GOS 1239010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574889
Annotathon code: GOS_1239010
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2010
Username : christhea
Annotated on : 2010-06-03 19:29:25
  • bressuire christelle
  • deschamps anthéa

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_1093025574889 GOS_1239010 Genomic DNA
GTAAGGAACTCAGCGTGCGAGTTGAAAGAGCTTATAACGAAGAGATAATTGATGAGGGAATTTTCAAACTTATGGGAGAAACCGGATTGCTAGGGTGTAC
AATACCAGAGGAATTTGGTGGATTAGGAGCTAATTATGTAACGTATGGTTTAATTACAAGAGAAATAGAAAAGGTGGATTCAGGCTACAGATCCATGATG
TCAGTTCAATCATCTCTTGTTATGTATCCAATATCGAAATTTGGATCCCAAGAACAAAAAGAAAAATATCTACCAAAATTGGCATCTGGTGAAAGTATCG
GGTGCTTTGGACTTACTGAAGCAAACTCCGGTTCTGATCCGGCTTCAATGACGACAAAAGCAAAAAAAGTAAATGGTGGATTTGAACTGAATGGTTCAAA
AATGTGGATTTCAAATGCTCCTATAGCTGATGTTTTTGTCATTTGGGCAAAGTCGGAATTTCATGAAAATAAAATAAAAGGCTTCATATTAGAAAAAAAT
TTTAAGGGACTAGAAACAAAAAAAATTCCCGGGAAATTGAGTTTACGCGCCTCTGTCACCGGTGAAATAAGTTTTAACAACGTTTTTGTTCCTGAAGAAA
ATATTTTGGAGGATGTTGAAGGCTTGAAAGGTCCCTTCAGTTGTTTAAATATGGCGAGATATGGAATAGCTTGGGGAGCGATGGGAGCTGCAGAGTTTTG
TTGGCACGCAGCCAGAGATTATGGTCTGTCGAGAAAACAATTTAACAAGCCTTTAGCGGGAACTCAACTATTTCAAAAAAAGTTAGCCGATATGCAGACC
GAGATCAGTTTAGGTATTCAAGGTGCGCTCAGGCTAGGTAGACTAATAGATGAAGGTCGCGGTGCCCCGGAAGCAATTAGCCTGATGAAAAGAAATAACT
GTGG

Translation

[3 - 902/904]   direct strand
>GOS_1239010 Translation [3-902   direct strand]
KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSGYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIG
CFGLTEANSGSDPASMTTKAKKVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLSLRASVTGEISFNNVFVPEEN
ILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYGLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

La séquence que nous avons annotée provient de l’environnement marin de la Polynésie française.

Nous nous sommes interrogés sur la fonction codée par l’ORF à analyser et sur la nature de l’organisme de notre séquence d’ADN.


L'obtention d' un ORF très long possédant des homologues par Blast nous permet de conclure que notre séquence est codante. Cependant notre séquence semblent être incomplète d'une part car aucun codon start/stop sont visibles, d'une autre part car nos domaine protéiques les plus probables sont également incomplet en N et C term mais aussi car notre analyse d' alignement multiple montre une séquence plus courte que celle de ses homologues.



A partir des arbres construits nous avons pu conclure que notre séquence proviendrait d'une protéobactéries. De plus, nos arbres révèlent une incohérence car ils ne correspondent pas à la phylogénie de référence. L'hypothèse pour expliquer cela serait qu'en effet notre séquence est peut être d'origine protéobactérienne mais elle a des homologues chez des séquences mitochondriales eucaryotes et les archaes. Ces homologues seraient obtenu par transferts horizontaux. Cette hypothèse explique l'arbre flou obtenu dans l'hypothèse 3.


Dans InterPro, lors de la recherche de domaines, nous avons pu déduire le processus biologique putatif de la protéine codé par notre séquence: process metabolic mais aussi la fonction : Acyl CoA déshydrogénase.




ORF finding

PROTOCOLE:


a) SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

b) SMS ORFinder / indirect strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code




ANALYSE DES RÉSULTATS:


On obtient 2 ORF putatifs:

- un ORF dans le cadre de lecture 3 en sens direct de la base 3 a 902

- un ORF dans le cadre de lecture 1 en sens indirect de la base 187 a 444

Il n' y a pas d' ORF putatif dans tous les autres cadres de lecture en sens indirect et direct.



L' ORF dans le cadre de lecture 1 en sens indirect est de 257 nucleotides ce qui rend l' ORF interessant et ne permet pas forcement de l'eliminer d'office. Cependant si on fait un Blastp vs NR avec cette sequence on obtient le message d'erreur suivant: "No significant similarity found", ce qui est un argument pour ne pas considerer cette ORF.


On observe que l'ORF détecté en sens direct dans le cadre de lecture 3 est le plus grand : 899 nucléotides.

Donc, on travaillera avec l'ORF détecté en sens direct sur le cadre de lecture 3 .


En effet on peut supposer que l'ORF le plus long sans codon stop correspond à une séquence codante mais ceci reste a verifier par la recherche d'homologue avec blast.

Il est à noter que la traduction de cette séquence ne fait pas apparaître de codon d'initiation (Méthionine) ni de codon stop elle est donc incomplete en 5' et 3', on peut émettre l'hypothèse que la protéine est plus grande et que nous nous situons au milieu de la sequence de celle ci.

Par consequent il n'est pas judicieux de calculer le poids moléculaire de notre séquence.

RÉSULTATS BRUTS:

a) direct strand

ORF Finder results
Results for 904 residue sequence "GOS_1239010 ADN génomique (Tropical South Pacific: 600 miles
from F. Polynesia)" starting "GTAAGGAACT"

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 902.
AAGGAACTCAGCGTGCGAGTTGAAAGAGCTTATAACGAAGAGATAATTGATGAGGGAATT
TTCAAACTTATGGGAGAAACCGGATTGCTAGGGTGTACAATACCAGAGGAATTTGGTGGA
TTAGGAGCTAATTATGTAACGTATGGTTTAATTACAAGAGAAATAGAAAAGGTGGATTCA
GGCTACAGATCCATGATGTCAGTTCAATCATCTCTTGTTATGTATCCAATATCGAAATTT
GGATCCCAAGAACAAAAAGAAAAATATCTACCAAAATTGGCATCTGGTGAAAGTATCGGG
TGCTTTGGACTTACTGAAGCAAACTCCGGTTCTGATCCGGCTTCAATGACGACAAAAGCA
AAAAAAGTAAATGGTGGATTTGAACTGAATGGTTCAAAAATGTGGATTTCAAATGCTCCT
ATAGCTGATGTTTTTGTCATTTGGGCAAAGTCGGAATTTCATGAAAATAAAATAAAAGGC
TTCATATTAGAAAAAAATTTTAAGGGACTAGAAACAAAAAAAATTCCCGGGAAATTGAGT
TTACGCGCCTCTGTCACCGGTGAAATAAGTTTTAACAACGTTTTTGTTCCTGAAGAAAAT
ATTTTGGAGGATGTTGAAGGCTTGAAAGGTCCCTTCAGTTGTTTAAATATGGCGAGATAT
GGAATAGCTTGGGGAGCGATGGGAGCTGCAGAGTTTTGTTGGCACGCAGCCAGAGATTAT
GGTCTGTCGAGAAAACAATTTAACAAGCCTTTAGCGGGAACTCAACTATTTCAAAAAAAG
TTAGCCGATATGCAGACCGAGATCAGTTTAGGTATTCAAGGTGCGCTCAGGCTAGGTAGA
CTAATAGATGAAGGTCGCGGTGCCCCGGAAGCAATTAGCCTGATGAAAAGAAATAACTGT


>Translation of ORF number 1 in reading frame 3 on the direct strand.
KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDS
GYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA
KKVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLS
LRASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDY
GLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC


b) indirect strand

ORF Finder results
Results for 904 residue sequence "GOS_1239010 ADN génomique (Tropical South Pacific: 600 miles 
from F. Polynesia)" starting "GTAAGGAACT"

>ORF number 1 in reading frame 1 on the reverse strand extends from base 187 to base 444.
TCTCTGGCTGCGTGCCAACAAAACTCTGCAGCTCCCATCGCTCCCCAAGCTATTCCATAT
CTCGCCATATTTAAACAACTGAAGGGACCTTTCAAGCCTTCAACATCCTCCAAAATATTT
TCTTCAGGAACAAAAACGTTGTTAAAACTTATTTCACCGGTGACAGAGGCGCGTAAACTC
AATTTCCCGGGAATTTTTTTTGTTTCTAGTCCCTTAAAATTTTTTTCTAATATGAAGCCT
TTTATTTTATTTTCATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SLAACQQNSAAPIAPQAIPYLAIFKQLKGPFKPSTSSKIFSSGTKTLLKLISPVTEARKL
NFPGIFFVSSPLKFFSNMKPFILFS*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 445 to base 699.
AATTCCGACTTTGCCCAAATGACAAAAACATCAGCTATAGGAGCATTTGAAATCCACATT
TTTGAACCATTCAGTTCAAATCCACCATTTACTTTTTTTGCTTTTGTCGTCATTGAAGCC
GGATCAGAACCGGAGTTTGCTTCAGTAAGTCCAAAGCACCCGATACTTTCACCAGATGCC
AATTTTGGTAGATATTTTTCTTTTTGTTCTTGGGATCCAAATTTCGATATTGGATACATA
ACAAGAGATGATTGA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
NSDFAQMTKTSAIGAFEIHIFEPFSSNPPFTFFAFVVIEAGSEPEFASVSPKHPILSPDA
NFGRYFSFCSWDPNFDIGYITRDD*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:


Hyphothèse 1 : La protéine codée par notre séquence est homologue à une (ou plusieurs) séquence mitochondriale eucaryote: "a-proteobacteria" et "eucaryotes" vs "b-proteobacteria" et "g-proteobacteria"


a) CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Hypothèse 2 : La protéine n'est pas homologue à une (ou plusieurs) protéine mitochondriale eucaryote. Donc notre groupe d'étude n'inclus pas les Eucaryotes: "proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria" vs "others bacteria" : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria"


b) CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Hypothèse 3 :La protéine codée par notre séquence a des homologues dans différents groupes phylogénétiques ceci est peut être du à des transferts horizontaux intervenu lors de l'évolution des espèces : "proteobacteria","others bacteria", "eucaryotes","archaea"


c)CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment




ANALYSE DES RÉSULTATS:



D'après la recherche d'ORF, notre séquence ne possède pas de codon d'initiation et de codon stop. Nous en avions déduit que la séquence nucléotidique devait être incomplète, donc notre protéine devrait être incomplète en N-terminale et C-terminale comme nous l'avons signalé dans l'analyse du BLAST.

Pour nos trois hypothèses, les 2 alignements multiples obtenus par MUSCLE, on observe que notre protéine est plus courte d'environ 40 à 80 acides aminées en N-terminale en comparaison aux autres séquences. En C-terminale, on voit que notre séquence protéique est aussi plus courte que les autres séquences des banques de données d'environ 60 acides aminés .

Cela confirme l'hypothèse émise lors de la Recherche d'ORF selon laquelle notre séquence est incomplète et que nous n'avons pas le codon stop. Les séquences des banques se terminent à plus de 50 acides aminées


Dans l'hypothése 1 il y àa253 résidus gardés Par Gblocks sur 638 soit 40% environ. Ceci montre une très bonne similarité entre notre séquence et celle de banques de données car il faut au minimum 70 résidus sur 75.

Mis à part le fait que les autres séquences commencent beaucoup plus tôt que la nôtre, nous avons à partir de l'acide aminés 90 de l'alignement en moyenne toute une région jusqu'à l'acide aminés 240 ou les similarites sont très importantes.


Dans l'hypothese 2 il y a 282 résidus gardés par Gblocks sur 673 soit 41% environ. De la même facon on observe de très bonne similarité entre les séquences.

Pareillement les séquences débutent plus tôt que la nôtre, à partir de l'acide aminés 60 de l'alignement en moyenne jusqu'au 240 ème on observe une région avec des acides aminés très similaire avec quand même quelques variations.


Dans l'hypothèse 3 il y a 733 résidus gardés par Gblocks sur soit environ. ce qui illustre une bonne similarité avec les autres séquences.

Malgrès le fait que notre séquence est incomplète en 5' et 3' de 40 acides aminés en début et 120 a la fin on observe des régions très similaire.


En vue de ces résultats nous pouvons supposer que notre arbre phylogenetique présentera des organismes très proches les uns des autres.

