GOS 1242010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118859827
Annotathon code: GOS_1242010
Sample :
  • GPS :9°9'52n; 79°50'10w
  • Panama Canal: Lake Gatun - Panama
  • Fresh Water (-2m, 28.6°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2010
Username : Kunkun
Annotated on : 2010-07-01 13:52:08
  • Delerce Jérémy
  • Guien Céline

Synopsis

Genomic Sequence

>JCVI_READ_1091118859827 GOS_1242010 Genomic DNA
TGCTTTACCATTAGCAGTAGGATTCAAGTCGGTATATCCTGACTCATTATCACCAAGCACACGCGTAATGAATATTATTACTCTTCTGGGGGTGGTCTGC
CTTCTAGCGGTCGCATAAACCCCAACACCATCCGGAGTCTTAATAGACCCAGATCTAATCTGCCTAGCCAGGTCCCTAAGATCGTTATGATAAGTATCAC
CAAGATACATCCGATGACTGCCCAAAACAAATAAATTCCAACTTAAAATGGCCCGACTTAAAGCAGAATCAATCTCCCTAGAATGCGGTACAATTTCTAC
CTTGTTCGATAGACTAGGTATGGTAGCTGTTAAATCTTGAATCATTGCGGGATACATCTGACGGTCGAAGCTATTATTAAATCCCTTATCCATGAAATAT
CTGATCAGCAACCTACGCACAACCTCCACATTCGAGGCGTGCTTAATAGTATCAACCGCTAATGGATCTAATTCATTCATGAGATACCTCGTCTTATATT
CGCTCTGAAATATTTATATCAATATACTTCTAGCTTAGACTGCCTATCCCTACGCGTTACGCGTAACTCTCTTGGAAAAGTATCAAACATCAGGTTACGG
TGAGATATAATCAGAACGGTTTCCACTCTACTAGCCAAATCGTTCTTGATAATATTAATCAACGATTCTATACCATCATCATCCATCCTACCATCGACTT
CGTCTAAAACTAAGACATTACATTGTCTGCCATACATCTGCTCGTGAAAGTCAAACATCGCCAGCATAAACGCCACATCAGTGCGTTTACGCTCACCACC
GGACTCAAATTCATATCCCCACATATTACTCTCAACACTCAACGAATCAGTCAAATTCACCTTTACGTCTAATCCGAACGTGTCCATATAATGCTTTAAT
CTGCTATTGATGAATGGCACATGTTCCTTAAAGACGTAACTCTTAATCTATTCCTGTCATTGTAAGCCTTGTGCACATAAGAATAGTGCTGTTAAGCAAT
TCCGACCTTACAAGCTCAT

Translation

[540 - 1019/1019]   indirect strand


Annotator commentaries

L'ORF étudié a une longueur de 160AA, il est donc très peu probable que l'ORF soit du au hasard. Cet ORF n'est pas complet car il se trouve en fin de séquence. De même, n'étant pas entier, nous n'avons pas pu calculer son poids moléculaire. Nous pouvons donc supposer que cette ORF est codant.


La recherche de séquence homologue ne nous a donné aucun résultat, excepté notre séquence. Notre séquence code soit pour une protéine rare, soit elle n'est pas codante et est finalement due au hasard.

N'ayant trouvé aucune homologie nous ne pouvons pas savoir de quel organisme est issue notre séquence.


En faisant un blastx sur toute notre séquence, on trouve des similitudes avec l'ORF en cadre 1 dans le sens indirect.

Notre séquence contient donc une partie codante mais il ne s'agit de notre ORF.


Nous en concluons donc que soit notre ORF code pour une protéine inconnue, soit ça n'en est pas un. Cependant grâce au blastx nous avons trouvé une correspondance entre une séquence connue et l'un des ORF putatifs que nous avions trouvé lors que la recherche par SMS. Il semble alors que cet ORF en cadre 1 dans le sens indirect soit un vrai ORF. Il serait donc intéressant de refaire les recherches avec cet ORF. Nous pourrions alors faire un arbre phylogénétique afin de trouver quels sont les organismes les plus proches, ou des homologues.


Ainsi, notre ORF étant dans le cadre 3 et cet autre ORF dans le cadre 1, après cette analyse, nous pouvons supposer que ce deuxième ORF serait un vrai. Or cet ORF et le notre ne se trouvent pas dans le même cadre de lecture, il est donc impossible que ces deux ORF putatifs soient vrais. Nous en concluons donc que notre ORF ne serait pas codant.

ORF finding

PROTOCOLE:

a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'anycodon' / code génétique 'standard'

b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'anycodon' / code génétique 'standard'

c) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'atg' / code génétique 'standard'

d) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'atg' / code génétique 'standard'



ANALYSE DES RÉSULTATS:


Notre première recherche d'ORF dans les deux sens, avec "anycodon" nous permet de trouver toutes les séquences comprises entre deux codons stop ou entre un codon stop et l'extrémité de la séquence.

Nous trouvons trois ORF putatifs, un en sens direct et deux en sens indirect dont celui dans le cadre 3 en sens indirect imcomplets en 3' car ils ne contient pas de codon stop.


La deuxième partie de la recherche d'ORF, avec le codon initiateur "ATG", nous permet de rechercher si nos ORF putatifs contiennent ce codon d'initiation.

Nous n'obtenons plus que deux ORF qui sont en sens indirect. L'ORF putatif dans le sens direct trouvé dans la première recherche d'ORF était sûrement trop court à partir du codon d'initiation, alors le logiciel ne nous l'a pas affiché.

L'ORF dans le cadre 1 de lecture en sens indirect possède un codon initiateur et un codon stop. Sa longueur étant largement supérieure à 60AA (123AA), il y a de fortes chances qu'il s'agisse d'un vrai ORF.

L'ORF dans le cadre 3 de lecture dans le sens indirect possède un codon initiateur et hypothétiquement un codon stop se trouvant sur la partie manquante de notre séquence. Sa taille est au minimum de 160AA. Il y a de fortes chances qu'il s'agisse aussi d'un vrai ORf.


Nous choisissons l'ORF le plus grand. Nous continuerons donc l'analyse avec l'ORF en sens indirect dans le cadre 3 de lecture.

RÉSULTATS BRUTS:

a) Sens direct

>ORF number 1 in reading frame 1 on the direct strand extends from base 43 to base 234.
CTCATTATCACCAAGCACACGCGTAATGAATATTATTACTCTTCTGGGGGTGGTCTGCCT
TCTAGCGGTCGCATAAACCCCAACACCATCCGGAGTCTTAATAGACCCAGATCTAATCTG
CCTAGCCAGGTCCCTAAGATCGTTATGATAAGTATCACCAAGATACATCCGATGACTGCC
CAAAACAAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LIITKHTRNEYYYSSGGGLPSSGRINPNTIRSLNRPRSNLPSQVPKIVMISITKIHPMTA
QNK*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.






b) Sens indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 73 to base 501.
ATTAAGAGTTACGTCTTTAAGGAACATGTGCCATTCATCAATAGCAGATTAAAGCATTAT
ATGGACACGTTCGGATTAGACGTAAAGGTGAATTTGACTGATTCGTTGAGTGTTGAGAGT
AATATGTGGGGATATGAATTTGAGTCCGGTGGTGAGCGTAAACGCACTGATGTGGCGTTT
ATGCTGGCGATGTTTGACTTTCACGAGCAGATGTATGGCAGACAATGTAATGTCTTAGTT
TTAGACGAAGTCGATGGTAGGATGGATGATGATGGTATAGAATCGTTGATTAATATTATC
AAGAACGATTTGGCTAGTAGAGTGGAAACCGTTCTGATTATATCTCACCGTAACCTGATG
TTTGATACTTTTCCAAGAGAGTTACGCGTAACGCGTAGGGATAGGCAGTCTAAGCTAGAA
GTATATTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSLSVESNMWGYEFESGGERKRTDVAF
MLAMFDFHEQMYGRQCNVLVLDEVDGRMDDDGIESLINIIKNDLASRVETVLIISHRNLM
FDTFPRELRVTRRDRQSKLEVY*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 507 to base 1019.
ATATTTCAGAGCGAATATAAGACGAGGTATCTCATGAATGAATTAGATCCATTAGCGGTT
GATACTATTAAGCACGCCTCGAATGTGGAGGTTGTGCGTAGGTTGCTGATCAGATATTTC
ATGGATAAGGGATTTAATAATAGCTTCGACCGTCAGATGTATCCCGCAATGATTCAAGAT
TTAACAGCTACCATACCTAGTCTATCGAACAAGGTAGAAATTGTACCGCATTCTAGGGAG
ATTGATTCTGCTTTAAGTCGGGCCATTTTAAGTTGGAATTTATTTGTTTTGGGCAGTCAT
CGGATGTATCTTGGTGATACTTATCATAACGATCTTAGGGACCTGGCTAGGCAGATTAGA
TCTGGGTCTATTAAGACTCCGGATGGTGTTGGGGTTTATGCGACCGCTAGAAGGCAGACC
ACCCCCAGAAGAGTAATAATATTCATTACGCGTGTGCTTGGTGATAATGAGTCAGGATAT
ACCGACTTGAATCCTACTGCTAATGGTAAAGCA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
IFQSEYKTRYLMNELDPLAVDTIKHASNVEVVRRLLIRYFMDKGFNNSFDRQMYPAMIQD
LTATIPSLSNKVEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIR
SGSIKTPDGVGVYATARRQTTPRRVIIFITRVLGDNESGYTDLNPTANGKA







c) Sens direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.






