCC2170] 96.7 96.7 93% 8e-19  
YP_002401190.1 dimethyladenosine transferase [Escherichia coli 55989] >sp|B7L4H4.1|RSMA_ECO55 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAU95938.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Escherichia coli 55989] 96.7 96.7 99% 8e-19  
ZP_06610788.1 dimethyladenosine transferase [Mycoplasma alligatoris A21JP2] >gb|EFF41316.1| dimethyladenosine transferase [Mycoplasma alligatoris A21JP2] 96.7 96.7 98% 8e-19  
YP_003074513.1 dimethyladenosine transferaseS-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [Teredinibacter turnerae T7901] >gb|ACR14233.1| dimethyladenosine transferaseS-adenosylmethionine-6-N',N'-adenosyl dimethyltransferase [Teredinibacter turnerae T7901] 96.7 96.7 99% 8e-19  
ZP_01831103.1 dimethyladenosine transferase [Streptococcus pneumoniae SP18-BS74] >gb|EDK68001.1| dimethyladenosine transferase [Streptococcus pneumoniae SP18-BS74] 96.7 96.7 92% 8e-19  
ZP_04613754.1 Dimethyladenosine transferase [Yersinia rohdei ATCC 43380] >gb|EEQ01780.1| Dimethyladenosine transferase [Yersinia rohdei ATCC 43380] 96.7 96.7 99% 8e-19  
YP_002562922.1 dimethyladenosine transferase [Streptococcus uberis 0140J] >sp|B9DVT4.1|RSMA_STRU0 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAR43508.1| dimethyladenosine transferase [Streptococcus uberis 0140J] 96.7 96.7 92% 8e-19  
ZP_01967886.1 hypothetical protein RUMTOR_01452 [Ruminococcus torques ATCC 27756] >gb|EDK24395.1| hypothetical protein RUMTOR_01452 [Ruminococcus torques ATCC 27756] 96.3 96.3 93% 9e-19  
YP_002939781.1 dimethyladenosine transferase [Kosmotoga olearia TBF 19.5.1] >gb|ACR78777.1| dimethyladenosine transferase [Kosmotoga olearia TBF 19.5.1] 96.3 96.3 96% 9e-19  
YP_001093010.1 dimethyladenosine transferase [Shewanella loihica PV-4] >sp|A3QBA3.1|RSMA_SHELP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABO22751.1| dimethyladenosine transferase [Shewanella loihica PV-4] 96.3 96.3 99% 9e-19  
ZP_05568415.1 dimethyladenosine transferase [Enterococcus faecalis HIP11704] >gb|EEU71372.1| dimethyladenosine transferase [Enterococcus faecalis HIP11704] 96.3 96.3 92% 9e-19  
ZP_03614431.1 dimethyladenosine transferase [Staphylococcus capitis SK14] >gb|EEE48299.1| dimethyladenosine transferase [Staphylococcus capitis SK14] 96.3 96.3 90% 9e-19  
ZP_01161964.1 dimethyladenosine transferase [Photobacterium sp. SKA34] >gb|EAR54271.1| dimethyladenosine transferase [Photobacterium sp. SKA34] 96.3 96.3 100% 9e-19  
YP_001333738.1 dimethyladenosine transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >ref|YP_002917758.1| dimethyladenosine transferase [Klebsiella pneumoniae NTUH-K2044] >ref|ZP_06017958.1| dimethyladenosine transferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] >sp|A6T4I7.1|RSMA_KLEP7 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABR75508.1| dimethyladenosine transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >dbj|BAH61691.1| dimethyladenosine transferase [Klebsiella pneumoniae NTUH-K2044] >dbj|BAH66524.1| dimethyladenosine transferase [Klebsiella pneumoniae NTUH-K2044] >dbj|BAH66555.1| dimethyladenosine transferase [Klebsiella pneumoniae] >gb|EEW38872.1| dimethyladenosine transferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] 96.3 96.3 95% 9e-19  
ZP_05844751.1 dimethyladenosine transferase [Rhodobacter sp. SW2] >gb|EEW24329.1| dimethyladenosine transferase [Rhodobacter sp. SW2] 96.3 96.3 90% 9e-19  
ZP_01467999.1 16S rRNA dimethylase [Synechococcus sp. BL107] >gb|EAU71892.1| 16S rRNA dimethylase [Synechococcus sp. BL107] 96.3 96.3 92% 1e-18  
YP_606199.1 dimethyladenosine transferase [Pseudomonas entomophila L48] >emb|CAK13382.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Pseudomonas entomophila L48] 96.3 96.3 99% 1e-18  
ZP_05427831.1 dimethyladenosine transferase [Eubacterium saphenum ATCC 49989] >gb|EEU03498.1| dimethyladenosine transferase [Eubacterium saphenum ATCC 49989] 96.3 96.3 90% 1e-18  
ZP_03989279.1 dimethyladenosine transferase [Acidaminococcus sp. D21] >gb|EEH90864.1| dimethyladenosine transferase [Acidaminococcus sp. D21] 96.3 96.3 94% 1e-18  
ZP_01666202.1 dimethyladenosine transferase [Thermosinus carboxydivorans Nor1] >gb|EAX48066.1| dimethyladenosine transferase [Thermosinus carboxydivorans Nor1] 96.3 96.3 91% 1e-18  
ZP_06792717.1 dimethyladenosine transferase [Brucella sp. NVSL 07-0026] >gb|EFG37632.1| dimethyladenosine transferase [Brucella sp. NVSL 07-0026] 96.3 96.3 91% 1e-18  
ZP_03608792.1 dimethyladenosine transferase [Campylobacter rectus RM3267] >gb|EEF15442.1| dimethyladenosine transferase [Campylobacter rectus RM3267] 96.3 96.3 99% 1e-18  
ZP_01726041.1 dimethyladenosine transferase [Bacillus sp. B14905] >gb|EAZ83444.1| dimethyladenosine transferase [Bacillus sp. B14905] 96.3 96.3 92% 1e-18  
ZP_06175291.1 dimethyladenosine transferase [Vibrio harveyi 1DA3] >gb|EEZ88450.1| dimethyladenosine transferase [Vibrio harveyi 1DA3] 96.3 96.3 99% 1e-18  
YP_002880998.1 dimethyladenosine transferase [Beutenbergia cavernae DSM 12333] >gb|ACQ79236.1| dimethyladenosine transferase [Beutenbergia cavernae DSM 12333] 96.3 96.3 97% 1e-18  
NP_697696.1 dimethyladenosine transferase [Brucella suis 1330] >ref|YP_414146.1| dimethyladenosine transferase [Brucella melitensis biovar Abortus 2308] >ref|YP_001258664.1| dimethyladenosine transferase [Brucella ovis ATCC 25840] >ref|YP_001592538.1| dimethyladenosine transferase [Brucella canis ATCC 23365] >ref|YP_001934662.1| SAM (and some other nucleotide) binding motif [Brucella abortus S19] >ref|ZP_03785217.1| dimethyladenosine transferase [Brucella ceti str. Cudo] >ref|YP_002732435.1| dimethyladenosine transferase [Brucella melitensis ATCC 23457] >ref|ZP_04594133.1| dimethyladenosine transferase [Brucella abortus str. 2308 A] >ref|ZP_05152208.1| dimethyladenosine transferase [Brucella abortus bv. 6 str. 870] >ref|ZP_05155264.1| dimethyladenosine transferase [Brucella abortus bv. 3 str. Tulya] >ref|ZP_05158916.1| dimethyladenosine transferase [Brucella abortus bv. 2 str. 86/8/59] >ref|ZP_05163293.1| dimethyladenosine transferase [Brucella suis bv. 5 str. 513] >ref|ZP_05165840.1| dimethyladenosine transferase [Brucella suis bv. 3 str. 686] >ref|ZP_05169442.1| dimethyladenosine transferase [Brucella pinnipedialis M163/99/10] >ref|ZP_05171614.1| dimethyladenosine transferase [Brucella pinnipedialis B2/94] >ref|ZP_05175618.1| dimethyladenosine transferase [Brucella ceti M644/93/1] >ref|ZP_05178946.1| dimethyladenosine transferase [Brucella ceti M13/05/1] >ref|ZP_05188562.1| dimethyladenosine transferase [Brucella abortus bv. 4 str. 292] >ref|ZP_05444908.1| dimethyladenosine transferase [Brucella pinnipedialis M292/94/1] >ref|ZP_05454086.1| dimethyladenosine transferase [Brucella melitensis bv. 3 str. Ether] >ref|ZP_05457186.1| dimethyladenosine transferase [Brucella ceti M490/95/1] >ref|ZP_05460238.1| dimethyladenosine transferase [Brucella ceti B1/94] >ref|ZP_05462738.1| dimethyladenosine transferase [Brucella abortus bv. 9 str. C68] >ref|ZP_05466822.1| dimethyladenosine transferase [Brucella melitensis bv. 2 str. 63/9] >ref|YP_003106625.1| dimethyladenosine transferase [Brucella microti CCM 4915] >ref|ZP_05755244.1| dimethyladenosine transferase [Brucella sp. F5/99] >ref|ZP_05821345.1| dimethyladenosine transferase [Brucella abortus NCTC 8038] >ref|ZP_05837209.1| dimethyladenosine transferase [Brucella suis bv. 4 str. 40] >ref|ZP_05866791.1| dimethyladenosine transferase [Brucella abortus bv. 6 str. 870] >ref|ZP_05870010.1| dimethyladenosine transferase [Brucella abortus bv. 4 str. 292] >ref|ZP_05873832.1| dimethyladenosine transferase [Brucella abortus bv. 2 str. 86/8/59] >ref|ZP_05895086.1| dimethyladenosine transferase [Brucella abortus bv. 9 str. C68] >ref|ZP_05927970.1| dimethyladenosine transferase [Brucella abortus bv. 3 str. Tulya] >ref|ZP_05933231.1| dimethyladenosine transferase [Brucella ceti M13/05/1] >ref|ZP_05936163.1| dimethyladenosine transferase [Brucella ceti B1/94] >ref|ZP_05954301.1| dimethyladenosine transferase [Brucella pinnipedialis M163/99/10] >ref|ZP_05956538.1| dimethyladenosine transferase [Brucella pinnipedialis B2/94] >ref|ZP_05960748.1| dimethyladenosine transferase [Brucella ceti M644/93/1] >ref|ZP_05995717.1| dimethyladenosine transferase [Brucella suis bv. 5 str. 513] >ref|ZP_05998376.1| dimethyladenosine transferase [Brucella suis bv. 3 str. 686] >ref|ZP_06001604.1| dimethyladenosine transferase [Brucella sp. F5/99] >ref|ZP_06100936.1| dimethyladenosine transferase [Brucella pinnipedialis M292/94/1] >ref|ZP_06107186.1| dimethyladenosine transferase [Brucella melitensis bv. 3 str. Ether] >ref|ZP_06110402.1| dimethyladenosine transferase [Brucella ceti M490/95/1] >sp|Q8G1N0.1|RSMA_BRUSU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q2YN15.1|RSMA_BRUA2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5VPL7.1|RSMA_BRUO2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A9MA55.1|RSMA_BRUC2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B2S4U1.1|RSMA_BRUA1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C0RI23.1|RSMA_BRUMB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN29611.1| dimethyladenosine transferase [Brucella suis 1330] >emb|CAJ10660.1| SAM (and some other nucleotide) binding motif:Ribosomal RNA adenine dimethylase [Brucella melitensis biovar Abortus 2308] >gb|ABQ61744.1| dimethyladenosine transferase [Brucella ovis ATCC 25840] >gb|ABX61767.1| dimethyladenosine transferase [Brucella canis ATCC 23365] >gb|ACD72188.1| SAM (and some other nucleotide) binding motif [Brucella abortus S19] >gb|EEH15058.1| dimethyladenosine transferase [Brucella ceti str. Cudo] >gb|ACO00481.1| dimethyladenosine transferase [Brucella melitensis ATCC 23457] >gb|EEP64182.1| dimethyladenosine transferase [Brucella abortus str. 2308 A] >gb|ACU47676.1| dimethyladenosine transferase [Brucella microti CCM 4915] >gb|EEW80886.1| dimethyladenosine transferase [Brucella abortus NCTC 8038] >gb|EEW91337.1| dimethyladenosine transferase [Brucella suis bv. 4 str. 40] >gb|EEX54920.1| dimethyladenosine transferase [Brucella abortus bv. 4 str. 292] >gb|EEX58742.1| dimethyladenosine transferase [Brucella abortus bv. 2 str. 86/8/59] >gb|EEX61372.1| dimethyladenosine transferase [Brucella abortus bv. 6 str. 870] >gb|EEX80069.1| dimethyladenosine transferase [Brucella abortus bv. 9 str. C68] >gb|EEX82157.1| dimethyladenosine transferase [Brucella abortus bv. 3 str. Tulya] >gb|EEX87119.1| dimethyladenosine transferase [Brucella ceti B1/94] >gb|EEX90607.1| dimethyladenosine transferase [Brucella ceti M13/05/1] >gb|EEX97737.1| dimethyladenosine transferase [Brucella ceti M644/93/1] >gb|EEY00061.1| dimethyladenosine transferase [Brucella pinnipedialis B2/94] >gb|EEY07627.1| dimethyladenosine transferase [Brucella pinnipedialis M163/99/10] >gb|EEY25875.1| dimethyladenosine transferase [Brucella sp. F5/99] >gb|EEY29687.1| dimethyladenosine transferase [Brucella suis bv. 5 str. 513] >gb|EEY32346.1| dimethyladenosine transferase [Brucella suis bv. 3 str. 686] >gb|EEZ08303.1| dimethyladenosine transferase [Brucella ceti M490/95/1] >gb|EEZ11531.1| dimethyladenosine transferase [Brucella melitensis bv. 3 str. Ether] >gb|EEZ18359.1| dimethyladenosine transferase [Brucella melitensis bv. 2 str. 63/9] >gb|EEZ30837.1| dimethyladenosine transferase [Brucella pinnipedialis M292/94/1] 96.3 96.3 91% 1e-18  
ZP_05553797.1 dimethyladenosine transferase [Lactobacillus coleohominis 101-4-CHN] >gb|EEU29930.1| dimethyladenosine transferase [Lactobacillus coleohominis 101-4-CHN] 96.3 96.3 92% 1e-18  
YP_002991206.1 dimethyladenosine transferase [Desulfovibrio salexigens DSM 2638] >sp|C6BSW3.1|RSMA_DESAD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACS79667.1| dimethyladenosine transferase [Desulfovibrio salexigens DSM 2638] 96.3 96.3 99% 1e-18  
YP_889677.1 dimethyladenosine transferase [Mycobacterium smegmatis str. MC2 155] >gb|ABK76055.1| dimethyladenosine transferase [Mycobacterium smegmatis str. MC2 155] 95.9 95.9 89% 1e-18  
YP_423081.1 dimethyladenosine transferase [Magnetospirillum magneticum AMB-1] >sp|Q2W0V3.1|RSMA_MAGSA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE52522.1| Dimethyladenosine transferase [Magnetospirillum magneticum AMB-1] 95.9 95.9 92% 1e-18  
ZP_04854216.1 dimethyladenosine transferase [Paenibacillus sp. oral taxon 786 str. D14] >gb|EES71781.1| dimethyladenosine transferase [Paenibacillus sp. oral taxon 786 str. D14] 95.9 95.9 98% 1e-18  
ZP_04590944.1 dimethyladenosine transferase [Pseudomonas syringae pv. oryzae str. 1_6] 95.9 95.9 100% 1e-18  
YP_350863.1 dimethyladenosine transferase [Pseudomonas fluorescens Pf0-1] >sp|Q3K5T2.1|RSMA_PSEPF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA76872.1| dimethyladenosine transferase [Pseudomonas fluorescens Pf0-1] 95.9 95.9 99% 1e-18  
YP_730799.1 dimethyladenosine transferase [Synechococcus sp. CC9311] >sp|Q0I9S3.1|RSMA_SYNS3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI45484.1| dimethyladenosine transferase [Synechococcus sp. CC9311] 95.9 95.9 92% 1e-18  
YP_003225175.1 dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis NCIB 11163] >gb|ACV74591.1| dimethyladenosine transferase [Zymomonas mobilis subsp. mobilis NCIMB 11163] 95.9 95.9 97% 1e-18  
ZP_05450967.1 dimethyladenosine transferase [Brucella neotomae 5K33] >ref|ZP_05963996.1| dimethyladenosine transferase [Brucella neotomae 5K33] >gb|EEY04276.1| dimethyladenosine transferase [Brucella neotomae 5K33] 95.9 95.9 91% 1e-18  
YP_526211.1 dimethyladenosine transferase [Saccharophagus degradans 2-40] >sp|Q21MT0.1|RSMA_SACD2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABD79999.1| dimethyladenosine transferase [Saccharophagus degradans 2-40] 95.9 95.9 99% 1e-18  
ZP_05215551.1 dimethyladenosine transferase [Mycobacterium avium subsp. avium ATCC 25291] 95.9 95.9 89% 1e-18  
ZP_04671960.1 conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] >gb|EEQ58941.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] 95.9 95.9 93% 1e-18  
NP_354124.1 dimethyladenosine transferase [Agrobacterium tumefaciens str. C58] >sp|Q8UGD5.1|RSMA_AGRT5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAK86909.1| rRNA-adenine N6,N6-dimethyltransferase [Agrobacterium tumefaciens str. C58] 95.9 95.9 92% 1e-18  
ZP_01814094.1 dimethyladenosine transferase [Vibrionales bacterium SWAT-3] >gb|EDK28566.1| dimethyladenosine transferase [Vibrionales bacterium SWAT-3] 95.9 95.9 100% 1e-18  
YP_002139096.1 dimethyladenosine transferase [Geobacter bemidjiensis Bem] >gb|ACH39300.1| dimethyladenosine transferase [Geobacter bemidjiensis Bem] 95.9 95.9 98% 1e-18  
ZP_03994445.1 dimethyladenosine transferase [Mobiluncus mulieris ATCC 35243] >ref|ZP_06183091.1| dimethyladenosine transferase [Mobiluncus mulieris 28-1] >gb|EEJ53301.1| dimethyladenosine transferase [Mobiluncus mulieris ATCC 35243] >gb|EEZ92220.1| dimethyladenosine transferase [Mobiluncus mulieris 28-1] 95.9 95.9 90% 1e-18  
YP_002572299.1 dimethyladenosine transferase [Anaerocellum thermophilum DSM 6725] >gb|ACM59526.1| dimethyladenosine transferase [Anaerocellum thermophilum DSM 6725] 95.9 95.9 93% 1e-18  
ZP_00949702.1 dimethyladenosine transferase [Croceibacter atlanticus HTCC2559] >gb|EAP87841.1| dimethyladenosine transferase [Croceibacter atlanticus HTCC2559] 95.9 95.9 96% 1e-18  
ZP_02042351.1 hypothetical protein RUMGNA_03152 [Ruminococcus gnavus ATCC 29149] >gb|EDN76472.1| hypothetical protein RUMGNA_03152 [Ruminococcus gnavus ATCC 29149] 95.9 95.9 95% 1e-18  
YP_002601552.1 KsgA [Desulfobacterium autotrophicum HRM2] >sp|C0QFJ2.1|RSMA_DESAH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACN13388.1| KsgA [Desulfobacterium autotrophicum HRM2] 95.9 95.9 95% 1e-18  
YP_934387.1 dimethyladenosine transferase [Azoarcus sp. BH72] >emb|CAL95500.1| dimethyladenosine transferase [Azoarcus sp. BH72] 95.9 95.9 98% 1e-18  
YP_002122649.1 dimethyladenosine transferase [Streptococcus equi subsp. zooepidemicus MGCS10565] >ref|YP_002745212.1| dimethyladenosine transferase [Streptococcus equi subsp. zooepidemicus] >sp|B4U0U9.1|RSMA_STREM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C0MF36.1|RSMA_STRS7 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACG61636.1| dimethyladenosine transferase [Streptococcus equi subsp. zooepidemicus MGCS10565] >emb|CAX00496.1| dimethyladenosine transferase [Streptococcus equi subsp. zooepidemicus] 95.5 95.5 92% 1e-18  
YP_003240144.1 dimethyladenosine transferase [Geobacillus sp. Y412MC10] >gb|ACX62337.1| dimethyladenosine transferase [Geobacillus sp. Y412MC10] 95.5 95.5 92% 1e-18  
YP_880398.1 dimethyladenosine transferase [Mycobacterium avium 104] >sp|A0QBW0.1|RSMA_MYCA1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK68498.1| dimethyladenosine transferase [Mycobacterium avium 104] 95.5 95.5 89% 1e-18  
YP_002745731.1 dimethyladenosine transferase [Streptococcus equi subsp. equi 4047] >sp|C0M8P2.1|RSMA_STRE4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAW92442.1| dimethyladenosine transferase [Streptococcus equi subsp. equi 4047] 95.5 95.5 92% 2e-18  
YP_001852739.1 dimethyladenosine transferase KsgA [Mycobacterium marinum M] >gb|ACC42884.1| dimethyladenosine transferase KsgA [Mycobacterium marinum M] 95.5 95.5 89% 2e-18  
ZP_05733082.1 dimethyladenosine transferase [Dialister invisus DSM 15470] >gb|EEW96518.1| dimethyladenosine transferase [Dialister invisus DSM 15470] 95.5 95.5 92% 2e-18  
YP_051947.1 dimethyladenosine transferase [Pectobacterium atrosepticum SCRI1043] >sp|Q6D0E0.1|RSMA_ERWCT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAG76757.1| dimethyladenosine transferase [Pectobacterium atrosepticum SCRI1043] 95.5 95.5 99% 2e-18  