RÉSULTATS BRUTS:

Hyphothèse 1  : La protéine codée par notre séquence est homologue à une (ou plusieurs) séquence mitochondriale eucaryote: 
"a-proteobacteria" et "eucaryotes" vs "b-proteobacteria" et "g-proteobacteria"

a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur : "b-proteobacteria" et "g-proteobacteria" _ alignement multiple 

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

gi|2123088      ------------------------------------------------------------
gi|2385060      ------------------------------------------------------------
gi|2388457      ------------------------------------------------------------
gi|2262793      ------------------------------------------------------------
gi|2611989      ------------------------------------------------------------
gi|1341138      ------------------------------------------------------------
gi|2840951      ------------------------------------------------------------
gi|1992083      ------------------------------------------------------------
gi|1675241      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|2095462      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|1496355      MQVSTLLPSPRPPRFSLDFLPPSTFNEGTIKPLTRPRSLAGGKGVLARNRWPVGEWQIYE
gi|1497568      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1637500      ------------------------------------------------------------
gi|1542486      ------------------------------------------------------------
gi|8905530      ------------------------------------------------------------
gi|2350196      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|1106810      ------------------------------------------------------------
gi|1492025      ------------------------------------------------------------
gi|2552635      ------------------------------------------------------------
                                                                            

gi|2123088      ---------------------------------------------MPVRPDDLFDVRAQL
gi|2385060      MNRSLLRAASRRLQSASHVHNAPTA----------SLNASVRGFATAFNWEDPLAASELY
gi|2388457      MNPALRSVPRAALRAARRPSG--------------VAGQRHAHSASSFRWQDPLYAENLY
gi|2262793      MHPLAIRRACCSLRAVKRPISA-------------NLGRRYAHASAGFNWEDPLAASNLY
gi|2611989      MNPFTVRHAFRRLHAANHFVSN-------------NIPRRYAHSTATFNWQDPLGTTNLY
gi|1341138      --MTAARSISPLLRKVTPSAGIVIA----------KRGMASTSKFAKYNWEDPLNMNSLL
gi|2840951      MLSSARKVITKNSNKSGLASLISNNSRCFS-----TNATQHKEVMVSFNWKDPLNVESLL
gi|1992083      ---MIAQSVISKLRPCARR----------------LASTSSKAAAPKFNWQDPLNLESQL
gi|1675241      MAAALTARQLVLRATSRR-----------------ALSSAAPLQARRMDWQDPFELDSQL
gi|8385914      --------------------------------------MAAKETGLSFSWEDPLHLQQQL
gi|2269418      -------------------------------------MTHAGAGSSRFVWEDPLQLEQQL
gi|2095462      ----------------------------------------MQHTREVFDWADPFRLAEQL
gi|1841569      -------------------------------------MVTTKKAKVQFNWQDPFLIEQQL
gi|7745634      -----------------------------------------MGGKASFNWIDPLLLDQQL
gi|1455890      ------------------------------------------MSKASFNWADPLLLDTQL
GOS_123901      ------------------------------------------------------------
gi|1496355      RGDAILATPLPAGPSRLRGVGPCYFS---------AASHSAESSKTQFDWRDSLLLEEQL
gi|1497568      MALRGVSVRLLSRRPGLRALRAWGSAAAQTEKGGKTQSRPAKSSRPEFDWRDPLVLEEQL
gi|8331233      --------------------------------------------MQHFKWDDPFLLEDQL
gi|1637500      ------------------------------------------MARVHFDWTDPLQFNALL
gi|1542486      ---------------------------------------MAAATKPVFDWTDPFDLNGQL
gi|8905530      ------------MPD--------------------GQTRHTGPSLAPFDWADPFHLADQL
gi|2350196      ------------------------------------------MSRAAFAWEDPFLLEEQL
gi|2209212      ---MTAASAAPQTSP--------------------SAARPQEGSRGAFRWDDPFLLEDQL
gi|1106810      ---------MNVETP--------------------ILKAKDAPDLAGFDWSDPFRLAEQL
gi|1492025      ---------MNANTP--------------------TLRAKDAPDLNSFDWADPFRLNDQL
gi|2552635      ---------MNANTS--------------------ILSPKDAPDLGRFDWQDAFRLDDQL
                                                                            

gi|2123088      SDDERAVQDAVARFTDTRVLPGIGEAFDAARFPRELVPELASLGLLGASLPVSEGGAGLG
gi|2385060      TEEELAIQDTARQYCQERLLPRVLDAYRNENYDRKILEEMGELGLLGASI-EGYGCAGAS
gi|2388457      TADELAIQDTARRYCQERLMPRVLDAYRNEDYDPAILREMGSLGLLGATI-DGYGCAGVS
gi|2262793      TEDELAIQDTARQYCQEQLAPRILEAYRNENYDKKIIREMGELGLLGATI-EGYGCAGVS
gi|2611989      TEDELAIQDTARQYCQERLAPRILEAYRNENYDKEIIREMGELGLLGATI-DGYGCAGVS
gi|1341138      SEEELAIHETAKSFSQAQLLPRVTEAYRTENFDPAILREMGELGLLGATI-QGYGCAGVS
gi|2840951      TEEEKEIRDQVHGYCQAKLMPRVLEANRKEHFDPEIMREMGEMGMLGINI-HGHGCAGAS
gi|1992083      TEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKKIMEEIGSLGVLGCTI-KGYGCAGVS
gi|1675241      TSEELMAKNTAREYCEASLQPRIIEAYRTETFDRSIMNEFGELGMLGSTI-DGYGCPGMS
gi|8385914      SEEERMIADSARSYCREKLLPRVVDAYREESFDRNIMTEMGEMGLLGATVAEEYGGAGLS
gi|2269418      TDEERLIRDSARSFCQARLAPRAREAFRHEQFDRDIMREMGEQGLLGCTL-NDWGCAGVS
gi|2095462      TDEERMVQNTAHAYAQEKLAPRVLDAFRNEKTDPAIFREMGELGLLGPTISPDYGGAGLG
gi|1841569      SPDERMIRDAAHAYCQERLQPRVLEQFRHETTDPSIFREMGELGLLGPTIPEQYGGAGLN
gi|7745634      TEEERMIRDTAEQFAQQSLAPRVLEAFRHEKTDPAIFREMGEVGLLGATIPEQYGGSGLN
gi|1455890      SEEERMIRDAAAEYAQGRLMPRIQEAYRNETTDPAIFREMGELGLLGVTIPEQYGGSNLN
GOS_123901      ----------------KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGAN
gi|1496355      TQDEIMIRDSFRTYCQEKLMPRILMANRNEVFHREMVTEMGELGVLGPTI-KGYGCAGTS
gi|1497568      TADEIAIRDTFRTYCQERLMPRILLANRNEVFHREIILEMGELGVLGPTI-KGHGCAGVS
gi|8331233      SEDEKLIRDSAHAYCQEKLQPRVMKAFRDETFDREIMNEMGEMGLLGPTIPEEYGGPGVN
gi|1637500      SEEERMIRDSVHDYAQDKLMPRVLMANRNEHFDREIMNELGELGLLGATLPEKYACSNIN
gi|1542486      TEDERLVRDTARDYAQEKLLPRVTSAYLEERFDREIMNEMGELGLLGPTIPAEYGGAGLG
gi|8905530      SDEERMIAESARAYAQDKLLPRVTDAYLEEHVTPDVFAEMGEMGLLGITIPEHLGGLGAG
gi|2350196      TEDERMIRDSAKAFASDVLLPRVEKAYLEETTDPELFHLMGQAGLLGVTLPEDYGAANAS
gi|2209212      TDEERLIRDTARSFAVERLLPGIVEAYAEEKTDRNLFNAMGELGLLGVTLPEEYGCAGAS
gi|1106810      HEDERMIQESAKAYAQEKLQPRVIDAYENEAVAPEIFKEMGDMGLLGITLPEEYGGLGGS
gi|1492025      SEEERMIAASARTFAQEVLQPRVIAAYREERVDPDIFKEMGQMGLLGTTIPEEYGGLGAN
gi|2552635      TEDERMLRDAAGEFAQSELQPGVTAAYRDEVTAPGLFKQMGDAGLLGSTIPETYGGLGAN
                                  :                :.  :.. *:** .:    .  . .

gi|2123088      AVAYGLICQELERGDSGLRSFVSVQSSLCMYPIHAYGSDAQRRQWLPEMAAGRVIGCFGL
gi|2385060      TVASGLITKEVERVDSGYRSGMSVQSSLAMTAIYEFGSQELKDRFLPGLAKGKIAGCFGL
gi|2388457      TVASGLITKEVERVDSGFRSGMSVQSSLIMTGIYEFGSEELKERLLPQLAQGKLLGCFGL
gi|2262793      TVASGLITKEVERIDSGYRSGMSVQSSLIMTGIYEFGTQEQKDKYLPELAKGKKLGCFGL
gi|2611989      TVASGLITKEVERVDSGYRSGMSVQSSLIMTGIYKFGTQAQKDKYLPDLAKGKKLGCFGL
gi|1341138      SVSYGLIAREIERVDSGYRSAMSVQSSLVMHPINEFGSDAQKDKYLPQLATGEIIGCFGL
gi|2840951      NVAYGLVAREVERVDSGYRSAMSVQSSLVMHPINQWGNEAQKQKYLPKLATGELIGCFGL
gi|1992083      SVAYGLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGL
gi|1675241      YVAYGLLAREVERVDSAYRSAMSVQSSLVMYPIHAYGTEAHKEKYLPRLATGELVGAFGL
gi|8385914      HVAYGLIAREVEAIDSGYRSAMSVQSSLVMYPIEAFGTEEQKHKYLPKLASGEYVGCFGL
gi|2269418      HVAYGLVAREVERVDSGYRSAMSVQSSLVMYPIATYGSPEQQARWLPGLARGELVGCFGL
gi|2095462      YTAYGLIAREVERVDSGYRSMMSVQSSLVMVPIDTFGSEAQKLKYLPKLATGEWIGCFGL
gi|1841569      YVSYGLVAREIEYVDSGYRSMASVQSSLVMVPIHEFGTEEQKQKYLPKLATGEYIGCFGL
gi|7745634      YVSYGLIAREVERVDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGL
gi|1455890      YVSYGLIAREIERVDSGYRSMMSVQSSLVMVPINDFGTEAQKQKYLPKLASGEWIGCFGL
GOS_123901      YVTYGLITREIEKVDSGYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGL
gi|1496355      SVAYGLLTRELERVDSGFRSVMSVQSSLVMHPIHAYGTEEQKQKYLPRLATGELLGCFGL
gi|1497568      SVAYGLLARELERVDSGYRSAMSVQSSLVMYPIYAYGSEEQQQKYLPRLAKGELLGCFGL
gi|8331233      HVAYGLISREVERVDSGYRSAMSVQSSLVMHPIFSYGTEEQKKKYLPRLATGEIIGCFGL
gi|1637500      YVSYGLVAREIERVDSGYRSAMSVQSSLVMYPIYAYGSEEQRLKYLPKLAKGEWIGCFGL
gi|1542486      YVSYGLAAREVERVDSGYRSAMSVQSSLVMHPIYAYGTEAQRQKYLPKLATGEWIGCFGL
gi|8905530      YVSYGLVAREVERVDSGYRSMMSVQSSLVMYPINAYGSDEQRQKYLPGLAAGTKIGCFGL
gi|2350196      YVAYGLVAREVERIDSGYRSMMSVQSSLVMYPIYAYGSDEQRKKYLPGLVSGELIGCFGL
gi|2209212      YVAYGLVAREVERVDSGYRSMMSVQSSLVMYPIYAYGDETQRKTYLPGLASGELVGCFGL
gi|1106810      YVAYGLVAREIERVDSGYRSMMSVQSSLVIYPIYAYGTEAQRQKYLPKLCSGESIGCFGL
gi|1492025      YVTYGLVAREIERVDSGYRSMMSVQSSLVMYPIYAYGSEEQRRKYLPGLASGDLIGCFGL
gi|2552635      YVTYGLIAREIERVDSGYRSMMSVQSSLVMYPIYAYGSEEQRQKYLPGLSAGTLIGCFGL
                 .: **  .*:*  **. **  ****** :  *  :*    .   ** :  *   *.***