d) Sens indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 133 to base 501.
ATGGACACGTTCGGATTAGACGTAAAGGTGAATTTGACTGATTCGTTGAGTGTTGAGAGT
AATATGTGGGGATATGAATTTGAGTCCGGTGGTGAGCGTAAACGCACTGATGTGGCGTTT
ATGCTGGCGATGTTTGACTTTCACGAGCAGATGTATGGCAGACAATGTAATGTCTTAGTT
TTAGACGAAGTCGATGGTAGGATGGATGATGATGGTATAGAATCGTTGATTAATATTATC
AAGAACGATTTGGCTAGTAGAGTGGAAACCGTTCTGATTATATCTCACCGTAACCTGATG
TTTGATACTTTTCCAAGAGAGTTACGCGTAACGCGTAGGGATAGGCAGTCTAAGCTAGAA
GTATATTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MDTFGLDVKVNLTDSLSVESNMWGYEFESGGERKRTDVAFMLAMFDFHEQMYGRQCNVLV
LDEVDGRMDDDGIESLINIIKNDLASRVETVLIISHRNLMFDTFPRELRVTRRDRQSKLE
VY*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 540 to base 1019.
ATGAATGAATTAGATCCATTAGCGGTTGATACTATTAAGCACGCCTCGAATGTGGAGGTT
GTGCGTAGGTTGCTGATCAGATATTTCATGGATAAGGGATTTAATAATAGCTTCGACCGT
CAGATGTATCCCGCAATGATTCAAGATTTAACAGCTACCATACCTAGTCTATCGAACAAG
GTAGAAATTGTACCGCATTCTAGGGAGATTGATTCTGCTTTAAGTCGGGCCATTTTAAGT
TGGAATTTATTTGTTTTGGGCAGTCATCGGATGTATCTTGGTGATACTTATCATAACGAT
CTTAGGGACCTGGCTAGGCAGATTAGATCTGGGTCTATTAAGACTCCGGATGGTGTTGGG
GTTTATGCGACCGCTAGAAGGCAGACCACCCCCAGAAGAGTAATAATATTCATTACGCGT
GTGCTTGGTGATAATGAGTCAGGATATACCGACTTGAATCCTACTGCTAATGGTAAAGCA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MNELDPLAVDTIKHASNVEVVRRLLIRYFMDKGFNNSFDRQMYPAMIQDLTATIPSLSNK
VEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVG
VYATARRQTTPRRVIIFITRVLGDNESGYTDLNPTANGKA

Multiple Alignement

PROTOCOLE:



ANALYSE DES RÉSULTATS:

RÉSULTATS BRUTS:

Protein Domains

PROTOCOLE:

a) InterProScan

b) Prosite

c) Pfam



ANALYSE DES RÉSULTATS:


Nous n'avons eu aucuns résultats avec les trois banques. Cela signifie qu'il n'y a pas de domaine protéique référencé pour notre ORF.

RÉSULTATS BRUTS: 

a) Interpro

No hits reported.





b) Prosite

Hits for all PROSITE (release 20.62) motifs on sequence USERSEQ1 :
no hit!





c) Pfam

Pfam HMM search results, glocal+local alignments merged (Pfam_ls+Pfam_fs)
[No hits in Pfam] 

Phylogeny

PROTOCOLE:



ANALYSE DES RÉSULTATS:

RÉSULTATS BRUTS:

Taxonomy report

PROTOCOLE:



ANALYSE DES RÉSULTATS:

RÉSULTATS BRUTS:

BLAST

PROTOCOLE:


a) NCBI Blastp / Database "nr"

b) NCBI Blastp / Database "env_nr"

c) NCBI Blastn / Database "Nr/Nt"

d) NCBI Blastn / Database "env_Nt"

e) NCBI Blastx / Database "nr" avec notre ORF

f) NCBI Blastx / Database "env_nr" avec notre ORF




g) NCBI Blastx / Database "nr" avec toute la séquence



ANALYSE DES RÉSULTATS:


Le blastp contre nr nous donne plusieurs résultats. Tous ces résultats ont une e-value élevée : 1.1 ou supérieur et il ne s'agit que d'alignements partiels. Il y a donc très peu de chances que notre séquence ait un homologue parmi les résultats.

N'ayant eu aucun homologue avec "nr", nous n'effectuons pas le blastp contre swissprot car les résultats seraient les mêmes, voire pires.

Avec le blastp contre "env_nr", les résultats sont du même type : e-value élevée, alignements partiels. Nous en arrivons donc à la même conclusion.


Nous faisons ensuite un blastn pour essayer de trouver des séquences qui ne seraient pas dans la banque protéique.

Le blastn contre "nr/nt" ne nous donne aucun résultat. Et le blastn contre "env_nt" ne nous donne qu'un seul résultat avec une e-value de 0. Après vérification en effectuant un blastn contre "env_nr" avec toute notre séquence, le résultat obtenu est le même, c'est donc notre ORF lui même que nous avons trouvé. Nous n'avons donc toujours pas trouvé d'homologue à notre ORF


Nous effectuons ensuite un blastx de notre séquence contre "nr" et contre "env_nr". Nous obtenons respectivement : un seul résultat avec une e-value élevée de 2.8 et aucun résultat.


Nous effectuons enfin un blastx de toute notre séquence contre "nr" pour voir si il n'y a pas d'homologue à une autre partie de notre séquence.

Nous obtenons plusieurs résultats avec une e-value faible mais les alignements s'effectuent sur la partie de la séquence qui correspond à un autre ORF (celui trouvé dans le sens indirect cadre 2 de lecture).


Il n'y a donc aucun homologue à notre ORF dans les bases de données.

RÉSULTATS BRUTS:

a) NCBI Blastp / Database "nr"

Query ID
    lcl|28421 
    lcl|28421
Description
    None
Molecule type
    amino acid
Query Length
    160

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTP 2.2.23+ Citation


YP_001634955.1	
hypothetical protein Caur_1338 [Chloroflexus aurantiacus J-10-fl] >ref|YP_002569204.1| hypothetical protein Chy400_1460 [Chloroflexus sp. Y-400-fl] >gb|ABY34566.1| conserved hypothetical protein [Chloroflexus aurantiacus J-10-fl] >gb|ACM52878.1| conserved hypothetical protein [Chloroflexus sp. Y-400-fl]
	36.2	36.2	33%	1.1	Gene info
ZP_05853749.1	
nitrate reductase, electron transfer subunit [Blautia hansenii DSM 20583] >gb|EEX22670.1| nitrate reductase, electron transfer subunit [Blautia hansenii DSM 20583]
	36.2	36.2	56%	1.1	
YP_003143581.1	
putative collagen-binding protein [Slackia heliotrinireducens DSM 20476] >gb|ACV22232.1| putative collagen-binding protein [Slackia heliotrinireducens DSM 20476]
	35.4	35.4	63%	1.8	Gene info
XP_002112918.1	
hypothetical protein TRIADDRAFT_56537 [Trichoplax adhaerens] >gb|EDV25028.1| hypothetical protein TRIADDRAFT_56537 [Trichoplax adhaerens]
	35.0	35.0	33%	2.3	Gene info
YP_003199890.1	
YidE/YbjL duplication [Nakamurella multipartita DSM 44233] >gb|ACV76901.1| YidE/YbjL duplication [Nakamurella multipartita DSM 44233]
	34.3	34.3	30%	4.0	
ZP_02520198.1	
50S ribosomal protein L18 [candidate division TM7 single-cell isolate TM7b]
	33.9	33.9	58%	5.2	
ZP_01911010.1	
Radical SAM [Plesiocystis pacifica SIR-1] >gb|EDM76033.1| Radical SAM [Plesiocystis pacifica SIR-1]
	33.9	33.9	45%	5.4	
EAZ37630.1	
hypothetical protein OsJ_21964 [Oryza sativa Japonica Group]
	33.5	33.5	46%	6.7	
YP_003140570.1	
lipolytic protein G-D-S-L family [Capnocytophaga ochracea DSM 7271] >gb|ACU92009.1| lipolytic protein G-D-S-L family [Capnocytophaga ochracea DSM 7271]
	33.5	33.5	43%	6.9	Gene info
NP_001058069.1	
Os06g0613100 [Oryza sativa (japonica cultivar-group)] >dbj|BAD35524.1| selenium-binding protein-like [Oryza sativa Japonica Group] >dbj|BAD35556.1| selenium-binding protein-like [Oryza sativa Japonica Group]
	33.5	33.5	46%	7.0	UniGene infoGene info
ZP_02434281.1	
hypothetical protein BACSTE_00506 [Bacteroides stercoris ATCC 43183] >gb|EDS16376.1| hypothetical protein BACSTE_00506 [Bacteroides stercoris ATCC 43183]
	33.5	33.5	39%	8.0	
ZP_05786990.1	
esterase YbfF [Silicibacter lacuscaerulensis ITI-1157] >gb|EEX10106.1| esterase YbfF [Silicibacter lacuscaerulensis ITI-1157]
	33.5	33.5	30%	8.1	
BAF19983.2	
Os06g0613100 [Oryza sativa Japonica Group]
	33.5	33.5	46%	8.1	
YP_359342.1	
methylaspartate ammonia-lyase [Carboxydothermus hydrogenoformans Z-2901] >gb|ABB16231.1| methylaspartate ammonia-lyase [Carboxydothermus hydrogenoformans Z-2901]
	33.1	33.1	55%	9.2	Gene info


ref|YP_001634955.1| Gene info hypothetical protein Caur_1338 [Chloroflexus aurantiacus J-10-fl]
 ref|YP_002569204.1| Gene info hypothetical protein Chy400_1460 [Chloroflexus sp. Y-400-fl]
 gb|ABY34566.1| Gene info conserved hypothetical protein [Chloroflexus aurantiacus J-10-fl]
 gb|ACM52878.1| Gene info conserved hypothetical protein [Chloroflexus sp. Y-400-fl]
Length=814

 GENE ID: 5828442 Caur_1338 | hypothetical protein
[Chloroflexus aurantiacus J-10-fl]

 Score = 36.2 bits (82),  Expect = 1.1, Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query  1    MNELDP--LAVDTIKHASNVEVVRRLLIRYFMDKGFNNSFDRQMYPAMIQDLTATI  54
            + EL P  +AVDTI  + ++  +R L+ +Y +D  +  S +R+ YPA   D+ A I
Sbjct  742  LAELGPRCIAVDTIYRSGDLNRIRPLIDQYSVDYIYVGSLERERYPASSLDVLAQI  797


>ref|ZP_05853749.1|  nitrate reductase, electron transfer subunit [Blautia hansenii 
DSM 20583]
 gb|EEX22670.1|  nitrate reductase, electron transfer subunit [Blautia hansenii 
DSM 20583]
Length=144

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 1/92 (1%)

Query  70   IDSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVYATARRQT  129
            ID+A      S ++  + +HR   G+ Y  DL D+  + R+   K PDG       R   
Sbjct  2    IDAAKCDGCKSCSVACMQAHRKDDGNVYTLDLTDITNESRNFIYKNPDGSYTPVFCRHCE  61

Query  130  TPRRVIIFITRVL-GDNESGYTDLNPTANGKA  160
             P  V+  ++  L  D ++G+   +    G  
Sbjct  62   QPECVMSCMSGALKKDEKTGHVQYDAEKCGSC  93


>ref|YP_003143581.1| Gene info putative collagen-binding protein [Slackia heliotrinireducens 
DSM 20476]
 gb|ACV22232.1| Gene info putative collagen-binding protein [Slackia heliotrinireducens 
DSM 20476]
Length=1562

 GENE ID: 8395095 Shel_12040 | putative collagen-binding protein
[Slackia heliotrinireducens DSM 20476]

 Score = 35.4 bits (80),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 9/107 (8%)