ZP_05312316.1 dimethyladenosine transferase [Geobacter sp. M18] >gb|EET34961.1| dimethyladenosine transferase [Geobacter sp. M18] 95.5 95.5 95% 2e-18  
ZP_01312950.1 dimethyladenosine transferase [Desulfuromonas acetoxidans DSM 684] >gb|EAT15336.1| dimethyladenosine transferase [Desulfuromonas acetoxidans DSM 684] 95.5 95.5 92% 2e-18  
YP_002971620.1 dimethyladenosine transferase [Bartonella grahamii as4aup] >gb|ACS50938.1| dimethyladenosine transferase [Bartonella grahamii as4aup] 95.5 95.5 90% 2e-18  
CBL20716.1 dimethyladenosine transferase [Ruminococcus sp. SR1/5] 95.5 95.5 95% 2e-18  
YP_003291864.1 dimethyladenosine transferase [Rhodothermus marinus DSM 4252] >gb|ACY49476.1| dimethyladenosine transferase [Rhodothermus marinus DSM 4252] 95.5 95.5 92% 2e-18  
NP_796715.1 dimethyladenosine transferase [Vibrio parahaemolyticus RIMD 2210633] >ref|ZP_01991644.1| dimethyladenosine transferase [Vibrio parahaemolyticus AQ3810] >ref|ZP_05774711.1| dimethyladenosine transferase [Vibrio parahaemolyticus K5030] >ref|ZP_05890378.1| dimethyladenosine transferase [Vibrio parahaemolyticus AN-5034] >ref|ZP_05905414.1| dimethyladenosine transferase [Vibrio parahaemolyticus Peru-466] >ref|ZP_05911785.1| dimethyladenosine transferase [Vibrio parahaemolyticus AQ4037] >sp|Q87ST6.1|RSMA_VIBPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC58599.1| dimethyladenosine transferase [Vibrio parahaemolyticus RIMD 2210633] >gb|EDM58497.1| dimethyladenosine transferase [Vibrio parahaemolyticus AQ3810] 95.5 95.5 99% 2e-18  
YP_908060.1 dimethyladenosine transferase [Mycobacterium ulcerans Agy99] >gb|ABL06589.1| dimethyladenosine transferase KsgA [Mycobacterium ulcerans Agy99] 95.5 95.5 89% 2e-18  
ZP_03780217.1 hypothetical protein CLOHYLEM_07308 [Clostridium hylemonae DSM 15053] >gb|EEG72669.1| hypothetical protein CLOHYLEM_07308 [Clostridium hylemonae DSM 15053] 95.5 95.5 93% 2e-18  
ZP_05564233.1 dimethyladenosine transferase [Enterococcus faecalis Merz96] >gb|EEU67190.1| dimethyladenosine transferase [Enterococcus faecalis Merz96] 95.5 95.5 92% 2e-18  
YP_003209046.1 Dimethyladenosine transferase [Cronobacter turicensis z3032] >emb|CBA27949.1| Dimethyladenosine transferase [Cronobacter turicensis z3032] 95.1 95.1 98% 2e-18  
YP_002538374.1 dimethyladenosine transferase [Geobacter sp. FRC-32] >gb|ACM21273.1| dimethyladenosine transferase [Geobacter sp. FRC-32] 95.1 95.1 95% 2e-18  
YP_001627356.1 dimethyladenosine transferase [Brucella suis ATCC 23445] >sp|B0CL06.1|RSMA_BRUSI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABY37786.1| dimethyladenosine transferase [Brucella suis ATCC 23445] 95.1 95.1 91% 2e-18  
ZP_02025069.1 hypothetical protein EUBVEN_00288 [Eubacterium ventriosum ATCC 27560] >gb|EDM52407.1| hypothetical protein EUBVEN_00288 [Eubacterium ventriosum ATCC 27560] 95.1 95.1 95% 2e-18  
ZP_01861284.1 dimethyladenosine transferase [Bacillus sp. SG-1] >gb|EDL63677.1| dimethyladenosine transferase [Bacillus sp. SG-1] 95.1 95.1 92% 2e-18  
YP_140213.1 dimethyladenosine transferase [Streptococcus thermophilus LMG 18311] >sp|Q5M2L6.1|RSMA_STRT2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAV61398.1| dimethyladenosine transferase (rRNA methylation) [Streptococcus thermophilus LMG 18311] 95.1 95.1 92% 2e-18  
ZP_04435506.1 dimethyladenosine transferase [Enterococcus faecalis TX1322] >ref|ZP_05559585.1| dimethyladenosine transferase [Enterococcus faecalis T8] >gb|EEN74117.1| dimethyladenosine transferase [Enterococcus faecalis TX1322] >gb|EEU24825.1| dimethyladenosine transferase [Enterococcus faecalis T8] 95.1 95.1 92% 2e-18  
ZP_04437597.1 dimethyladenosine transferase [Enterococcus faecalis ATCC 29200] >ref|ZP_05421972.1| dimethyladenosine transferase [Enterococcus faecalis T1] >ref|ZP_05598170.1| dimethyladenosine transferase dimethyltransferase [Enterococcus faecalis X98] >gb|EEN71889.1| dimethyladenosine transferase [Enterococcus faecalis ATCC 29200] >gb|EET94880.1| dimethyladenosine transferase [Enterococcus faecalis T1] >gb|EEU92964.1| dimethyladenosine transferase dimethyltransferase [Enterococcus faecalis X98] 95.1 95.1 92% 2e-18  
ZP_01864436.1 dimethyladenosine transferase [Erythrobacter sp. SD-21] >gb|EDL48590.1| dimethyladenosine transferase [Erythrobacter sp. SD-21] 95.1 95.1 96% 2e-18  
YP_002514780.1 dimethyladenosine transferase [Thioalkalivibrio sp. HL-EbGR7] >gb|ACL73793.1| dimethyladenosine transferase [Thioalkalivibrio sp. HL-EbGR7] 95.1 95.1 100% 2e-18  
ZP_01903182.1 dimethyladenosine transferase [Roseobacter sp. AzwK-3b] >gb|EDM71280.1| dimethyladenosine transferase [Roseobacter sp. AzwK-3b] 95.1 95.1 92% 2e-18  
ZP_05575540.1 dimethyladenosine transferase [Enterococcus faecalis E1Sol] >gb|EEU76511.1| dimethyladenosine transferase [Enterococcus faecalis E1Sol] 95.1 95.1 92% 2e-18  
YP_003546002.1 dimethyladenosine transferase [Sphingobium japonicum UT26S] >dbj|BAI97390.1| dimethyladenosine transferase [Sphingobium japonicum UT26S] 95.1 95.1 92% 2e-18  
NP_814674.1 dimethyladenosine transferase [Enterococcus faecalis V583] >ref|ZP_03947905.1| dimethyladenosine transferase [Enterococcus faecalis TX0104] >ref|ZP_03985094.1| dimethyladenosine transferase [Enterococcus faecalis HH22] >ref|ZP_04647727.1| dimethyladenosine transferase [Enterococcus faecalis TUSoD Ef11] >ref|ZP_05424590.1| dimethyladenosine transferase [Enterococcus faecalis T2] >ref|ZP_05474651.1| dimethyladenosine transferase [Enterococcus faecalis ATCC 4200] >ref|ZP_05502270.1| dimethyladenosine transferase [Enterococcus faecalis T3] >ref|ZP_05561379.1| dimethyladenosine transferase [Enterococcus faecalis DS5] >ref|ZP_05572181.1| dimethyladenosine transferase [Enterococcus faecalis JH1] >ref|ZP_05578208.1| dimethyladenosine transferase [Enterococcus faecalis Fly1] >ref|ZP_05580633.1| dimethyladenosine transferase [Enterococcus faecalis D6] >ref|ZP_05583707.1| dimethyladenosine transferase [Enterococcus faecalis CH188] >ref|ZP_05592492.1| dimethyladenosine transferase [Enterococcus faecalis AR01/DG] >ref|ZP_05595524.1| dimethyladenosine transferase [Enterococcus faecalis T11] >ref|ZP_06629721.1| dimethyladenosine transferase [Enterococcus faecalis R712] >ref|ZP_06633203.1| dimethyladenosine transferase [Enterococcus faecalis S613] >ref|ZP_06745886.1| dimethyladenosine transferase [Bacteroides vulgatus EK4.2] >sp|Q837A7.1|RSMA_ENTFA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO80744.1| dimethyladenosine transferase [Enterococcus faecalis V583] >gb|EEI12662.1| dimethyladenosine transferase [Enterococcus faecalis TX0104] >gb|EEI56806.1| dimethyladenosine transferase [Enterococcus faecalis HH22] >gb|EEQ22253.1| dimethyladenosine transferase [Enterococcus faecalis TUSoD Ef11] >gb|EET97498.1| dimethyladenosine transferase [Enterococcus faecalis T2] >gb|EEU16508.1| dimethyladenosine transferase [Enterococcus faecalis ATCC 4200] >gb|EEU22636.1| dimethyladenosine transferase [Enterococcus faecalis T3] >gb|EEU64336.1| dimethyladenosine transferase [Enterococcus faecalis DS5] >gb|EEU73152.1| dimethyladenosine transferase [Enterococcus faecalis JH1] >gb|EEU79179.1| dimethyladenosine transferase [Enterococcus faecalis Fly1] >gb|EEU81604.1| dimethyladenosine transferase [Enterococcus faecalis D6] >gb|EEU84678.1| dimethyladenosine transferase [Enterococcus faecalis CH188] >gb|EEU87286.1| dimethyladenosine transferase [Enterococcus faecalis AR01/DG] >gb|EEU90318.1| dimethyladenosine transferase [Enterococcus faecalis T11] >gb|EFE16254.1| dimethyladenosine transferase [Enterococcus faecalis R712] >gb|EFE18830.1| dimethyladenosine transferase [Enterococcus faecalis S613] >gb|EFG20789.1| dimethyladenosine transferase [Bacteroides vulgatus EK4.2] 95.1 95.1 92% 2e-18  
YP_002027056.1 dimethyladenosine transferase [Stenotrophomonas maltophilia R551-3] >gb|ACF50373.1| dimethyladenosine transferase [Stenotrophomonas maltophilia R551-3] 95.1 95.1 98% 2e-18  
YP_001970708.1 putative dimethyladenosine transferase [Stenotrophomonas maltophilia K279a] >emb|CAQ44394.1| putative dimethyladenosine transferase [Stenotrophomonas maltophilia K279a] 95.1 95.1 98% 2e-18  
YP_377291.1 dimethyladenosine transferase [Synechococcus sp. CC9902] >sp|Q3AXF3.1|RSMA_SYNS9 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB26247.1| dimethyladenosine transferase [Synechococcus sp. CC9902] 95.1 95.1 92% 2e-18  
YP_262708.1 dimethyladenosine transferase [Pseudomonas fluorescens Pf-5] >sp|Q4K4X5.1|RSMA_PSEF5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAY94842.1| dimethyladenosine transferase [Pseudomonas fluorescens Pf-5] 95.1 95.1 99% 2e-18  
ZP_05787454.1 dimethyladenosine transferase [Silicibacter lacuscaerulensis ITI-1157] >gb|EEX10570.1| dimethyladenosine transferase [Silicibacter lacuscaerulensis ITI-1157] 95.1 95.1 92% 2e-18  
YP_003532281.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Erwinia amylovora CFBP1430] >ref|YP_003537756.1| dimethyladenosine transferase [Erwinia amylovora ATCC 49946] >emb|CBJ45341.1| dimethyladenosine transferase [Erwinia amylovora ATCC 49946] >emb|CBA22688.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Erwinia amylovora CFBP1430] 95.1 95.1 99% 2e-18  
NP_959909.1 dimethyladenosine transferase [Mycobacterium avium subsp. paratuberculosis K-10] >sp|Q741W2.1|RSMA_MYCPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAS03292.1| KsgA [Mycobacterium avium subsp. paratuberculosis K-10] 95.1 95.1 89% 2e-18  
YP_002875073.1 dimethyladenosine transferase [Pseudomonas fluorescens SBW25] >emb|CAY52848.1| dimethyladenosine transferase [Pseudomonas fluorescens SBW25] 95.1 95.1 92% 2e-18  
ZP_01460115.1 dimethyladenosine transferase [Stigmatella aurantiaca DW4/3-1] >gb|EAU69219.1| dimethyladenosine transferase [Stigmatella aurantiaca DW4/3-1] 95.1 95.1 99% 2e-18  
ZP_01157668.1 dimethyladenosine transferase [Oceanicola granulosus HTCC2516] >gb|EAR50183.1| dimethyladenosine transferase [Oceanicola granulosus HTCC2516] 95.1 95.1 92% 2e-18  
NP_301300.1 dimethyladenosine transferase [Mycobacterium leprae TN] >ref|YP_002502931.1| putative dimethyladenosine transferase [Mycobacterium leprae Br4923] >sp|Q9CD52.1|RSMA_MYCLE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B8ZU59.1|RSMA_MYCLB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAC29749.1| putative dimethyladenosine transferase [Mycobacterium leprae] >emb|CAR70334.1| putative dimethyladenosine transferase [Mycobacterium leprae Br4923] 95.1 95.1 90% 2e-18  
ZP_01471905.1 putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. RS9916] >gb|EAU73619.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. RS9916] 95.1 95.1 92% 2e-18  
YP_001444036.1 dimethyladenosine transferase [Vibrio harveyi ATCC BAA-1116] >sp|A7MWC6.1|RSMA_VIBHB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABU69809.1| hypothetical protein VIBHAR_00808 [Vibrio harveyi ATCC BAA-1116] 95.1 95.1 99% 2e-18  
ZP_04601274.1 hypothetical protein GCWU000324_00743 [Kingella oralis ATCC 51147] >gb|EEP68834.1| hypothetical protein GCWU000324_00743 [Kingella oralis ATCC 51147] 94.7 94.7 99% 3e-18  
ZP_03991445.1 dimethyladenosine transferase [Oribacterium sinus F0268] >gb|EEJ51324.1| dimethyladenosine transferase [Oribacterium sinus F0268] 94.7 94.7 92% 3e-18  
ZP_01986908.1 dimethyladenosine transferase [Vibrio harveyi HY01] >gb|EDL68435.1| dimethyladenosine transferase [Vibrio harveyi HY01] 94.7 94.7 99% 3e-18  
YP_002769571.1 dimethyladenosine transferase [Brevibacillus brevis NBRC 100599] >dbj|BAH41067.1| dimethyladenosine transferase [Brevibacillus brevis NBRC 100599] 94.7 94.7 90% 3e-18  
YP_142130.1 dimethyladenosine transferase [Streptococcus thermophilus CNRZ1066] >sp|Q5LY12.1|RSMA_STRT1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAV63315.1| dimethyladenosine transferase (rRNA methylation) [Streptococcus thermophilus CNRZ1066] 94.7 94.7 92% 3e-18  
CBL26106.1 dimethyladenosine transferase [Ruminococcus torques L2-14] 94.7 94.7 95% 3e-18  
ZP_00961043.1 dimethyladenosine transferase [Roseovarius nubinhibens ISM] >gb|EAP76614.1| dimethyladenosine transferase [Roseovarius nubinhibens ISM] 94.7 94.7 92% 3e-18  
ZP_03489809.1 hypothetical protein EUBIFOR_02405 [Eubacterium biforme DSM 3989] >gb|EEC89058.1| hypothetical protein EUBIFOR_02405 [Eubacterium biforme DSM 3989] 94.7 94.7 92% 3e-18  
YP_272932.1 dimethyladenosine transferase [Pseudomonas syringae pv. phaseolicola 1448A] >ref|ZP_05637147.1| dimethyladenosine transferase [Pseudomonas syringae pv. tabaci ATCC 11528] >sp|Q48NT7.1|RSMA_PSE14 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ35682.1| dimethyladenosine transferase [Pseudomonas syringae pv. phaseolicola 1448A] 94.7 94.7 100% 3e-18  
NP_873641.1 dimethyladenosine transferase [Haemophilus ducreyi 35000HP] >sp|Q7VM33.1|RSMA_HAEDU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAP96030.1| dimethyladenosine transferase [Haemophilus ducreyi 35000HP] 94.7 94.7 92% 3e-18  
YP_821106.1 dimethyladenosine transferase [Streptococcus thermophilus LMD-9] >sp|Q03IR2.1|RSMA_STRTD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABJ66910.1| dimethyladenosine transferase [Streptococcus thermophilus LMD-9] 94.7 94.7 92% 3e-18  
ZP_01253075.1 dimethyladenosine transferase [Psychroflexus torquis ATCC 700755] >gb|EAS71999.1| dimethyladenosine transferase [Psychroflexus torquis ATCC 700755] 94.7 94.7 91% 3e-18  
CBK83486.1 dimethyladenosine transferase [Coprococcus sp. ART55/1] 94.4 94.4 95% 3e-18  
ZP_03395822.1 dimethyladenosine transferase [Pseudomonas syringae pv. tomato T1] >gb|EEB60999.1| dimethyladenosine transferase [Pseudomonas syringae pv. tomato T1] 94.4 94.4 100% 3e-18  
ZP_04431352.1 dimethyladenosine transferase [Bacillus coagulans 36D1] >gb|EEN92387.1| dimethyladenosine transferase [Bacillus coagulans 36D1] 94.4 94.4 92% 3e-18  
YP_411218.1 dimethyladenosine transferase [Nitrosospira multiformis ATCC 25196] >sp|Q2YBP5.1|RSMA_NITMU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB73826.1| dimethyladenosine transferase [Nitrosospira multiformis ATCC 25196] 94.4 94.4 100% 4e-18  
NP_737582.1 dimethyladenosine transferase [Corynebacterium efficiens YS-314] >ref|ZP_05749964.1| dimethyladenosine transferase [Corynebacterium efficiens YS-314] >sp|Q8FQZ5.1|RSMA_COREF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAC17782.1| putative dimethyladenosine transferase [Corynebacterium efficiens YS-314] >gb|EEW49896.1| dimethyladenosine transferase [Corynebacterium efficiens YS-314] 94.4 94.4 92% 4e-18  
NP_790398.1 dimethyladenosine transferase [Pseudomonas syringae pv. tomato str. DC3000] >sp|Q88A46.1|RSMA_PSESM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO54093.1| dimethyladenosine transferase [Pseudomonas syringae pv. tomato str. DC3000] 94.4 94.4 100% 4e-18  
YP_003555546.1 dimethyladenosine transferase [Shewanella violacea DSS12] >dbj|BAJ00768.1| dimethyladenosine transferase [Shewanella violacea DSS12] 94.4 94.4 99% 4e-18  
ZP_01964660.1 hypothetical protein RUMOBE_02385 [Ruminococcus obeum ATCC 29174] >gb|EDM86977.1| hypothetical protein RUMOBE_02385 [Ruminococcus obeum ATCC 29174] 94.4 94.4 93% 4e-18  
YP_001759402.1 dimethyladenosine transferase [Shewanella woodyi ATCC 51908] >sp|B1KGH9.1|RSMA_SHEWM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA85307.1| dimethyladenosine transferase [Shewanella woodyi ATCC 51908] 94.4 94.4 98% 4e-18  
ZP_02951318.1 dimethyladenosine transferase [Clostridium butyricum 5521] >ref|ZP_04529452.1| dimethyladenosine transferase [Clostridium butyricum E4 str. BoNT E BL5262] >gb|EDT73708.1| dimethyladenosine transferase [Clostridium butyricum 5521] >gb|EEP52476.1| dimethyladenosine transferase [Clostridium butyricum E4 str. BoNT E BL5262] 94.4 94.4 98% 4e-18  
ABC97698.1 KsgA [Shigella flexneri] 94.4 94.4 99% 4e-18  
ZP_01733911.1 dimethyladenosine transferase [Flavobacteria bacterium BAL38] >gb|EAZ96980.1| dimethyladenosine transferase [Flavobacteria bacterium BAL38] 94.4 94.4 99% 4e-18  
YP_001270820.1 dimethyladenosine transferase [Lactobacillus reuteri DSM 20016] >ref|YP_001841200.1| dimethyladenosine transferase [Lactobacillus reuteri JCM 1112] >ref|ZP_03847717.1| dimethyladenosine transferase [Lactobacillus reuteri MM2-3] >ref|ZP_03960850.1| dimethyladenosine transferase [Lactobacillus reuteri MM4-1A] >sp|A5VI09.1|RSMA_LACRD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B2G5I8.1|RSMA_LACRJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABQ82483.1| dimethyladenosine transferase [Lactobacillus reuteri DSM 20016] >dbj|BAG24720.1| dimethyladenosine transferase [Lactobacillus reuteri JCM 1112] >gb|EEI09702.1| dimethyladenosine transferase [Lactobacillus reuteri MM2-3] >gb|EEI74722.1| dimethyladenosine transferase [Lactobacillus reuteri MM4-1A] 94.4 94.4 92% 4e-18  
YP_955579.1 dimethyladenosine transferase [Mycobacterium vanbaalenii PYR-1] >sp|A1TEH3.1|RSMA_MYCVP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM15573.1| dimethyladenosine transferase [Mycobacterium vanbaalenii PYR-1] 94.4 94.4 89% 4e-18  
YP_291473.1 dimethyladenosine transferase [Prochlorococcus marinus str. NATL2A] >sp|Q46L58.1|RSMA_PROMT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ57770.1| dimethyladenosine transferase [Prochlorococcus marinus str. NATL2A] 94.4 94.4 92% 4e-18  
ZP_02206176.1 hypothetical protein COPEUT_00938 [Coprococcus eutactus ATCC 27759] >gb|EDP27417.1| hypothetical protein COPEUT_00938 [Coprococcus eutactus ATCC 27759] 94.4 94.4 95% 4e-18  
YP_003261173.1 dimethyladenosine transferase [Pectobacterium wasabiae WPP163] >gb|ACX89566.1| dimethyladenosine transferase [Pectobacterium wasabiae WPP163] 94.0 94.0 99% 4e-18  