gi|2123088      SEAQGGSDPAAMTTRAVR--DGDG--WRLRGAKMWITNGSIADLAIIWAHT------DDG
gi|2385060      TEPNHGSDPGSMETVAREHPTKKG-YYSLSGTKTWITNSPISDILIVWAKL----ESTGK
gi|2388457      TEPNHGSDPGSMETTAKPHPTKKG-YYSLSGTKTWITNSPISDAFLVWAKL------DGK
gi|2262793      TEPNHGSDPGSMETVAKPHPTKKG-YYSISGSKTWITNSPISDYFLVWAKL----ETTGK
gi|2611989      TEPNHGSDPSSMESVAKPHPTKKG-YYSISGSKTWITNSPISDYFLVWAKL----ETTGK
gi|1341138      TEPNHGSDPSSMETTATK--TSDG--WVLNGSKTWISNAPVADLFVIWARV-VENGEKGK
gi|2840951      TEPNHGSDPSSMETKAKL--SQCGKYYILNGSKMWITNSPIADIFVVWARS---EAHEGK
gi|1992083      TEPNHGSDPAGMETRAKY--DSKSKTYILNGSKTWITSAPIADVIVVWAKC-----EDGK
gi|1675241      TEPDHGSDPGSMATKAKA--VDGG--YLLNGSKTWITNAPIADVFIIWANL------DGD
gi|8385914      TEPDGGSDPGAMRTTARK--ADGG--YVLNGAKMWITNSPISDLAVVWAKL------DGE
gi|2269418      TEPDAGSDPGSMHSRARK--VDGG--YLLSGSKMWITNSPIADVLLVWARD-----DAGD
gi|2095462      TEPDHGSDPGSMATRAKK--VDGG--YSLTGSKTWISNAPIADVFVVWAKT-----EDGL
gi|1841569      TEPDHGSDPGSMITRAKK--VDGG--YRLTGAKMWITNSPIADVFVVWAKEVSAEGNVGD
gi|7745634      TEPNHGSDPGAMITRARK--VDGG--YSLTGAKMWITNSPIADVFVVWAKD-----DAGD
gi|1455890      TEPNYGSDAGGMITRAKK--VPGG--FSLTGSKMWISNAPIADVFVVWAKN-----DEGI
GOS_123901      TEANSGSDPASMTTKAKK--VNGG--FELNGSKMWISNAPIADVFVIWAKS---EFHENK
gi|1496355      TEPNHGSDPGSMETRARHNSANKT--FTLNGSKTWITNAPVADLFVVWAKC-----EDGK
gi|1497568      TEPNHGSDPGSLETRARH--NPSGRSYTLNGTKTWITNSPVADLFVVWARC-----EDGR
gi|8331233      TEPDAGSDPGGMRTRAKK--VDGG--YLLTGSKMWITNSPISDIAIVWAKS---DAHEGK
gi|1637500      TEPDVGSDSGAMKTRVER--IDGG--YRLNGAKMWITNSPIADVFIVWGKL------EGT
gi|1542486      TEPDAGSDPAGMRTRAEK--IDGG--YRLNGAKMWITNSPIADLAVVWAKS---AAHDNA
gi|8905530      TEPDAGSDPAGMKTTAKK--TEGG--YVINGAKMWISNAPIADVFVIWAKS---DAHGGK
gi|2350196      TEPDAGSDPAGMKTRAEK--IDGG--YRLSGSKMWISNSPIADVFVVWAKS---AAHDNA
gi|2209212      TEPDAGSDPGGMKTRAKK--IDGG--YLLSGVKTWISNAPIADVFVVWAKS---AAHDNQ
gi|1106810      TEPDAGSDPAGMKTRAEK--TPTG--YKLTGSKMWISNSPIADVFVVWAKS---EAHGGK
gi|1492025      TEPDAGSDPAGMKTRAVR--TTGG--YRLTGSKMWISNSPIADVFVVWAKS---EAHDGK
gi|2552635      TEPDAGSDPAGMKTIARK--TDTG--YVLNGSKMWISNSPIADVFVIWAKS---EAHGGK
                :*.: ***...: : .          : : * * **:...::*  ::*..        . 

gi|2123088      VRGFLVDT-RS--EGFRAQDIGHKMSLRASVTSAVFLDDVFVPEQQRLPDALGLKAPLGC
gi|2385060      IRGFVVERDQCPPGTLETPAIKNKTAL----TGV--------------------------
gi|2388457      IRGFVIERDQCPPGTLSTPAIKNKTALRASITGMIQMDNCPVPEANMFPEVSGLVGPFTC
gi|2262793      IKGFIIERDQCPPGTFETPAIKNKTALRASITGMIQMDSCPVPEANMFPDVEGLKGPFTC
gi|2611989      IKGFIIERDQCPPGTLETPAIKNKTALRASITGMIQLDSCPVPEANMFPDVEGLVGPFTC
gi|1341138      VRGFLVEK-GT--AGLSAPAIKNKMSLRASITGSIFMEDVKVSDDAVLPKSNGLGSPFSC
gi|2840951      IKGFILEK-GM--KGLTAPKIEGKMSLRASITGSIGMDDVHVPVENLLPHASGLGGPFSC
gi|1992083      VRGFLVDR-KISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPNVAGFSGPFSC
gi|1675241      IRGFVVERDGS--EGLTTPKIEGKLSLRASITGQIMLDNVFVPEENLFPTVKGLKGPFGC
gi|8385914      IRGFIVDK-GT--EGFDCPKIEGKLSLRASITGSISLNDAFVPEENLLPHVKGLRGPFSC
gi|2269418      IRGFVLER-GM--AGLSTPKIEGKFSLRASVTGEIVMDGVMVPDSHCLPGVRGLKGPFSC
gi|2095462      IRGFILEK-GW--KGLSAPAIHGKVGLRASITGEVVMDGVFVPEENLLPGVTGLKGPFTC
gi|1841569      IRGFILEK-GW--EGLSAPAIHGKVGLRASITGEIVMDNVFVPEENAFPEIRGLKGPFTC
gi|7745634      IRGFVLEK-GW--KGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGLKGPFTC
gi|1455890      IRGYILEK-GM--KGLSAPKISGKLGLRASITGEIVMDEVFVPDENEFPEVTGLKGPFTC
GOS_123901      IKGFILEK-NF--KGLETKKIPGKLSLRASVTGEISFNNVFVPEENILEDVEGLKGPFSC
gi|1496355      VRGFLLEK-GM--KGLSAPKIEGKFALRASVTGMILMEDVEVPEENLLPNVSGLAGPFGC
gi|1497568      IRGFLLEK-GM--RGLSAPKIEGKFSLRASATGLIVMDDVEVPEENVLPNASGLAGPFGC
gi|8331233      IKGFIVEK-GI--KGFTTPKIEGKLSLRASITGEIVLDEAFVPDEALMPNASGLGGPFGC
gi|1637500      IRGFILEK-GM--KGLSAPKIEGKFSLRASITGEIVMDNVEVPESALLPNVEGLKGPFGC
gi|1542486      IRGFVVER-GM--KGFSTPKIEGKLSLRASITGEIVLEDVEIPEENLLPNVSGLAGPFGC
gi|8905530      IRGFVLEK-GM--KGLSAPKIGGKLSLRASVTGEIVMDNVEVGEDALLPGVEGLKGPFGC
gi|2350196      IRGFILEK-GM--KGLSAPKIGGKLSLRASITGEIVMDGVEVSEDAILPNVSGLKGPFGC
gi|2209212      IRGFILEK-GM--KGLSAPKIKGKLSLRASVTGEIVMDGVEVPESALLPNVSGLKGPFGC
gi|1106810      IRGFILEK-GM--KGLSAPKVGNKLSLRASVTGEIVMDGVEVGEDALLPNVQGLKGPFGC
gi|1492025      IRGFILEK-GM--KGLSAPKVGGKLSLRASVTGEIVMDNVEVPESALLPNVQGLKGPFGC
gi|2552635      IRGFVLEK-GM--DGLSAPKIGGKLSLRASITGEIVMQDVAVGEDALLPNVQGLKGPFGC
                :.*::::        :    :  * .*    *.                           

gi|2123088      LSQARFGIAWGAIGAAVACLREALAYSGERILF-GRPLAATQSAQIKLADMARRIATAQL
gi|2385060      YHRARLGIAFGAMGALEDCLSRARTYALERKQFKGNPLAKYQLIQKKLADAATDAAYGTL
gi|2388457      LNSARLGIAFGTMGALEDCISRAREYALERKQFKGNPLAKYQLVQKKLADAATDAAYGTL
gi|2262793      LNSARLGIAFGTMGALEDCINRARSYALERKQFKGNPLAKYQLVQKKLADATTDAAYGTL
gi|2611989      LNSARLGIAFGTMGALEDCIDRARTYALERKQFKGNPLAKYQLVQKKLADAATDAAYGTL
gi|1341138      LNNARYGISWGVMGALEDCIARARDYAIERNQF-KRPLASFQLIQKKLADASTAATLGLL
gi|2840951      LNSARYGIAWGALGAAEYCFHTARQYQIDRKQF-GRPLAQNQLPQKKMADMLTEISLGLV
gi|1992083      LNNARYGIAWGALGAAETCVEIARQYTLDRKQF-GRPLAANQLIQKKLADAITEIALGLQ
gi|1675241      LNNARYGIAWGALGAAESCFEVARQYTLDRQQF-GRPLAANQLMQKKFADMLTEINIGLQ
gi|8385914      LNKARYGIAWGAMGAAEFCLHAARDYAMERVVF-GKPIAGTQLVQKKLADMQTEIALGYQ
gi|2269418      LNKARYGIALGALGAAESCWHTARQYVLDRLQF-GRPLAANQLVQWKLAEMQTEIALGLQ
gi|2095462      LNSARFGIAWGALGAAEDCYARARQYTLERKQF-GRPLAANQLIQKKLADMAAEISLGLQ
gi|1841569      LNSARYGIAWGAMGAAEFCWHTAHQYTMDRKQF-GRPLAANQLIQKKLADMQTEIALGLQ
gi|7745634      LNSARYGISWGALGAAEFCWHTARQYTLDRQQF-GRPLAATQLIQKKLADMQTEITLALQ
gi|1455890      LNSARYGISWGALGAAEWCWHAARQYTLDRKQF-GKPLAANQLIQKKLADMQTEIALGLQ
GOS_123901      LNMARYGIAWGAMGAAEFCWHAARDYGLSRKQF-NKPLAGTQLFQKKLADMQTEISLGIQ
gi|1496355      LNTARFGIAWGALGAAEFCLHTARQYALDRIQF-GVPLARNQLIQKKLADMLTEITIGLQ
gi|1497568      LNNARYGITWGVLGAAEFCLHTARQYTLDRIQF-GVPLARNQLIQKKLADMLTEITLGLH
gi|8331233      LNKARYGIAWGVIGAAEFCWHAARQYMLDRKQF-GRPLAANQIPQLKLANMMTEITLGLQ
gi|1637500      LNKARYGIAWGVLGAAEFCWHAARQYTLDRIQF-NRPLAANQLIQKKLADMQTEITLGLF
gi|1542486      LNRARYGIGWGAMGAAEACFAQARQYTLDRKQF-GKPLAATQLVQKKLADMATDIAFGLQ
gi|8905530      LNRARFGISWGVMGAAEDCWHRARDYGLDRVQF-GRPLAQTQLFQKKLADMQTEIALGLQ
gi|2350196      LNRARYGISWGVLGAAEDCWFRARQYGLDRKQF-NKPLAGTQLYQKKLADMQTEIALGLQ
gi|2209212      LNRARYGISWGAMGAAEDCWHRARQYTLDRTQF-GRPLAQTQLVQRKLADMQTEIALGLQ
gi|1106810      LNRARYGISWGVMGAAEFCWHAARQYGLDRHQF-GKPIAGTQLFQKKLADMQTEIALGLQ
gi|1492025      LNRARYGIAWGVMGSAEFCWHASRQYGLDRKQF-NRPLAQTQLFQLKLANMQTEITLGLQ
gi|2552635      LNRARYGISWGVMGAAEFCWHAALQYGLDRKQF-DKPIAQTQLFQLKLANMQTEITLGLQ
                   ** **  *.:*:   *   :  *  .*  *   *:*  *  * *:*:       .  