Query  59   NKVEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDG  118
            N+++  P  + +         +W + V G H+M +G TY +D   + +  R     T DG
Sbjct  422  NRIDKEPAGKPVQIGEGLYEQTWTITVNGDHKMPMGGTYISDW--IVQNSRPFMQFTGDG  479

Query  119  VGVYATARRQTTPRRVIIF-----ITRVLGDNESGYTDLNPTANGKA  160
            + V  T    TT  R + +      T   G    GY  L P ++GKA
Sbjct  480  ISVAVTMENGTTETRNVTWDDLRLYTSEYGTYGWGY--LTPASDGKA  524


>ref|XP_002112918.1| Gene info hypothetical protein TRIADDRAFT_56537 [Trichoplax adhaerens]
 gb|EDV25028.1| Gene info hypothetical protein TRIADDRAFT_56537 [Trichoplax adhaerens]
Length=372

 GENE ID: 6753691 TRIADDRAFT_56537 | hypothetical protein [Trichoplax adhaerens]
(10 or fewer PubMed links)

 Score = 35.0 bits (79),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query  44   PAMIQDLTATIPSLSNKVEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTY  97
            P ++ D       L    E + H ++I   L  A L+W L +LG+H  YLGDT+
Sbjct  149  PKLVADANERAIELEKCPEAI-HKKQIKH-LDDAYLTWVLGILGAHHFYLGDTF  200


>ref|YP_003199890.1|  YidE/YbjL duplication [Nakamurella multipartita DSM 44233]
 gb|ACV76901.1|  YidE/YbjL duplication [Nakamurella multipartita DSM 44233]
Length=527

 Score = 34.3 bits (77),  Expect = 4.0, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query  107  QIRSGS---IKTPDGVGVYATARRQTTPRRVIIFITRVLGDNESGYTDLNP  154
            ++R G    I TPD V       R T PR  +  IT+ LGD+E    D+NP
Sbjct  302  RVRRGDVDIIATPDLVLASGDRLRVTAPREQLAAITKELGDSERTAGDINP  352


>ref|ZP_02520198.1|  50S ribosomal protein L18 [candidate division TM7 single-cell 
isolate TM7b]
Length=114

 Score = 33.9 bits (76),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 25/112 (22%)

Query  22   RRLLIRYFMDKGFNNSFDR----------QMYPAMIQDLTATIPSLSNKV--EIVPHSRE  69
            RRL I+Y + K  N + DR          Q+Y  +I D+T T  ++++ V  E +P   +
Sbjct  8    RRLKIKYHIRKNVNGTADRPRLSVFRSNKQIYAQVINDITGTTLAVASSVGLEKMP---K  64

Query  70   IDSA-------LSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIK  114
            ID A         RA+ +    V+     YL   YH  ++ LA   R G +K
Sbjct  65   IDRAKKVGELIAGRAVAAGIQQVVFDRNGYL---YHGRVQALADGAREGGLK  113


>ref|ZP_01911010.1|  Radical SAM [Plesiocystis pacifica SIR-1]
 gb|EDM76033.1|  Radical SAM [Plesiocystis pacifica SIR-1]
Length=355

 Score = 33.9 bits (76),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query  32   KGFNNSFDRQMYPAMIQDLTATIPSLSNKVE--------IVPHSREIDSALSRAILSWNL  83
            KGF++ F R++  A +Q +  T+  L+N  E        I+P   + D A  RA   W +
Sbjct  183  KGFDDGFYRKLTGARLQPVLETLDYLANDTEVWLELTTLIIPGFND-DEAKLRAQCEWIV  241

Query  84   FVLGSHRMYLGDTYHNDLRDL  104
              LG+H       +H D + L
Sbjct  242  EHLGAHVPLHFSAFHPDFKML  262


>gb|EAZ37630.1|  hypothetical protein OsJ_21964 [Oryza sativa Japonica Group]
Length=583

 Score = 33.5 bits (75),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 0/74 (0%)

Query  40   RQMYPAMIQDLTATIPSLSNKVEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHN  99
            R+  P  +    + I   S   +++   R  D+ L R+++SWN  ++G  R  LG    +
Sbjct  240  RKELPFFVALQNSLIDMYSKCGKLLYSRRVFDNMLERSVVSWNAMLMGYGRHGLGHEVIS  299

Query  100  DLRDLARQIRSGSI  113
              +DL ++++  S+
Sbjct  300  LFKDLHKEVKPDSV  313


>ref|YP_003140570.1| Gene info lipolytic protein G-D-S-L family [Capnocytophaga ochracea DSM 
7271]
 gb|ACU92009.1| Gene info lipolytic protein G-D-S-L family [Capnocytophaga ochracea DSM 
7271]
Length=243

 GENE ID: 8366852 Coch_0446 | lipolytic protein G-D-S-L family
[Capnocytophaga ochracea DSM 7271]

 Score = 33.5 bits (75),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query  79   LSWNLFVLGSHRMYLGDTYHNDLRDLARQIRS-GSIKTPDGVGVYATARRQTTPRRVIIF  137
            LS ++  LGS  + L DT + D   L    RS G     D +  Y T  +  TP+ ++++
Sbjct  62   LSCDVLFLGSSSINLWDTIYEDFAPLKLIRRSYGGATLRDMIYNYNTIAKGYTPKSILLY  121

Query  138  ITRVLGDNESG  148
            +   LG+++ G
Sbjct  122  VENDLGNHKEG  132


>ref|NP_001058069.1| UniGene infoGene info Os06g0613100 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD35524.1| Gene info selenium-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD35556.1| Gene info selenium-binding protein-like [Oryza sativa Japonica Group]
Length=615

 GENE ID: 4341523 Os06g0613100 | Os06g0613100 [Oryza sativa Japonica Group]
(10 or fewer PubMed links)

 Score = 33.5 bits (75),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 0/74 (0%)

Query  40   RQMYPAMIQDLTATIPSLSNKVEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHN  99
            R+  P  +    + I   S   +++   R  D+ L R+++SWN  ++G  R  LG    +
Sbjct  272  RKELPFFVALQNSLIDMYSKCGKLLYSRRVFDNMLERSVVSWNAMLMGYGRHGLGHEVIS  331

Query  100  DLRDLARQIRSGSI  113
              +DL ++++  S+
Sbjct  332  LFKDLHKEVKPDSV  345







b) NCBI Blastp / Database "env_nr"

Query ID
    lcl|19316 
    lcl|19316
Description
    unnamed protein product
Molecule type
    amino acid
Query Length
    160

Database Name
    env_nr
Description
    Environmental sample proteins from WGS projects See details
Program
    BLASTP 2.2.23+ Citation

Accession  	Description  	 Max score   	 Total score   	 Query coverage   	 E value   	Links
ECK81574.1	
hypothetical protein GOS_5862703 [marine metagenome]
	34.7	34.7	60%	1.2	
ECL27917.1	
hypothetical protein GOS_4020717 [marine metagenome]
	34.3	34.3	58%	1.3	
ECS63842.1	
hypothetical protein GOS_3920403 [marine metagenome]
	34.3	34.3	60%	1.6	
ECD48722.1	
hypothetical protein GOS_3263699 [marine metagenome]
	33.9	33.9	38%	1.8	
ECU97207.1	
hypothetical protein GOS_2985715 [marine metagenome]
	33.5	33.5	35%	2.3	
ECZ28469.1	
hypothetical protein GOS_2210471 [marine metagenome]
	33.5	33.5	35%	2.4	
EDD26587.1	
hypothetical protein GOS_1330625 [marine metagenome]
	33.1	33.1	55%	2.9	
EBC66645.1	
hypothetical protein GOS_33068 [marine metagenome]
	33.1	33.1	49%	2.9	
EDF06161.1	
hypothetical protein GOS_1021873 [marine metagenome]
	32.7	32.7	45%	3.7	
EDE94269.1	
hypothetical protein GOS_1043170 [marine metagenome]
	32.7	32.7	45%	3.8	
EBH01484.1	
hypothetical protein GOS_9335353 [marine metagenome]
	32.7	32.7	45%	4.1	
EDB25569.1	
hypothetical protein GOS_1855758 [marine metagenome]
	32.7	32.7	38%	4.1	
EBW76387.1	
hypothetical protein GOS_6695319 [marine metagenome]
	32.7	32.7	31%	4.2	
ECZ74764.1	
hypothetical protein GOS_2128052 [marine metagenome]
	32.3	32.3	71%	4.8	
EBN99023.1	
hypothetical protein GOS_8154883 [marine metagenome]
	32.3	32.3	42%	5.1	
EDE32396.1	
hypothetical protein GOS_1150418 [marine metagenome]
	32.3	32.3	60%	5.2	
ECS61072.1	
hypothetical protein GOS_4032083 [marine metagenome]
	32.3	32.3	60%	5.2	
ECV89512.1	
hypothetical protein GOS_2816222 [marine metagenome]
	32.3	32.3	30%	6.2	
ECT62630.1	
hypothetical protein GOS_5216189 [marine metagenome]
	32.0	32.0	71%	7.3	
EDJ63759.1	
hypothetical protein GOS_1660092 [marine metagenome]
	32.0	32.0	28%	7.5	
EDE40418.1	
hypothetical protein GOS_1136731 [marine metagenome]
	32.0	32.0	60%	7.6	
ECQ34755.1	
hypothetical protein GOS_6011825 [marine metagenome]
	31.6	31.6	45%	8.4	
EBO73715.1	
hypothetical protein GOS_8029257 [marine metagenome]
	31.6	31.6	64%	8.4	
EBO56548.1	
hypothetical protein GOS_8058827 [marine metagenome]
	31.6	31.6	60%	8.8	
EBO26783.1	
hypothetical protein GOS_8108846 [marine metagenome]
	31.6	31.6	46%	9.0	
EDF68106.1	
hypothetical protein GOS_912682 [marine metagenome]
	31.6	31.6	71%	9.1	
EBS19096.1	
hypothetical protein GOS_7476809 [marine metagenome]
	31.6	31.6	35%	9.3	
ECV72369.1	
hypothetical protein GOS_2846767 [marine metagenome]
	31.6	31.6	47%	9.8	
ECA93370.1	
hypothetical protein GOS_6387042 [marine metagenome]
	31.6	31.6	35%	10.0	


>gb|ECK81574.1|  hypothetical protein GOS_5862703 [marine metagenome]
Length=270

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query  48   QDLTATIPSLSNKVEIVPHSREIDSALSRAILSWNLFVLGSHRM-----YLGDTYHNDLR  102
            +DL   +     + ++VP      +AL+ ++   NL  LG+  M     YLG+T ++ + 
Sbjct  119  EDLDFKVDFFGPEEDLVPEQYGSVTALNVSMAGGNLVFLGTENMISGSFYLGNTLYSGIE  178