ZP_05004037.1 dimethyladenosine transferase dimethyltransferase [Streptomyces clavuligerus ATCC 27064] >ref|ZP_06771743.1| Dimethyladenosine transferase [Streptomyces clavuligerus ATCC 27064] >gb|EDY48336.1| dimethyladenosine transferase dimethyltransferase [Streptomyces clavuligerus ATCC 27064] >gb|EFG07342.1| Dimethyladenosine transferase [Streptomyces clavuligerus ATCC 27064] 94.0 94.0 91% 4e-18  
ZP_03394276.1 dimethyladenosine transferase [Corynebacterium amycolatum SK46] >gb|EEB62680.1| dimethyladenosine transferase [Corynebacterium amycolatum SK46] 94.0 94.0 90% 4e-18  
ZP_03166408.1 hypothetical protein RUMLAC_00054 [Ruminococcus lactaris ATCC 29176] >gb|EDY34156.1| hypothetical protein RUMLAC_00054 [Ruminococcus lactaris ATCC 29176] 94.0 94.0 95% 4e-18  
YP_003153251.1 dimethyladenosine transferase [Anaerococcus prevotii DSM 20548] >gb|ACV29530.1| dimethyladenosine transferase [Anaerococcus prevotii DSM 20548] 94.0 94.0 96% 4e-18  
ZP_05990334.1 dimethyladenosine transferase [Mannheimia haemolytica serotype A2 str. BOVINE] >ref|ZP_05991512.1| dimethyladenosine transferase [Mannheimia haemolytica serotype A2 str. OVINE] >gb|EEY10523.1| dimethyladenosine transferase [Mannheimia haemolytica serotype A2 str. OVINE] >gb|EEY11712.1| dimethyladenosine transferase [Mannheimia haemolytica serotype A2 str. BOVINE] 94.0 94.0 91% 4e-18  
YP_003098454.1 dimethyladenosine transferase [Actinosynnema mirum DSM 43827] >gb|ACU34608.1| dimethyladenosine transferase [Actinosynnema mirum DSM 43827] 94.0 94.0 90% 5e-18  
ZP_01755097.1 dimethyladenosine transferase [Roseobacter sp. SK209-2-6] >gb|EBA16213.1| dimethyladenosine transferase [Roseobacter sp. SK209-2-6] 94.0 94.0 92% 5e-18  
ZP_01545559.1 dimethyladenosine transferase [Stappia aggregata IAM 12614] >gb|EAV46402.1| dimethyladenosine transferase [Stappia aggregata IAM 12614] 94.0 94.0 91% 5e-18  
YP_002543978.1 dimethyladenosine transferase [Agrobacterium radiobacter K84] >gb|ACM26052.1| dimethyladenosine transferase [Agrobacterium radiobacter K84] 94.0 94.0 92% 5e-18  
ZP_01980089.1 dimethyladenosine transferase [Vibrio cholerae MZO-2] >gb|EDM53008.1| dimethyladenosine transferase [Vibrio cholerae MZO-2] 94.0 94.0 100% 5e-18  
ZP_06805385.1 dimethyladenosine transferase [Brevibacterium mcbrellneri ATCC 49030] >gb|EFG47806.1| dimethyladenosine transferase [Brevibacterium mcbrellneri ATCC 49030] 94.0 94.0 91% 5e-18  
ZP_04577394.1 dimethyladenosine transferase dimethyltransferase [Oxalobacter formigenes HOxBLS] >gb|EEO28356.1| dimethyladenosine transferase dimethyltransferase [Oxalobacter formigenes HOxBLS] 94.0 94.0 95% 5e-18  
ZP_06480350.1 dimethyladenosine transferase [Pseudomonas syringae pv. aesculi str. 2250] 94.0 94.0 100% 5e-18  
YP_001695830.1 dimethyladenosine transferase [Lysinibacillus sphaericus C3-41] >sp|B1HS82.1|RSMA_LYSSC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA37700.1| Dimethyladenosine transferase [Lysinibacillus sphaericus C3-41] 94.0 94.0 92% 5e-18  
YP_156613.1 dimethyladenosine transferase [Idiomarina loihiensis L2TR] >sp|Q5QVN7.1|RSMA_IDILO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAV83064.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Idiomarina loihiensis L2TR] 94.0 94.0 96% 5e-18  
ZP_03073614.1 dimethyladenosine transferase [Lactobacillus reuteri 100-23] >gb|EDX43560.1| dimethyladenosine transferase [Lactobacillus reuteri 100-23] 94.0 94.0 92% 5e-18  
NP_240923.1 dimethyladenosine transferase [Bacillus halodurans C-125] >sp|Q9KGK4.1|RSMA_BACHD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB03776.1| dimethyladenosine transferase [Bacillus halodurans C-125] 94.0 94.0 95% 5e-18  
ZP_05742607.1 dimethyladenosine transferase [Silicibacter sp. TrichCH4B] >gb|EEW56766.1| dimethyladenosine transferase [Silicibacter sp. TrichCH4B] 94.0 94.0 92% 5e-18  
ZP_05336288.1 dimethyladenosine transferase [Thermoanaerobacterium thermosaccharolyticum DSM 571] >gb|EET54179.1| dimethyladenosine transferase [Thermoanaerobacterium thermosaccharolyticum DSM 571] 94.0 94.0 95% 5e-18  
YP_942485.1 dimethyladenosine transferase [Psychromonas ingrahamii 37] >sp|A1STS1.1|RSMA_PSYIN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM02886.1| dimethyladenosine transferase [Psychromonas ingrahamii 37] 93.6 93.6 98% 6e-18  
ZP_06497055.1 dimethyladenosine transferase [Pseudomonas syringae pv. syringae FF5] 93.6 93.6 100% 6e-18  
YP_002905841.1 dimethyladenosine transferase [Corynebacterium kroppenstedtii DSM 44385] >gb|ACR17298.1| dimethyladenosine transferase [Corynebacterium kroppenstedtii DSM 44385] 93.6 93.6 90% 6e-18  
ZP_03523230.1 dimethyladenosine transferase [Rhizobium etli GR56] 93.6 93.6 92% 6e-18  
ZP_05483222.1 dimethyladenosine transferase [Streptomyces sp. AA4] 93.6 93.6 84% 6e-18  
ZP_02920113.1 hypothetical protein STRINF_00988 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gb|EDT47625.1| hypothetical protein STRINF_00988 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] 93.6 93.6 92% 6e-18  
Q28RD6.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 93.6 93.6 92% 6e-18  
YP_237695.1 dimethyladenosine transferase [Pseudomonas syringae pv. syringae B728a] >sp|Q4ZMG5.1|RSMA_PSEU2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAY39657.1| RRNA 16S rRNA dimethylase [Pseudomonas syringae pv. syringae B728a] 93.6 93.6 100% 6e-18  
ZP_05368398.1 dimethyladenosine transferase [Rothia mucilaginosa ATCC 25296] >gb|EET74947.1| dimethyladenosine transferase [Rothia mucilaginosa ATCC 25296] 93.6 93.6 91% 6e-18  
NP_688769.1 dimethyladenosine transferase [Streptococcus agalactiae 2603V/R] >ref|ZP_00780496.1| dimethyladenosine transferase [Streptococcus agalactiae 18RS21] >sp|Q8DXR8.1|RSMA_STRA5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN00642.1|AE014272_13 dimethyladenosine transferase [Streptococcus agalactiae 2603V/R] >gb|EAO62909.1| dimethyladenosine transferase [Streptococcus agalactiae 18RS21] 93.6 93.6 92% 6e-18  
YP_003431436.1 dimethyladenosine transferase [Streptococcus gallolyticus UCN34] >emb|CBI14519.1| dimethyladenosine transferase [Streptococcus gallolyticus UCN34] 93.6 93.6 92% 6e-18  
YP_001036040.1 dimethyladenosine transferase [Streptococcus sanguinis SK36] >sp|A3CQN5.1|RSMA_STRSV RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABN45490.1| Dimethyladenosine transferase, putative [Streptococcus sanguinis SK36] 93.6 93.6 92% 6e-18  
YP_802659.1 hypothetical protein BCc_089 [Buchnera aphidicola str. Cc (Cinara cedri)] >gb|ABJ90566.1| dimethyladenosine transferase [Buchnera aphidicola str. Cc (Cinara cedri)] 93.6 93.6 90% 6e-18  
YP_612939.1 dimethyladenosine transferase [Ruegeria sp. TM1040] >sp|Q1GI39.1|RSMA_SILST RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABF63677.1| dimethyladenosine transferase [Ruegeria sp. TM1040] 93.6 93.6 92% 6e-18  
YP_509751.1 dimethyladenosine transferase [Jannaschia sp. CCS1] >gb|ABD54726.1| dimethyladenosine transferase [Jannaschia sp. CCS1] 93.6 93.6 92% 6e-18  
ZP_03927955.1 dimethyladenosine transferase [Actinomyces urogenitalis DSM 15434] >gb|EEH65195.1| dimethyladenosine transferase [Actinomyces urogenitalis DSM 15434] 93.6 93.6 92% 7e-18  
YP_001143076.1 dimethyladenosine transferase [Aeromonas salmonicida subsp. salmonicida A449] >gb|ABO91328.1| dimethyladenosine transferase [Aeromonas salmonicida subsp. salmonicida A449] 93.6 93.6 99% 7e-18  
ZP_06743661.1 dimethyladenosine transferase [Bacteroides vulgatus PC510] >gb|EFG16437.1| dimethyladenosine transferase [Bacteroides vulgatus PC510] 93.6 93.6 95% 7e-18  
ZP_05255502.1 dimethyladenosine transferase [Bacteroides sp. 4_3_47FAA] >gb|EET15894.1| dimethyladenosine transferase [Bacteroides sp. 4_3_47FAA] 93.6 93.6 95% 7e-18  
YP_003363250.1 dimethyladenosine transferase [Rothia mucilaginosa DY-18] >dbj|BAI65430.1| dimethyladenosine transferase [Rothia mucilaginosa DY-18] 93.6 93.6 91% 7e-18  
ZP_01264129.1 Dimethyladenosine transferase [Candidatus Pelagibacter ubique HTCC1002] >gb|EAS84616.1| Dimethyladenosine transferase [Candidatus Pelagibacter ubique HTCC1002] 93.6 93.6 89% 7e-18  
ZP_04679845.1 dimethyladenosine transferase [Ochrobactrum intermedium LMG 3301] >gb|EEQ95351.1| dimethyladenosine transferase [Ochrobactrum intermedium LMG 3301] 93.6 93.6 91% 7e-18  
ZP_06048068.1 dimethyladenosine transferase [Vibrio cholerae CT 5369-93] >gb|EEY52792.1| dimethyladenosine transferase [Vibrio cholerae CT 5369-93] 93.2 93.2 100% 7e-18  
YP_003143154.1 dimethyladenosine transferase [Slackia heliotrinireducens DSM 20476] >gb|ACV21805.1| dimethyladenosine transferase [Slackia heliotrinireducens DSM 20476] 93.2 93.2 92% 7e-18  
YP_001299220.1 dimethyladenosine transferase [Bacteroides vulgatus ATCC 8482] >sp|A6L1N4.1|RSMA_BACV8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABR39598.1| dimethyladenosine transferase [Bacteroides vulgatus ATCC 8482] 93.2 93.2 95% 7e-18  
ZP_05134911.1 dimethyladenosine transferase [Stenotrophomonas sp. SKA14] >gb|EED38972.1| dimethyladenosine transferase [Stenotrophomonas sp. SKA14] 93.2 93.2 98% 7e-18  
ZP_01678961.1 dimethyladenosine transferase [Vibrio cholerae 2740-80] >ref|YP_001218711.1| dimethyladenosine transferase [Vibrio cholerae O395] >ref|ZP_01950985.1| dimethyladenosine transferase [Vibrio cholerae 1587] >ref|ZP_01954560.1| dimethyladenosine transferase [Vibrio cholerae MAK 757] >ref|ZP_01958131.1| dimethyladenosine transferase [Vibrio cholerae MZO-3] >ref|ZP_01972879.1| dimethyladenosine transferase [Vibrio cholerae NCTC 8457] >ref|ZP_04396588.1| dimethyladenosine transferase [Vibrio cholerae BX 330286] >ref|ZP_04398255.1| dimethyladenosine transferase [Vibrio cholerae B33] >ref|ZP_04402096.1| dimethyladenosine transferase [Vibrio cholerae TMA 21] >ref|ZP_04409193.1| dimethyladenosine transferase [Vibrio cholerae RC9] >ref|ZP_04409416.1| dimethyladenosine transferase [Vibrio cholerae TM 11079-80] >ref|ZP_04414541.1| dimethyladenosine transferase [Vibrio cholerae bv. albensis VL426] >ref|ZP_04419675.1| dimethyladenosine transferase [Vibrio cholerae 12129(1)] >ref|YP_002876910.1| dimethyladenosine transferase [Vibrio cholerae MJ-1236] >ref|ZP_05240024.1| dimethyladenosine transferase [Vibrio cholerae MO10] >ref|ZP_05417783.1| dimethyladenosine transferase [Vibrio cholera CIRS 101] >ref|ZP_06027985.1| dimethyladenosine transferase [Vibrio cholerae INDRE 91/1] >ref|ZP_06035297.1| dimethyladenosine transferase [Vibrio cholerae RC27] >sp|Q9KUS2.2|RSMA_VIBCH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5F8N2.1|RSMA_VIBC3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EAX56639.1| dimethyladenosine transferase [Vibrio cholerae 2740-80] >gb|EAY32564.1| dimethyladenosine transferase [Vibrio cholerae 1587] >gb|EAY36243.1| dimethyladenosine transferase [Vibrio cholerae MAK 757] >gb|EAY39655.1| dimethyladenosine transferase [Vibrio cholerae MZO-3] >gb|EAZ71835.1| dimethyladenosine transferase [Vibrio cholerae NCTC 8457] >gb|ABQ19551.1| dimethyladenosine transferase [Vibrio cholerae O395] >gb|EEN97548.1| dimethyladenosine transferase [Vibrio cholerae 12129(1)] >gb|EEO03734.1| dimethyladenosine transferase [Vibrio cholerae bv. albensis VL426] >gb|EEO07925.1| dimethyladenosine transferase [Vibrio cholerae TM 11079-80] >gb|EEO09414.1| dimethyladenosine transferase [Vibrio cholerae RC9] >gb|EEO15255.1| dimethyladenosine transferase [Vibrio cholerae TMA 21] >gb|EEO19097.1| dimethyladenosine transferase [Vibrio cholerae B33] >gb|EEO20747.1| dimethyladenosine transferase [Vibrio cholerae BX 330286] >gb|ACQ59340.1| dimethyladenosine transferase [Vibrio cholerae MJ-1236] >gb|EET24793.1| dimethyladenosine transferase [Vibrio cholerae MO10] >gb|EET93963.1| dimethyladenosine transferase [Vibrio cholera CIRS 101] >gb|EEY42626.1| dimethyladenosine transferase [Vibrio cholerae RC27] >gb|EEY49992.1| dimethyladenosine transferase [Vibrio cholerae INDRE 91/1] 93.2 93.2 100% 7e-18  
ZP_03827892.1 dimethyladenosine transferase [Pectobacterium carotovorum subsp. brasiliensis PBR1692] 93.2 93.2 99% 8e-18  
ZP_04753995.1 dimethyladenosine transferase [Actinobacillus minor NM305] >gb|EER46594.1| dimethyladenosine transferase [Actinobacillus minor NM305] 93.2 93.2 90% 8e-18  
ZP_06516471.1 predicted protein [Mycobacterium tuberculosis T85] >gb|EFD76669.1| predicted protein [Mycobacterium tuberculosis T85] 93.2 93.2 89% 8e-18  
NP_230097.1 dimethyladenosine transferase [Vibrio cholerae O1 biovar El Tor str. N16961] >ref|ZP_01682375.1| dimethyladenosine transferase [Vibrio cholerae V52] >ref|ZP_01983496.1| dimethyladenosine transferase [Vibrio cholerae 623-39] >ref|YP_002809205.1| dimethyladenosine transferase [Vibrio cholerae M66-2] >ref|ZP_04962980.1| dimethyladenosine transferase [Vibrio cholerae AM-19226] >gb|AAF93616.1| dimethyladenosine transferase [Vibrio cholerae O1 biovar El Tor str. N16961] >gb|EAX60805.1| dimethyladenosine transferase [Vibrio cholerae V52] >gb|EDL71823.1| dimethyladenosine transferase [Vibrio cholerae 623-39] >gb|EDN13850.1| dimethyladenosine transferase [Vibrio cholerae AM-19226] >gb|ACP04754.1| dimethyladenosine transferase [Vibrio cholerae M66-2] >gb|ACP08507.1| dimethyladenosine transferase [Vibrio cholerae O395] 93.2 93.2 100% 8e-18  
ZP_01057261.1 dimethyladenosine transferase [Roseobacter sp. MED193] >gb|EAQ44950.1| dimethyladenosine transferase [Roseobacter sp. MED193] 93.2 93.2 92% 8e-18  
ZP_06291862.1 dimethyladenosine transferase [Peptoniphilus lacrimalis 315-B] >gb|EFA89392.1| dimethyladenosine transferase [Peptoniphilus lacrimalis 315-B] 93.2 93.2 94% 8e-18  
YP_001906668.1 dimethyladenosine transferase [Erwinia tasmaniensis Et1/99] >sp|B2VGP6.1|RSMA_ERWT9 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAO95770.1| Dimethyladenosine transferase [Erwinia tasmaniensis Et1/99] 93.2 93.2 99% 8e-18  
YP_246272.1 dimethyladenosine transferase [Rickettsia felis URRWXCal2] >gb|AAY61107.1| Dimethyladenosine transferase [Rickettsia felis URRWXCal2] 93.2 93.2 72% 8e-18  
YP_001179111.1 dimethyladenosine transferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gb|ABP65920.1| dimethyladenosine transferase [Caldicellulosiruptor saccharolyticus DSM 8903] 93.2 93.2 92% 8e-18  
YP_458669.1 dimethyladenosine transferase [Erythrobacter litoralis HTCC2594] >sp|Q2N8W9.1|RSMA_ERYLH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC63872.1| dimethyladenosine transferase [Erythrobacter litoralis HTCC2594] 93.2 93.2 99% 8e-18  
ZP_03431912.1 dimethyladenosine transferase [Mycobacterium tuberculosis T85] 93.2 93.2 89% 8e-18  
YP_719764.1 dimethyladenosine transferase [Haemophilus somnus 129PT] >ref|YP_001783811.1| dimethyladenosine transferase [Haemophilus somnus 2336] >sp|Q0I5C3.1|RSMA_HAES1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B0URM7.1|RSMA_HAES2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI25827.1| dimethyladenosine transferase [Haemophilus somnus 129PT] >gb|ACA32110.1| dimethyladenosine transferase [Haemophilus somnus 2336] 93.2 93.2 90% 8e-18  
YP_002479675.1 dimethyladenosine transferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] >gb|ACL48997.1| dimethyladenosine transferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] 93.2 93.2 91% 8e-18  
ZP_01794150.1 dimethyladenosine transferase [Haemophilus influenzae PittII] >gb|EDK12044.1| dimethyladenosine transferase [Haemophilus influenzae PittII] 93.2 93.2 95% 8e-18  
ZP_05116472.1 dimethyladenosine transferase [Labrenzia alexandrii DFL-11] >gb|EEE47071.1| dimethyladenosine transferase [Labrenzia alexandrii DFL-11] 93.2 93.2 92% 9e-18  
YP_003472612.1 Dimethyladenosine transferase [Staphylococcus lugdunensis HKU09-01] >gb|ADC88484.1| Dimethyladenosine transferase [Staphylococcus lugdunensis HKU09-01] 93.2 93.2 91% 9e-18  
ZP_01437692.1 dimethyladenosine transferase (16S rRNA dimethylase) protein [Fulvimarina pelagi HTCC2506] >gb|EAU42689.1| dimethyladenosine transferase (16S rRNA dimethylase) protein [Fulvimarina pelagi HTCC2506] 93.2 93.2 91% 9e-18  
ZP_06755367.1 dimethyladenosine transferase [Scardovia inopinata F0304] >gb|EFG26459.1| dimethyladenosine transferase [Scardovia inopinata F0304] 93.2 93.2 92% 9e-18  
Q4UMV1.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 93.2 93.2 72% 9e-18  
ZP_01796106.1 dimethyladenosine transferase [Haemophilus influenzae R3021] >gb|EDK14970.1| dimethyladenosine transferase [Haemophilus influenzae 22.4-21] 93.2 93.2 95% 9e-18  
YP_001133201.1 dimethyladenosine transferase [Mycobacterium gilvum PYR-GCK] >sp|A4T6P3.1|RSMA_MYCGI RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABP44413.1| dimethyladenosine transferase [Mycobacterium gilvum PYR-GCK] 93.2 93.2 89% 9e-18  
ZP_01793068.1 dimethyladenosine transferase [Haemophilus influenzae PittHH] >gb|EDK09299.1| dimethyladenosine transferase [Haemophilus influenzae PittHH] 93.2 93.2 95% 9e-18  
NP_438707.1 dimethyladenosine transferase [Haemophilus influenzae Rd KW20] >ref|ZP_01784730.1| dimethyladenosine transferase [Haemophilus influenzae 22.1-21] >ref|ZP_05848819.1| dimethyladenosine transferase [Haemophilus influenzae RdAW] >sp|P44749.1|RSMA_HAEIN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAC22207.1| dimethyladenosine transferase (ksgA) [Haemophilus influenzae Rd KW20] >gb|EDJ89086.1| dimethyladenosine transferase [Haemophilus influenzae 22.1-21] >gb|EEW76295.1| dimethyladenosine transferase [Haemophilus influenzae RdAW] 92.8 92.8 95% 9e-18  
YP_001371148.1 dimethyladenosine transferase [Ochrobactrum anthropi ATCC 49188] >sp|A6X265.1|RSMA_OCHA4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS15319.1| dimethyladenosine transferase [Ochrobactrum anthropi ATCC 49188] 92.8 92.8 91% 1e-17  
YP_601711.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS10750] >sp|Q1J8J4.1|RSMA_STRPF RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABF37167.1| Dimethyladenosine transferase [Streptococcus pyogenes MGAS10750] 92.8 92.8 92% 1e-17  