gi|2123088      LALQLGRLKEA-GTLRPEQISLAKWNNCRMALDVARECRDLLGAAGITTEHVAIRHALNL
gi|2385060      AATQVARLKDE-GKSTPEMISMIKRQNCDRALANSRILQEVFGGNATSDEYHIGRHVANL
gi|2388457      AAVQVARLKDE-GKAVPEMISMIKRQNCDRALAGARTLQEIFGGNAASDEYHIGRHVANL
gi|2262793      AAIQVSRLKDE-GKAAPEMISMIKRQNCDRALAGARTLQEIFGGNAASDEYHIGRHVANL
gi|2611989      AAVQVARLNDE-GKSVPEMISIIKRQNCDRALVGARTLQEIFGGNAASDEYHIGRHVANL
gi|1341138      GALQLGRLKDK-GEWSSDMVSMMKRNNCGEALHHSRVLLDILGGNACSDEYHIGRHAANL
gi|2840951      SCVQLGRLKDK-GEWAPEMISMLKRNNAGKALEIARVCRDMLGGNGIADEYHIIRHSANL
gi|1992083      ACLHVGRLKDQ-KLHTPDMISLLKRNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINL
gi|1675241      ACLRVGRLREEHGEFTPDLVSMIKRNSCGKALDIARMTRDMLGGNGISEDYHVLRHAINL
gi|8385914      GALALGRMLDQ-GAWIPEAISMMKRNNCGKALAIAREARDIHGGNGIAEEYHILRHAINL
gi|2269418      AALQVGRLMDA-GTAAPEMVSLIKRNNCGKALGIARMARDMLGGNGISDEFGVIRHVLNL
gi|2095462      GCLRLGRMKEE-GHPPVELTSILKRNSCGKALEIARAARDMLGGNGISDEFGIARHLVNL
gi|1841569      AALRFGRMKDE-GIASVEGTSLIKRNNCGKALDIARMARDMMGGNGISDEFGVARHLVNL
gi|7745634      GCLRLGRMKDE-GTAAVEITSIMKRNSCGKSLEIARMARDMLGGNGISDEFGVARHLVNL
gi|1455890      GCLRLGRMKDE-GIAAPEITSIMKRNSCGKSLDIARMARDMHGGNGISDEYGVARHMMNL
GOS_123901      GALRLGRLIDE-GRGAPEAISLMKRNNC--------------------------------
gi|1496355      ACLQLGRLKDK-DKATPEMVSMLKRNSCGKALEIARQARDMLGGNGISDEYHVIRHAMNL
gi|1497568      ACLQLGRLKDQ-DKATPEMISLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNL
gi|8331233      ACVRVGRMMDD-HTWAPEAVSLIKRNNCGKALDIARMARDMHGGNGISEEFHVIRHMVNL
gi|1637500      ACLQAGRLMDQ-DALPVEAISLIKRNSCGKALDIARLSRDMHGGNGISDEFHVIRHLMNL
gi|1542486      ACLRVGRLFEE-GRLPPETISFIKRNNCGKALDIARTARDMHGGNGISAEFHVIRHAANL
gi|8905530      GALRAGRMMED-GTCGPELISLMKRNNCGKALEIARHARDMHGGNGIMAEYHVMRHAQNL
gi|2350196      ASLRVGRLFDE-GKMAPEMISIVKRNNCGKALDIARQARDMHGGNGIQIEYHVMRHAQNL
gi|2209212      ASLRVGRLFDE-GRVAPEMISIVKRNNCGKALAIAREARDMHGGNGIMGEYHVMRHAQNL
gi|1106810      GSLQVGRLMDS-AQAAPEMISIMKRNNCGKALDVARMSRDMHGGNGISGEFQVIRHMMNL
gi|1492025      AALRVGRLMDE-ANAAPEMISMIKRNNCGKALEIARHARDMHGGNGISEEFQVIRHMVNL
gi|2552635      GSLRVGRLMDE-ANAAPEMISLMKRNNCGKALEIARHARDMHGGNGISEDFQVMRHMVNL
                 .   .*: :       :  *: *.:.                                 

gi|2123088      ESVITYEGTETVHQLVVGRALTGLNA----------------------------------
gi|2385060      FVVQTYEGQSDIHSLILGRAITGVQADPPSSCSAGPVGEDLFHWQATIMGPGDSPYSGGV
gi|2388457      FVAQTYEGQSDIHSLILGRAITGVQA----------------------------------
gi|2262793      FVTQTYEGQSDIHSLIIGRAITGIQA----------------------------------
gi|2611989      FVTQTYEGQSDIHSLIIGRAMTGVQA----------------------------------
gi|1341138      QVANTYEGTNDIHALILGKAITGLQA----------------------------------
gi|2840951      ESVNTYEGTHDIHALILGRSITGLAA----------------------------------
gi|1992083      ESVNTYEGTHDIHALILGRAITGLAA----------------------------------
gi|1675241      ETVNTYEGTHDIHALILGRAITGLQS----------------------------------
gi|8385914      ETVNTYEGTHDVHALILGRAMTGLQA----------------------------------
gi|2269418      EAVNTYEGTHDIHALILGRAQTGIQA----------------------------------
gi|2095462      EVVNTYEGTHDIHALIIGRAITGIAA----------------------------------
gi|1841569      EVVNTYEGTHDVHALILGRAQTGIAA----------------------------------
gi|7745634      EVVNTYEGTHDVHALILGRAQTGLQA----------------------------------
gi|1455890      EVVNTYEGTHDIHALILGRAQTGIQA----------------------------------
GOS_123901      ------------------------------------------------------------
gi|1496355      EAVNTYEGTHDIHALILGRAITGLQA----------------------------------
gi|1497568      EAVNTYEGTHDIHALILGRAITGIQA----------------------------------
gi|8331233      ETVNTYEGAHDVHALILGRAMTGIQA----------------------------------
gi|1637500      EAVNTYEGTHDIHALILGRAQTGIQA----------------------------------
gi|1542486      ETVNTYEGTHDIHALILGRGITGIQA----------------------------------
gi|8905530      ETVNTYEGTHDVHALILGRAQTGLQA----------------------------------
gi|2350196      ETVNTYEGTHDVHALILGRAQTGIQA----------------------------------
gi|2209212      ETVNTYEGTHDVHALILGRAQTGLQA----------------------------------
gi|1106810      ETVNTYEGTHDIHALILGRAQTGVQA----------------------------------
gi|1492025      ETVNTYEGTHDVHALILGRAQTGLQA----------------------------------
gi|2552635      ETVNTYEGTHDVHALILGRAQTGLQA----------------------------------
                                                                            

gi|2123088      F-----------------------------------------------------------
gi|2385060      FFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSM
gi|2388457      FV----------------------------------------------------------
gi|2262793      FI----------------------------------------------------------
gi|2611989      FV----------------------------------------------------------
gi|1341138      FAN---------------------------------------------------------
gi|2840951      F-----------------------------------------------------------
gi|1992083      FAN---------------------------------------------------------
gi|1675241      FKP---------------------------------------------------------
gi|8385914      FS----------------------------------------------------------
gi|2269418      FV----------------------------------------------------------
gi|2095462      FAN---------------------------------------------------------
gi|1841569      FSN---------------------------------------------------------
gi|7745634      FY----------------------------------------------------------
gi|1455890      FS----------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|1496355      FTVGK-------------------------------------------------------
gi|1497568      FTASK-------------------------------------------------------
gi|8331233      FS----------------------------------------------------------
gi|1637500      FG----------------------------------------------------------
gi|1542486      FF----------------------------------------------------------
gi|8905530      FF----------------------------------------------------------
gi|2350196      FF----------------------------------------------------------
gi|2209212      FF----------------------------------------------------------
gi|1106810      FF----------------------------------------------------------
gi|1492025      FF----------------------------------------------------------
gi|2552635      FF----------------------------------------------------------
                                                                            

gi|2123088      --------------------------------------
gi|2385060      LTDPNPDDPLVPEIAHVYKTDRGRYEATAREWTRKYAI
gi|2388457      --------------------------------------
gi|2262793      --------------------------------------
gi|2611989      --------------------------------------
gi|1341138      --------------------------------------
gi|2840951      --------------------------------------
gi|1992083      --------------------------------------
gi|1675241      --------------------------------------
gi|8385914      --------------------------------------
gi|2269418      --------------------------------------
gi|2095462      --------------------------------------
gi|1841569      --------------------------------------
gi|7745634      --------------------------------------
gi|1455890      --------------------------------------
GOS_123901      --------------------------------------
gi|1496355      --------------------------------------
gi|1497568      --------------------------------------
gi|8331233      --------------------------------------
gi|1637500      --------------------------------------
gi|1542486      --------------------------------------
gi|8905530      --------------------------------------
gi|2350196      --------------------------------------
gi|2209212      --------------------------------------
gi|1106810      --------------------------------------
gi|1492025      --------------------------------------
gi|2552635      --------------------------------------
                                                      

                                                      
Hypothèse 2 : La protéine n'est pas homologue à une (ou plusieurs) protéine mitochondriale eucaryote.
:"proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria" vs "othersb bacteria" :  "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria"

b) CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

gi|1637531      -------------------MKPDLFQAPDYYNLDELLTDEHKLVRDAAREWVKRDVSPII
gi|2683169      -------------------MGSFPFNPDDAFLFESMLKEEDRLIMETAREYAQSCLEPRA
gi|8385914      ---------------MAAKETGLSFSWEDPLHLQQQLSEEERMIADSARSYCREKLLPRV
gi|8881172      --------------------MTIPFEWADPLRLDEQLTEDECMARDAARDYAQQRLMPRI
GOS_123901      -----------------------------------------------------KELSVRV
gi|7190617      -------------------MAKASFNWEDPLLLDSQLAADERQVRNAARSFAQKALAPRI
gi|2095462      -----------------MQHTREVFDWADPFRLAEQLTDEERMVQNTAHAYAQEKLAPRV
gi|1841569      --------------MVTTKKAKVQFNWQDPFLIEQQLSPDERMIRDAAHAYCQERLQPRV
gi|1455890      -------------------MSKASFNWADPLLLDTQLSEEERMIRDAAAEYAQGRLMPRI
gi|7745634      ------------------MGGKASFNWIDPLLLDQQLTEEERMIRDTAEQFAQQSLAPRV
gi|1638578      ------------------MSSNPSFHWQDPLLLDQQLTDEERMVRDAAAAYAQDKLAPRV
gi|2269418      --------------MTHAGAGSSRFVWEDPLQLEQQLTDEERLIRDSARSFCQARLAPRA
gi|3449937      ---------------MAASTQRAPFAWEDPLLLQDRLTDDERLVQQSAHEYCQERLLPRV
gi|1637500      -------------------MARVHFDWTDPLQFNALLSEEERMIRDSVHDYAQDKLMPRV
gi|5645928      -------------------MSSAGFNWSDPLNWQNTLSDEEKMIQESAHQYAQEKLMPRV
gi|8331233      ---------------------MQHFKWDDPFLLEDQLSEDEKLIRDSAHAYCQEKLQPRV
gi|1542486      ----------------MAAATKPVFDWTDPFDLNGQLTEDERLVRDTARDYAQEKLLPRV
gi|2209212      MTAASAAPQTSPSAARPQEGSRGAFRWDDPFLLEDQLTDEERLIRDTARSFAVERLLPGI
gi|1106810      ------MNVETPILKAKDAPDLAGFDWSDPFRLAEQLHEDERMIQESAKAYAQEKLQPRV
gi|1492025      ------MNANTPTLRAKDAPDLNSFDWADPFRLNDQLSEEERMIAASARTFAQEVLQPRV
gi|2552635      ------MNANTSILSPKDAPDLGRFDWQDAFRLDDQLTEDERMLRDAAGEFAQSELQPGV
gi|2399321      ---------------MSASAKLPPFDPADPLGVDDLLEPEDLAVRDTVRAWAADRVLPYV
gi|2840424      --------------MTASTTAPPPLRPNDYLGIDALLSDEERDIRDAVRAFVAGEVVPHV
gi|2123088      ----------------------MPVRPDDLFDVRAQLSDDERAVQDAVARFTDTRVLPGI
gi|1483586      -----------------------------MLFLDEQLHDDERMIRDSVSRFVSNDVIPLM
gi|2398259      -------------------------------MMNFDFTPEQEMLRSTVRKFVDKEIMPYI
gi|2377453      --------------------------------MLFKTTEEHEALRMQVREFVETEVKPIA
gi|2517792      --------------------------------MFFNTTEQHEAFRKKIREFAEAEIKPLA
                                                                       :    