Query  103  DLARQIRSGSIKTPDGVGVYATARRQTTPRRVIIFITRVLG  143
                 + S  IK+  G   Y +A R T P   +I+   V+G
Sbjct  179  --MAGVNSAYIKSV-GYKSYLSASRGTGPAGFLIWSGSVMG  216


>gb|ECL27917.1|  hypothetical protein GOS_4020717 [marine metagenome]
Length=248

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query  30   MDKGFNNSFDRQMYPAMIQDLTATIPSLSNKVEIVPHSREIDS-ALSRAILSWNLFVLGS  88
             DKG   S+       +   + A I S++N  E V  +  +D+ AL +A L+ +  VLG+
Sbjct  157  FDKGTTVSYVLDQCHNIEPKIPAQIRSITNVQEAVAKALLVDADALKKAQLAGD--VLGA  214

Query  89   HRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVY  122
            + + L D Y+ D+RDL  ++RS     PD    Y
Sbjct  215  NDL-LMDAYNTDVRDLLGELRSEQGLAPDPKSAY  247


>gb|ECS63842.1|  hypothetical protein GOS_3920403 [marine metagenome]
Length=262

 Score = 34.3 bits (77),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query  30   MDKGFNNSFDRQMYPAMIQDLTATIPSLSNKVEIVPHSREIDS-ALSRAILSWNLFVLGS  88
             DKG   S+       +   + A I S++N  E V  +  +D+ AL +A L+ +  VLG+
Sbjct  149  FDKGTTVSYVLDQCHNIEPKIPAQIRSITNVQEAVAKALLVDTDALKKAQLAGD--VLGA  206

Query  89   HRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVYATA  125
            + + + D Y+ D+R+L  ++RS     PD    YA +
Sbjct  207  NDLLM-DAYNTDVRELLGELRSEQGLAPDPKSAYAKS  242


>gb|ECD48722.1|  hypothetical protein GOS_3263699 [marine metagenome]
Length=237

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query  41   QMYPAMIQDLTATIPSLSNK----VEIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDT  96
            + YPA+I+ +     SL  +    +E   H+ + DSA+S    SW    LGS R+ LG T
Sbjct  49   ERYPAIIEAIEDGGTSLELRKQLALEAFSHTADYDSAVS----SWLAGQLGSERLSLGFT  104

Query  97   YHNDLR  102
               DLR
Sbjct  105  KSGDLR  110


>gb|ECU97207.1|  hypothetical protein GOS_2985715 [marine metagenome]
Length=254

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 0/57 (0%)

Query  78   ILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVYATARRQTTPRRV  134
            ++  NL  LG     + + Y+ +LRDLA+QI     +  DG+  + T     TP  V
Sbjct  120  LIGSNLDELGPRFPDMSNVYNKELRDLAKQISKDLFEYKDGIYAWFTGPTYETPSEV  176


>gb|ECZ28469.1|  hypothetical protein GOS_2210471 [marine metagenome]
Length=263

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 0/57 (0%)

Query  78   ILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVYATARRQTTPRRV  134
            ++  NL  LG     + + Y+ +LRDLA+QI     +  DG+  + T     TP  V
Sbjct  146  LIGSNLDELGPRFPDMSNVYNKELRDLAKQISKDLFEYKDGIYAWFTGPTYETPSEV  202


>gb|EDD26587.1|  hypothetical protein GOS_1330625 [marine metagenome]
Length=514

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 13/97 (13%)

Query  25   LIRYFMDK---GFNNSFDRQMYPAMIQDLT--ATIPSLSNKVEIVPHSRE---IDSALSR  76
            +++Y+ D+   GFN     Q  P    DLT   ++PS    + IVP S     ID++ + 
Sbjct  398  VLKYWQDRSVSGFNTVGTAQTQPTYGFDLTEFTSVPSTGGNLTIVPSSGSNLAIDTSFTG  457

Query  77   AILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSI  113
                    V+ +   YLG T+ + + D   +  SG+I
Sbjct  458  VST-----VINNRTYYLGQTFTSGVADPEVRQHSGNI  489


>gb|EBC66645.1|  hypothetical protein GOS_33068 [marine metagenome]
Length=128

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 20/79 (25%)

Query  71   DSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGVYATARRQTT  130
            D+ +   +L W L ++G HR YLGDT+   ++ L          T  G+G++        
Sbjct  70   DNQIVALVLCWFLGLIGVHRFYLGDTWQGIVQLL----------TLGGLGIW--------  111

Query  131  PRRVIIFITRVLGDNESGY  149
               +I FI   +GD   G+
Sbjct  112  --TLIDFIRIAIGDLGPGW  128


>gb|EDF06161.1|  hypothetical protein GOS_1021873 [marine metagenome]
Length=347

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 32/82 (39%), Gaps = 13/82 (15%)

Query  30   MDKGFNNSFDRQMYPAM----------IQDLTATIPSLSNKVEIVPHSREIDSALSRAIL  79
            M   FNN F R    A           + + T     L   +E     RE D A+S+ I+
Sbjct  162  MSPAFNNWFSRLFLTAFYKTPSNIFTQVGERTVDFGPLKQAIE-KGQGREFDEAMSKLIV  220

Query  80   SWNLFVLGSHRMYLGDTYHNDL  101
             W   + G H M    T+ +D+
Sbjct  221  GWGTILFGGHLM--NKTFGDDI  240


>gb|EDE94269.1|  hypothetical protein GOS_1043170 [marine metagenome]
Length=275

 Score = 32.7 bits (73),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 0/73 (0%)

Query  62   EIVPHSREIDSALSRAILSWNLFVLGSHRMYLGDTYHNDLRDLARQIRSGSIKTPDGVGV  121
            +IV     I+   S  ++  N+  LG     + DTY+ +LR LA  I     K  DGV  
Sbjct  125  DIVNIKDHINLTGSNPLMGKNIDELGPRFPDMTDTYNKELRKLAESISKDIFKYKDGVYA  184

Query  122  YATARRQTTPRRV  134
            + T     TP  V
Sbjct  185  WFTGPTYETPAEV  197






c) NCBI Blastn / Database "nr/nt"

Query ID
    lcl|40995 
    lcl|40995
Description
    None
Molecule type
    nucleic acid
Query Length
    480

Database Name
    nr
Description
    All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS,environmental samples or phase 0, 1 or 2 HTGS sequences) See details
Program
    BLASTN 2.2.23+ Citation


No significant similarity found.






d) NCBI Blastn / Database "env_nt"

Query ID
    lcl|62275 
    lcl|62275
Description
    None
Molecule type
    nucleic acid
Query Length
    480

Database Name
    env_nt
Description
    environmental samples See details
Program
    BLASTN 2.2.23+ Citation


Accession  	Description  	 Max score   	 Total score   	 Query coverage   	 E value   	Max ident  	Links
AACY023426005.1	
Marine metagenome ctg_1101668233356, whole genome shotgun sequence
	887	887	100%	0.0	100%	

>gb|AACY023426005.1|  Marine metagenome ctg_1101668233356, whole genome shotgun sequence
Length=1597

 Score =  887 bits (480),  Expect = 0.0
 Identities = 480/480 (100%), Gaps = 0/480 (0%)
 Strand=Plus/Minus

Query  1    ATGAATGAATTAGATCCATTAGCGGTTGATACTATTAAGCACGCCTCGAATGTGGAGGTT  60
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  480  ATGAATGAATTAGATCCATTAGCGGTTGATACTATTAAGCACGCCTCGAATGTGGAGGTT  421

Query  61   GTGCGTAGGTTGCTGATCAGATATTTCATGGATAAGGGATTTAATAATAGCTTCGACCGT  120
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  420  GTGCGTAGGTTGCTGATCAGATATTTCATGGATAAGGGATTTAATAATAGCTTCGACCGT  361

Query  121  CAGATGTATCCCGCAATGATTCAAGATTTAACAGCTACCATACCTAGTCTATCGAACAAG  180
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  360  CAGATGTATCCCGCAATGATTCAAGATTTAACAGCTACCATACCTAGTCTATCGAACAAG  301

Query  181  GTAGAAATTGTACCGCATTCTAGGGAGATTGATTCTGCTTTAAGTCGGGCCATTTTAAGT  240
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  300  GTAGAAATTGTACCGCATTCTAGGGAGATTGATTCTGCTTTAAGTCGGGCCATTTTAAGT  241

Query  241  TGGAATTTATTTGTTTTGGGCAGTCATCGGATGTATCTTGGTGATACTTATCATAACGAT  300
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  240  TGGAATTTATTTGTTTTGGGCAGTCATCGGATGTATCTTGGTGATACTTATCATAACGAT  181

Query  301  CTTAGGGACCTGGCTAGGCAGATTAGATCTGGGTCTATTAAGACTCCGGATGGTGTTGGG  360
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  180  CTTAGGGACCTGGCTAGGCAGATTAGATCTGGGTCTATTAAGACTCCGGATGGTGTTGGG  121

Query  361  GTTTATGCGACCGCTAGAAGGCAGACCACCCCCAGAAGAGTAATAATATTCATTACGCGT  420
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  120  GTTTATGCGACCGCTAGAAGGCAGACCACCCCCAGAAGAGTAATAATATTCATTACGCGT  61

Query  421  GTGCTTGGTGATAATGAGTCAGGATATACCGACTTGAATCCTACTGCTAATGGTAAAGCA  480
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  60   GTGCTTGGTGATAATGAGTCAGGATATACCGACTTGAATCCTACTGCTAATGGTAAAGCA  1





e) NCBI Blastx / Database "nr"

Query ID
    lcl|12201 
    lcl|12201
Description
    None
Molecule type
    nucleic acid
Query Length
    480

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTX 2.2.23+ Citation

Accession  	Description  	 Max score   	 Total score   	 Query coverage   	 E value   	Max ident  	Links
YP_001634955.1	
hypothetical protein Caur_1338 [Chloroflexus aurantiacus J-10-fl] >ref|YP_002569204.1| hypothetical protein Chy400_1460 [Chloroflexus sp. Y-400-fl] >gb|ABY34566.1| conserved hypothetical protein [Chloroflexus aurantiacus J-10-fl] >gb|ACM52878.1| conserved hypothetical protein [Chloroflexus sp. Y-400-fl]
	35.0	35.0	32%	2.8	37%	Gene info


GENE ID: 5828442 Caur_1338 | hypothetical protein
[Chloroflexus aurantiacus J-10-fl]

 Score = 35.0 bits (79),  Expect = 2.7
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +1