NP_789497.1 dimethyladenosine transferase [Tropheryma whipplei TW08/27] >emb|CAD67235.1| dimethyladenosine transferase [Tropheryma whipplei TW08/27] 92.8 92.8 91% 1e-17  
ZP_06363944.1 dimethyladenosine transferase [Bacillus cellulosilyticus DSM 2522] >gb|EFC16230.1| dimethyladenosine transferase [Bacillus cellulosilyticus DSM 2522] 92.8 92.8 92% 1e-17  
ZP_04979047.1 rRNA (adenine-N6,N6-)-dimethyltransferase [Mannheimia haemolytica PHL213] >gb|EDN75443.1| rRNA (adenine-N6,N6-)-dimethyltransferase [Mannheimia haemolytica PHL213] 92.8 92.8 91% 1e-17  
ZP_05924087.1 dimethyladenosine transferase [Vibrio sp. RC341] >gb|EEX67685.1| dimethyladenosine transferase [Vibrio sp. RC341] 92.8 92.8 100% 1e-17  
YP_062610.1 dimethyladenosine transferase [Leifsonia xyli subsp. xyli str. CTCB07] >sp|Q6ADP1.1|RSMA_LEIXX RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAT89505.1| dimethyladenosine transferase [Leifsonia xyli subsp. xyli str. CTCB07] 92.8 92.8 74% 1e-17  
ZP_06754283.1 dimethyladenosine transferase [Simonsiella muelleri ATCC 29453] >gb|EFG30832.1| dimethyladenosine transferase [Simonsiella muelleri ATCC 29453] 92.8 92.8 99% 1e-17  
ZP_06622184.1 dimethyladenosine transferase [Turicibacter sp. PC909] >gb|EFF63494.1| dimethyladenosine transferase [Turicibacter sp. PC909] 92.8 92.8 90% 1e-17  
ZP_00155543.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Haemophilus influenzae R2846] >ref|YP_001289927.1| dimethyladenosine transferase [Haemophilus influenzae PittEE] >ref|YP_001292496.1| dimethyladenosine transferase [Haemophilus influenzae PittGG] >ref|ZP_04465834.1| dimethyladenosine transferase [Haemophilus influenzae 6P18H1] >ref|ZP_04466742.1| dimethyladenosine transferase [Haemophilus influenzae 7P49H1] >sp|A5U9U3.1|RSMA_HAEIE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5UH57.1|RSMA_HAEIG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABQ97544.1| dimethyladenosine transferase [Haemophilus influenzae PittEE] >gb|ABR00113.1| dimethyladenosine transferase [Haemophilus influenzae PittGG] >gb|EEP46445.1| dimethyladenosine transferase [Haemophilus influenzae 7P49H1] >gb|EEP47061.1| dimethyladenosine transferase [Haemophilus influenzae 6P18H1] 92.8 92.8 95% 1e-17  
ZP_03301750.1 hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17855] >ref|ZP_04539263.1| dimethyladenosine transferase [Bacteroides sp. 9_1_42FAA] >ref|ZP_04554701.1| dimethyladenosine transferase [Bacteroides sp. D4] >ref|ZP_06090419.1| dimethyladenosine transferase [Bacteroides sp. 3_1_33FAA] >gb|EEB24449.1| hypothetical protein BACDOR_03140 [Bacteroides dorei DSM 17855] >gb|EEO47485.1| dimethyladenosine transferase [Bacteroides sp. D4] >gb|EEO62929.1| dimethyladenosine transferase [Bacteroides sp. 9_1_42FAA] >gb|EEZ19631.1| dimethyladenosine transferase [Bacteroides sp. 3_1_33FAA] 92.8 92.8 93% 1e-17  
YP_003158959.1 dimethyladenosine transferase [Desulfomicrobium baculatum DSM 4028] >gb|ACU90543.1| dimethyladenosine transferase [Desulfomicrobium baculatum DSM 4028] 92.8 92.8 92% 1e-17  
YP_003008793.1 dimethyladenosine transferase [Paenibacillus sp. JDR-2] >gb|ACS98706.1| dimethyladenosine transferase [Paenibacillus sp. JDR-2] 92.8 92.8 92% 1e-17  
YP_003271242.1 dimethyladenosine transferase [Haliangium ochraceum DSM 14365] >gb|ACY19349.1| dimethyladenosine transferase [Haliangium ochraceum DSM 14365] 92.8 92.8 99% 1e-17  
ZP_06460642.1 dimethyladenosine transferase [Pseudomonas syringae pv. aesculi str. NCPPB3681] 92.8 92.8 100% 1e-17  
YP_001352110.1 dimethyladenosine transferase [Janthinobacterium sp. Marseille] >sp|A6SV13.1|RSMA_JANMA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABR88294.1| dimethyladenosine transferase [Janthinobacterium sp. Marseille] 92.8 92.8 99% 1e-17  
YP_563890.1 dimethyladenosine transferase [Shewanella denitrificans OS217] >sp|Q12K59.1|RSMA_SHEDO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABE56167.1| dimethyladenosine transferase [Shewanella denitrificans OS217] 92.8 92.8 99% 1e-17  
ZP_06560127.1 dimethyladenosine transferase [Megasphaera genomosp. type_1 str. 28L] >gb|EFD93832.1| dimethyladenosine transferase [Megasphaera genomosp. type_1 str. 28L] 92.8 92.8 92% 1e-17  
YP_003150896.1 dimethyladenosine transferase [Cryptobacterium curtum DSM 15641] >gb|ACU94214.1| dimethyladenosine transferase [Cryptobacterium curtum DSM 15641] 92.8 92.8 90% 1e-17  
ZP_01133762.1 dimethyladenosine transferase [Pseudoalteromonas tunicata D2] >gb|EAR29161.1| dimethyladenosine transferase [Pseudoalteromonas tunicata D2] 92.8 92.8 99% 1e-17  
YP_001977673.1 dimethyladenosine transferase (16S rRNA dimethylase) protein [Rhizobium etli CIAT 652] >ref|ZP_03512660.1| dimethyladenosine transferase [Rhizobium etli 8C-3] >sp|B3PUU6.1|RSMA_RHIE6 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACE90495.1| dimethyladenosine transferase (16S rRNA dimethylase) protein [Rhizobium etli CIAT 652] 92.8 92.8 92% 1e-17  
ZP_01789228.1 dimethyladenosine transferase [Haemophilus influenzae 3655] >gb|EDJ92476.1| dimethyladenosine transferase [Haemophilus influenzae 3655] 92.8 92.8 95% 1e-17  
ZP_05065717.1 dimethyladenosine transferase [Octadecabacter antarcticus 238] >gb|EDY90956.1| dimethyladenosine transferase [Octadecabacter antarcticus 238] 92.8 92.8 92% 1e-17  
ZP_02931975.1 dimethyladenosine transferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >ref|ZP_02964605.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >ref|ZP_02997074.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >ref|ZP_03003922.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >ref|ZP_03004272.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >ref|ZP_03079446.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >ref|ZP_03205903.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >ref|YP_002285056.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] >ref|ZP_03771825.1| conserved domain protein [Ureaplasma urealyticum serovar 2 str. ATCC 27814] >ref|ZP_03772242.1| conserved domain protein [Ureaplasma urealyticum serovar 8 str. ATCC 27618] >sp|B5ZCB6.1|RSMA_UREU1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EDT49833.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gb|EDU06486.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gb|EDU56740.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gb|EDU67190.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gb|EDX53432.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gb|EDX54171.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gb|EDY74667.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gb|ACI60331.1| dimethyladenosine transferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] >gb|EEH01476.1| conserved domain protein [Ureaplasma urealyticum serovar 8 str. ATCC 27618] >gb|EEH02392.1| conserved domain protein [Ureaplasma urealyticum serovar 2 str. ATCC 27814] 92.8 92.8 99% 1e-17  
YP_001831793.1 dimethyladenosine transferase [Beijerinckia indica subsp. indica ATCC 9039] >gb|ACB94304.1| dimethyladenosine transferase [Beijerinckia indica subsp. indica ATCC 9039] 92.8 92.8 91% 1e-17  
ZP_01786049.1 dimethyladenosine transferase [Haemophilus influenzae 22.4-21] >gb|EDJ91440.1| dimethyladenosine transferase [Haemophilus influenzae R3021] 92.8 92.8 95% 1e-17  
NP_078440.1 dimethyladenosine transferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gb|AAF31015.1|AE002158_13 dimethyladenosine transferase [Ureaplasma parvum serovar 3 str. ATCC 700970] 92.8 92.8 92% 1e-17  
YP_003399108.1 dimethyladenosine transferase [Acidaminococcus fermentans DSM 20731] >gb|ADB47793.1| dimethyladenosine transferase [Acidaminococcus fermentans DSM 20731] 92.8 92.8 93% 1e-17  
ZP_05850532.1 dimethyladenosine transferase [Haemophilus influenzae NT127] >gb|EEW78096.1| dimethyladenosine transferase [Haemophilus influenzae NT127] 92.8 92.8 95% 1e-17  
ZP_05121470.1 dimethyladenosine transferase [Vibrio parahaemolyticus 16] >gb|EED24733.1| dimethyladenosine transferase [Vibrio parahaemolyticus 16] 92.8 92.8 100% 1e-17  
ZP_06811954.1 dimethyladenosine transferase [Geobacillus thermoglucosidasius C56-YS93] >gb|EFG51610.1| dimethyladenosine transferase [Geobacillus thermoglucosidasius C56-YS93] 92.8 92.8 92% 1e-17  
ZP_05374123.1 dimethyladenosine transferase [Geobacillus sp. Y4.1MC1] >gb|EET69234.1| dimethyladenosine transferase [Geobacillus sp. Y4.1MC1] 92.8 92.8 92% 1e-17  
YP_003019186.1 dimethyladenosine transferase [Pectobacterium carotovorum subsp. carotovorum PC1] >sp|C6DEY6.1|RSMA_PECCP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACT14650.1| dimethyladenosine transferase [Pectobacterium carotovorum subsp. carotovorum PC1] 92.8 92.8 99% 1e-17  
NP_787331.1 dimethyladenosine transferase [Tropheryma whipplei str. Twist] >gb|AAO44300.1| dimethyladenosine transferase [Tropheryma whipplei str. Twist] 92.8 92.8 91% 1e-17  
YP_001532528.1 dimethyladenosine transferase [Dinoroseobacter shibae DFL 12] >sp|A8LI73.1|RSMA_DINSH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV92927.1| dimethyladenosine transferase [Dinoroseobacter shibae DFL 12] 92.8 92.8 92% 1e-17  
YP_248258.1 dimethyladenosine transferase [Haemophilus influenzae 86-028NP] >ref|ZP_01791070.1| dimethyladenosine transferase [Haemophilus influenzae PittAA] >sp|Q4QMZ9.1|RSMA_HAEI8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAX87598.1| dimethyladenosine transferase [Haemophilus influenzae 86-028NP] >gb|EDK07376.1| dimethyladenosine transferase [Haemophilus influenzae PittAA] 92.8 92.8 95% 1e-17  
YP_437176.1 dimethyladenosine transferase [Hahella chejuensis KCTC 2396] >sp|Q2S9C3.1|RSMA_HAHCH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC32751.1| dimethyladenosine transferase [Hahella chejuensis KCTC 2396] 92.8 92.8 97% 1e-17  
ZP_01450577.1 dimethyladenosine transferase [alpha proteobacterium HTCC2255] >ref|ZP_03561525.1| dimethyladenosine transferase [Glaciecola sp. HTCC2999] 92.8 92.8 98% 1e-17  
YP_001407358.1 dimethyladenosine transferase [Campylobacter curvus 525.92] >sp|A7GVW6.1|RSMA_CAMC5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EAT99787.1| dimethyladenosine transferase [Campylobacter curvus 525.92] 92.4 92.4 99% 1e-17  
YP_546260.1 dimethyladenosine transferase [Methylobacillus flagellatus KT] >sp|Q1GZB8.1|RSMA_METFK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABE50419.1| dimethyladenosine transferase [Methylobacillus flagellatus KT] 92.4 92.4 99% 1e-17  
YP_002525582.1 Dimethyladenosine transferase [Rhodobacter sphaeroides KD131] >sp|B9KST5.1|RSMA_RHOSK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACM01081.1| Dimethyladenosine transferase [Rhodobacter sphaeroides KD131] 92.4 92.4 92% 1e-17  
ZP_06597294.1 dimethyladenosine transferase [Oribacterium sp. oral taxon 078 str. F0262] >gb|EFE93167.1| dimethyladenosine transferase [Oribacterium sp. oral taxon 078 str. F0262] 92.4 92.4 92% 1e-17  
YP_428934.1 dimethyladenosine transferase [Moorella thermoacetica ATCC 39073] >sp|Q2RME8.1|RSMA_MOOTA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC18391.1| dimethyladenosine transferase [Moorella thermoacetica ATCC 39073] 92.4 92.4 93% 1e-17  
NP_215526.1 dimethyladenosine transferase [Mycobacterium tuberculosis H37Rv] >ref|NP_335475.1| dimethyladenosine transferase [Mycobacterium tuberculosis CDC1551] >ref|NP_854694.1| dimethyladenosine transferase [Mycobacterium bovis AF2122/97] >ref|YP_977162.1| dimethyladenosine transferase [Mycobacterium bovis BCG str. Pasteur 1173P2] >ref|YP_001282315.1| dimethyladenosine transferase [Mycobacterium tuberculosis H37Ra] >ref|YP_001286974.1| dimethyladenosine transferase [Mycobacterium tuberculosis F11] >ref|ZP_02550409.1| dimethyladenosine transferase [Mycobacterium tuberculosis H37Ra] >ref|ZP_03415007.1| dimethyladenosine transferase [Mycobacterium tuberculosis 02_1987] >ref|ZP_03419421.1| dimethyladenosine transferase [Mycobacterium tuberculosis 94_M4241A] >ref|ZP_03427790.1| dimethyladenosine transferase [Mycobacterium tuberculosis EAS054] >ref|ZP_03531478.1| dimethyladenosine transferase [Mycobacterium tuberculosis GM 1503] >ref|ZP_03535953.1| dimethyladenosine transferase [Mycobacterium tuberculosis T17] >ref|YP_002644098.1| dimethyladenosine transferase [Mycobacterium bovis BCG str. Tokyo 172] >ref|ZP_04924632.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis C] >ref|ZP_04979972.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis str. Haarlem] >ref|ZP_05140443.1| dimethyladenosine transferase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] >ref|ZP_05219800.1| dimethyladenosine transferase [Mycobacterium tuberculosis KZN 4207] >ref|ZP_05763395.1| dimethyladenosine transferase [Mycobacterium tuberculosis CPHL_A] >ref|ZP_05767530.1| dimethyladenosine transferase [Mycobacterium tuberculosis T46] >ref|ZP_05771719.1| dimethyladenosine transferase [Mycobacterium tuberculosis K85] >ref|ZP_06432175.1| dimethyladenosine transferase [Mycobacterium tuberculosis T46] >ref|ZP_06436336.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis CPHL_A] >ref|ZP_06444417.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis KZN 605] >ref|ZP_06449214.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis T17] >ref|ZP_06453877.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis K85] >ref|ZP_06504124.1| dimethyladenosine transferase [Mycobacterium tuberculosis 02_1987] >ref|ZP_06512449.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis EAS054] >ref|ZP_06520524.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis GM 1503] >ref|ZP_06737395.1| dimethyladenosine transferase [Mycobacterium tuberculosis KZN 4207] >ref|ZP_06761469.1| dimethyladenosine transferase [Mycobacterium tuberculosis KZN V2475] >ref|ZP_06777856.1| dimethyladenosine transferase [Mycobacterium tuberculosis KZN R506] >ref|ZP_06800891.1| dimethyladenosine transferase [Mycobacterium tuberculosis 210] >sp|P66661.1|RSMA_MYCBO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|P66660.1|RSMA_MYCTU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A1KHE8.1|RSMA_MYCBP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A5U153.1|RSMA_MYCTA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C1AM01.1|RSMA_MYCBT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAB08137.1| PROBABLE DIMETHYLADENOSINE TRANSFERASE KSGA (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) [Mycobacterium tuberculosis H37Rv] >gb|AAK45289.1| dimethyladenosine transferase [Mycobacterium tuberculosis CDC1551] >emb|CAD93898.1| PROBABLE DIMETHYLADENOSINE TRANSFERASE KSGA (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) [Mycobacterium bovis AF2122/97] >emb|CAL71054.1| Probable dimethyladenosine transferase ksgA [Mycobacterium bovis BCG str. Pasteur 1173P2] >gb|EAY59374.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis C] >gb|EBA41485.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis str. Haarlem] >gb|ABQ72753.1| dimethyladenosine transferase [Mycobacterium tuberculosis H37Ra] >gb|ABR05372.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis F11] >dbj|BAH25330.1| dimethyladenosine transferase [Mycobacterium bovis BCG str. Tokyo 172] >gb|EFD12590.1| dimethyladenosine transferase [Mycobacterium tuberculosis T46] >gb|EFD16751.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis CPHL_A] >gb|EFD22332.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis KZN 605] >gb|EFD42659.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis K85] >gb|EFD46389.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis T17] >gb|EFD52762.1| dimethyladenosine transferase [Mycobacterium tuberculosis 02_1987] >gb|EFD61087.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis EAS054] >gb|EFD72668.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis GM 1503] 92.4 92.4 90% 1e-17  
ZP_06508917.1 LOW QUALITY PROTEIN: dimethyladenosine transferase ksgA [Mycobacterium tuberculosis T92] >gb|EFD57555.1| LOW QUALITY PROTEIN: dimethyladenosine transferase ksgA [Mycobacterium tuberculosis T92] 92.4 92.4 90% 1e-17  
YP_003032961.1 dimethyladenosine transferase ksgA [Mycobacterium tuberculosis KZN 1435] >gb|ACT26066.1| dimethyladenosine transferase ksgA [Mycobacterium tuberculosis KZN 1435] 92.4 92.4 90% 1e-17  
YP_266132.1 dimethyladenosine transferase [Candidatus Pelagibacter ubique HTCC1062] >sp|Q4FMR0.1|RSMA_PELUB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAZ21529.1| Dimethyladenosine transferase [Candidatus Pelagibacter ubique HTCC1062] 92.4 92.4 89% 1e-17  
ZP_03831754.1 dimethyladenosine transferase [Pectobacterium carotovorum subsp. carotovorum WPP14] 92.4 92.4 93% 1e-17  
YP_001752686.1 dimethyladenosine transferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >ref|ZP_02931616.1| dimethyladenosine transferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >ref|ZP_02958159.1| dimethyladenosine transferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >ref|ZP_02971428.1| dimethyladenosine transferase [Ureaplasma parvum serovar 6 str. ATCC 27818] >sp|Q9PPN8.2|RSMA_UREPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B1AJP2.1|RSMA_UREP2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA33268.1| dimethyladenosine transferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gb|EDT48940.1| dimethyladenosine transferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gb|EDT88037.1| dimethyladenosine transferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gb|EDU19292.1| dimethyladenosine transferase [Ureaplasma parvum serovar 6 str. ATCC 27818] 92.4 92.4 92% 1e-17  