gi|1637531      EDYAQRAEFP--NQIIKGLADIGAFGPYIPEEYGGAGLDQISYGLIMQEIERGDSGVRST
gi|2683169      LEGNQQGIFH--MEIPREMGELGLLGVTIDPKYGGGGASYTAYGLIARELERVDSAYRSF
gi|8385914      VDAYREESFD--RNIMTEMGEMGLLGATVAEEYGGAGLSHVAYGLIAREVEAIDSGYRSA
gi|8881172      LDANRHERFD--REIMREMGTLGLLGPTLPEQYGGAGANHVCYGLIARELERVDSSYRSA
GOS_123901      ERAYNEEIID--EGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSGYRSM
gi|7190617      RDAFRNETTD--PAIFREMGDMGLLGPTLPPQYGGAGLNYVSYGLIAREIERVDSAYRTL
gi|2095462      LDAFRNEKTD--PAIFREMGELGLLGPTISPDYGGAGLGYTAYGLIAREVERVDSGYRSM
gi|1841569      LEQFRHETTD--PSIFREMGELGLLGPTIPEQYGGAGLNYVSYGLVAREIEYVDSGYRSM
gi|1455890      QEAYRNETTD--PAIFREMGELGLLGVTIPEQYGGSNLNYVSYGLIAREIERVDSGYRSM
gi|7745634      LEAFRHEKTD--PAIFREMGEVGLLGATIPEQYGGSGLNYVSYGLIAREVERVDSGYRSM
gi|1638578      LNAFRNEQTD--PKIFAEMGELGLLGATIPTEYGGAGLNYVSYGLIAREVERIDSGYRSM
gi|2269418      REAFRHEQFD--RDIMREMGEQGLLGCTL-NDWGCAGVSHVAYGLVAREVERVDSGYRSA
gi|3449937      LMANREERFD--REIISEMGELGFLGCTI-EGYGCAGLSHVAYGLVAREVERVDSGYRSA
gi|1637500      LMANRNEHFD--REIMNELGELGLLGATLPEKYACSNINYVSYGLVAREIERVDSGYRSA
gi|5645928      LEANRNENFD--RQIMNELGEMGLLGATLPEEYGGSGVNHVSYGLIAREIERVDSGYRSA
gi|8331233      MKAFRDETFD--REIMNEMGEMGLLGPTIPEEYGGPGVNHVAYGLISREVERVDSGYRSA
gi|1542486      TSAYLEERFD--REIMNEMGELGLLGPTIPAEYGGAGLGYVSYGLAAREVERVDSGYRSA
gi|2209212      VEAYAEEKTD--RNLFNAMGELGLLGVTLPEEYGCAGASYVAYGLVAREVERVDSGYRSM
gi|1106810      IDAYENEAVA--PEIFKEMGDMGLLGITLPEEYGGLGGSYVAYGLVAREIERVDSGYRSM
gi|1492025      IAAYREERVD--PDIFKEMGQMGLLGTTIPEEYGGLGANYVTYGLVAREIERVDSGYRSM
gi|2552635      TAAYRDEVTA--PGLFKQMGDAGLLGSTIPETYGGLGANYVTYGLIAREIERVDSGYRSM
gi|2399321      ADWYEKGELPGIRELARELGGIGALGMSL-DGYGCAGASAVQYGLACLELEAADSGIRSL
gi|2840424      GEWFEQATIP--RELANRLGDLNVLGMHL-TGYGCAGASATAYGLACLELEAGDSGVRSL
gi|2123088      GEAFDAARFP--RELVPELASLGLLGASLPVSEGGAGLGAVAYGLICQELERGDSGLRSF
gi|1483586      AESYEHAHFP--KELIKKSADLGLLGLTLPAEYGGAEASYVAYGLVCQELERGDSGLRSF
gi|2398259      KEWDERGYFD--PNIFKRLAELNLMGVCIPEEYGGMGMDYNSLAIVCEELERGDTAFRTA
gi|2377453      AILDKENKFP--HEAIKKFGQMGFMGLPYPKEYGGAGKDILSYAIAVEELSRVDGGTGVI
gi|2517792      FLLDKESKFP--TEGIEKLAKMGVLGTPYPKKYGGAGLDILSYAIAVEELSRVDGGTGVI
                                   .  . :*       .    .    .:   *:.  * .    

gi|1637531      ASVQSSLVMYPIWKYGNEAQRKKYLPKLASGEWMGSFGLTEPDHGSNPGGMTTNYKDMGD
gi|2683169      MSVQSSLVMFPIEKYGTEEQKRKYLPKLATGELIGCFGLTEPDHGSDPGSMETTARRVDG
gi|8385914      MSVQSSLVMYPIEAFGTEEQKHKYLPKLASGEYVGCFGLTEPDGGSDPGAMRTTARKADG
gi|8881172      LSVQSSLVMFPIATFGSPQQRSKYLPRLASGDWVGCFGLTEPDHGSDPGGMTSHAQKVRG
GOS_123901      MSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKAKKVNG
gi|7190617      LSVQSSLVMLPIYAFGSEEQKQKYLPKLGKGEWIGCFGLTEPNSGSDPGSLATRARTVPG
gi|2095462      MSVQSSLVMVPIDTFGSEAQKLKYLPKLATGEWIGCFGLTEPDHGSDPGSMATRAKKVDG
gi|1841569      ASVQSSLVMVPIHEFGTEEQKQKYLPKLATGEYIGCFGLTEPDHGSDPGSMITRAKKVDG
gi|1455890      MSVQSSLVMVPINDFGTEAQKQKYLPKLASGEWIGCFGLTEPNYGSDAGGMITRAKKVPG
gi|7745634      MSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGAMITRARKVDG
gi|1638578      MSVQSSLVMVPINEFGSEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPNGMETRAVLTGS
gi|2269418      MSVQSSLVMYPIATYGSPEQQARWLPGLARGELVGCFGLTEPDAGSDPGSMHSRARKVDG
gi|3449937      MSVQSSLVMHPIWAYGSDAQKDKYLPRLASGEWLGCFGLTEPDSGSDPASMKTRARKVDG
gi|1637500      MSVQSSLVMYPIYAYGSEEQRLKYLPKLAKGEWIGCFGLTEPDVGSDSGAMKTRVERIDG
gi|5645928      MSVQSSLVMHPIYTFGTEAQRKKYLPKLASGEWVGCFGLTEPDSGSDPASMRTTAKRTDK
gi|8331233      MSVQSSLVMHPIFSYGTEEQKKKYLPRLATGEIIGCFGLTEPDAGSDPGGMRTRAKKVDG
gi|1542486      MSVQSSLVMHPIYAYGTEAQRQKYLPKLATGEWIGCFGLTEPDAGSDPAGMRTRAEKIDG
gi|2209212      MSVQSSLVMYPIYAYGDETQRKTYLPGLASGELVGCFGLTEPDAGSDPGGMKTRAKKIDG
gi|1106810      MSVQSSLVIYPIYAYGTEAQRQKYLPKLCSGESIGCFGLTEPDAGSDPAGMKTRAEKTPT
gi|1492025      MSVQSSLVMYPIYAYGSEEQRRKYLPGLASGDLIGCFGLTEPDAGSDPAGMKTRAVRTTG
gi|2552635      MSVQSSLVMYPIYAYGSEEQRQKYLPGLSAGTLIGCFGLTEPDAGSDPAGMKTIARKTDT
gi|2399321      VSVQGSLAMYAVHRFGSEEQKQRWLPRMAAGEVIGCFGLTEPDHGSDPASMRTYAKRDGG
gi|2840424      VSVQGSLAMFAIWRWGSEEQKQQWLPRMARGEAIGCFGLTEPDSGSDPGSMRTRARRDGD
gi|2123088      VSVQSSLCMYPIHAYGSDAQRRQWLPEMAAGRVIGCFGLSEAQGGSDPAAMTTRAVRDGD
gi|1483586      VSVQSSLCMYPIFKFGSEEQKKRYLPEMAAGNIIGCFGLTEPDSGSDPASMRTHAKKIEG
gi|2398259      VSVHTGLNSLTLLQWGTEEQKQKYLVPQAKGEKIGAFGLTEPNAGSDVASISTTAVRDGD
gi|2377453      LSAHVSLGSYPIYAFGTEEQKKKYLVPLAKGEKLGAFGLTEPNAGSDAGGTETTAVKEGD
gi|2517792      LSAHVSLGTYPIFAYGTEEQKKKYMIPLAKGEKIGAFGLTEPNAGSDAGGTETTAVLDGD
                 *.: .*   .:  :*   *.  ::     *  :*.***:*.: **:  .  :       

gi|1637531      HYLLNGAKMWISNSPFCQIAVVWAKN-----EEGRIHGLIVERGMEGFSTPETHNKWSLR
gi|2683169      GWILNGTKAWITNAPIADIAVVWARAKEHPDDEGEIMGFILERDMPGLSTPETKNKMSLR
gi|8385914      GYVLNGAKMWITNSPISDLAVVWAKL------DGEIRGFIVDKGTEGFDCPKIEGKLSLR
gi|8881172      GYRVSGAKSWITHSPIADVLVIWAKL------DGEIRGFILERDMTGLETPKIEGKFALR
GOS_123901      GFELNGSKMWISNAPIADVFVIWAKS---EFHENKIKGFILEKNFKGLETKKIPGKLSLR
gi|7190617      GWKLSGSKNWISSAPIADVFVVWAKD-----DDGVIRGFILDKGMPGLSAPVIHGKVGMR
gi|2095462      GYSLTGSKTWISNAPIADVFVVWAKT-----EDGLIRGFILEKGWKGLSAPAIHGKVGLR
gi|1841569      GYRLTGAKMWITNSPIADVFVVWAKEVSAEGNVGDIRGFILEKGWEGLSAPAIHGKVGLR
gi|1455890      GFSLTGSKMWISNAPIADVFVVWAKN-----DEGIIRGYILEKGMKGLSAPKISGKLGLR
gi|7745634      GYSLTGAKMWITNSPIADVFVVWAKD-----DAGDIRGFVLEKGWKGLSAPAIHGKVGLR
gi|1638578      GYKLSGNKMWITNSPIADVFVVWAKC-VGGDYDGKIRGFILEKGMKGLSAPAIHGKVGLR
gi|2269418      GYLLSGSKMWITNSPIADVLLVWARD-----DAGDIRGFVLERGMAGLSTPKIEGKFSLR
gi|3449937      GYLLSGSKMWITNSPAADVFVVWAKD-----DDDEIRGFILEKGMKGLSAPAIHGKFSLR
gi|1637500      GYRLNGAKMWITNSPIADVFIVWGKL------EGTIRGFILEKGMKGLSAPKIEGKFSLR
gi|5645928      GYVLSGSKMWITNSPIADVFVVWAKL------DGEIRGFVLEKGMKGLSAPKIDGKFSLR
gi|8331233      GYLLTGSKMWITNSPISDIAIVWAKS---DAHEGKIKGFIVEKGIKGFTTPKIEGKLSLR
gi|1542486      GYRLNGAKMWITNSPIADLAVVWAKS---AAHDNAIRGFVVERGMKGFSTPKIEGKLSLR
gi|2209212      GYLLSGVKTWISNAPIADVFVVWAKS---AAHDNQIRGFILEKGMKGLSAPKIKGKLSLR
gi|1106810      GYKLTGSKMWISNSPIADVFVVWAKS---EAHGGKIRGFILEKGMKGLSAPKVGNKLSLR
gi|1492025      GYRLTGSKMWISNSPIADVFVVWAKS---EAHDGKIRGFILEKGMKGLSAPKVGGKLSLR
gi|2552635      GYVLNGSKMWISNSPIADVFVIWAKS---EAHGGKIRGFVLEKGMDGLSAPKIGGKLSLR
gi|2399321      DWVLNGRKMWITNGSVAGVAVVWART------DEGIRGFVVPTDSAGFSAPEIRHKWSLR
gi|2840424      EWVLNGQKMWITNGTIADVAVVWAQT------DDGVRGFLVPRGTPGFSAPEIHKKLSLR
gi|2123088      GWRLRGAKMWITNGSIADLAIIWAHT------DDGVRGFLVDTRSEGFRAQDIGHKMSLR
gi|1483586      GWVLNGAKMWITNAPIADIAIVWAKT------EAGIRGFIVDTKSEGMSCPEIKLKMSLR
gi|2398259      YYILNGQKTWISLCDIADHFIVFAYT-DKSKKHRGISAFIVERTMPGFSSKAIKGKLGIR
gi|2377453      YYILNGEKIFITNADVAETYVVFAVT-TPDIGTKGISAFIVEKGWEGFTFGDHYDKLGIR
gi|2517792      YYILNGGKIFITNADKADTYVVFAVT-TPDIGVRGISAFIVEKGWEGFTFGDHYDKLGIR
                 : : * * :*:    .   :::.           : . ::     *:       * .:*