Query  7    ELDP--LAVDTIKHASNVEVVRRLLIRYFMDKGFNNSFDRQMYPAMIQDLTATI  162
            EL P  +AVDTI  + ++  +R L+ +Y +D  +  S +R+ YPA   D+ A I
Sbjct  744  ELGPRCIAVDTIYRSGDLNRIRPLIDQYSVDYIYVGSLERERYPASSLDVLAQI  797






f) NCBI Blastx / Database "env_nr"

Query ID
    lcl|35139 
    lcl|35139
Description
    None
Molecule type
    nucleic acid
Query Length
    480

Database Name
    env_nr
Description
    Environmental sample proteins from WGS projects See details
Program
    BLASTX 2.2.23+ Citation


No significant similarity found. 








g) NCBI Blastx / Database "nr" avec toute la séquence

Query ID
    lcl|3929 
    lcl|3929
Description
    None
Molecule type
    nucleic acid
Query Length
    1019

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTX 2.2.23+ Citation

Accession  	Description  	 Max score   	 Total score   	 Query coverage   	 E value   	Max ident  	Links
YP_002922108.1	
recombination endonuclease subunit [Enterobacteria phage JSE] >gb|ACL77985.1| recombination endonuclease subunit [Enterobacteria phage JSE]
	68.9	68.9	41%	9e-10	32%	Gene info
YP_001469378.1	
endonuclease subunit [Enterobacteria phage Phi1] >gb|ABR24544.1| gp46 recombination endonuclease subunit [Enterobacteria phage Phi1]
	68.9	68.9	41%	9e-10	32%	Gene info
NP_891605.1	
recombination endonuclease subunit [Enterobacteria phage RB49] >gb|AAL87829.2|AF410869_1 recombination endonuclease subunit [Enterobacteria phage RB49]
	68.9	68.9	41%	9e-10	32%	Gene info
YP_656279.1	
gp46 recombination protein subunit [Aeromonas phage 25] >gb|ABF72603.1| gp46 recombination protein subunit [Aeromonas phage 25]
	67.8	67.8	40%	2e-09	32%	Gene info
YP_164705.1	
hypothetical protein LP65_gp070 [Lactobacillus phage LP65] >gb|AAV35890.1| orf70 [Lactobacillus phage LP65]
	64.3	64.3	41%	2e-08	26%	Gene info
NP_932398.1	
gp46 [Aeromonas phage 44RR2.8t] >ref|YP_238771.1| gp46 [Aeromonas phage 31] >gb|AAQ81362.1| recombination endonuclease subunit [Aeromonas phage 44RR2.8t] >gb|AAX63531.1| gp46 [Aeromonas phage 31]
	63.9	63.9	41%	3e-08	30%	Gene info
AAR90909.1	
gp46 recombination endonuclease subunit [Aeromonas phage 65]
	62.4	62.4	41%	8e-08	28%	
NP_861753.1	
endonuclease subunit [Enterobacteria phage RB69] >sp|O64299.2|EXO2_BPR69 RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46 >gb|AAP75965.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB69]
	61.2	61.2	41%	2e-07	29%	Gene info
YP_239031.1	
gp46 recombination endonuclease subunit [Enterobacteria phage RB43] >gb|AAX78577.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB43]
	61.2	61.2	40%	2e-07	28%	Gene info
AAC39308.1	
DNase subunit [Enterobacteria phage RB69]
	61.2	61.2	41%	2e-07	29%	
YP_002300391.1	
gp21.9 [Bacillus phage SPO1] >gb|ACI91020.1| gp21.9 [Bacillus phage SPO1]
	60.1	60.1	38%	4e-07	27%	Gene info
NP_899322.1	
recombination endonuclease subunit [Vibrio phage KVP40] >gb|AAQ64145.1| recombination endonuclease subunit [Vibrio phage KVP40]
	59.7	59.7	34%	5e-07	35%	Gene info
ZP_04661998.1	
RecF/RecN/SMC domain-containing protein [Acinetobacter baumannii AB900]
	58.5	58.5	40%	1e-06	26%	
NP_943902.1	
gp46 recombination endonuclease subunit [Aeromonas phage Aeh1] >gb|AAQ17679.1| gp46 recombination endonuclease subunit [Aeromonas phage Aeh1]
	58.5	58.5	39%	1e-06	27%	Gene info
YP_195153.1	
endonuclease subunit [Synechococcus phage S-PM2] >emb|CAF34183.1| recombination protein gp46 [Synechococcus phage S-PM2]
	58.2	58.2	41%	2e-06	28%	Gene info
BAI83065.1	
recombination endonuclease subunit [Enterobacteria phage AR1]
	57.8	57.8	34%	2e-06	29%	
NP_049669.1	
gp46 recombination endonuclease subunit [Enterobacteria phage T4] >sp|P04522.2|EXO2_BPT4 RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46 >gb|AAD42472.1|AF158101_59 gp46 recombination endonuclease subunit [Enterobacteria phage T4] >gb|AAC05392.1| exonuclease g46 (gtg start codon) [Enterobacteria phage T4] >emb|CAA25945.1| unnamed protein product [Enterobacteria phage T4]
	57.8	57.8	34%	2e-06	29%	GeoGene info
YP_002854390.1	
gp46 recombination endonuclease subunit [Enterobacteria phage RB14] >gb|ACP30698.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB14]
	57.4	57.4	34%	3e-06	28%	Gene info
YP_024504.1	
putative exonuclease [Staphylococcus phage K] >ref|YP_240940.1| ORF009 [Staphylococcus phage G1] >gb|AAO47523.1| ORF74 [Staphylococcus phage K] >gb|AAX92091.1| ORF009 [Staphylococcus phage G1] >gb|ABL87145.1| putative nuclease [Staphylococcus phage 812] >gb|ACB89096.1| gp ORF103 [Staphylococcus phage A5W]
	56.2	56.2	41%	6e-06	25%	Gene info
YP_003358594.1	
Gp46 recombination endonuclease subunit [Shigella phage phiSboM-AG3] >gb|ACO94341.1| Gp46 recombination endonuclease subunit [Shigella phage phiSboM-AG3]
	55.8	55.8	36%	8e-06	23%	Gene info
YP_002922403.1	
gp46 recombination endonuclease subunit [Enterobacteria phage JS10] >gb|ACL78280.1| gp46 recombination endonuclease subunit [Enterobacteria phage JS10]
	55.1	55.1	41%	1e-05	27%	Gene info
YP_001504156.1	
putative exonuclease [Enterococcus phage phiEF24C] >dbj|BAF81315.1| putative exonuclease [Enterococcus phage phiEF24C]
	54.7	54.7	41%	2e-05	26%	Gene info
YP_002854013.1	
gp46 recombination endonuclease subunit [Enterobacteria phage RB51] >gb|ACP30976.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB51]
	53.9	53.9	34%	3e-05	28%	Gene info
YP_802997.1	
gp46 recombination endonuclease subunit [Enterobacteria phage RB32] >gb|ABI94879.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB32]
	53.9	53.9	34%	3e-05	28%	Gene info
YP_001595183.1	
gp46 recombination endonuclease subunit [Enterobacteria phage JS98] >gb|AAU29245.1| gp46 recombination endonuclease subunit [Enterobacteria phage JS98]
	53.5	53.5	41%	4e-05	26%	Gene info
YP_214682.1	
gp46 [Prochlorococcus phage P-SSM4] >gb|AAX46922.1| gp46 [Prochlorococcus phage P-SSM4]
	53.1	53.1	40%	5e-05	26%	Gene info
YP_003462311.1	
SMC domain protein [Dehalococcoides sp. GT] >gb|ADC73855.1| SMC domain protein [Dehalococcoides sp. GT]
	52.8	52.8	32%	6e-05	28%	
YP_307629.1	
putative exonuclease SbcC [Dehalococcoides sp. CBDB1] >emb|CAI82713.1| putative exonuclease SbcC [Dehalococcoides sp. CBDB1]
	52.8	52.8	32%	6e-05	28%	Gene info
YP_001213988.1	
SMC domain-containing protein [Dehalococcoides sp. BAV1] >gb|ABQ17110.1| SMC domain protein [Dehalococcoides sp. BAV1]
	52.8	52.8	32%	6e-05	28%	Gene info
ZP_05334874.1	
SMC domain protein [Thermoanaerobacterium thermosaccharolyticum DSM 571] >gb|EET55501.1| SMC domain protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
	52.4	52.4	32%	8e-05	27%	
YP_001996621.1	
SMC domain protein [Chloroherpeton thalassium ATCC 35110] >gb|ACF14174.1| SMC domain protein [Chloroherpeton thalassium ATCC 35110]
	52.4	52.4	31%	8e-05	26%	Gene info
YP_003329972.1	
ATPase involved in DNA repair [Dehalococcoides sp. VS] >gb|ACZ61644.1| ATPase involved in DNA repair [Dehalococcoides sp. VS]
	52.0	52.0	32%	1e-04	28%	Gene info
YP_181293.1	
exonuclease SbcC, putative [Dehalococcoides ethenogenes 195] >gb|AAW40153.1| exonuclease SbcC, putative [Dehalococcoides ethenogenes 195]
	52.0	52.0	32%	1e-04	28%	Gene info
YP_003421539.1	
RecF/RecN/SMC N-terminal domain-containing protein [cyanobacterium UCYN-A] >gb|ADB95181.1| RecF/RecN/SMC N-terminal domain-containing protein [cyanobacterium UCYN-A]
	51.6	51.6	39%	1e-04	27%	
YP_003097325.1	
recombination endonuclease sunbunit [Synechococcus phage S-RSM4] >emb|CAR63288.1| recombination endonuclease sunbunit [Synechococcus phage S-RSM4]
	50.8	50.8	41%	2e-04	25%	Gene info
YP_001604554.1	
RecF/RecN/SMC domain-containing protein [Yersinia pestis Angola] >gb|ABX84787.1| RecF/RecN/SMC domain protein [Yersinia pestis Angola]
	50.8	50.8	35%	2e-04	24%	Gene info
ZP_02224275.1	
RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. F1991016] >ref|ZP_02228845.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. IP275] >ref|ZP_02232963.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. E1979001] >ref|ZP_02240469.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. B42003004] >ref|ZP_02307817.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. UG05-0454] >ref|ZP_02314525.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gb|AAC13199.1| ABC transporter [Yersinia pestis KIM 10] >gb|EDR30405.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. IP275] >gb|EDR36872.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. F1991016] >gb|EDR41300.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. E1979001] >gb|EDR48862.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. B42003004] >gb|EDR55286.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gb|EDR59652.1| RecF/RecN/SMC domain protein [Yersinia pestis biovar Antiqua str. UG05-0454]
	50.8	50.8	35%	2e-04	24%	
XP_002641048.1	
C. briggsae CBR-DPY-27 protein [Caenorhabditis briggsae] >emb|CAP37231.1| C. briggsae CBR-DPY-27 protein [Caenorhabditis briggsae]
	50.8	50.8	25%	2e-04	34%	Gene info
NP_857792.1	
putative exonuclease [Yersinia pestis KIM] >ref|NP_857675.2| exonuclease [Yersinia pestis KIM] >ref|NP_995493.1| putative exonuclease subunit 2 [Yersinia pestis biovar Microtus str. 91001] >ref|YP_093924.1| putative exonuclease [Yersinia pestis] >gb|AAC82670.1| putative exonuclease [Yersinia pestis KIM 10] >gb|AAS58684.1| putative exonuclease subunit 2 [Yersinia pestis biovar Microtus str. 91001] >emb|CAG27450.1| putative exonuclease [Yersinia pestis]
	50.8	50.8	35%	2e-04	24%	Gene info
NP_395379.1	
putative exonuclease subunit 2 [Yersinia pestis CO92] >ref|YP_636723.1| exonuclease subunit 2 [Yersinia pestis Antiqua] >ref|YP_636613.1| exonuclease subunit 2 [Yersinia pestis Nepal516] >ref|YP_001154702.1| exonuclease subunit 2 [Yersinia pestis Pestoides F] >ref|YP_001293987.1| putative exonuclease subunit 2 [Yersinia pestis CA88-4125] >ref|ZP_02331410.1| putative exonuclease subunit 2 [Yersinia pestis FV-1] >ref|ZP_04512138.1| putative exonuclease subunit 2 [Yersinia pestis Pestoides A] >ref|ZP_04512889.1| putative exonuclease subunit 2 [Yersinia pestis biovar Orientalis str. PEXU2] >ref|ZP_04515451.1| putative exonuclease subunit 2 [Yersinia pestis biovar Orientalis str. India 195] >ref|ZP_04519949.1| putative exonuclease subunit 2 [Yersinia pestis Nepal516] >ref|ZP_06208100.1| putative DNA sulfur modification protein DndD [Yersinia pestis KIM D27] >emb|CAB55222.1| putative exonuclease subunit 2 [Yersinia pestis CO92] >gb|ABG20356.1| exonuclease subunit 2 [Yersinia pestis Nepal516] >gb|ABG16176.1| exonuclease subunit 2 [Yersinia pestis Antiqua] >gb|ABP42410.1| exonuclease subunit 2 [Yersinia pestis Pestoides F] >gb|ABR14903.1| putative exonuclease subunit 2 [Yersinia pestis CA88-4125] >gb|EEO74260.1| putative exonuclease subunit 2 [Yersinia pestis Nepal516] >gb|EEO78756.1| putative exonuclease subunit 2 [Yersinia pestis biovar Orientalis str. India 195] >gb|EEO83365.1| putative exonuclease subunit 2 [Yersinia pestis biovar Orientalis str. PEXU2] >gb|EEO88055.1| putative exonuclease subunit 2 [Yersinia pestis Pestoides A] >gb|ACY60642.1| putative exonuclease subunit 2 [Yersinia pestis D106004] >gb|ACY64415.1| putative exonuclease subunit 2 [Yersinia pestis D182038] >gb|EFA45786.1| putative DNA sulfur modification protein DndD [Yersinia pestis KIM D27]