YP_001679822.1 dimethyladenosine transferase [Heliobacterium modesticaldum Ice1] >gb|ABZ83811.1| dimethyladenosine transferase [Heliobacterium modesticaldum Ice1] 92.4 92.4 98% 1e-17  
ZP_02081442.1 hypothetical protein CLOLEP_02918 [Clostridium leptum DSM 753] >gb|EDO60100.1| hypothetical protein CLOLEP_02918 [Clostridium leptum DSM 753] 92.4 92.4 96% 1e-17  
YP_003328621.1 dimethyladenosine transferase [Anaplasma centrale str. Israel] >gb|ACZ49307.1| dimethyladenosine transferase [Anaplasma centrale str. Israel] 92.4 92.4 87% 1e-17  
YP_003298609.1 dimethyladenosine transferase [Thermomonospora curvata DSM 43183] >gb|ACY96571.1| dimethyladenosine transferase [Thermomonospora curvata DSM 43183] 92.4 92.4 90% 1e-17  
CBL41726.1 dimethyladenosine transferase [Clostridiales sp. SS3/4] 92.4 92.4 95% 1e-17  
ZP_03630408.1 dimethyladenosine transferase [bacterium Ellin514] >gb|EEF59247.1| dimethyladenosine transferase [bacterium Ellin514] 92.4 92.4 93% 1e-17  
ZP_04771838.1 dimethyladenosine transferase [Asticcacaulis excentricus CB 48] >gb|EER48969.1| dimethyladenosine transferase [Asticcacaulis excentricus CB 48] 92.4 92.4 92% 1e-17  
ZP_03699859.1 dimethyladenosine transferase [Lutiella nitroferrum 2002] >gb|EEG07162.1| dimethyladenosine transferase [Lutiella nitroferrum 2002] 92.4 92.4 100% 1e-17  
YP_855484.1 dimethyladenosine transferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >sp|A0KGT8.1|RSMA_AERHH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK36812.1| dimethyladenosine transferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] 92.4 92.4 99% 1e-17  
ZP_03424207.1 dimethyladenosine transferase [Mycobacterium tuberculosis T92] 92.4 92.4 90% 1e-17  
YP_002975040.1 dimethyladenosine transferase [Rhizobium leguminosarum bv. trifolii WSM1325] >gb|ACS55501.1| dimethyladenosine transferase [Rhizobium leguminosarum bv. trifolii WSM1325] 92.4 92.4 92% 2e-17  
ZP_06239396.1 ribosomal RNA adenine methylase transferase [Frankia sp. EuI1c] >gb|EFA59328.1| ribosomal RNA adenine methylase transferase [Frankia sp. EuI1c] 92.4 92.4 90% 2e-17  
ZP_06031843.1 dimethyladenosine transferase [Vibrio mimicus VM223] >gb|EEY46298.1| dimethyladenosine transferase [Vibrio mimicus VM223] 92.4 92.4 100% 2e-17  
ZP_05718409.1 dimethyladenosine transferase [Vibrio mimicus VM573] >ref|ZP_06040134.1| dimethyladenosine transferase [Vibrio mimicus MB-451] >gb|EEW09116.1| dimethyladenosine transferase [Vibrio mimicus VM573] >gb|EEY39518.1| dimethyladenosine transferase [Vibrio mimicus MB-451] 92.4 92.4 100% 2e-17  
YP_001043431.1 dimethyladenosine transferase [Rhodobacter sphaeroides ATCC 17029] >sp|A3PJZ3.1|RSMA_RHOS1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABN76659.1| dimethyladenosine transferase [Rhodobacter sphaeroides ATCC 17029] 92.4 92.4 92% 2e-17  
ZP_05721851.1 dimethyladenosine transferase [Vibrio mimicus VM603] >gb|EEW05678.1| dimethyladenosine transferase [Vibrio mimicus VM603] 92.4 92.4 100% 2e-17  
ZP_06268297.1 dimethyladenosine transferase [Prevotella bivia JCVIHMP010] >gb|EFB93177.1| dimethyladenosine transferase [Prevotella bivia JCVIHMP010] 92.4 92.4 93% 2e-17  
ZP_01883604.1 dimethyladenosine transferase [Pedobacter sp. BAL39] >gb|EDM37074.1| dimethyladenosine transferase [Pedobacter sp. BAL39] 92.0 92.0 98% 2e-17  
YP_352966.1 dimethyladenosine transferase [Rhodobacter sphaeroides 2.4.1] >sp|Q3J2B9.1|RSMA_RHOS4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA79065.1| dimethyladenosine transferase [Rhodobacter sphaeroides 2.4.1] 92.0 92.0 92% 2e-17  
ZP_05292236.1 Dimethyladenosine transferase [Acidithiobacillus caldus ATCC 51756] >gb|EET27802.1| Dimethyladenosine transferase [Acidithiobacillus caldus ATCC 51756] 92.0 92.0 96% 2e-17  
YP_003189697.1 dimethyladenosine transferase [Desulfotomaculum acetoxidans DSM 771] >gb|ACV61074.1| dimethyladenosine transferase [Desulfotomaculum acetoxidans DSM 771] 92.0 92.0 96% 2e-17  
YP_002647741.1 Dimethyladenosine transferase [Erwinia pyrifoliae Ep1/96] >emb|CAX54490.1| Dimethyladenosine transferase [Erwinia pyrifoliae Ep1/96] >emb|CAY73125.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase [Erwinia pyrifoliae DSM 12163] 92.0 92.0 99% 2e-17  
ZP_02438074.1 hypothetical protein CLOSS21_00513 [Clostridium sp. SS2/1] >gb|EDS22680.1| hypothetical protein CLOSS21_00513 [Clostridium sp. SS2/1] 92.0 92.0 95% 2e-17  
ZP_02622122.1 dimethyladenosine transferase [Clostridium botulinum C str. Eklund] >gb|EDS76754.1| dimethyladenosine transferase [Clostridium botulinum C str. Eklund] 92.0 92.0 98% 2e-17  
ZP_00785733.1 dimethyladenosine transferase [Streptococcus agalactiae COH1] >gb|EAO75505.1| dimethyladenosine transferase [Streptococcus agalactiae COH1] 92.0 92.0 92% 2e-17  
ZP_05629872.1 dimethyladenosine transferase [Actinobacillus minor 202] >gb|EEV25204.1| dimethyladenosine transferase [Actinobacillus minor 202] 92.0 92.0 90% 2e-17  
ZP_01016334.1 dimethyladenosine transferase [Parvularcula bermudensis HTCC2503] >gb|EAQ16845.1| dimethyladenosine transferase [Parvularcula bermudensis HTCC2503] 92.0 92.0 80% 2e-17  
YP_003485519.1 dimethyladenosine transferase [Streptococcus mutans NN2025] >dbj|BAH88627.1| dimethyladenosine transferase [Streptococcus mutans NN2025] 92.0 92.0 92% 2e-17  
YP_001014770.1 dimethyladenosine transferase [Prochlorococcus marinus str. NATL1A] >sp|A2C1Z5.1|RSMA_PROM1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM75505.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Prochlorococcus marinus str. NATL1A] 92.0 92.0 92% 2e-17  
ZP_04659819.1 dimethyladenosine transferase [Selenomonas flueggei ATCC 43531] >gb|EEQ47657.1| dimethyladenosine transferase [Selenomonas flueggei ATCC 43531] 92.0 92.0 80% 2e-17  
ZP_01960094.1 hypothetical protein BACCAC_01706 [Bacteroides caccae ATCC 43185] >gb|EDM21000.1| hypothetical protein BACCAC_01706 [Bacteroides caccae ATCC 43185] 92.0 92.0 95% 2e-17  
ZP_06346790.1 dimethyladenosine transferase [Clostridium sp. M62/1] >gb|EFE12114.1| dimethyladenosine transferase [Clostridium sp. M62/1] 92.0 92.0 95% 2e-17  
YP_003319096.1 dimethyladenosine transferase [Sphaerobacter thermophilus DSM 20745] >gb|ACZ38274.1| dimethyladenosine transferase [Sphaerobacter thermophilus DSM 20745] 92.0 92.0 99% 2e-17  
ZP_01123964.1 putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. WH 7805] >gb|EAR18599.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. WH 7805] 92.0 92.0 92% 2e-17  
ZP_03293694.1 hypothetical protein CLOHIR_01644 [Clostridium hiranonis DSM 13275] >gb|EEA84684.1| hypothetical protein CLOHIR_01644 [Clostridium hiranonis DSM 13275] 92.0 92.0 97% 2e-17  
YP_173574.1 dimethyladenosine transferase [Bacillus clausii KSM-K16] >sp|Q5WLW2.1|RSMA_BACSK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAD62613.1| dimethyladenosine transferase [Bacillus clausii KSM-K16] 92.0 92.0 95% 2e-17  
CBK76086.1 dimethyladenosine transferase [Clostridium saccharolyticum-like K10] 92.0 92.0 95% 2e-17  
ZP_03946781.1 possible dimethyladenosine transferase [Atopobium vaginae DSM 15829] >gb|EEI83965.1| possible dimethyladenosine transferase [Atopobium vaginae DSM 15829] 92.0 92.0 92% 2e-17  
ZP_04025926.1 dimethyladenosine transferase [Tsukamurella paurometabola DSM 20162] >gb|EEK01328.1| dimethyladenosine transferase [Tsukamurella paurometabola DSM 20162] 92.0 92.0 93% 2e-17  
YP_879149.1 dimethyladenosine transferase [Clostridium novyi NT] >gb|ABK62593.1| dimethyladenosine transferase [Clostridium novyi NT] 92.0 92.0 98% 2e-17  
NP_540184.1 dimethyladenosine transferase [Brucella melitensis 16M] >ref|ZP_05447279.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. Rev.1] >ref|ZP_05834213.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. 16M] >ref|ZP_06103350.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. Rev.1] >sp|Q8YG94.1|RSMA_BRUME RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAL52448.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. 16M] >gb|EEW88835.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. 16M] >gb|EEZ14152.1| dimethyladenosine transferase [Brucella melitensis bv. 1 str. Rev.1] 92.0 92.0 91% 2e-17  
ZP_05709999.1 dimethyladenosine transferase [Desulfurivibrio alkaliphilus AHT2] >gb|EEV93571.1| dimethyladenosine transferase [Desulfurivibrio alkaliphilus AHT2] 91.7 91.7 99% 2e-17  
YP_001560985.1 dimethyladenosine transferase [Clostridium phytofermentans ISDg] >sp|A9KL97.1|RSMA_CLOPH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX44246.1| dimethyladenosine transferase [Clostridium phytofermentans ISDg] 91.7 91.7 93% 2e-17  
ZP_02002345.1 Ribosomal RNA adenine methylase transferase [Beggiatoa sp. PS] >gb|EDN67654.1| Ribosomal RNA adenine methylase transferase [Beggiatoa sp. PS] 91.7 91.7 99% 2e-17  
YP_330398.1 dimethyladenosine transferase [Streptococcus agalactiae A909] >ref|ZP_00783335.1| dimethyladenosine transferase [Streptococcus agalactiae H36B] >sp|Q3JZA5.1|RSMA_STRA1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA44983.1| dimethyladenosine transferase [Streptococcus agalactiae A909] >gb|EAO77923.1| dimethyladenosine transferase [Streptococcus agalactiae H36B] 91.7 91.7 92% 2e-17  
ZP_05315893.1 dimethyladenosine transferase [Nitrosomonas sp. AL212] >gb|EET31443.1| dimethyladenosine transferase [Nitrosomonas sp. AL212] 91.7 91.7 99% 2e-17  
YP_002280583.1 dimethyladenosine transferase [Rhizobium leguminosarum bv. trifolii WSM2304] >sp|B5ZWD8.1|RSMA_RHILW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACI54357.1| dimethyladenosine transferase [Rhizobium leguminosarum bv. trifolii WSM2304] 91.7 91.7 92% 2e-17  
YP_001666679.1 dimethyladenosine transferase [Pseudomonas putida GB-1] >gb|ABY96343.1| dimethyladenosine transferase [Pseudomonas putida GB-1] 91.7 91.7 99% 2e-17  
ZP_05919212.1 dimethyladenosine transferase [Pasteurella dagmatis ATCC 43325] >gb|EEX51269.1| dimethyladenosine transferase [Pasteurella dagmatis ATCC 43325] 91.7 91.7 90% 2e-17  
YP_003120937.1 dimethyladenosine transferase [Chitinophaga pinensis DSM 2588] >gb|ACU58736.1| dimethyladenosine transferase [Chitinophaga pinensis DSM 2588] 91.7 91.7 92% 2e-17  
YP_003161894.1 dimethyladenosine transferase [Jonesia denitrificans DSM 20603] >gb|ACV09591.1| dimethyladenosine transferase [Jonesia denitrificans DSM 20603] 91.7 91.7 92% 2e-17  
ZP_03752035.1 hypothetical protein ROSEINA2194_00434 [Roseburia inulinivorans DSM 16841] >gb|EEG95737.1| hypothetical protein ROSEINA2194_00434 [Roseburia inulinivorans DSM 16841] 91.7 91.7 93% 2e-17  
ZP_00788438.1 dimethyladenosine transferase [Streptococcus agalactiae CJB111] >gb|EAO72808.1| dimethyladenosine transferase [Streptococcus agalactiae CJB111] 91.7 91.7 92% 2e-17  
ZP_03974780.1 dimethyladenosine transferase [Lactobacillus reuteri CF48-3A] >ref|ZP_04023648.1| dimethyladenosine transferase [Lactobacillus reuteri SD2112] >gb|EEI65342.1| dimethyladenosine transferase [Lactobacillus reuteri CF48-3A] >gb|EEJ92213.1| dimethyladenosine transferase [Lactobacillus reuteri SD2112] 91.7 91.7 92% 2e-17  
ZP_04704215.1 dimethyladenosine transferase [Streptomyces albus J1074] 91.7 91.7 90% 2e-17  
ZP_06592943.1 dimethyladenosine transferase dimethyltransferase [Streptomyces albus J1074] >gb|EFE83404.1| dimethyladenosine transferase dimethyltransferase [Streptomyces albus J1074] 91.7 91.7 90% 2e-17  
ZP_05735065.1 dimethyladenosine transferase [Prevotella tannerae ATCC 51259] >gb|EEX72272.1| dimethyladenosine transferase [Prevotella tannerae ATCC 51259] 91.7 91.7 93% 2e-17  
YP_940330.1 dimethyladenosine transferase [Mycobacterium sp. KMS] >ref|YP_001072898.1| dimethyladenosine transferase [Mycobacterium sp. JLS] >sp|A3Q5I0.1|RSMA_MYCSJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A1UL32.1|RSMA_MYCSK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABL93540.1| dimethyladenosine transferase [Mycobacterium sp. KMS] >gb|ABO00408.1| dimethyladenosine transferase [Mycobacterium sp. JLS] 91.7 91.7 89% 2e-17  
ZP_04034114.1 dimethyladenosine transferase [Meiothermus silvanus DSM 9946] >gb|EEJ90615.1| dimethyladenosine transferase [Meiothermus silvanus DSM 9946] 91.7 91.7 90% 2e-17  
YP_641424.1 dimethyladenosine transferase [Mycobacterium sp. MCS] >sp|Q1B416.1|RSMA_MYCSS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG10368.1| dimethyladenosine transferase [Mycobacterium sp. MCS] 91.7 91.7 89% 2e-17  
YP_157621.1 dimethyladenosine transferase [Aromatoleum aromaticum EbN1] >sp|Q5P7J1.1|RSMA_AZOSE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAI06720.1| dimethyladenosine transferase [Aromatoleum aromaticum EbN1] 91.7 91.7 96% 2e-17  
CBK75588.1 dimethyladenosine transferase [Butyrivibrio fibrisolvens 16/4] 91.7 91.7 95% 3e-17  
ZP_05648515.1 dimethyladenosine transferase [Enterococcus gallinarum EG2] >gb|EEV31848.1| dimethyladenosine transferase [Enterococcus gallinarum EG2] 91.7 91.7 92% 3e-17  
ZP_01003678.1 dimethyladenosine transferase [Loktanella vestfoldensis SKA53] >gb|EAQ06471.1| dimethyladenosine transferase [Loktanella vestfoldensis SKA53] 91.7 91.7 92% 3e-17  
NP_875155.1 dimethyladenosine transferase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >sp|Q7VCH7.1|RSMA_PROMA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAP99807.1| Dimethyladenosine transferase [Prochlorococcus marinus subsp. marinus str. CCMP1375] 91.7 91.7 92% 3e-17  
ZP_02086962.1 hypothetical protein CLOBOL_04506 [Clostridium bolteae ATCC BAA-613] >gb|EDP15169.1| hypothetical protein CLOBOL_04506 [Clostridium bolteae ATCC BAA-613] 91.7 91.7 93% 3e-17  
YP_756452.1 dimethyladenosine transferase [Maricaulis maris MCS10] >sp|Q0AQC3.1|RSMA_MARMM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI65514.1| dimethyladenosine transferase [Maricaulis maris MCS10] 91.3 91.3 92% 3e-17  
ZP_05375663.1 dimethyladenosine transferase [Hyphomicrobium denitrificans ATCC 51888] >gb|EET67733.1| dimethyladenosine transferase [Hyphomicrobium denitrificans ATCC 51888] 91.3 91.3 90% 3e-17  
YP_003064811.1 dimethyladenosine transferase [Candidatus Liberibacter asiaticus str. psy62] >gb|ACT56871.1| dimethyladenosine transferase [Candidatus Liberibacter asiaticus str. psy62] 91.3 91.3 92% 3e-17  
NP_736256.1 dimethyladenosine transferase [Streptococcus agalactiae NEM316] >ref|ZP_00790325.1| dimethyladenosine transferase [Streptococcus agalactiae 515] >sp|Q8E3D7.1|RSMA_STRA3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAD47481.1| Unknown [Streptococcus agalactiae NEM316] >gb|EAO70929.1| dimethyladenosine transferase [Streptococcus agalactiae 515] 91.3 91.3 92% 3e-17  
ZP_03756039.1 hypothetical protein CLOSTASPAR_00018 [Clostridium asparagiforme DSM 15981] >gb|EEG57800.1| hypothetical protein CLOSTASPAR_00018 [Clostridium asparagiforme DSM 15981] 91.3 91.3 93% 3e-17  
CBL36353.1 dimethyladenosine transferase [butyrate-producing bacterium SM4/1] 91.3 91.3 95% 3e-17  
ZP_03211282.1 Dimethyladenosine transferase (rRNA methylation) [Lactobacillus rhamnosus HN001] >ref|YP_003172317.1| dimethyladenosine transferase [Lactobacillus rhamnosus GG] >gb|EDY99372.1| Dimethyladenosine transferase (rRNA methylation) [Lactobacillus rhamnosus HN001] >emb|CAR88466.1| Dimethyladenosine transferase [Lactobacillus rhamnosus GG] >dbj|BAI42995.1| dimethyladenosine transferase [Lactobacillus rhamnosus GG] 91.3 91.3 92% 3e-17  
ZP_01304260.1 dimethyladenosine transferase [Sphingomonas sp. SKA58] >gb|EAT07942.1| dimethyladenosine transferase [Sphingomonas sp. SKA58] 91.3 91.3 92% 3e-17  
ZP_04777593.1 dimethyladenosine transferase [Sphingobacterium spiritivorum ATCC 33861] >gb|EER73717.1| dimethyladenosine transferase [Sphingobacterium spiritivorum ATCC 33861] 91.3 91.3 99% 3e-17  
YP_001609227.1 dimethyladenosine transferase [Bartonella tribocorum CIP 105476] >sp|A9IRW8.1|RSMA_BART1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAK01232.1| dimethyladenosine transferase [Bartonella tribocorum CIP 105476] 91.3 91.3 90% 3e-17  
YP_595955.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS9429] >ref|YP_599836.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS2096] >sp|Q1JDL6.1|RSMA_STRPB RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q1JNI8.1|RSMA_STRPC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABF31411.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS9429] >gb|ABF35292.1| Dimethyladenosine transferase [Streptococcus pyogenes MGAS2096] 91.3 91.3 92% 3e-17  
NP_268616.1 dimethyladenosine transferase [Streptococcus pyogenes M1 GAS] >ref|YP_281586.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS5005] >sp|Q9A1I0.1|RSMA_STRP1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAK33337.1| putative dimethyladenosine transferase [Streptococcus pyogenes M1 GAS] >gb|AAZ50841.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS5005] 91.3 91.3 92% 3e-17  
YP_001279807.1 dimethyladenosine transferase [Psychrobacter sp. PRwf-1] >gb|ABQ93857.1| dimethyladenosine transferase [Psychrobacter sp. PRwf-1] 91.3 91.3 98% 3e-17  
ZP_03967563.1 dimethyladenosine transferase [Sphingobacterium spiritivorum ATCC 33300] >gb|EEI92666.1| dimethyladenosine transferase [Sphingobacterium spiritivorum ATCC 33300] 91.3 91.3 99% 3e-17  
YP_279685.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS6180] >ref|YP_597831.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS10270] >ref|YP_002997643.1| dimethyladenosine transferase [Streptococcus dysgalactiae subsp. equisimilis GGS_124] >sp|Q1JIN6.1|RSMA_STRPD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|Q48VC6.1|RSMA_STRPM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAX71330.1| dimethyladenosine transferase [Streptococcus pyogenes MGAS6180] >gb|ABF33287.1| Dimethyladenosine transferase [Streptococcus pyogenes MGAS10270] >dbj|BAH82429.1| dimethyladenosine transferase [Streptococcus dysgalactiae subsp. equisimilis GGS_124] 91.3 91.3 92% 3e-17  