gi|1637531      ASATGELIFDNVKVPKENLLPNK-SGLGAPLGCLDSARFGIAWGAIGAAMDCYDTALRYS
gi|2683169      ASSTGEIVMEDVFVPDANVLPGV-RGLRGPFSCLSNARYGIAWGTVGAAEDCYQRTRRYV
gi|8385914      ASITGSISLNDAFVPEENLLPHV-KGLRGPFSCLNKARYGIAWGAMGAAEFCLHAARDYA
gi|8881172      ASVTGQIHMDEVFVPEANALL-V-EGLKGPFSCLSKARYGIIWGSMGAAEFCWQAARRYS
GOS_123901      ASVTGEISFNNVFVPEENILEDV-EGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYG
gi|7190617      AAITGEIVMDEVFVPNENLLPGV-SGLKGPFTCLNSARYGIAWGALGAAEACWHTARQYT
gi|2095462      ASITGEVVMDGVFVPEENLLPGV-TGLKGPFTCLNSARFGIAWGALGAAEDCYARARQYT
gi|1841569      ASITGEIVMDNVFVPEENAFPEI-RGLKGPFTCLNSARYGIAWGAMGAAEFCWHTAHQYT
gi|1455890      ASITGEIVMDEVFVPDENEFPEV-TGLKGPFTCLNSARYGISWGALGAAEWCWHAARQYT
gi|7745634      ASITGEIVMDNVFVPEENIFPDV-RGLKGPFTCLNSARYGISWGALGAAEFCWHTARQYT
gi|1638578      ASITGEIVMDEVEVSAEQMLPDV-SGLRGPFTCLNSARYGIAWGALGAAEACWHTARQYT
gi|2269418      ASVTGEIVMDGVMVPDSHCLPGV-RGLKGPFSCLNKARYGIALGALGAAESCWHTARQYV
gi|3449937      ASITGEIVMDDVLVSEDQLLPGV-KGLKGPFGCLNKARYGIAWGAMGAAEFCWHAARQYT
gi|1637500      ASITGEIVMDNVEVPESALLPNV-EGLKGPFGCLNKARYGIAWGVLGAAEFCWHAARQYT
gi|5645928      ASITGEIVMDGVEVSEDHIFPEV-KGLKGPFSCLNKARYGIAWGSLGAAEFCWHAARQYT
gi|8331233      ASITGEIVLDEAFVPDEALMPNA-SGLGGPFGCLNKARYGIAWGVIGAAEFCWHAARQYM
gi|1542486      ASITGEIVLEDVEIPEENLLPNV-SGLAGPFGCLNRARYGIGWGAMGAAEACFAQARQYT
gi|2209212      ASVTGEIVMDGVEVPESALLPNV-SGLKGPFGCLNRARYGISWGAMGAAEDCWHRARQYT
gi|1106810      ASVTGEIVMDGVEVGEDALLPNV-QGLKGPFGCLNRARYGISWGVMGAAEFCWHAARQYG
gi|1492025      ASVTGEIVMDNVEVPESALLPNV-QGLKGPFGCLNRARYGIAWGVMGSAEFCWHASRQYG
gi|2552635      ASITGEIVMQDVAVGEDALLPNV-QGLKGPFGCLNRARYGISWGVMGAAEFCWHAALQYG
gi|2399321      ASVTSELVLDDVRLPADAVLPEA-TGLKGPLSCLSHARYGIVWGAMGAARSCFEAAVDYA
gi|2840424      ASVTSELVLDDVRLPDSARLPEA-TSLRGPLSCLNEARYGIVWGAAGAARACFEAALDYS
gi|2123088      ASVTSAVFLDDVFVPEQQRLPDA-LGLKAPLGCLSQARFGIAWGAIGAAVACLREALAYS
gi|1483586      ASITGELVFDNVFVPDENLLPKSEKGLGAALSCLSQARYGIAWGAMGAAMACFDIARNYL
gi|2398259      AGNTGELFFDNVRVPKENLLGEEGEGFKIAMSALDNGRFTVAAGAVGLIMACLEASVKYC
gi|2377453      SSSTCQLLFNNVKVPKENLLGKEGDGFKIAMSTLDGGRIGIAAQALGIAQGAFEHALEYA
gi|2517792      SSSTAELIFNNVKVPKENLLGKEGQGFKISMQTLDGGRIGIASQALGIAQGAYENALEYS
                :. *  : :: . :     :     .:  .:  *. .*  :     *    .   :  * 

gi|1637531      KERIQFGKPIGQFQLQQKKLAEMITEITKAQLLAWRLGVLRENGKATSAQISMAKRNNVE
gi|2683169      MERTQFGYPLAAMQLIQTKLANMLTEITQMQLLVFRLGQLADEGKVTPAQISLAKRNNAG
gi|8385914      MERVVFGKPIAGTQLVQKKLADMQTEIALGYQGALALGRMLDQGAWIPEAISMMKRNNCG
gi|8881172      LERTQFGRPLAANQLIQKKLADMQTEITLGLQAALRLGRLIDADRWAPEMVSLLKRNNCG
GOS_123901      LSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC-
gi|7190617      LDRKQFDKPLAANQLIQKKLADMQTEITLGIQGALRLGRMMDDGSATPEIVSMMKRNSCG
gi|2095462      LERKQFGRPLAANQLIQKKLADMAAEISLGLQGCLRLGRMKEEGHPPVELTSILKRNSCG
gi|1841569      MDRKQFGRPLAANQLIQKKLADMQTEIALGLQAALRFGRMKDEGIASVEGTSLIKRNNCG
gi|1455890      LDRKQFGKPLAANQLIQKKLADMQTEIALGLQGCLRLGRMKDEGIAAPEITSIMKRNSCG
gi|7745634      LDRQQFGRPLAATQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
gi|1638578      LDRKQFGRPLAANQLIQKKLADMQTEITLGLQGCLRLGRMKDEGTAAVEITSIMKRNSCG
gi|2269418      LDRLQFGRPLAANQLVQWKLAEMQTEIALGLQAALQVGRLMDAGTAAPEMVSLIKRNNCG
gi|3449937      LDREQFGRPLAANQLIQLKLANMQTEIALGLSAALQVGRLMDEGRAAPEMISLIKRNNCG
gi|1637500      LDRIQFNRPLAANQLIQKKLADMQTEITLGLFACLQAGRLMDQDALPVEAISLIKRNSCG
gi|5645928      LERSQFGRPLAANQLIQKKLADMQTEISLGLLGCLQAGRELDKGTLNPIAISLIKRNSCG
gi|8331233      LDRKQFGRPLAANQIPQLKLANMMTEITLGLQACVRVGRMMDDHTWAPEAVSLIKRNNCG
gi|1542486      LDRKQFGKPLAATQLVQKKLADMATDIAFGLQACLRVGRLFEEGRLPPETISFIKRNNCG
gi|2209212      LDRTQFGRPLAQTQLVQRKLADMQTEIALGLQASLRVGRLFDEGRVAPEMISIVKRNNCG
gi|1106810      LDRHQFGKPIAGTQLFQKKLADMQTEIALGLQGSLQVGRLMDSAQAAPEMISIMKRNNCG
gi|1492025      LDRKQFNRPLAQTQLFQLKLANMQTEITLGLQAALRVGRLMDEANAAPEMISMIKRNNCG
gi|2552635      LDRKQFDKPIAQTQLFQLKLANMQTEITLGLQGSLRVGRLMDEANAAPEMISLMKRNNCG
gi|2399321      KSREQFGRPIGGFQLTQAKLADMAVELHKGILLAHHLGRRMDAGRLRPEQVSFGKLNNVR
gi|2840424      KTRIQFDKPIASFQLVQQRLAEMAVKVNQSTLLALHLGRLKDAGTLRPEHVSMGKLANVN
gi|2123088      GERILFGRPLAATQSAQIKLADMARRIATAQLLALQLGRLKEAGTLRPEQISLAKWNNCR
gi|1483586      LERKQFAKPLASFQLIQKDLADMYTEIIKAQCLNLQIGRLKDQHRETPTMISLAKGNACR
gi|2398259      HERKTFGKEIGRHQLVQQMIARMEAGLQISRLLVYKVGFLKNQGRRTTREASLAKWIACD
gi|2377453      KEREQFGKPIAFQQAISFKLADMATKIRTARFLIYSAAELKEHHEPYGMESAMAKQYASD
gi|2517792      KERVQFGKPICQQQVISFKLADMATKIRAARLLVYSAAELKENHESYSMEAAMAKQYASD
                  *  *   :   *  .  :* *   :          .   :         :: *     

gi|1637531      MALKIAREARQMLGGMGISGEYSIMRHMMNLESVVTYEGTHDIHLLITGLDVTG------
gi|2683169      KALEIARMARDMHGANGIVGEYRVIHHMVNLESVNTYEGTYDIHGLILGREITG------
gi|8385914      KALAIAREARDIHGGNGIAEEYHILRHAINLETVNTYEGTHDVHALILGRAMTG------
gi|8881172      KALEIARTARDIHGGNGIVDEYHVIRHMLNLEAVNTYEGTHDIHALILGRAQTG------
GOS_123901      ------------------------------------------------------------
gi|7190617      KALDIARTARDMLGGNGISDDFGVIRHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|2095462      KALEIARAARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDIHALIIGRAITG------
gi|1841569      KALDIARMARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|1455890      KSLDIARMARDMHGGNGISDEYGVARHMMNLEVVNTYEGTHDIHALILGRAQTG------
gi|7745634      KSLEIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|1638578      KALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|2269418      KALGIARMARDMLGGNGISDEFGVIRHVLNLEAVNTYEGTHDIHALILGRAQTG------
gi|3449937      KALDIARVARDMHGGNGICDEFHVIRHVMNLEAVNTYEGTHDVHALILGRAQTG------
gi|1637500      KALDIARLSRDMHGGNGISDEFHVIRHLMNLEAVNTYEGTHDIHALILGRAQTG------
gi|5645928      KALDIARQARDMHGGNGIADEYHVIRHVMNLEAVNTYEGTHDIHALILGRSQTD------
gi|8331233      KALDIARMARDMHGGNGISEEFHVIRHMVNLETVNTYEGAHDVHALILGRAMTG------
gi|1542486      KALDIARTARDMHGGNGISAEFHVIRHAANLETVNTYEGTHDIHALILGRGITG------
gi|2209212      KALAIAREARDMHGGNGIMGEYHVMRHAQNLETVNTYEGTHDVHALILGRAQTG------
gi|1106810      KALDVARMSRDMHGGNGISGEFQVIRHMMNLETVNTYEGTHDIHALILGRAQTG------
gi|1492025      KALEIARHARDMHGGNGISEEFQVIRHMVNLETVNTYEGTHDVHALILGRAQTG------
gi|2552635      KALEIARHARDMHGGNGISEDFQVMRHMVNLETVNTYEGTHDVHALILGRAQTG------
gi|2399321      EAIDICRTARTVLGANGISLAYPVMRHATNLESVLTYEGTVEMHQLVLGKALTG------
gi|2840424      AALDVARTARQVLGANGITLEYPVIRHMNNLESVVTYEGTADVHALVIGHALTG------
gi|2123088      MALDVARECRDLLGAAGITTEHVAIRHALNLESVITYEGTETVHQLVVGRALTG------
gi|1483586      EALKIARKCRNLMGGNGISLEYHVIRHMLNLESVFTYEGTDNVHTLVLGRHITG------
gi|2398259      FANQAADDAVQIHGAYGYSNEYPVERYLRNSKAPVIYEGTREIHTIMQAEYVLG------
gi|2377453      IALEVVNDALQIFGGAGYLKGMEVERAYRDAKITTIYEGTNEIQRVVIAAHLIGKPPKTD
gi|2517792      ICLEVVNDSLQIFGGNGYLKGMDVERAYRDAKICTIYEGTNEIQRMVIASHIIGKMPKNE
                                                                            

gi|1637531      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|7190617      ------------------------------------------------------------
gi|2095462      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|3449937      ------------------------------------------------------------
gi|1637500      ------------------------------------------------------------
gi|5645928      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1542486      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|1106810      ------------------------------------------------------------
gi|1492025      ------------------------------------------------------------
gi|2552635      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2123088      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      VPGLVKKKKGPVTGPRKNIIFKDGSAKEKVAALVAALKADGYDFTVGIPLDTPIGKSERV
gi|2517792      NRDRKTSSREPLTGVRKKIIIKDGTAEERVFKLVEVLKADGYDFTVGIDINTPISKAERV
                                                                            

gi|1637531      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|7190617      ------------------------------------------------------------
gi|2095462      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|3449937      ------------------------------------------------------------
gi|1637500      ------------------------------------------------------------
gi|5645928      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1542486      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|1106810      ------------------------------------------------------------
gi|1492025      ------------------------------------------------------------
gi|2552635      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2123088      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      VSAGKGIGDKKNMKLIENLAKQAGASIGSSRPVAETLQYVPLDRYVGMSGQKFVGNLYIA
gi|2517792      VSVGKGIGEEKNMELAKSLAVQAGAAIGSSRPVAETLKYLPLNRYVGMSGQKFNGNLYIA
                                                                            