	50.8	50.8	35%	2e-04	24%	Gene info
NP_569597.1	
hypothetical protein HCM2.0125c [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >emb|CAD09992.1| hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
	50.8	50.8	35%	2e-04	24%	Gene info
YP_717818.1	
recombination endonuclease [Synechococcus phage syn9] >gb|ABA47119.1| recombination endonuclease [Synechococcus phage syn9]
	50.4	50.4	40%	3e-04	23%	Gene info
YP_001545944.1	
SMC domain-containing protein [Herpetosiphon aurantiacus ATCC 23779] >gb|ABX05816.1| SMC domain protein [Herpetosiphon aurantiacus ATCC 23779]
	50.1	50.1	33%	4e-04	27%	Gene info
YP_001180375.1	
SMC domain-containing protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gb|ABP67184.1| SMC domain protein [Caldicellulosiruptor saccharolyticus DSM 8903]
	50.1	50.1	31%	4e-04	28%	Gene info
YP_003359081.1	
gp46 recombination endonuclease subunit [Deftia phage phiW-14] >gb|ACV50249.1| gp46 recombination endonuclease subunit [Deftia phage phiW-14]
	49.7	49.7	40%	5e-04	19%	Gene info
XP_002649437.1	
chromosome segregation protein cut14 [Enterocytozoon bieneusi H348] >gb|EED44667.1| chromosome segregation protein cut14 [Enterocytozoon bieneusi H348]
	49.3	49.3	39%	7e-04	24%	Gene info
ZP_06308479.1	
Exonuclease SbcC [Cylindrospermopsis raciborskii CS-505] >gb|EFA69541.1| Exonuclease SbcC [Cylindrospermopsis raciborskii CS-505]
	48.9	48.9	39%	0.001	27%	
YP_003320105.1	
SMC domain protein [Sphaerobacter thermophilus DSM 20745] >gb|ACZ39283.1| SMC domain protein [Sphaerobacter thermophilus DSM 20745]
	48.9	48.9	28%	0.001	29%	Gene info
ZP_05028553.1	
RecF/RecN/SMC N terminal domain, putative [Microcoleus chthonoplastes PCC 7420] >gb|EDX73278.1| RecF/RecN/SMC N terminal domain, putative [Microcoleus chthonoplastes PCC 7420]
	48.9	48.9	33%	0.001	30%	
YP_214379.1	
T4-like endonuclease [Prochlorococcus phage P-SSM2] >gb|AAX44525.1| T4-like endonuclease [Prochlorococcus phage P-SSM2] >gb|ACY76026.1| predicted protein [Prochlorococcus phage P-SSM2]
	48.9	48.9	41%	0.001	23%	Gene info
YP_002522473.1	
RecF/RecN/SMC N terminal domain protein [Thermomicrobium roseum DSM 5159] >gb|ACM04878.1| RecF/RecN/SMC N terminal domain protein [Thermomicrobium roseum DSM 5159]
	48.5	48.5	31%	0.001	30%	Gene info
YP_002573016.1	
SMC domain protein [Anaerocellum thermophilum DSM 6725] >gb|ACM60243.1| SMC domain protein [Anaerocellum thermophilum DSM 6725]
	48.1	48.1	28%	0.002	28%	Gene info
YP_002379792.1	
exonuclease SbcC [Cyanothece sp. PCC 7424] >gb|ACK72924.1| exonuclease SbcC [Cyanothece sp. PCC 7424]
	48.1	48.1	27%	0.002	31%	Gene info
YP_002484223.1	
exonuclease SbcC [Cyanothece sp. PCC 7425] >gb|ACL45862.1| exonuclease SbcC [Cyanothece sp. PCC 7425]
	47.8	47.8	28%	0.002	30%	Gene info
NP_682965.1	
hypothetical protein tlr2175 [Thermosynechococcus elongatus BP-1] >dbj|BAC09727.1| tlr2175 [Thermosynechococcus elongatus BP-1]
	47.8	47.8	39%	0.002	30%	Gene info
YP_001865205.1	
exonuclease SbcC [Nostoc punctiforme PCC 73102] >gb|ACC80262.1| exonuclease SbcC [Nostoc punctiforme PCC 73102]
	47.8	47.8	39%	0.002	28%	Gene info
YP_003290535.1	
SMC domain protein [Rhodothermus marinus DSM 4252] >gb|ACY48147.1| SMC domain protein [Rhodothermus marinus DSM 4252]
	47.4	47.4	25%	0.003	31%	Gene info
YP_002790820.1	
putative exonuclease [Lactobacillus phage Lb338-1] >gb|ACO37062.1| putative exonuclease [Lactobacillus phage Lb338-1]
	47.4	47.4	34%	0.003	27%	Gene info
NP_110746.1	
chromosome segregation protein [Thermoplasma volcanium GSS1] >sp|P58302.1|RAD50_THEVO RecName: Full=DNA double-strand break repair rad50 ATPase >dbj|BAB59370.1| purine NTPase [Thermoplasma volcanium GSS1]
	47.0	47.0	41%	0.004	25%	Gene info
ZP_00514690.1	
SMC protein, N-terminal [Crocosphaera watsonii WH 8501] >gb|EAM52528.1| SMC protein, N-terminal [Crocosphaera watsonii WH 8501]
	47.0	47.0	28%	0.004	29%	
XP_001754477.1	
predicted protein [Physcomitrella patens subsp. patens] >gb|EDQ80927.1| predicted protein [Physcomitrella patens subsp. patens]
	46.6	46.6	22%	0.005	38%	UniGene infoGene info
YP_477347.1	
exonuclease SbcC [Synechococcus sp. JA-2-3B'a(2-13)] >gb|ABD02084.1| exonuclease SbcC [Synechococcus sp. JA-2-3B'a(2-13)]
	46.6	46.6	28%	0.005	30%	Gene info
ZP_06383083.1	
exonuclease SbcC [Arthrospira platensis str. Paraca]
	46.2	46.2	28%	0.006	30%	
YP_003138690.1	
exonuclease SbcC [Cyanothece sp. PCC 8802] >gb|ACV01855.1| exonuclease SbcC [Cyanothece sp. PCC 8802]
	46.2	46.2	39%	0.006	25%	Gene info
ZP_03157857.1	
exonuclease SbcC [Cyanothece sp. PCC 7822] >gb|EDX94362.1| exonuclease SbcC [Cyanothece sp. PCC 7822]
	46.2	46.2	27%	0.006	30%	
YP_002373248.1	
exonuclease SbcC [Cyanothece sp. PCC 8801] >gb|ACK67092.1| exonuclease SbcC [Cyanothece sp. PCC 8801]
	46.2	46.2	39%	0.006	25%	Gene info
XP_391759.1	
hypothetical protein FG11583.1 [Gibberella zeae PH-1]
	46.2	46.2	27%	0.006	27%	
YP_001801779.1	
putative exonuclease SbcC [Cyanothece sp. ATCC 51142] >gb|ACB49713.1| putative exonuclease SbcC [Cyanothece sp. ATCC 51142]
	45.8	45.8	28%	0.008	28%	Gene info
ZP_01728188.1	
hypothetical protein CY0110_02489 [Cyanothece sp. CCY0110] >gb|EAZ92557.1| hypothetical protein CY0110_02489 [Cyanothece sp. CCY0110]
	45.8	45.8	28%	0.008	28%	
ZP_01629284.1	
Exonuclease SbcC [Nodularia spumigena CCY9414] >gb|EAW46104.1| Exonuclease SbcC [Nodularia spumigena CCY9414]
	45.8	45.8	39%	0.008	27%	
YP_002464247.1	
SMC domain protein [Chloroflexus aggregans DSM 9485] >gb|ACL25811.1| SMC domain protein [Chloroflexus aggregans DSM 9485]
	45.8	45.8	34%	0.008	28%	Gene info
ZP_03763492.1	
exonuclease SbcC ['Nostoc azollae' 0708] >gb|EEG05970.1| exonuclease SbcC ['Nostoc azollae' 0708]
	45.4	45.4	27%	0.010	30%	
YP_474195.1	
SbcC family exonuclease [Synechococcus sp. JA-3-3Ab] >gb|ABC98932.1| exonuclease, SbcC family [Synechococcus sp. JA-3-3Ab]
	45.4	45.4	27%	0.010	32%	Gene info
YP_322226.1	
exonuclease SbcC [Anabaena variabilis ATCC 29413] >gb|ABA21331.1| Exonuclease SbcC [Anabaena variabilis ATCC 29413]
	45.4	45.4	39%	0.010	27%	Gene info
NP_488028.1	
hypothetical protein alr3988 [Nostoc sp. PCC 7120] >dbj|BAB75687.1| alr3988 [Nostoc sp. PCC 7120]
	45.4	45.4	39%	0.010	27%	Gene info
ZP_03271349.1	
SMC domain protein [Arthrospira maxima CS-328] >gb|EDZ97137.1| SMC domain protein [Arthrospira maxima CS-328]
	45.1	45.1	28%	0.013	30%	
NP_925808.1	
hypothetical protein glr2862 [Gloeobacter violaceus PCC 7421] >dbj|BAC90803.1| glr2862 [Gloeobacter violaceus PCC 7421]
	45.1	45.1	39%	0.013	29%	Gene info
NP_440352.1	
hypothetical protein slr1048 [Synechocystis sp. PCC 6803] >dbj|BAA17032.1| slr1048 [Synechocystis sp. PCC 6803]
	45.1	45.1	28%	0.013	28%	Gene info
ZP_06306112.1	
Exonuclease SbcC [Raphidiopsis brookii D9] >gb|EFA72162.1| Exonuclease SbcC [Raphidiopsis brookii D9]
	44.7	44.7	39%	0.017	26%	
CAL55637.1	
ABC transporter AbcH.3 (ISS) [Ostreococcus tauri]
	44.7	44.7	19%	0.017	38%	
XP_002116280.1	
hypothetical protein TRIADDRAFT_50834 [Trichoplax adhaerens] >gb|EDV21313.1| hypothetical protein TRIADDRAFT_50834 [Trichoplax adhaerens]
	44.3	44.3	40%	0.023	26%	Gene info
YP_445980.1	
exonuclease SbcC, putative [Salinibacter ruber DSM 13855] >gb|ABC45983.1| exonuclease SbcC, putative [Salinibacter ruber DSM 13855]
	44.3	44.3	25%	0.023	32%	Gene info
NP_497771.1	
DumPY : shorter than wild-type family member (dpy-27) [Caenorhabditis elegans] >sp|P48996.1|DPY27_CAEEL RecName: Full=Chromosome condensation protein dpy-27; AltName: Full=Protein dumpy-27 >gb|AAA62647.1| chromosome condensation protein [Caenorhabditis elegans] >emb|CAA84669.1| C. elegans protein R13G10.1, partially confirmed by transcript evidence [Caenorhabditis elegans]
	44.3	44.3	25%	0.023	31%	UniGene infoGene info
YP_001736469.1	
ATPase involved in DNA repair, SbcC [Candidatus Korarchaeum cryptofilum OPF8] >gb|ACB06786.1| ATPase involved in DNA repair, SbcC [Candidatus Korarchaeum cryptofilum OPF8]
	43.9	43.9	38%	0.030	23%	Gene info
YP_001735859.1	
RecF/RecN/SMC domain-containing protein [Synechococcus sp. PCC 7002] >gb|ACB00604.1| RecF/RecN/SMC N terminal domain protein [Synechococcus sp. PCC 7002]
	43.9	43.9	39%	0.030	25%	Gene info
ZP_01623041.1	
Exonuclease SbcC [Lyngbya sp. PCC 8106] >gb|EAW34958.1| Exonuclease SbcC [Lyngbya sp. PCC 8106]
	43.9	43.9	28%	0.030	29%	
YP_001635843.1	
SMC domain-containing protein [Chloroflexus aurantiacus J-10-fl] >ref|YP_002570139.1| SMC domain protein [Chloroflexus sp. Y-400-fl] >gb|ABY35454.1| SMC domain protein [Chloroflexus aurantiacus J-10-fl] >gb|ACM53813.1| SMC domain protein [Chloroflexus sp. Y-400-fl]
	43.9	43.9	33%	0.030	27%	Gene info
YP_723388.1	
exonuclease SbcC [Trichodesmium erythraeum IMS101] >gb|ABG52915.1| exonuclease SbcC [Trichodesmium erythraeum IMS101]
	43.9	43.9	27%	0.030	29%	Gene info
XP_001420405.1	
predicted protein [Ostreococcus lucimarinus CCE9901] >gb|ABO98698.1| predicted protein [Ostreococcus lucimarinus CCE9901]
	43.5	43.5	19%	0.039	38%	Gene info
YP_048989.1	
putative ABC transporter ATP-binding protein [Pectobacterium atrosepticum SCRI1043] >emb|CAG73792.1| putative ABC transporter ATP-binding protein [Pectobacterium atrosepticum SCRI1043]
	43.5	43.5	36%	0.039	32%	Gene info
1II8_B	
Chain B, Crystal Structure Of The P. Furiosus Rad50 Atpase Domain
	43.5	43.5	27%	0.039	30%	Related structures
NP_578896.1	
chromosome segregation protein [Pyrococcus furiosus DSM 3638] >sp|P58301.1|RAD50_PYRFU RecName: Full=DNA double-strand break repair rad50 ATPase >gb|AAL81291.1| smc-like protein [Pyrococcus furiosus DSM 3638]
	43.5	43.5	27%	0.039	30%	Gene info
1F2T_B	
Chain B, Crystal Structure Of Atp-Free Rad50 Abc-Atpase >pdb|1F2U|B Chain B, Crystal Structure Of Rad50 Abc-Atpase >pdb|1F2U|D Chain D, Crystal Structure Of Rad50 Abc-Atpase
	43.5	43.5	27%	0.039	30%	Related structures
ADD79549.1	
FeS assembly ATPase SufC [Candidatus Riesia pediculicola USDA]
	43.1	43.1	21%	0.051	31%	
YP_001655825.1	
exonuclease SbcC-like protein [Microcystis aeruginosa NIES-843] >dbj|BAG00633.1| exonuclease SbcC homolog [Microcystis aeruginosa NIES-843]
	43.1	43.1	27%	0.051	28%	Gene info
CAO90893.1	
unnamed protein product [Microcystis aeruginosa PCC 7806]
	43.1	43.1	27%	0.051	28%	
YP_001275264.1	
SMC domain-containing protein [Roseiflexus sp. RS-1] >gb|ABQ89314.1| SMC domain protein [Roseiflexus sp. RS-1]
	43.1	43.1	31%	0.051	28%	Gene info
YP_001434143.1	
SMC domain-containing protein [Roseiflexus castenholzii DSM 13941] >gb|ABU60125.1| SMC domain protein [Roseiflexus castenholzii DSM 13941]
	42.7	42.7	30%	0.066	26%	Gene info
YP_760618.1	
chromosome segregation protein SMC [Hyphomonas neptunium ATCC 15444] >gb|ABI77480.1| chromosome segregation protein SMC [Hyphomonas neptunium ATCC 15444]
	42.7	42.7	25%	0.066	30%	Gene info
YP_183430.1	
chromosome segregation ATPase [Thermococcus kodakarensis KOD1] >dbj|BAD85206.1| chromosome segregation ATPase [Thermococcus kodakarensis KOD1]
	42.7	42.7	27%	0.066	30%	Gene info