NP_606530.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS8232] >ref|YP_002285258.1| Dimethyladenosine transferase [Streptococcus pyogenes NZ131] >sp|Q8P2N8.1|RSMA_STRP8 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAL97029.1| putative dimethyladenosine transferase [Streptococcus pyogenes MGAS8232] >gb|ACI60563.1| Dimethyladenosine transferase [Streptococcus pyogenes NZ131] 91.3 91.3 92% 3e-17  
ZP_05090539.1 dimethyladenosine transferase [Ruegeria sp. R11] >gb|EEB72231.1| dimethyladenosine transferase [Ruegeria sp. R11] 91.3 91.3 92% 3e-17  
ZP_01896271.1 dimethyladenosine transferase [Moritella sp. PE36] >gb|EDM69123.1| dimethyladenosine transferase [Moritella sp. PE36] 91.3 91.3 98% 3e-17  
ZP_05788300.1 dimethyladenosine transferase [Synechococcus sp. WH 8109] >gb|EEX05500.1| dimethyladenosine transferase [Synechococcus sp. WH 8109] 91.3 91.3 92% 3e-17  
ZP_01752138.1 dimethyladenosine transferase [Roseobacter sp. CCS2] >gb|EBA11086.1| dimethyladenosine transferase [Roseobacter sp. CCS2] 91.3 91.3 92% 3e-17  
ZP_01996019.1 hypothetical protein DORLON_02017 [Dorea longicatena DSM 13814] >gb|EDM62623.1| hypothetical protein DORLON_02017 [Dorea longicatena DSM 13814] 91.3 91.3 95% 3e-17  
YP_001111452.1 dimethyladenosine transferase [Desulfotomaculum reducens MI-1] >gb|ABO48627.1| dimethyladenosine transferase [Desulfotomaculum reducens MI-1] 91.3 91.3 91% 3e-17  
ZP_03802646.1 hypothetical protein PROPEN_00993 [Proteus penneri ATCC 35198] >gb|EEG86700.1| hypothetical protein PROPEN_00993 [Proteus penneri ATCC 35198] 91.3 91.3 91% 3e-17  
YP_002561322.1 dimethyladenosine transferase [Macrococcus caseolyticus JCSC5402] >sp|B9E8V8.1|RSMA_MACCJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAH18626.1| dimethyladenosine transferase [Macrococcus caseolyticus JCSC5402] 91.3 91.3 92% 3e-17  
YP_003255101.1 dimethyladenosine transferase [Aggregatibacter actinomycetemcomitans D11S-1] >gb|ACX81882.1| dimethyladenosine transferase [Aggregatibacter actinomycetemcomitans D11S-1] 91.3 91.3 99% 3e-17  
YP_767168.1 dimethyladenosine transferase [Rhizobium leguminosarum bv. viciae 3841] >sp|Q1MJ01.1|RSMA_RHIL3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAK07059.1| putative dimethyladenosine transferase [Rhizobium leguminosarum bv. viciae 3841] 91.3 91.3 92% 3e-17  
ZP_04440208.1 dimethyladenosine transferase [Lactobacillus rhamnosus LMS2-1] >ref|YP_003175269.1| dimethyladenosine transferase [Lactobacillus rhamnosus Lc 705] >gb|EEN81139.1| dimethyladenosine transferase [Lactobacillus rhamnosus LMS2-1] >emb|CAR91418.1| Dimethyladenosine transferase [Lactobacillus rhamnosus Lc 705] 91.3 91.3 92% 3e-17  
ZP_03010544.1 hypothetical protein BACCOP_02425 [Bacteroides coprocola DSM 17136] >gb|EDV00504.1| hypothetical protein BACCOP_02425 [Bacteroides coprocola DSM 17136] 91.3 91.3 96% 3e-17  
YP_002247582.1 dimethyladenosine transferase [Coprothermobacter proteolyticus DSM 5265] >gb|ACI17193.1| dimethyladenosine transferase [Coprothermobacter proteolyticus DSM 5265] 91.3 91.3 90% 4e-17  
YP_516368.1 hypothetical protein DSY0135 [Desulfitobacterium hafniense Y51] >ref|YP_002456579.1| dimethyladenosine transferase [Desulfitobacterium hafniense DCB-2] >sp|Q251W8.1|RSMA_DESHY RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|B8FY38.1|RSMA_DESHD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE81924.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gb|ACL18143.1| dimethyladenosine transferase [Desulfitobacterium hafniense DCB-2] 91.3 91.3 91% 4e-17  
ZP_03784307.1 hypothetical protein RUMHYD_03790 [Blautia hydrogenotrophica DSM 10507] >gb|EEG47323.1| hypothetical protein RUMHYD_03790 [Blautia hydrogenotrophica DSM 10507] 91.3 91.3 95% 4e-17  
YP_003449042.1 dimethyladenosine transferase [Azospirillum sp. B510] >dbj|BAI72498.1| dimethyladenosine transferase [Azospirillum sp. B510] 90.9 90.9 91% 4e-17  
ZP_03658049.1 dimethyladenosine transferase [Helicobacter cinaedi CCUG 18818] 90.9 90.9 96% 4e-17  
ZP_04600012.1 hypothetical protein VEIDISOL_01455 [Veillonella dispar ATCC 17748] >gb|EEP65074.1| hypothetical protein VEIDISOL_01455 [Veillonella dispar ATCC 17748] 90.9 90.9 91% 4e-17  
ZP_03209519.1 hypothetical protein BACPLE_03195 [Bacteroides plebeius DSM 17135] >gb|EDY94783.1| hypothetical protein BACPLE_03195 [Bacteroides plebeius DSM 17135] 90.9 90.9 96% 4e-17  
YP_059572.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS10394] >gb|AAT86389.1| Dimethyladenosine transferase [Streptococcus pyogenes MGAS10394] 90.9 90.9 92% 4e-17  
ZP_01042851.1 dimethyladenosine transferase [Idiomarina baltica OS145] >gb|EAQ32352.1| dimethyladenosine transferase [Idiomarina baltica OS145] 90.9 90.9 89% 4e-17  
CBL06618.1 dimethyladenosine transferase [Megamonas hypermegale ART12/1] 90.9 90.9 92% 4e-17  
ZP_05738530.1 dimethyladenosine transferase [Granulicatella adiacens ATCC 49175] >gb|EEW36445.1| dimethyladenosine transferase [Granulicatella adiacens ATCC 49175] 90.9 90.9 98% 4e-17  
ZP_05414834.1 dimethyladenosine transferase [Bacteroides finegoldii DSM 17565] >gb|EEX46125.1| dimethyladenosine transferase [Bacteroides finegoldii DSM 17565] 90.9 90.9 95% 4e-17  
ZP_01070600.1 dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 260.94] >ref|ZP_01072328.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni HB93-13] >ref|YP_001483189.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 81116] >gb|EAQ57939.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 260.94] >gb|EAQ59585.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni HB93-13] >gb|ABV53212.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 81116] 90.9 90.9 96% 4e-17  
YP_002362522.1 dimethyladenosine transferase [Methylocella silvestris BL2] >gb|ACK51160.1| dimethyladenosine transferase [Methylocella silvestris BL2] 90.9 90.9 99% 4e-17  
YP_001127795.1 dimethyladenosine transferase [Streptococcus pyogenes str. Manfredo] >sp|Q5XDX4.2|RSMA_STRP6 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|A2RCH2.1|RSMA_STRPG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAM29544.1| dimethyladenosine transferase [Streptococcus pyogenes str. Manfredo] 90.9 90.9 92% 4e-17  
ZP_02157302.1 dimethyladenosine transferase [Shewanella benthica KT99] >gb|EDQ01098.1| dimethyladenosine transferase [Shewanella benthica KT99] 90.9 90.9 99% 4e-17  
CBL22584.1 dimethyladenosine transferase [Ruminococcus obeum A2-162] 90.9 90.9 93% 4e-17  
ZP_06635352.1 dimethyladenosine transferase [Aggregatibacter actinomycetemcomitans D7S-1] >gb|EFE01671.1| dimethyladenosine transferase [Aggregatibacter actinomycetemcomitans D7S-1] 90.9 90.9 99% 4e-17  
ZP_01080119.1 putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. RS9917] >gb|EAQ69100.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Synechococcus sp. RS9917] 90.9 90.9 92% 4e-17  
NP_439988.1 dimethyladenosine transferase [Synechocystis sp. PCC 6803] >sp|P72666.1|RSMA_SYNY3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAA16668.1| dimethyladenosine transferase [Synechocystis sp. PCC 6803] 90.9 90.9 92% 4e-17  
ZP_02171929.1 binding-protein-dependent transport systems inner membrane component [Bacillus selenitireducens MLS10] >gb|EDP81315.1| binding-protein-dependent transport systems inner membrane component [Bacillus selenitireducens MLS10] 90.9 90.9 92% 4e-17  
YP_863515.1 dimethyladenosine transferase [Gramella forsetii KT0803] >emb|CAL68448.1| dimethyladenosine transferase [Gramella forsetii KT0803] 90.9 90.9 99% 4e-17  
YP_760849.1 dimethyladenosine transferase [Hyphomonas neptunium ATCC 15444] >gb|ABI77670.1| dimethyladenosine transferase [Hyphomonas neptunium ATCC 15444] 90.9 90.9 92% 4e-17  
YP_001326451.1 dimethyladenosine transferase [Sinorhizobium medicae WSM419] >sp|A6U7I6.1|RSMA_SINMW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABR59616.1| dimethyladenosine transferase [Sinorhizobium medicae WSM419] 90.9 90.9 92% 4e-17  
ZP_03291367.1 hypothetical protein CLONEX_03589 [Clostridium nexile DSM 1787] >gb|EEA80564.1| hypothetical protein CLONEX_03589 [Clostridium nexile DSM 1787] 90.9 90.9 92% 5e-17  
ZP_01613283.1 dimethyladenosine transferase [Alteromonadales bacterium TW-7] >gb|EAW27558.1| dimethyladenosine transferase [Alteromonadales bacterium TW-7] 90.9 90.9 97% 5e-17  
YP_381497.1 dimethyladenosine transferase [Synechococcus sp. CC9605] >sp|Q3AKE0.1|RSMA_SYNSC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB34942.1| dimethyladenosine transferase [Synechococcus sp. CC9605] 90.9 90.9 92% 5e-17  
YP_002432280.1 dimethyladenosine transferase [Desulfatibacillum alkenivorans AK-01] >gb|ACL04812.1| dimethyladenosine transferase [Desulfatibacillum alkenivorans AK-01] 90.9 90.9 96% 5e-17  
ZP_04061610.1 dimethyladenosine transferase [Streptococcus salivarius SK126] >gb|EEK10162.1| dimethyladenosine transferase [Streptococcus salivarius SK126] 90.5 90.5 92% 5e-17  
ZP_05980460.1 dimethyladenosine transferase [Subdoligranulum variabile DSM 15176] >gb|EFB75899.1| dimethyladenosine transferase [Subdoligranulum variabile DSM 15176] 90.5 90.5 92% 5e-17  
YP_003194009.1 dimethyladenosine transferase [Robiginitalea biformata HTCC2501] >gb|EAR16230.1| dimethyladenosine transferase [Robiginitalea biformata HTCC2501] 90.5 90.5 95% 5e-17  
ZP_01041464.1 dimethyladenosine transferase [Erythrobacter sp. NAP1] >gb|EAQ27583.1| dimethyladenosine transferase [Erythrobacter sp. NAP1] 90.5 90.5 92% 5e-17  
YP_001167322.1 dimethyladenosine transferase [Rhodobacter sphaeroides ATCC 17025] >sp|A4WRK3.1|RSMA_RHOS5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABP70017.1| dimethyladenosine transferase [Rhodobacter sphaeroides ATCC 17025] 90.5 90.5 90% 5e-17  
ZP_05051367.1 dimethyladenosine transferase [Octadecabacter antarcticus 307] >gb|EDY77633.1| dimethyladenosine transferase [Octadecabacter antarcticus 307] 90.5 90.5 92% 5e-17  
ZP_03568764.1 dimethyladenosine transferase [Atopobium rimae ATCC 49626] >gb|EEE16869.1| dimethyladenosine transferase [Atopobium rimae ATCC 49626] 90.5 90.5 92% 5e-17  
YP_357259.1 dimethyladenosine transferase [Pelobacter carbinolicus DSM 2380] >sp|Q3A3G8.1|RSMA_PELCD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA89089.1| dimethyladenosine transferase [Pelobacter carbinolicus DSM 2380] 90.5 90.5 95% 5e-17  
ZP_01690735.1 dimethyladenosine transferase [Microscilla marina ATCC 23134] >gb|EAY28221.1| dimethyladenosine transferase [Microscilla marina ATCC 23134] 90.5 90.5 90% 5e-17  
YP_746016.1 dimethyladenosine transferase [Granulibacter bethesdensis CGDNIH1] >gb|ABI63093.1| dimethyladenosine transferase [Granulibacter bethesdensis CGDNIH1] 90.5 90.5 98% 5e-17  
YP_928691.1 dimethyladenosine transferase [Shewanella amazonensis SB2B] >sp|A1S9G5.1|RSMA_SHEAM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM01022.1| dimethyladenosine transferase [Shewanella amazonensis SB2B] 90.5 90.5 99% 5e-17  
ZP_06341580.1 dimethyladenosine transferase [Bulleidia extructa W1219] >gb|EFC06432.1| dimethyladenosine transferase [Bulleidia extructa W1219] 90.5 90.5 92% 5e-17  
YP_003284060.1 dimethyladenosine transferase [Blattabacterium sp. (Blattella germanica) str. Bge] >gb|ACY40450.1| dimethyladenosine transferase [Blattabacterium sp. (Blattella germanica) str. Bge] 90.5 90.5 93% 5e-17  
ZP_05180629.1 dimethyladenosine transferase [Brucella sp. 83/13] >ref|ZP_06096538.1| dimethyladenosine transferase [Brucella sp. 83/13] >gb|EEZ32656.1| dimethyladenosine transferase [Brucella sp. 83/13] 90.5 90.5 91% 5e-17  
YP_683318.1 dimethyladenosine transferase [Roseobacter denitrificans OCh 114] >sp|Q164G1.1|RSMA_ROSDO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG32632.1| dimethyladenosine transferase, putative [Roseobacter denitrificans OCh 114] 90.5 90.5 92% 5e-17  
NP_899791.1 dimethyladenosine transferase [Chromobacterium violaceum ATCC 12472] >sp|Q7P1U1.1|RSMA_CHRVO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAQ57800.1| dimethyladenosine transferase [Chromobacterium violaceum ATCC 12472] 90.5 90.5 100% 5e-17  
ZP_02691890.1 dimethyladenosine transferase [Epulopiscium sp. 'N.t. morphotype B'] 90.5 90.5 75% 6e-17  
YP_468979.1 dimethyladenosine transferase [Rhizobium etli CFN 42] >sp|Q2KA84.1|RSMA_RHIEC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC90252.1| dimethyladenosine transferase (16S rRNA dimethylase) protein [Rhizobium etli CFN 42] 90.5 90.5 92% 6e-17  
YP_001716246.1 dimethyladenosine transferase [Candidatus Desulforudis audaxviator MP104C] >gb|ACA58614.1| dimethyladenosine transferase [Candidatus Desulforudis audaxviator MP104C] 90.5 90.5 91% 6e-17  
YP_003008590.1 dimethyladenosine transferase [Aggregatibacter aphrophilus NJ8700] >gb|ACS98503.1| dimethyladenosine transferase [Aggregatibacter aphrophilus NJ8700] 90.5 90.5 95% 6e-17  
XP_726907.1 dimethyladenosine transferase [Plasmodium yoelii yoelii str. 17XNL] >gb|EAA18472.1| dimethyladenosine transferase, putative [Plasmodium yoelii yoelii] 90.5 90.5 92% 6e-17  
ZP_05078438.1 dimethyladenosine transferase [Rhodobacterales bacterium Y4I] >gb|EDZ46417.1| dimethyladenosine transferase [Rhodobacterales bacterium Y4I] 90.5 90.5 92% 6e-17  
ZP_02862296.1 hypothetical protein ANASTE_01510 [Anaerofustis stercorihominis DSM 17244] >gb|EDS71807.1| hypothetical protein ANASTE_01510 [Anaerofustis stercorihominis DSM 17244] 90.5 90.5 95% 6e-17  
ZP_02072204.1 hypothetical protein BACUNI_03648 [Bacteroides uniformis ATCC 8492] >gb|EDO52853.1| hypothetical protein BACUNI_03648 [Bacteroides uniformis ATCC 8492] 90.5 90.5 95% 6e-17  
YP_002534599.1 Dimethyladenosine transferase [Thermotoga neapolitana DSM 4359] >sp|B9K8F0.1|RSMA_THENN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACM23233.1| Dimethyladenosine transferase [Thermotoga neapolitana DSM 4359] 90.5 90.5 90% 6e-17  
ZP_05758238.1 dimethyladenosine transferase [Bacteroides sp. D2] 90.1 90.1 95% 6e-17  
ZP_04544965.1 dimethyladenosine transferase [Bacteroides sp. D1] >ref|ZP_06084863.1| dimethyladenosine transferase [Bacteroides sp. 2_1_22] >ref|ZP_06619940.1| dimethyladenosine transferase [Bacteroides ovatus SD CMC 3f] >ref|ZP_06724267.1| dimethyladenosine transferase [Bacteroides ovatus SD CC 2a] >ref|ZP_06764766.1| dimethyladenosine transferase [Bacteroides xylanisolvens SD CC 1b] >gb|EEO51439.1| dimethyladenosine transferase [Bacteroides sp. D1] >gb|EEZ02961.1| dimethyladenosine transferase [Bacteroides sp. 2_1_22] >gb|EFF50047.1| dimethyladenosine transferase [Bacteroides ovatus SD CMC 3f] >gb|EFF56410.1| dimethyladenosine transferase [Bacteroides ovatus SD CC 2a] >gb|EFG15522.1| dimethyladenosine transferase [Bacteroides xylanisolvens SD CC 1b] >emb|CBK68144.1| dimethyladenosine transferase [Bacteriodes xylanisolvens XB1A] 90.1 90.1 95% 6e-17  
YP_003148181.1 dimethyladenosine transferase [Kytococcus sedentarius DSM 20547] >gb|ACV05416.1| dimethyladenosine transferase [Kytococcus sedentarius DSM 20547] 90.1 90.1 92% 6e-17  
ZP_02437084.1 hypothetical protein BACSTE_03355 [Bacteroides stercoris ATCC 43183] >gb|EDS14211.1| hypothetical protein BACSTE_03355 [Bacteroides stercoris ATCC 43183] 90.1 90.1 95% 7e-17  
YP_001514184.1 dimethyladenosine transferase [Alkaliphilus oremlandii OhILAs] >sp|A8MK56.1|RSMA_ALKOO RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABW20188.1| dimethyladenosine transferase [Alkaliphilus oremlandii OhILAs] 90.1 90.1 95% 7e-17  
YP_003344003.1 dimethyladenosine transferase [Streptosporangium roseum DSM 43021] >gb|ACZ91260.1| dimethyladenosine transferase [Streptosporangium roseum DSM 43021] 90.1 90.1 91% 7e-17  
NP_487269.1 dimethyladenosine transferase [Nostoc sp. PCC 7120] >sp|Q8YS62.1|RSMA_ANASP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAB74928.1| rRNA (adenine-N6,N6)-dimethyltransferase [Nostoc sp. PCC 7120] 90.1 90.1 92% 7e-17  
ACJ23056.1 KsgA [Neisseria gonorrhoeae] 90.1 90.1 99% 7e-17  
YP_001295008.1 dimethyladenosine transferase [Flavobacterium psychrophilum JIP02/86] >sp|A6GVR5.1|RSMA_FLAPJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAL42187.1| Dimethyladenosine transferase [Flavobacterium psychrophilum JIP02/86] 90.1 90.1 95% 7e-17  
NP_720801.1 dimethyladenosine transferase [Streptococcus mutans UA159] >sp|P59156.1|RSMA_STRMU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAN58107.1|AE014882_10 dimethyladenosine transferase [Streptococcus mutans UA159] 90.1 90.1 92% 7e-17  
ZP_06200689.1 dimethyladenosine transferase [Bacteroides sp. D20] >gb|EFA21814.1| dimethyladenosine transferase [Bacteroides sp. D20] 90.1 90.1 95% 7e-17  
YP_002549105.1 rRNA-adenine N6N6-dimethyltransferase [Agrobacterium vitis S4] >sp|B9JUV4.1|RSMA_AGRVS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACM36099.1| rRNA-adenine N6N6-dimethyltransferase [Agrobacterium vitis S4] 90.1 90.1 92% 7e-17  
NP_246146.1 dimethyladenosine transferase [Pasteurella multocida subsp. multocida str. Pm70] >sp|Q9CLL5.1|RSMA_PASMU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAK03293.1| KsgA [Pasteurella multocida subsp. multocida str. Pm70] 90.1 90.1 90% 7e-17  
NP_812954.1 dimethyladenosine transferase [Bacteroides thetaiotaomicron VPI-5482] >ref|ZP_04847589.1| dimethyladenosine transferase [Bacteroides sp. 1_1_6] >sp|Q8A0H8.1|RSMA_BACTN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAO79148.1| dimethyladenosine transferase [Bacteroides thetaiotaomicron VPI-5482] >gb|EES68643.1| dimethyladenosine transferase [Bacteroides sp. 1_1_6] 90.1 90.1 95% 7e-17  
ZP_00134853.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >ref|YP_001053108.1| dimethyladenosine transferase [Actinobacillus pleuropneumoniae L20] >sp|A3MZB7.1|RSMA_ACTP2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABN73503.1| dimethyladenosine transferase [Actinobacillus pleuropneumoniae L20] 90.1 90.1 95% 7e-17  