gi|1637531      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|7190617      ------------------------------------------------------------
gi|2095462      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|3449937      ------------------------------------------------------------
gi|1637500      ------------------------------------------------------------
gi|5645928      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1542486      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|1106810      ------------------------------------------------------------
gi|1492025      ------------------------------------------------------------
gi|2552635      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2123088      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      CGISGALQHLKGIKDATTIVAINTNANAPIFKNADYGIVGDLVEILPLLTKELDNGEAKK
gi|2517792      CGISGAGQHLKGIKDATTIVAINNNPNAPIFKNSDYGIIGDILEIMPLLAAALDNGEPKK
                                                                            

gi|1637531      ----------------LNAFK---------------------------------------
gi|2683169      ----------------IQAFVPRGNDLPPKKKPAPATAS---------------------
gi|8385914      ----------------LQAFS---------------------------------------
gi|8881172      ----------------IPAFTG--------------------------------------
GOS_123901      ------------------------------------------------------------
gi|7190617      ----------------ISAF----------------------------------------
gi|2095462      ----------------IAAFAN--------------------------------------
gi|1841569      ----------------IAAFSN--------------------------------------
gi|1455890      ----------------IQAFS---------------------------------------
gi|7745634      ----------------LQAFY---------------------------------------
gi|1638578      ----------------IQAFS---------------------------------------
gi|2269418      ----------------IQAFV---------------------------------------
gi|3449937      ----------------IQAFA---------------------------------------
gi|1637500      ----------------IQAFG---------------------------------------
gi|5645928      ----------------IPAF----------------------------------------
gi|8331233      ----------------IQAFS---------------------------------------
gi|1542486      ----------------IQAFF---------------------------------------
gi|2209212      ----------------LQAFF---------------------------------------
gi|1106810      ----------------VQAFF---------------------------------------
gi|1492025      ----------------LQAFF---------------------------------------
gi|2552635      ----------------LQAFF---------------------------------------
gi|2399321      ----------------IDAFR---------------------------------------
gi|2840424      ----------------IQAFR---------------------------------------
gi|2123088      ----------------LNAF----------------------------------------
gi|1483586      ----------------INAFG---------------------------------------
gi|2398259      ------YRQDKPLRKMLPPWNPDSVKL---------------------------------
gi|2377453      DAPPMKKM-KRVIPRVVYSPHVYVCSGCGHEYNPDLGDEDSDIKPGTRFKDLPEDWTCPD
gi|2517792      EAPPMKKMKKRVSEKVIPNWKRYVCDGCGYEYDPAIGDLENDIVPGTLFEALPDEWICPD
                                                                            

gi|1637531      -------------
gi|2683169      -------------
gi|8385914      -------------
gi|8881172      -------------
GOS_123901      -------------
gi|7190617      -------------
gi|2095462      -------------
gi|1841569      -------------
gi|1455890      -------------
gi|7745634      -------------
gi|1638578      -------------
gi|2269418      -------------
gi|3449937      -------------
gi|1637500      -------------
gi|5645928      -------------
gi|8331233      -------------
gi|1542486      -------------
gi|2209212      -------------
gi|1106810      -------------
gi|1492025      -------------
gi|2552635      -------------
gi|2399321      -------------
gi|2840424      -------------
gi|2123088      -------------
gi|1483586      -------------
gi|2398259      -------------
gi|2377453      CGDPKSGYIDAKK
gi|2517792      CGEEKDMFIEI


Hypothèse 3 :La protéine codée par notre séquence a des homologues dans différents groupes phylogénétiques ceci est peut être du à des transferts horizontaux intervenu lors de l'évolution des espèces : "proteobacteria","others bacteria", "eucaryotes","archaea" 

c)CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|1149859      -----------------------------------------------MFRGVDF----YN
gi|1483586      -----------------------------------------------------M----LF
gi|1499217      ------------------------------------------------MASKDPRTYLLG
gi|1637531      ------------------------------------------MKPDL-FQAPDY----YN
gi|2418906      ------------------------------------------------MKEVDY----FQ
gi|2388457      MNPALRSVPRAALRAARRPSGVA--------------GQRHAHSASS-FRWQDP----LY
gi|1341138      MTAARSISPLLRKVTPSAGI------------VIAKRGMASTSKFAK-YNWEDP----LN
gi|2683169      ------------------------------------------MGSFP-FNPDDA----FL
gi|1675241      MAAALTARQLVLRATSRRAL-----------------SSAAPLQARR-MDWQDP----FE
GOS_123901      ------------------------------------------------------------
gi|8385914      -------------------------------------MAAKETGLS--FSWEDP----LH
gi|8331233      --------------------------------------------MQH-FKWDDP----FL
gi|1841569      -------------------------------------MVTTKKAKVQ-FNWQDP----FL
gi|1455890      ------------------------------------------MSKAS-FNWADP----LL
gi|7745634      -----------------------------------------MGGKAS-FNWIDP----LL
gi|1638578      -----------------------------------------MSSNPS-FHWQDP----LL
gi|8881172      -------------------------------------MTIP-------FEWADP----LR
gi|2209212      ------------------------MTAASAAPQTSPSAARPQEGSRGAFRWDDP----FL
gi|2269418      -------------------------------------MTHAGAGSSR-FVWEDP----LQ
gi|2840951      -----MLSSARKVITKNSNKSGLASLISNNSRCFSTNATQHKEVMVS-FNWKDP----LN
gi|4722027      --------------------------------MGENTPKQAKSAKVP-FNWRDS----LD
gi|1091235      MALRGVSVQLLSRVPGLRVFRTWVSSAAQTEKGGRTQSQLAKSSRPE-FDWRDP----LV
gi|1497568      MALRGVSVRLLSRRPGLRALRAWGSAAAQTEKGGKTQSRPAKSSRPE-FDWRDP----LV
gi|2813530      -----VSERLLSRGPGLNFLRGWGSAAAQTEKGGKTQNRATKSSRPE-FDWRDP----LV
gi|1992083      MIAQSVISKLRPCARRLA-------------------STSSKAAAPK-FNWQDP----LN
gi|1571071      MALRIISSQLRSFCKIGNVQR----------------AFASSSNEPT-FNWEDP----LN
gi|2840424      -------------------------------------MTASTTAPPP-LRPNDY----LG
gi|2399321      --------------------------------------MSASAKLPP-FDPADP----LG
gi|2380623      ------------------------------------------------MTPVDL----LD
gi|2262278      -------------------------------------MPALPSVDLK-AHAADL----FN
gi|7822328      -------------------------------------------MSVT-TELTDY----MG
gi|2573871      --------------------------------------------------MLDY----LD
gi|5537869      --------------------------------------------------MIDY----LG
gi|2895825      --------------------------------------------------MLDF----VQ
gi|2841637      --------------------------------------------------MLDF----VD
gi|2224809      --------------------------------------------------MLDY----FD
gi|7680344      --------------------------------------------------MLDY----LG
gi|1692370      --------------------------------------------------MLDY----VG
gi|1579126      ------------------------------------------------------------
gi|2398259      -----------------------------------------------------------M
gi|2377453      ----------------------------------------------------------ML
gi|2517792      ----------------------------------------------------------MF
                                                                            

gi|1149859      VDELLSDEDRLVRQSVREFLEKEVVPLVADAWHEEKPLNFHELGKKFGELGMLGTFLPEE
gi|1483586      LDEQLHDDERMIRDSVSRFVSNDVIPLMAESYEHAHFP--KELIKKSADLGLLGLTLPAE
gi|1499217      IDHLLTEDERLTWKAAHDFCQSRVMPVIEKHYEAGTFP--KELIPEFAEMGFLGCSL-EG
gi|1637531      LDELLTDEHKLVRDAAREWVKRDVSPIIEDYAQRAEFP--NQIIKGLADIGAFGPYIPEE
gi|2418906      IDELLSEEQLMIRNTVREFVNKEIRPVIDEAAQQHKDI--PGLMQKLGAIGALGPYIPQE
gi|2388457      AENLYTADELAIQDTARRYCQERLMPRVLDAYRNEDYD--PAILREMGSLGLLGATI-DG
gi|1341138      MNSLLSEEELAIHETAKSFSQAQLLPRVTEAYRTENFD--PAILREMGELGLLGATI-QG
gi|2683169      FESMLKEEDRLIMETAREYAQSCLEPRALEGNQQGIFH--MEIPREMGELGLLGVTIDPK
gi|1675241      LDSQLTSEELMAKNTAREYCEASLQPRIIEAYRTETFD--RSIMNEFGELGMLGSTI-DG
GOS_123901      ---------------------KELSVRVERAYNEEIID--EGIFKLMGETGLLGCTIPEE
gi|8385914      LQQQLSEEERMIADSARSYCREKLLPRVVDAYREESFD--RNIMTEMGEMGLLGATVAEE
gi|8331233      LEDQLSEDEKLIRDSAHAYCQEKLQPRVMKAFRDETFD--REIMNEMGEMGLLGPTIPEE
gi|1841569      IEQQLSPDERMIRDAAHAYCQERLQPRVLEQFRHETTD--PSIFREMGELGLLGPTIPEQ
gi|1455890      LDTQLSEEERMIRDAAAEYAQGRLMPRIQEAYRNETTD--PAIFREMGELGLLGVTIPEQ
gi|7745634      LDQQLTEEERMIRDTAEQFAQQSLAPRVLEAFRHEKTD--PAIFREMGEVGLLGATIPEQ
gi|1638578      LDQQLTDEERMVRDAAAAYAQDKLAPRVLNAFRNEQTD--PKIFAEMGELGLLGATIPTE
gi|8881172      LDEQLTEDECMARDAARDYAQQRLMPRILDANRHERFD--REIMREMGTLGLLGPTLPEQ
gi|2209212      LEDQLTDEERLIRDTARSFAVERLLPGIVEAYAEEKTD--RNLFNAMGELGLLGVTLPEE
gi|2269418      LEQQLTDEERLIRDSARSFCQARLAPRAREAFRHEQFD--RDIMREMGEQGLLGCTL-ND
gi|2840951      VESLLTEEEKEIRDQVHGYCQAKLMPRVLEANRKEHFD--PEIMREMGEMGMLGINI-HG
gi|4722027      LEGQLTEEEIMIRDSFRDYCHEKLMPRVLMANRHEHFH--REIISEMGEMGVLGPTI-KG
gi|1091235      LEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFH--REIISEMGELGVLGPTI-KG
gi|1497568      LEEQLTADEIAIRDTFRTYCQERLMPRILLANRNEVFH--REIILEMGELGVLGPTI-KG
gi|2813530      LEEQLTADEILIRDTFRTYCQERLMPRILLANRNEVFH--REIISEMGELGVLGPTI-KG
gi|1992083      LESQLTEEEVAIRDAFRGYCQAELQPRVKMANRLETFD--KKIMEEIGSLGVLGCTI-KG
gi|1571071      LESQLKEDEIAIRDSFRAYCEDKLMSRVILANRDEVFH--KEIMKELGLFGVLGCTI-KG
gi|2840424      IDALLSDEERDIRDAVRAFVAGEVVPHVGEWFEQATIP--RELANRLGDLNVLGMHL-TG
gi|2399321      VDDLLEPEDLAVRDTVRAWAADRVLPYVADWYEKGELPGIRELARELGGIGALGMSL-DG
gi|2380623      LDSLLDDEERQIRSVVRRLVDDRVRPHVAEWYEQGQVPA-RELAREFGRLGLLGMHL-TG
gi|2262278      IDAALTEEERAIRDTIRQFVDEKLIPVMGDCYVEGRFP--DELIPELAELGVLGANLPEE
gi|7822328      FQGLLTDEEKLVRETARKFVNDEVLPIIEEHALNETFP--SHLIPKMGELGFYGPNLPEK
gi|2573871      LESDLDGEERMIRDTAREFVDEHVRPEIGEWFESGTSP--DHLFEAMGELDFFAPTL--S
gi|5537869      LEGDLGEEERMVRDTARDFVENEVKPDVGQHWIDGTFP--TDLITEMGELGFYAPNL-DG
gi|2895825      LEADLDQEERLIRDTAREFVEEHVKPDIGEHFEEGTFP--TELISEMGELGFYAPNL-EG
gi|2841637      LEADLDQEERMIRDTAREFVTEHVTPDIGEHFENGTFP--KEIIPKMGELGFYAPNL-EG
gi|2224809      MESTLSEEERMLVDSARSFIDGEVE-DIGQHWIDGTFP--MDLIPKMGEMGFYAPNL-EG
gi|7680344      LESDLDEEERLIQETARDFVEDNVAPDIGQHWIDGTFP--TDLIPKMGELGFYAPNL-EG
gi|1692370      LEADLDSEERLIRDTAREFVDEHVQDDIGEHYLDGTFP--TELIPEMGEMGFYAPNL-DG
gi|1579126      ----------------------------------------------MGEMGFYAPNL-DG
gi|2398259      MNFDFTPEQEMLRSTVRKFVDKEIMPYIKEWDERGYFD--PNIFKRLAELNLMGVCIPEE
gi|2377453      FKT--TEEHEALRMQVREFVETEVKPIAAILDKENKFP--HEAIKKFGQMGFMGLPYPKE
gi|2517792      FNT--TEQHEAFRKKIREFAEAEIKPLAFLLDKESKFP--TEGIEKLAKMGVLGTPYPKK
                                                               .  .  .      