>ref|YP_002922108.1| Gene info recombination endonuclease subunit [Enterobacteria phage JSE]
 gb|ACL77985.1| Gene info recombination endonuclease subunit [Enterobacteria phage JSE]
Length=560

 GENE ID: 7943156 EpJSE_00036 | recombination endonuclease subunit
[Enterobacteria phage JSE]

 Score = 68.9 bits (167),  Expect = 9e-10
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 14/149 (9%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMD------TFGLDVKVNLTDSLSVESNMWGYEFESGGERK  786
            +K+ + K+++P+ N R+ +Y+D       F LD + N T   S     + Y   S GE+ 
Sbjct  416  VKASIVKKYIPYFNDRIAYYLDIMEADYIFTLDEEFNETIK-SRGRESFSYTSFSQGEKA  474

Query  785  RTDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINII-KNDLASRVETVL  612
            R D+A +    D   ++ G   ++LVLDE+ DG  D  G+++L +II K D     + V 
Sbjct  475  RIDLAMLFTWRDVAGKVSGTNISLLVLDEIYDGATDVQGVKALDSIIDKLD-----DNVY  529

Query  611  IISHRNLMFDTFPRELRVTRRDRQSKLEV  525
            IISHR+   D F R L++ +R R +++ V
Sbjct  530  IISHRDHNPDDFSRHLKMVKRGRFTEMNV  558


>ref|YP_001469378.1| Gene info endonuclease subunit [Enterobacteria phage Phi1]
 gb|ABR24544.1| Gene info gp46 recombination endonuclease subunit [Enterobacteria phage 
Phi1]
Length=560

 GENE ID: 5602140 46 | endonuclease subunit [Enterobacteria phage Phi1]

 Score = 68.9 bits (167),  Expect = 9e-10
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 14/149 (9%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMD------TFGLDVKVNLTDSLSVESNMWGYEFESGGERK  786
            +K+ + K+++P+ N R+ +Y+D       F LD + N T   S     + Y   S GE+ 
Sbjct  416  VKASIVKKYIPYFNDRIAYYLDIMEADYIFTLDEEFNETIK-SRGRESFSYTSFSQGEKA  474

Query  785  RTDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINII-KNDLASRVETVL  612
            R D+A +    D   ++ G   ++LVLDE+ DG  D  G+++L +II K D     + V 
Sbjct  475  RIDLAMLFTWRDVAGKVSGTNISLLVLDEIYDGATDVQGVKALDSIIDKLD-----DNVY  529