ZP_06409143.1 dimethyladenosine transferase [Prevotella melaninogenica D18] >gb|EFC72249.1| dimethyladenosine transferase [Prevotella melaninogenica D18] 90.1 90.1 93% 7e-17  
ZP_04550309.1 dimethyladenosine transferase [Bacteroides sp. 2_2_4] >gb|EEO56888.1| dimethyladenosine transferase [Bacteroides sp. 2_2_4] 90.1 90.1 95% 7e-17  
YP_002923650.1 S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] >sp|C4K4K9.1|RSMA_HAMD5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACQ67502.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, kasugamycin resistance [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] 90.1 90.1 99% 8e-17  
YP_003311589.1 dimethyladenosine transferase [Veillonella parvula DSM 2008] >gb|ACZ24309.1| dimethyladenosine transferase [Veillonella parvula DSM 2008] 90.1 90.1 91% 8e-17  
YP_002313338.1 dimethyladenosine transferase [Shewanella piezotolerans WP3] >sp|B8CSX5.1|RSMA_SHEPW RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACJ30751.1| Dimethyladenosine transferase [Shewanella piezotolerans WP3] 90.1 90.1 97% 8e-17  
ZP_02212890.1 hypothetical protein CLOBAR_02510 [Clostridium bartlettii DSM 16795] >gb|EDQ95531.1| hypothetical protein CLOBAR_02510 [Clostridium bartlettii DSM 16795] 90.1 90.1 97% 8e-17  
YP_001339917.1 dimethyladenosine transferase [Marinomonas sp. MWYL1] >sp|A6VU53.1|RSMA_MARMS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABR69982.1| dimethyladenosine transferase [Marinomonas sp. MWYL1] 90.1 90.1 98% 8e-17  
XP_001611402.1 dimethyladenosine transferase [Babesia bovis T2Bo] >gb|EDO07834.1| dimethyladenosine transferase, putative [Babesia bovis] 90.1 90.1 92% 8e-17  
YP_032138.1 dimethyladenosine transferase [Bartonella quintana str. Toulouse] >sp|Q6G052.1|RSMA_BARQU RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAF25957.1| Dimethyladenosine transferase [Bartonella quintana str. Toulouse] 90.1 90.1 90% 8e-17  
ZP_03922037.1 dimethyladenosine transferase [Corynebacterium pseudogenitalium ATCC 33035] >gb|EEJ37464.1| dimethyladenosine transferase [Corynebacterium pseudogenitalium ATCC 33035] 90.1 90.1 90% 8e-17  
YP_001576769.1 dimethyladenosine transferase [Lactobacillus helveticus DPC 4571] >sp|A8YX55.1|RSMA_LACH4 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABX26478.1| Dimethyladenosine transferase [Lactobacillus helveticus DPC 4571] 90.1 90.1 92% 8e-17  
YP_454104.1 dimethyladenosine transferase [Sodalis glossinidius str. 'morsitans'] >sp|Q2NVX6.1|RSMA_SODGM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >dbj|BAE73699.1| dimethyladenosine transferase [Sodalis glossinidius str. 'morsitans'] 90.1 90.1 98% 8e-17  
ZP_05279729.1 dimethyladenosine transferase [Bacteroides fragilis 3_1_12] 89.7 89.7 93% 8e-17  
YP_003574851.1 dimethyladenosine transferase [Prevotella ruminicola 23] >gb|ADE82393.1| dimethyladenosine transferase [Prevotella ruminicola 23] 89.7 89.7 95% 8e-17  
ZP_06258350.1 dimethyladenosine transferase [Veillonella parvula ATCC 17745] >gb|EFB86630.1| dimethyladenosine transferase [Veillonella parvula ATCC 17745] 89.7 89.7 71% 8e-17  
YP_001968217.1 dimethyladenosine transferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >sp|B3H0R3.1|RSMA_ACTP7 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACE61075.1| dimethyladenosine transferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] 89.7 89.7 95% 8e-17  
YP_384265.1 dimethyladenosine transferase [Geobacter metallireducens GS-15] >sp|Q39W34.1|RSMA_GEOMG RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABB31540.1| dimethyladenosine transferase [Geobacter metallireducens GS-15] 89.7 89.7 95% 8e-17  
ZP_01744607.1 dimethyladenosine transferase [Sagittula stellata E-37] >gb|EBA09773.1| dimethyladenosine transferase [Sagittula stellata E-37] 89.7 89.7 92% 9e-17  
ZP_00156369.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Haemophilus influenzae R2866] 89.7 89.7 95% 9e-17  
YP_002152052.1 dimethyladenosine transferase [Proteus mirabilis HI4320] >ref|ZP_03841657.1| rRNA (adenine-N6,N6-)-dimethyltransferase [Proteus mirabilis ATCC 29906] >sp|B4F2I2.1|RSMA_PROMH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAR44618.1| dimethyladenosine transferase [Proteus mirabilis HI4320] >gb|EEI47552.1| rRNA (adenine-N6,N6-)-dimethyltransferase [Proteus mirabilis ATCC 29906] 89.7 89.7 91% 9e-17  
YP_001884370.1 dimethyladenosine transferase [Clostridium botulinum B str. Eklund 17B] >gb|ACD22910.1| dimethyladenosine transferase [Clostridium botulinum B str. Eklund 17B] 89.7 89.7 92% 9e-17  
YP_001952549.1 dimethyladenosine transferase [Geobacter lovleyi SZ] >gb|ACD96029.1| dimethyladenosine transferase [Geobacter lovleyi SZ] 89.7 89.7 99% 9e-17  
YP_988818.1 dimethyladenosine transferase [Bartonella bacilliformis KC583] >sp|A1US65.1|RSMA_BARBK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM45468.1| dimethyladenosine transferase [Bartonella bacilliformis KC583] 89.7 89.7 90% 9e-17  
ZP_06758590.1 dimethyladenosine transferase [Veillonella sp. 3_1_44] >gb|EFG23395.1| dimethyladenosine transferase [Veillonella sp. 3_1_44] 89.7 89.7 91% 9e-17  
ZP_02143229.1 dimethyladenosine transferase [Roseobacter litoralis Och 149] >gb|EDQ15226.1| dimethyladenosine transferase [Roseobacter litoralis Och 149] 89.7 89.7 92% 9e-17  
ZP_06604884.1 dimethyladenosine transferase [Aeromicrobium marinum DSM 15272] >gb|EFF72292.1| dimethyladenosine transferase [Aeromicrobium marinum DSM 15272] 89.7 89.7 92% 9e-17  
ZP_04834654.1 dimethyladenosine transferase [Prevotella melaninogenica ATCC 25845] >gb|EES81951.1| dimethyladenosine transferase [Prevotella melaninogenica ATCC 25845] 89.7 89.7 95% 9e-17  
YP_002931456.1 dimethyladenosine transferase [Eubacterium eligens ATCC 27750] >gb|ACR73009.1| dimethyladenosine transferase [Eubacterium eligens ATCC 27750] 89.7 89.7 95% 1e-16  
ZP_05101892.1 dimethyladenosine transferase [Roseobacter sp. GAI101] >gb|EEB86194.1| dimethyladenosine transferase [Roseobacter sp. GAI101] 89.7 89.7 92% 1e-16  
YP_001500724.1 dimethyladenosine transferase [Shewanella pealeana ATCC 700345] >sp|A8H0V2.1|RSMA_SHEPA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABV86189.1| dimethyladenosine transferase [Shewanella pealeana ATCC 700345] 89.7 89.7 99% 1e-16  
YP_001651453.1 dimethyladenosine transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >sp|B0BTQ4.1|RSMA_ACTPJ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABY69009.1| dimethyladenosine transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] 89.7 89.7 95% 1e-16  
ZP_06371208.1 dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 414] >gb|EFC33456.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 414] 89.7 89.7 97% 1e-16  
ZP_05121582.1 dimethyladenosine transferase [Rhodobacteraceae bacterium KLH11] >gb|EEE36214.1| dimethyladenosine transferase [Rhodobacteraceae bacterium KLH11] 89.7 89.7 90% 1e-16  
YP_871939.1 dimethyladenosine transferase [Acidothermus cellulolyticus 11B] >sp|A0LR93.1|RSMA_ACIC1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK51953.1| dimethyladenosine transferase [Acidothermus cellulolyticus 11B] 89.4 89.4 92% 1e-16  
ZP_05791655.1 dimethyladenosine transferase [Butyrivibrio crossotus DSM 2876] >gb|EFF69069.1| dimethyladenosine transferase [Butyrivibrio crossotus DSM 2876] 89.4 89.4 93% 1e-16  
ZP_02067821.1 hypothetical protein BACOVA_04832 [Bacteroides ovatus ATCC 8483] >gb|EDO08974.1| hypothetical protein BACOVA_04832 [Bacteroides ovatus ATCC 8483] 89.4 89.4 95% 1e-16  
ZP_05081592.1 dimethyladenosine transferase [beta proteobacterium KB13] >gb|EDZ64279.1| dimethyladenosine transferase [beta proteobacterium KB13] 89.4 89.4 92% 1e-16  
YP_002218807.1 dimethyladenosine transferase [Acidithiobacillus ferrooxidans ATCC 53993] >sp|B5EL84.1|RSMA_ACIF5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACH82600.1| dimethyladenosine transferase [Acidithiobacillus ferrooxidans ATCC 53993] 89.4 89.4 91% 1e-16  
YP_002424676.1 dimethyladenosine transferase [Acidithiobacillus ferrooxidans ATCC 23270] >sp|B7J3R3.1|RSMA_ACIF2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACK79465.1| dimethyladenosine transferase [Acidithiobacillus ferrooxidans ATCC 23270] 89.4 89.4 91% 1e-16  
ZP_00050666.1 COG0030: Dimethyladenosine transferase (rRNA methylation) [Magnetospirillum magnetotacticum MS-1] 89.4 89.4 92% 1e-16  
ZP_01217237.1 KsgA [Psychromonas sp. CNPT3] >gb|EAS37952.1| KsgA [Psychromonas sp. CNPT3] 89.4 89.4 97% 1e-16  
ZP_05366546.1 dimethyladenosine transferase [Corynebacterium tuberculostearicum SK141] >gb|EET76841.1| dimethyladenosine transferase [Corynebacterium tuberculostearicum SK141] 89.4 89.4 90% 1e-16  
YP_179850.1 dimethyladenosine transferase [Campylobacter jejuni RM1221] >ref|ZP_03222495.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Campylobacter jejuni subsp. jejuni CG8421] >sp|Q5HS85.1|RSMA_CAMJR RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAW34480.1| dimethyladenosine transferase [Campylobacter jejuni RM1221] >gb|EDZ33135.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Campylobacter jejuni subsp. jejuni CG8421] 89.4 89.4 96% 1e-16  
ZP_05852086.1 dimethyladenosine transferase [Granulicatella elegans ATCC 700633] >gb|EEW92926.1| dimethyladenosine transferase [Granulicatella elegans ATCC 700633] 89.4 89.4 92% 1e-16  
ZP_01889421.1 dimethyladenosine transferase [unidentified eubacterium SCB49] >gb|EDM45551.1| dimethyladenosine transferase [unidentified eubacterium SCB49] 89.4 89.4 93% 1e-16  
ZP_01810481.1 putative dimethyladenosine transferase (16S rRNA dimethylase) [Campylobacter jejuni subsp. jejuni CG8486] >gb|EDK21634.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Campylobacter jejuni subsp. jejuni CG8486] 89.4 89.4 96% 1e-16  
YP_461281.1 dimethyladenosine transferase [Syntrophus aciditrophicus SB] >sp|Q2LSQ6.1|RSMA_SYNAS RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC77113.1| dimethyladenosine transferase [Syntrophus aciditrophicus SB] 89.4 89.4 92% 1e-16  
ZP_03016901.1 hypothetical protein BACINT_04510 [Bacteroides intestinalis DSM 17393] >gb|EDV05365.1| hypothetical protein BACINT_04510 [Bacteroides intestinalis DSM 17393] 89.4 89.4 94% 1e-16  
ZP_05342125.1 dimethyladenosine transferase [Thalassiobium sp. R2A62] >gb|EET47792.1| dimethyladenosine transferase [Thalassiobium sp. R2A62] 89.4 89.4 90% 1e-16  
YP_002794030.1 KsgA [Laribacter hongkongensis HLHK9] >sp|C1D9C2.1|RSMA_LARHH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACO73021.1| KsgA [Laribacter hongkongensis HLHK9] 89.4 89.4 98% 1e-16  
YP_002127700.1 dimethyladenosine transferase [Alteromonas macleodii 'Deep ecotype'] >gb|ACG67706.1| dimethyladenosine transferase [Alteromonas macleodii 'Deep ecotype'] 89.4 89.4 91% 1e-16  
YP_002825441.1 dimethyladenosine transferase [Rhizobium sp. NGR234] >sp|C3M9C2.1|RSMA_RHISN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACP24688.1| dimethyladenosine transferase [Rhizobium sp. NGR234] 89.4 89.4 92% 1e-16  
ZP_06808278.1 dimethyladenosine transferase [Aerococcus viridans ATCC 11563] >gb|EFG49363.1| dimethyladenosine transferase [Aerococcus viridans ATCC 11563] 89.4 89.4 92% 1e-16  
ZP_06425159.1 dimethyladenosine transferase [Peptostreptococcus anaerobius 653-L] >gb|EFD04939.1| dimethyladenosine transferase [Peptostreptococcus anaerobius 653-L] 89.0 89.0 97% 1e-16  
YP_033375.1 dimethyladenosine transferase [Bartonella henselae str. Houston-1] >sp|Q6G438.1|RSMA_BARHE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAF27348.1| Dimethyladenosine transferase [Bartonella henselae str. Houston-1] 89.0 89.0 90% 1e-16  
CBK79434.1 dimethyladenosine transferase [Coprococcus catus GD/7] 89.0 89.0 95% 1e-16  
ZP_05729755.1 dimethyladenosine transferase [Pantoea sp. At-9b] >gb|EEW01872.1| dimethyladenosine transferase [Pantoea sp. At-9b] 89.0 89.0 100% 1e-16  
NP_894454.1 dimethyladenosine transferase [Prochlorococcus marinus str. MIT 9313] >sp|Q7V7W0.1|RSMA_PROMM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAE20796.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Prochlorococcus marinus str. MIT 9313] 89.0 89.0 92% 1e-16  
ZP_01049518.1 dimethyladenosine transferase [Dokdonia donghaensis MED134] >gb|EAQ39490.1| dimethyladenosine transferase [Dokdonia donghaensis MED134] 89.0 89.0 95% 1e-16  
YP_003443550.1 dimethyladenosine transferase [Allochromatium vinosum DSM 180] >gb|ADC62518.1| dimethyladenosine transferase [Allochromatium vinosum DSM 180] 89.0 89.0 90% 1e-16  
YP_001919554.1 dimethyladenosine transferase [Clostridium botulinum E3 str. Alaska E43] >gb|ACD51723.1| dimethyladenosine transferase [Clostridium botulinum E3 str. Alaska E43] 89.0 89.0 92% 1e-16  
YP_808702.1 dimethyladenosine transferase [Lactococcus lactis subsp. cremoris SK11] >gb|ABJ72280.1| dimethyladenosine transferase [Lactococcus lactis subsp. cremoris SK11] 89.0 89.0 92% 1e-16  
YP_003002924.1 dimethyladenosine transferase [Dickeya zeae Ech1591] >gb|ACT05445.1| dimethyladenosine transferase [Dickeya zeae Ech1591] 89.0 89.0 97% 1e-16  
ZP_04821856.1 dimethyladenosine transferase [Clostridium botulinum E1 str. 'BoNT E Beluga'] >gb|EES49141.1| dimethyladenosine transferase [Clostridium botulinum E1 str. 'BoNT E Beluga'] 89.0 89.0 92% 1e-16  
CBL10794.1 dimethyladenosine transferase [Roseburia intestinalis M50/1] >emb|CBL10926.1| dimethyladenosine transferase [Roseburia intestinalis XB6B4] 89.0 89.0 93% 1e-16  
ZP_00996614.1 dimethyladenosine transferase [Janibacter sp. HTCC2649] >gb|EAP97200.1| dimethyladenosine transferase [Janibacter sp. HTCC2649] 89.0 89.0 91% 1e-16  
YP_001673149.1 dimethyladenosine transferase [Shewanella halifaxensis HAW-EB4] >sp|B0TV52.1|RSMA_SHEHH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABZ75490.1| dimethyladenosine transferase [Shewanella halifaxensis HAW-EB4] 89.0 89.0 99% 2e-16  
YP_001001355.1 dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 81-176] >ref|ZP_02272002.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 81-176] >gb|EAQ72002.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 81-176] 89.0 89.0 96% 2e-16  
ZP_04743694.1 dimethyladenosine transferase [Roseburia intestinalis L1-82] >gb|EEV01050.1| dimethyladenosine transferase [Roseburia intestinalis L1-82] 89.0 89.0 93% 2e-16  
YP_003572293.1 Dimethyladenosine transferase [Salinibacter ruber] >emb|CBH25341.1| Dimethyladenosine transferase [Salinibacter ruber] 89.0 89.0 92% 2e-16  
ZP_03644081.1 hypothetical protein BACCOPRO_02456 [Bacteroides coprophilus DSM 18228] >gb|EEF76949.1| hypothetical protein BACCOPRO_02456 [Bacteroides coprophilus DSM 18228] 89.0 89.0 96% 2e-16  
ZP_06286978.1 dimethyladenosine transferase [Prevotella buccalis ATCC 35310] >gb|EFA91973.1| dimethyladenosine transferase [Prevotella buccalis ATCC 35310] 89.0 89.0 95% 2e-16  
YP_003515245.1 Dimethyladenosine transferase(S adenosylmethionine 6 N', N' adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High levelkasugamycin resistance protein ksgA) (Kasugamycindimethyltransferase) [Mycoplasma agalactiae] >emb|CBH40287.1| Dimethyladenosine transferase(S adenosylmethionine 6 N', N' adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High levelkasugamycin resistance protein ksgA) (Kasugamycindimethyltransferase) [Mycoplasma agalactiae] 89.0 89.0 93% 2e-16  
ZP_04454853.1 hypothetical protein GCWU000342_00858 [Shuttleworthia satelles DSM 14600] >gb|EEP29492.1| hypothetical protein GCWU000342_00858 [Shuttleworthia satelles DSM 14600] 89.0 89.0 92% 2e-16  
ZP_02234170.1 hypothetical protein DORFOR_01028 [Dorea formicigenerans ATCC 27755] >gb|EDR47503.1| hypothetical protein DORFOR_01028 [Dorea formicigenerans ATCC 27755] 89.0 89.0 95% 2e-16  
NP_663994.1 dimethyladenosine transferase [Streptococcus pyogenes MGAS315] >ref|NP_801457.1| dimethyladenosine transferase [Streptococcus pyogenes SSI-1] >sp|Q8K8N6.1|RSMA_STRP3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAM78797.1| putative dimethyladenosine transferase [Streptococcus pyogenes MGAS315] >dbj|BAC63290.1| putative dimethyladenosine transferase [Streptococcus pyogenes SSI-1] 89.0 89.0 92% 2e-16  
ZP_05030370.1 dimethyladenosine transferase [Microcoleus chthonoplastes PCC 7420] >gb|EDX71598.1| dimethyladenosine transferase [Microcoleus chthonoplastes PCC 7420] 89.0 89.0 92% 2e-16  
ZP_06274531.1 dimethyladenosine transferase [Streptomyces sp. ACTE] >gb|EFB65075.1| dimethyladenosine transferase [Streptomyces sp. ACTE] 89.0 89.0 91% 2e-16  
ZP_05743788.1 dimethyladenosine transferase [Lactobacillus iners DSM 13335] >gb|EEW52075.1| dimethyladenosine transferase [Lactobacillus iners DSM 13335] 88.6 88.6 92% 2e-16  
YP_747439.1 dimethyladenosine transferase [Nitrosomonas eutropha C91] >sp|Q0AGQ8.1|RSMA_NITEC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABI59474.1| dimethyladenosine transferase [Nitrosomonas eutropha C91] 88.6 88.6 100% 2e-16  
ABD75772.1 hypothetical protein [uncultured bacterium] 88.6 88.6 78% 2e-16  
YP_446299.1 dimethyladenosine transferase [Salinibacter ruber DSM 13855] >sp|Q2S0I2.1|RSMA_SALRD RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABC45883.1| dimethyladenosine transferase [Salinibacter ruber DSM 13855] 88.6 88.6 92% 2e-16  
CAM74438.1 Ribosomal RNA adenine methylase transferase [Magnetospirillum gryphiswaldense MSR-1] 88.6 88.6 92% 2e-16  
ZP_01059488.1 dimethyladenosine transferase [Leeuwenhoekiella blandensis MED217] >gb|EAQ51320.1| dimethyladenosine transferase [Leeuwenhoekiella blandensis MED217] 88.6 88.6 99% 2e-16  