Query  611  IISHRNLMFDTFPRELRVTRRDRQSKLEV  525
            IISHR+   D F R L++ +R R +++ V
Sbjct  530  IISHRDHNPDDFSRHLKMVKRGRFTEMNV  558


>ref|NP_891605.1| Gene info recombination endonuclease subunit [Enterobacteria phage RB49]
 gb|AAL87829.2|AF410869_1 Gene info recombination endonuclease subunit [Enterobacteria phage RB49]
Length=560

 GENE ID: 1725534 46 | Gp46 [Enterobacteria phage RB49]
(10 or fewer PubMed links)

 Score = 68.9 bits (167),  Expect = 9e-10
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 14/149 (9%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMD------TFGLDVKVNLTDSLSVESNMWGYEFESGGERK  786
            +K+ + K+++P+ N R+ +Y+D       F LD + N T   S     + Y   S GE+ 
Sbjct  416  VKASIVKKYIPYFNDRIAYYLDIMEADYIFTLDEEFNETIK-SRGRESFSYTSFSQGEKA  474

Query  785  RTDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINII-KNDLASRVETVL  612
            R D+A +    D   ++ G   ++LVLDE+ DG  D  G+++L +II K D     + V 
Sbjct  475  RIDLAMLFTWRDVAGKVSGTNISLLVLDEIYDGATDVQGVKALDSIIDKLD-----DNVY  529

Query  611  IISHRNLMFDTFPRELRVTRRDRQSKLEV  525
            IISHR+   D F R L++ +R R +++ V
Sbjct  530  IISHRDHNPDDFSRHLKMVKRGRFTEMNV  558


>ref|YP_656279.1| Gene info gp46 recombination protein subunit [Aeromonas phage 25]
 gb|ABF72603.1| Gene info gp46 recombination protein subunit [Aeromonas phage 25]
Length=570

 GENE ID: 4156415 46 | recombination protein and nuclease subunit; gp46/gp47
subunit required for recombination and host DNA degradation [Aeromonas phage 25]
(10 or fewer PubMed links)

 Score = 67.8 bits (164),  Expect = 2e-09
 Identities = 46/143 (32%), Positives = 69/143 (48%), Gaps = 10/143 (6%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSL-----SVESNMWGYEFESGGERKR  783
            IK+ +   ++P+ N+R+ HY+D    D    L         S   + + Y   S GE+ R
Sbjct  422  IKAVIMARYIPYFNNRISHYLDIMDADFGFTLDSEFKEVIKSSGRSTFSYNSFSQGEKAR  481

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             D+A M A  D   ++ G   N L +DEV DG  DDD   S+ +II+N  A+    V II
Sbjct  482  IDMAVMFAWRDLASEVSGVDVNALFMDEVFDGPSDDDAQRSVFSIIENMKAN----VFII  537

Query  605  SHRNLMFDTFPRELRVTRRDRQS  537
            SH       F R + +++  R S
Sbjct  538  SHGEHDPQKFDRHIVMSKLGRTS  560


>ref|YP_164705.1| Gene info hypothetical protein LP65_gp070 [Lactobacillus phage LP65]
 gb|AAV35890.1| Gene info orf70 [Lactobacillus phage LP65]
Length=638

 GENE ID: 3197352 LP65_gp070 | hypothetical protein [Lactobacillus phage LP65]
(10 or fewer PubMed links)

 Score = 64.3 bits (155),  Expect = 2e-08
 Identities = 42/156 (26%), Positives = 81/156 (51%), Gaps = 19/156 (12%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTF---GLDVKV---------NLTDSLSV----ESNMWG  816
            IKS+V ++  P IN  L+ YM       +   +         N++D +++    ++    
Sbjct  486  IKSFVLEQVYPAINESLEKYMSVLTDGSISATISAVTENKSGNVSDKINIKVFRDAESTD  545

Query  815  YEFESGGERKRTDVAFMLAMFDFHEQMYGRQCNVLVLDEVDGRMDDDGIESLINIIKNDL  636
            Y+  S GE++R DVA  L++ D+     G   NVL LDE+   +D  G++ ++ ++K + 
Sbjct  546  YDSLSSGEQRRFDVALSLSLQDYVSSNSG--INVLFLDEIFDSLDAVGVDKVMTLLK-EK  602

Query  635  ASRVETVLIISHRNLMFDTFPRELRVTRRDRQSKLE  528
            + +  +V +ISH   + D F  E++V + +  +K+E
Sbjct  603  SKQYSSVFVISHSTELKDNFDNEIKVVKTEAGTKIE  638


>ref|NP_932398.1| Gene info gp46 [Aeromonas phage 44RR2.8t]
 ref|YP_238771.1| Gene info gp46 [Aeromonas phage 31]
 gb|AAQ81362.1| Gene info recombination endonuclease subunit [Aeromonas phage 44RR2.8t]
 gb|AAX63531.1| Gene info gp46 [Aeromonas phage 31]
Length=570

 GENE ID: 2610606 46 | gp46 [Aeromonas phage 44RR2.8t]

 Score = 63.9 bits (154),  Expect = 3e-08
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 10/146 (6%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDT----FGLDVKVNLTDSL-SVESNMWGYEFESGGERKR  783
            IK+ +   ++P+ N+R+ HY++     FG  +     + + S   + + Y   S GE+ R
Sbjct  422  IKAVIMARYIPYFNNRIAHYLEIMEADFGFTLDAEFKEVIKSAGRSTFSYNSFSQGEKAR  481

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             D+A M A  D   ++ G   N L +DEV DG  D D   ++ +II    A+    VLII
Sbjct  482  IDMAVMFAWRDLASEVSGVDVNALFMDEVFDGPSDTDAQGAVFSIIDKMKAN----VLII  537

Query  605  SHRNLMFDTFPRELRVTRRDRQSKLE  528
            SH +     F R +++++  R S +E
Sbjct  538  SHGDHDPQNFDRHVKMSKLGRTSVME  563


>gb|AAR90909.1|  gp46 recombination endonuclease subunit [Aeromonas phage 65]
Length=775

 Score = 62.4 bits (150),  Expect = 8e-08
 Identities = 42/147 (28%), Positives = 78/147 (53%), Gaps = 11/147 (7%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSL--SVES---NMWGYEFESGGERKR  783
            IK  + K ++P  NS++  Y+   G D   +L +S   S++S   + + Y   S GE+ R
Sbjct  631  IKGEIVKRYIPIFNSKINEYLSITGADYVFSLNESFEESIKSRGRDEFTYMSFSQGEKAR  690

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             ++A +         + G   ++L+LDE+ DG MD DG+ + +N + N++        II
Sbjct  691  INIALLFTWRYIASMVSGTNISMLILDEIFDGGMDSDGVYA-VNRLLNEIGG---NTFII  746

Query  605  SHR-NLMFDTFPRELRVTRRDRQSKLE  528
            SHR     D+F   +++T++ R +++E
Sbjct  747  SHRVENRDDSFTSHIKMTKKGRFTEME  773


>ref|NP_861753.1| Gene info endonuclease subunit [Enterobacteria phage RB69]
 sp|O64299.2|EXO2_BPR69 Gene info RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46
 gb|AAP75965.1| Gene info gp46 recombination endonuclease subunit [Enterobacteria phage 
RB69]
Length=562

 GENE ID: 1494179 46 | gp46 subunit required for recombination and host-DNA
degradation [Enterobacteria phage RB69] (10 or fewer PubMed links)

 Score = 61.2 bits (147),  Expect = 2e-07
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 9/147 (6%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSL--SVESN---MWGYEFESGGERKR  783
            IK  + K++VP  N ++ HY+     D   ++ +    S++S     + Y   S GE+ R
Sbjct  418  IKGAIIKKYVPLFNKQINHYLKIMEADYVFSIDEEFNESIKSRGREEFSYASFSQGEKAR  477

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             D+A +    D  E++ G + N L++DEV D   D +GI++ I+ I N L      V II
Sbjct  478  IDIALLFTWRDIAEKVSGVRINTLIMDEVMDSATDSEGIKA-ISTILNSLTD--ANVFII  534

Query  605  SHRNLMFDTFPRELRVTRRDRQSKLEV  525
            SHR+     + + L++++  R + + V
Sbjct  535  SHRDHDPQAYGQHLQMSKVGRFTVMTV  561


>ref|YP_239031.1| Gene info gp46 recombination endonuclease subunit [Enterobacteria phage 
RB43]
 gb|AAX78577.1| Gene info gp46 recombination endonuclease subunit [Enterobacteria phage 
RB43]
Length=567

 GENE ID: 3416123 46 | endonuclease subunit [Enterobacteria phage RB43]

 Score = 61.2 bits (147),  Expect = 2e-07
 Identities = 41/144 (28%), Positives = 77/144 (53%), Gaps = 10/144 (6%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSL-----SVESNMWGYEFESGGERKR  783
            +K+ + K ++P+ N ++ +Y++  G D +  L D       S+  + + Y   S GER R
Sbjct  418  VKASIVKRYIPYFNKQIAYYLNLLGADYQFTLDDEFNESIKSLGRDDFSYASFSQGERAR  477

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             +++ +    D   ++ G   ++LVLDEV DG +D +G  +    IK+ L S    V++I
Sbjct  478  INLSILFTWRDVTSKVSGVDLSLLVLDEVFDGPLDKEGSFA----IKSLLDSVDGNVIVI  533

Query  605  SHRNLMFDTFPRELRVTRRDRQSK  534
            SH++L    F R + +++  R +K
Sbjct  534  SHQDLDPQDFDRHIIMSKVGRFTK  557


>gb|AAC39308.1|  DNase subunit [Enterobacteria phage RB69]
Length=558

 Score = 61.2 bits (147),  Expect = 2e-07
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 9/147 (6%)
 Frame = -1

Query  947  IKSYVFKEHVPFINSRLKHYMDTFGLDVKVNLTDSL--SVESN---MWGYEFESGGERKR  783
            IK  + K++VP  N ++ HY+     D   ++ +    S++S     + Y   S GE+ R
Sbjct  414  IKGAIIKKYVPLFNKQINHYLKIMEADYVFSIDEEFNESIKSRGREEFSYASFSQGEKAR  473

Query  782  TDVAFMLAMFDFHEQMYGRQCNVLVLDEV-DGRMDDDGIESLINIIKNDLASRVETVLII  606
             D+A +    D  E++ G + N L++DEV D   D +GI++ I+ I N L      V II
Sbjct  474  IDIALLFTWRDIAEKVSGVRINTLIMDEVMDSATDSEGIKA-ISTILNSLTD--ANVFII  530

Query  605  SHRNLMFDTFPRELRVTRRDRQSKLEV  525
            SHR+     + + L++++  R + + V