ZP_06080488.1 dimethyladenosine transferase [Vibrio sp. RC586] >gb|EEY99029.1| dimethyladenosine transferase [Vibrio sp. RC586] 88.6 88.6 100% 2e-16  
ZP_05752471.1 dimethyladenosine transferase [Lactobacillus helveticus DSM 20075] >gb|EEW68095.1| dimethyladenosine transferase [Lactobacillus helveticus DSM 20075] 88.6 88.6 92% 2e-16  
ZP_02181118.1 dimethyladenosine transferase [Flavobacteriales bacterium ALC-1] >gb|EDP72586.1| dimethyladenosine transferase [Flavobacteriales bacterium ALC-1] 88.6 88.6 91% 2e-16  
YP_003578826.1 dimethyladenosine transferase [Rhodobacter capsulatus SB1003] >gb|ADE86419.1| dimethyladenosine transferase [Rhodobacter capsulatus SB1003] 88.6 88.6 90% 2e-16  
ZP_03925188.1 possible dimethyladenosine transferase [Actinomyces coleocanis DSM 15436] >gb|EEH63707.1| possible dimethyladenosine transferase [Actinomyces coleocanis DSM 15436] 88.6 88.6 91% 2e-16  
ZP_03931544.1 dimethyladenosine transferase [Corynebacterium accolens ATCC 49725] >gb|EEI15483.1| dimethyladenosine transferase [Corynebacterium accolens ATCC 49725] 88.6 88.6 90% 2e-16  
YP_001033150.1 dimethyladenosine transferase [Lactococcus lactis subsp. cremoris MG1363] >emb|CAL98452.1| dimethyladenosine transferase [Lactococcus lactis subsp. cremoris MG1363] 88.6 88.6 92% 2e-16  
YP_001017626.1 dimethyladenosine transferase [Prochlorococcus marinus str. MIT 9303] >sp|A2CA51.1|RSMA_PROM3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABM78361.1| putative rRNA (adenine-N6,N6)-dimethyltransferase [Prochlorococcus marinus str. MIT 9303] 88.6 88.6 92% 2e-16  
ZP_06373652.1 dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 1336] >gb|EFC31105.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 1336] 88.6 88.6 97% 2e-16  
ZP_03734981.1 dimethyladenosine transferase [Dethiobacter alkaliphilus AHT 1] >gb|EEG76596.1| dimethyladenosine transferase [Dethiobacter alkaliphilus AHT 1] 88.6 88.6 92% 2e-16  
YP_325378.1 dimethyladenosine transferase [Anabaena variabilis ATCC 29413] >sp|Q3M3F3.1|RSMA_ANAVT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABA24483.1| dimethyladenosine transferase [Anabaena variabilis ATCC 29413] 88.6 88.6 92% 2e-16  
ZP_04861886.1 dimethyladenosine transferase [Clostridium botulinum D str. 1873] >gb|EES92378.1| dimethyladenosine transferase [Clostridium botulinum D str. 1873] 88.6 88.6 98% 2e-16  
XP_675435.1 dimethyladenosine transferase [Plasmodium berghei strain ANKA] >emb|CAH94666.1| dimethyladenosine transferase, putative [Plasmodium berghei] 88.6 88.6 92% 2e-16  
YP_001373406.1 dimethyladenosine transferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >sp|A7GJV3.1|RSMA_BACCN RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS20411.1| dimethyladenosine transferase [Bacillus cytotoxicus NVH 391-98] 88.6 88.6 95% 2e-16  
ZP_03296187.1 hypothetical protein COLSTE_00071 [Collinsella stercoris DSM 13279] >gb|EEA91728.1| hypothetical protein COLSTE_00071 [Collinsella stercoris DSM 13279] 88.6 88.6 56% 2e-16  
YP_914704.1 dimethyladenosine transferase [Paracoccus denitrificans PD1222] >sp|A1B0G4.1|RSMA_PARDP RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABL69008.1| dimethyladenosine transferase [Paracoccus denitrificans PD1222] 88.6 88.6 92% 2e-16  
YP_001803912.1 dimethyladenosine transferase [Cyanothece sp. ATCC 51142] >sp|B1WRJ7.1|RSMA_CYAA5 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACB51846.1| rRNA dimethyladenosine transferase [Cyanothece sp. ATCC 51142] 88.6 88.6 90% 2e-16  
YP_002048899.1 putative rRNA (adenine-N6,N6)- dimethyltransferase [Paulinella chromatophora] >gb|ACB42689.1| putative rRNA (adenine-N6,N6)- dimethyltransferase [Paulinella chromatophora] 88.6 88.6 92% 2e-16  
ZP_05614578.1 dimethyladenosine transferase [Faecalibacterium prausnitzii A2-165] >gb|EEU97016.1| dimethyladenosine transferase [Faecalibacterium prausnitzii A2-165] 88.6 88.6 96% 2e-16  
YP_002309161.1 dimethyladenosine transferase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] >dbj|BAG83750.1| dimethyladenosine transferase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] 88.6 88.6 94% 2e-16  
ZP_04748565.1 dimethyladenosine transferase [Mycobacterium kansasii ATCC 12478] 88.6 88.6 89% 2e-16  
ZP_05014866.1 dimethyladenosine transferase [Streptomyces sviceus ATCC 29083] >gb|EDY53424.1| dimethyladenosine transferase [Streptomyces sviceus ATCC 29083] 88.6 88.6 90% 2e-16  
ZP_05532069.1 dimethyladenosine transferase [Streptomyces viridochromogenes DSM 40736] 88.2 88.2 90% 2e-16  
YP_001344040.1 dimethyladenosine transferase [Actinobacillus succinogenes 130Z] >gb|ABR74105.1| dimethyladenosine transferase [Actinobacillus succinogenes 130Z] 88.2 88.2 95% 2e-16  
ZP_02147117.1 dimethyladenosine transferase [Phaeobacter gallaeciensis BS107] >ref|ZP_02150540.1| dimethyladenosine transferase [Phaeobacter gallaeciensis 2.10] >gb|EDQ07962.1| dimethyladenosine transferase [Phaeobacter gallaeciensis 2.10] >gb|EDQ11300.1| dimethyladenosine transferase [Phaeobacter gallaeciensis BS107] 88.2 88.2 92% 2e-16  
YP_001417730.1 dimethyladenosine transferase [Xanthobacter autotrophicus Py2] >sp|A7IJ80.1|RSMA_XANP2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS68073.1| dimethyladenosine transferase [Xanthobacter autotrophicus Py2] 88.2 88.2 91% 3e-16  
ZP_05620285.1 dimethyladenosine transferase [Enhydrobacter aerosaccus SK60] >gb|EEV22553.1| dimethyladenosine transferase [Enhydrobacter aerosaccus SK60] 88.2 88.2 98% 3e-16  
YP_001535636.1 dimethyladenosine transferase [Salinispora arenicola CNS-205] >gb|ABV96645.1| dimethyladenosine transferase [Salinispora arenicola CNS-205] 88.2 88.2 87% 3e-16  
YP_892964.1 dimethyladenosine transferase [Bacillus thuringiensis str. Al Hakam] >ref|ZP_03114578.1| dimethyladenosine transferase [Bacillus cereus 03BB108] >ref|YP_002747471.1| dimethyladenosine transferase [Bacillus cereus 03BB102] >sp|A0R8B4.1|RSMA_BACAH RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >sp|C1ESX0.1|RSMA_BACC3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK83457.1| dimethyladenosine transferase [Bacillus thuringiensis str. Al Hakam] >gb|EDX60461.1| dimethyladenosine transferase [Bacillus cereus 03BB108] >gb|ACO28737.1| dimethyladenosine transferase [Bacillus cereus 03BB102] 88.2 88.2 95% 3e-16  
YP_341125.1 dimethyladenosine transferase [Pseudoalteromonas haloplanktis TAC125] >sp|Q3IFD1.1|RSMA_PSEHT RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >emb|CAI87683.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase, Kasugamycin dimethyltransferase [Pseudoalteromonas haloplanktis TAC125] 88.2 88.2 97% 3e-16  
ZP_06052875.1 dimethyladenosine transferase [Grimontia hollisae CIP 101886] >gb|EEY72941.1| dimethyladenosine transferase [Grimontia hollisae CIP 101886] 88.2 88.2 100% 3e-16  
ZP_03458046.1 hypothetical protein BACEGG_00819 [Bacteroides eggerthii DSM 20697] >gb|EEC54940.1| hypothetical protein BACEGG_00819 [Bacteroides eggerthii DSM 20697] 88.2 88.2 93% 3e-16  
YP_002574638.1 dimethyladenosine transferase [Campylobacter lari RM2100] >gb|ACM63387.1| dimethyladenosine transferase [Campylobacter lari RM2100] 88.2 88.2 96% 3e-16  
YP_830707.1 dimethyladenosine transferase [Arthrobacter sp. FB24] >sp|A0JU87.1|RSMA_ARTS2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABK02607.1| dimethyladenosine transferase [Arthrobacter sp. FB24] 88.2 88.2 91% 3e-16  
YP_505210.1 dimethyladenosine transferase [Anaplasma phagocytophilum HZ] >sp|Q2GK91.1|RSMA_ANAPZ RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABD43291.1| dimethyladenosine transferase [Anaplasma phagocytophilum HZ] 88.2 88.2 92% 3e-16  
ZP_01619486.1 dimethyladenosine transferase [Lyngbya sp. PCC 8106] >gb|EAW38454.1| dimethyladenosine transferase [Lyngbya sp. PCC 8106] 88.2 88.2 92% 3e-16  
ZP_01053404.1 ribosomal RNA adenine dimethylase [Polaribacter sp. MED152] >gb|EAQ42832.1| ribosomal RNA adenine dimethylase [Polaribacter sp. MED152] 87.8 87.8 92% 3e-16  
YP_003050351.1 dimethyladenosine transferase [Methylovorus sp. SIP3-4] >gb|ACT49824.1| dimethyladenosine transferase [Methylovorus sp. SIP3-4] 87.8 87.8 99% 3e-16  
ZP_05045398.1 dimethyladenosine transferase [Cyanobium sp. PCC 7001] >gb|EDY38707.1| dimethyladenosine transferase [Cyanobium sp. PCC 7001] 87.8 87.8 92% 3e-16  
NP_906334.1 dimethyladenosine transferase [Wolinella succinogenes DSM 1740] >emb|CAE09234.1| PUTATIVE DIMETHYLADENOSINE TRANSFERASE 16S RRNA DIMETHYLASEEC 2.1.1. [Wolinella succinogenes] 87.8 87.8 96% 3e-16  
YP_001307205.1 dimethyladenosine transferase [Clostridium beijerinckii NCIMB 8052] >gb|ABR32249.1| dimethyladenosine transferase [Clostridium beijerinckii NCIMB 8052] 87.8 87.8 98% 3e-16  
YP_001407258.1 dimethyladenosine transferase [Campylobacter hominis ATCC BAA-381] >sp|A7I417.1|RSMA_CAMHC RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS52302.1| dimethyladenosine transferase [Campylobacter hominis ATCC BAA-381] 87.8 87.8 97% 3e-16  
ZP_02616974.1 dimethyladenosine transferase [Clostridium botulinum Bf] >ref|YP_002860950.1| dimethyladenosine transferase [Clostridium botulinum Ba4 str. 657] >sp|C3KXY4.1|RSMA_CLOB6 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EDT86651.1| dimethyladenosine transferase [Clostridium botulinum Bf] >gb|ACQ53030.1| dimethyladenosine transferase [Clostridium botulinum Ba4 str. 657] 87.8 87.8 92% 3e-16  
CBL49666.1 Dimethyladenosine transferase [Lactobacillus crispatus ST1] 87.8 87.8 90% 3e-16  
ZP_04309688.1 Dimethyladenosine transferase [Bacillus cereus BGSC 6E1] >gb|EEK58584.1| Dimethyladenosine transferase [Bacillus cereus BGSC 6E1] 87.8 87.8 95% 3e-16  
ZP_01068745.1 dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni CF93-6] >ref|ZP_01100953.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 84-25] >ref|YP_002345077.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] >sp|Q9PLW7.1|RSMA_CAMJE RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|EAQ56238.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni CF93-6] >gb|EAQ94000.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni 84-25] >emb|CAL35805.1| putative dimethyladenosine transferase (16S rRNA dimethylase) [Campylobacter jejuni subsp. jejuni NCTC 11168] >gb|ADC29254.1| dimethyladenosine transferase [Campylobacter jejuni subsp. jejuni IA3902] 87.8 87.8 96% 3e-16  
YP_003421502.1 dimethyladenosine transferase [cyanobacterium UCYN-A] >gb|ADB95144.1| dimethyladenosine transferase [cyanobacterium UCYN-A] 87.8 87.8 92% 4e-16  
ZP_05855360.1 dimethyladenosine transferase [Blautia hansenii DSM 20583] >gb|EEX20761.1| dimethyladenosine transferase [Blautia hansenii DSM 20583] 87.8 87.8 81% 4e-16  
ZP_06197136.1 dimethyladenosine transferase [Pediococcus acidilactici 7_4] >gb|EFA26806.1| dimethyladenosine transferase [Pediococcus acidilactici 7_4] 87.8 87.8 92% 4e-16  
YP_678238.1 dimethyladenosine transferase [Cytophaga hutchinsonii ATCC 33406] >sp|Q11UL8.1|RSMA_CYTH3 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABG58897.1| dimethyladenosine transferase [Cytophaga hutchinsonii ATCC 33406] 87.8 87.8 93% 4e-16  
AAN87468.1 Dimethyladenosine transferase [Heliobacillus mobilis] 87.8 87.8 98% 4e-16  
YP_662981.1 dimethyladenosine transferase [Pseudoalteromonas atlantica T6c] >gb|ABG41927.1| dimethyladenosine transferase [Pseudoalteromonas atlantica T6c] 87.8 87.8 97% 4e-16  
ZP_03801324.1 hypothetical protein COPCOM_03619 [Coprococcus comes ATCC 27758] >gb|EEG88284.1| hypothetical protein COPCOM_03619 [Coprococcus comes ATCC 27758] 87.8 87.8 92% 4e-16  
ZP_05864600.1 dimethyladenosine transferase [Lactobacillus fermentum 28-3-CHN] >gb|EEX24879.1| dimethyladenosine transferase [Lactobacillus fermentum 28-3-CHN] 87.4 87.4 92% 4e-16  
CBK97860.1 dimethyladenosine transferase [Faecalibacterium prausnitzii L2-6] 87.4 87.4 96% 4e-16  
YP_002953440.1 dimethyladenosine transferase [Desulfovibrio magneticus RS-1] >dbj|BAH75554.1| dimethyladenosine transferase [Desulfovibrio magneticus RS-1] 87.4 87.4 92% 4e-16  
ADF37004.1 dimethyladenosine transferase [Bacillus megaterium DSM319] 87.4 87.4 93% 4e-16  
YP_001779707.1 dimethyladenosine transferase [Clostridium botulinum B1 str. Okra] >sp|B1ID54.1|RSMA_CLOBK RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA44243.1| dimethyladenosine transferase [Clostridium botulinum B1 str. Okra] 87.4 87.4 92% 4e-16  
YP_001252629.1 dimethyladenosine transferase [Clostridium botulinum A str. ATCC 3502] >emb|CAL81637.1| dimethyladenosine transferase [Clostridium botulinum A str. ATCC 3502] 87.4 87.4 92% 4e-16  
YP_902155.1 dimethyladenosine transferase [Pelobacter propionicus DSM 2379] >gb|ABL00098.1| dimethyladenosine transferase [Pelobacter propionicus DSM 2379] 87.4 87.4 93% 4e-16  
YP_001193197.1 dimethyladenosine transferase [Flavobacterium johnsoniae UW101] >sp|A5FLP4.1|RSMA_FLAJ1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABQ03878.1| dimethyladenosine transferase [Flavobacterium johnsoniae UW101] 87.4 87.4 99% 4e-16  
ZP_02153811.1 dimethyladenosine transferase [Oceanibulbus indolifex HEL-45] >gb|EDQ04749.1| dimethyladenosine transferase [Oceanibulbus indolifex HEL-45] 87.4 87.4 92% 4e-16  
YP_001785410.1 dimethyladenosine transferase [Clostridium botulinum A3 str. Loch Maree] >sp|B1KRY8.1|RSMA_CLOBM RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ACA56864.1| dimethyladenosine transferase [Clostridium botulinum A3 str. Loch Maree] 87.4 87.4 92% 4e-16  
YP_001382487.1 dimethyladenosine transferase [Clostridium botulinum A str. ATCC 19397] >ref|YP_001386039.1| dimethyladenosine transferase [Clostridium botulinum A str. Hall] >sp|A7FQA9.1|RSMA_CLOB1 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS33045.1| dimethyladenosine transferase [Clostridium botulinum A str. ATCC 19397] >gb|ABS38460.1| dimethyladenosine transferase [Clostridium botulinum A str. Hall] 87.4 87.4 92% 4e-16  
ZP_01173994.1 dimethyladenosine transferase [Bacillus sp. NRRL B-14911] >gb|EAR63297.1| dimethyladenosine transferase [Bacillus sp. NRRL B-14911] 87.4 87.4 95% 4e-16  
YP_003426585.1 dimethyladenosine transferase [Bacillus pseudofirmus OF4] >gb|ADC49693.1| dimethyladenosine transferase [Bacillus pseudofirmus OF4] 87.4 87.4 95% 4e-16  
ZP_05069391.1 dimethyladenosine transferase [Candidatus Pelagibacter sp. HTCC7211] >gb|EDZ60390.1| dimethyladenosine transferase [Candidatus Pelagibacter sp. HTCC7211] 87.4 87.4 90% 4e-16  
ZP_02612078.1 dimethyladenosine transferase [Clostridium botulinum NCTC 2916] >gb|EDT83103.1| dimethyladenosine transferase [Clostridium botulinum NCTC 2916] 87.4 87.4 92% 4e-16  
YP_001389445.1 dimethyladenosine transferase [Clostridium botulinum F str. Langeland] >sp|A7G9I5.1|RSMA_CLOBL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABS42086.1| dimethyladenosine transferase [Clostridium botulinum F str. Langeland] >gb|ADF97927.1| dimethyladenosine transferase [Clostridium botulinum F str. 230613] 87.4 87.4 92% 4e-16  
Q9RU68.2 RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase 87.4 87.4 100% 4e-16  
ZP_04082372.1 Dimethyladenosine transferase [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] >gb|EEM85902.1| Dimethyladenosine transferase [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] 87.4 87.4 95% 4e-16  
YP_616524.1 dimethyladenosine transferase [Sphingopyxis alaskensis RB2256] >sp|Q1GT31.1|RSMA_SPHAL RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|ABF53191.1| dimethyladenosine transferase [Sphingopyxis alaskensis RB2256] 87.4 87.4 92% 4e-16  
ZP_03461516.1 hypothetical protein BACPEC_00573 [Bacteroides pectinophilus ATCC 43243] >gb|EEC58441.1| hypothetical protein BACPEC_00573 [Bacteroides pectinophilus ATCC 43243] 87.4 87.4 95% 4e-16  
CBK88410.1 dimethyladenosine transferase [Eubacterium cylindroides T2-87] 87.4 87.4 90% 5e-16  
ZP_04178236.1 Dimethyladenosine transferase [Bacillus cereus AH1272] >gb|EEL90061.1| Dimethyladenosine transferase [Bacillus cereus AH1272] 87.4 87.4 95% 5e-16  
YP_003383531.1 dimethyladenosine transferase [Kribbella flavida DSM 17836] >gb|ADB34732.1| dimethyladenosine transferase [Kribbella flavida DSM 17836] 87.4 87.4 90% 5e-16  
ZP_05364755.1 dimethyladenosine transferase [Campylobacter showae RM3277] >gb|EET78626.1| dimethyladenosine transferase [Campylobacter showae RM3277] 87.4 87.4 93% 5e-16  
NP_295249.1 dimethyladenosine transferase [Deinococcus radiodurans R1] >gb|AAF11091.1|AE001996_6 dimethyladenosine transferase [Deinococcus radiodurans R1] 87.4 87.4 100% 5e-16  
CBL02743.1 dimethyladenosine transferase [Faecalibacterium prausnitzii SL3/3] 87.4 87.4 97% 5e-16  
NP_266846.1 dimethyladenosine transferase [Lactococcus lactis subsp. lactis Il1403] >ref|YP_003353169.1| Dimethyladenosine transferase [Lactococcus lactis subsp. lactis KF147] >sp|Q9CHN8.1|RSMA_LACLA RecName: Full=Ribosomal RNA small subunit methyltransferase A; AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase; AltName: Full=16S rRNA dimethyladenosine transferase; AltName: Full=16S rRNA dimethylase >gb|AAK04788.1|AE006302_6 kasugamycin dimethyltransferase [Lactococcus lactis subsp. lactis Il1403] >gb|ADA64448.1| Dimethyladenosine transferase [Lactococcus lactis subsp. lactis KF147] 87.4 87.4 92% 5e-16  
YP_003183584.1 dimethyladenosine transferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] >gb|ACV57195.1| dimethyladenosine transferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] 87.4 87.4 95% 5e-16  
ZP_05132523.1 dimethyladenosine transferase [Clostridium sp. 7_2_43FAA] >gb|EEH99417.1| dimethyladenosine transferase [Clostridium sp. 7_2_43FAA] 87.4 87.4 92% 5e-16  
YP_001398990.1 dimethyladenosine transferase [Campylobacter jejuni subsp. doylei 269.97] >gb|ABS44695.1| dimethyladenosine transferase [Campylobacter jejuni subsp. doylei 269.97] 87.4 87.4 96% 5e-16