gi|1149859      YGC-PGMTYTTFGVVCQEVERVDSALRSFVAVTSGLVMYPIWRYGSEEQKGEYLPKLARG
gi|1483586      YGG-AEASYVAYGLVCQELERGDSGLRSFVSVQSSLCMYPIFKFGSEEQKKRYLPEMAAG
gi|1499217      YDC-AGLNPVAYGTIMLELERVDSGIRSFCSVQTALAMYPIWAYGTEEQKQKWLPGMAHG
gi|1637531      YGG-AGLDQISYGLIMQEIERGDSGVRSTASVQSSLVMYPIWKYGNEAQRKKYLPKLASG
gi|2418906      YGG-AGLDQLSYGLIMQELEAGDSAVRSAASVQSSLVMFPIYTYGSEEQKRKFLPKLATG
gi|2388457      YGC-AGVSTVASGLITKEVERVDSGFRSGMSVQSSLIMTGIYEFGSEELKERLLPQLAQG
gi|1341138      YGC-AGVSSVSYGLIAREIERVDSGYRSAMSVQSSLVMHPINEFGSDAQKDKYLPQLATG
gi|2683169      YGG-GGASYTAYGLIARELERVDSAYRSFMSVQSSLVMFPIEKYGTEEQKRKYLPKLATG
gi|1675241      YGC-PGMSYVAYGLLAREVERVDSAYRSAMSVQSSLVMYPIHAYGTEAHKEKYLPRLATG
GOS_123901      FGG-LGANYVTYGLITREIEKVDSGYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASG
gi|8385914      YGG-AGLSHVAYGLIAREVEAIDSGYRSAMSVQSSLVMYPIEAFGTEEQKHKYLPKLASG
gi|8331233      YGG-PGVNHVAYGLISREVERVDSGYRSAMSVQSSLVMHPIFSYGTEEQKKKYLPRLATG
gi|1841569      YGG-AGLNYVSYGLVAREIEYVDSGYRSMASVQSSLVMVPIHEFGTEEQKQKYLPKLATG
gi|1455890      YGG-SNLNYVSYGLIAREIERVDSGYRSMMSVQSSLVMVPINDFGTEAQKQKYLPKLASG
gi|7745634      YGG-SGLNYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASG
gi|1638578      YGG-AGLNYVSYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGSEAQKQKYLPKLASG
gi|8881172      YGG-AGANHVCYGLIARELERVDSSYRSALSVQSSLVMFPIATFGSPQQRSKYLPRLASG
gi|2209212      YGC-AGASYVAYGLVAREVERVDSGYRSMMSVQSSLVMYPIYAYGDETQRKTYLPGLASG
gi|2269418      WGC-AGVSHVAYGLVAREVERVDSGYRSAMSVQSSLVMYPIATYGSPEQQARWLPGLARG
gi|2840951      HGC-AGASNVAYGLVAREVERVDSGYRSAMSVQSSLVMHPINQWGNEAQKQKYLPKLATG
gi|4722027      YGC-AGTSYVAYGLIAREVERVDSGYRSVMSVQSSLVMHPISAYGTEAQKEKYLPRLARG
gi|1091235      YGC-AGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPRLAKG
gi|1497568      HGC-AGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMYPIYAYGSEEQQQKYLPRLAKG
gi|2813530      YGC-AGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYTYGSKEQQQKYLPRLAKG
gi|1992083      YGC-AGVSSVAYGLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEG
gi|1571071      YDC-AGVSNVAYGLLTREVERVDSGYRSAFSVQSSLCMGAIYDYGSEEQKQKYLPKMAKG
gi|2840424      YGC-AGASATAYGLACLELEAGDSGVRSLVSVQGSLAMFAIWRWGSEEQKQQWLPRMARG
gi|2399321      YGC-AGASAVQYGLACLELEAADSGIRSLVSVQGSLAMYAVHRFGSEEQKQRWLPRMAAG
gi|2380623      YGC-AGSTAVAYGLACLELEAGDSGVRSLVSVQGSLAMYAIWRYGSEEQKRRWLPPMATG
gi|2262278      YGC-AGLSSVAYGLIMQELERGDSGIRSFASVQGALVMYPIFAFGSEEQKRHYLPKLAKA
gi|7822328      YGC-AGLSNVAYGLLMYELERGDSGLRSFASVQGSLVMYPIYAYGSEAQKEYWLPKLAAG
gi|2573871      WGTLPGVSPRSYGLLMQELEAGDSGVRSMASVQGALVMYPIHEFGSEAQRERWLPDLAAG
gi|5537869      YGL-PGLSETAYGLLLQELEAGDSGLRSMASVQGALVMYPIHAYGSDAQKEEWLPALGSG
gi|2895825      YGS-PNVSETAYGLLMQELEAGDSGLRSMASVQGALVMYPIHAYGSEEQKEEWLPKLGQG
gi|2841637      YSS-PNVSETAYGLLMQELEACDSGLRSMASVQGALVMYPIHAYGSEEQKEEWLPALGRG
gi|2224809      YGL-PGVSETAYGLLMRELEACDSGLRSMASVQGALVMYPIHAFGSDAQKEEWLPKLGTG
gi|7680344      YGS-PNVSETAYGLLMQELEACDSGLRSMASVQGALVMYPIHAYGSEAQKEEWLPALGQG
gi|1692370      YGL-PNVSETAYGLLMQELEACDSGLRSMASVQGALVMYPIHAFGSEAQKERWLPALGAG
gi|1579126      YGL-PNVSETAYGLLMQELEACDSGLRSMASVQGALVMYPIHAFGSEAQKERWLPALGAG
gi|2398259      YGG-MGMDYNSLAIVCEELERGDTAFRTAVSVHTGLNSLTLLQWGTEEQKQKYLVPQAKG
gi|2377453      YGG-AGKDILSYAIAVEELSRVDGGTGVILSAHVSLGSYPIYAFGTEEQKKKYLVPLAKG
gi|2517792      YGG-AGLDILSYAIAVEELSRVDGGTGVILSAHVSLGTYPIFAYGTEEQKKKYMIPLAKG
                 .          .    *:.  * .     :.  .*    :  :*    .   :   . .

gi|1149859      EIIGAFGLTEPNHGSDPGSMEATARRDGDE---WVLNGTKTWISEADVADIAVVWARDVE
gi|1483586      NIIGCFGLTEPDSGSDPASMRTHAKKIEGG---WVLNGAKMWITNAPIADIAIVWAKT--
gi|1499217      ELIGCFGLTEPNSGSDPGSMRTHAKQESEGG-DYILNGQKMWITNSPISNLCVVWAKTLD
gi|1637531      EWMGSFGLTEPDHGSNPGGMTTNYKDMGDH---YLLNGAKMWISNSPFCQIAVVWAKNE-
gi|2418906      ELIGSFGLTEPNHGSDPGAMETRLSKDGDG---YILTGAKMWITNAPVCDLAVVWARDE-
gi|2388457      KLLGCFGLTEPNHGSDPGSMETTAKPHPTKKGYYSLSGTKTWITNSPISDAFLVWAKL--
gi|1341138      EIIGCFGLTEPNHGSDPSSMETTATKTSDG---WVLNGSKTWISNAPVADLFVIWARVVE
gi|2683169      ELIGCFGLTEPDHGSDPGSMETTARRVDGG---WILNGTKAWITNAPIADIAVVWARAKE
gi|1675241      ELVGAFGLTEPDHGSDPGSMATKAKAVDGG---YLLNGSKTWITNAPIADVFIIWANL--
GOS_123901      ESIGCFGLTEANSGSDPASMTTKAKKVNGG---FELNGSKMWISNAPIADVFVIWAKSEF
gi|8385914      EYVGCFGLTEPDGGSDPGAMRTTARKADGG---YVLNGAKMWITNSPISDLAVVWAKL--
gi|8331233      EIIGCFGLTEPDAGSDPGGMRTRAKKVDGG---YLLTGSKMWITNSPISDIAIVWAKSDA
gi|1841569      EYIGCFGLTEPDHGSDPGSMITRAKKVDGG---YRLTGAKMWITNSPIADVFVVWAKEVS
gi|1455890      EWIGCFGLTEPNYGSDAGGMITRAKKVPGG---FSLTGSKMWISNAPIADVFVVWAKND-
gi|7745634      EWIGCFGLTEPNHGSDPGAMITRARKVDGG---YSLTGAKMWITNSPIADVFVVWAKDD-
gi|1638578      EWIGCFGLTEPNHGSDPNGMETRAVLTGSG---YKLSGNKMWITNSPIADVFVVWAKCVG
gi|8881172      DWVGCFGLTEPDHGSDPGGMTSHAQKVRGG---YRVSGAKSWITHSPIADVLVIWAKL--
gi|2209212      ELVGCFGLTEPDAGSDPGGMKTRAKKIDGG---YLLSGVKTWISNAPIADVFVVWAKSAA
gi|2269418      ELVGCFGLTEPDAGSDPGSMHSRARKVDGG---YLLSGSKMWITNSPIADVLLVWARDD-
gi|2840951      ELIGCFGLTEPNHGSDPSSMETKAKLSQCGK-YYILNGSKMWITNSPIADIFVVWARSEA
gi|4722027      EILGCFGLTEPNHGSDPSGMETRARYNPSSD-TFSISGAKSWITNSPVADIAVVWAKCD-
gi|1091235      ELLGCFGLTEPNSGSDPSSMETRARYNSSNK-SYTLNGTKTWITNSPMADLFVVWARCE-
gi|1497568      ELLGCFGLTEPNHGSDPGSLETRARHNPSGR-SYTLNGTKTWITNSPVADLFVVWARCE-
gi|2813530      ELLGCFGLTEPNHGSDPGSMETRARHNPSNR-SYTLNGTKTWITNSPVADLFVVWARCE-
gi|1992083      KLIGAFGLTEPNHGSDPAGMETRAKYDSKSK-TYILNGSKTWITSAPIADVIVVWAKCE-
gi|1571071      ELIGCFGLTEPNHGSDPSSMETRAVHDPRTK-TYVLTGSKTWITNSPVADVCIVWGKTE-
gi|2840424      EAIGCFGLTEPDSGSDPGSMRTRARRDGDE---WVLNGQKMWITNGTIADVAVVWAQT--
gi|2399321      EVIGCFGLTEPDHGSDPASMRTYAKRDGGD---WVLNGRKMWITNGSVAGVAVVWART--
gi|2380623      EAIGCFGLTEPDHGSDPASMATRARRDGDD---WLLHGGKMWITNAPVADVAVIWARA--
gi|2262278      EYIGCFGLTEPDFGSNPSGMITRARQQADG--SWILNGAKMWITNGSKAHVAVVWAKTGD
gi|7822328      EKIGCFGLTEPDFGSNPAGMRTNAVREANGK--WRINGSKMWITNGSVADVAVVWART--
gi|2573871      DAVGCFGLTEPEHGSDPASMETTAVPDGDG---YRLSGTKTWITNAPIADVAVIWCKIDD
gi|5537869      ERVGCFGLTEPEHGSNPSAMETTAERDADG---YVLNGSKTWITNAPISDLAVVWAKVTS
gi|2895825      EAVGCFGLTEPEHGSNPSGMETYAEADGDG---YVLNGSKTWITNSPISDVAIVWARDRS
gi|2841637      EAVGCFGLTEPEHGSNPSAMETRAERDGDG---YILNGSKTWITNSPISDVAVVWARDQS
gi|2224809      EAVGCFGLTEPEHGSNPSAMETRAEADGDD---YVLNGSKTWITNSPIADVAVVWAKDHT
gi|7680344      EAVGCFGLTEPEHGSNPTAMETQAEKDGDE---YVLNGSKTWITNSPIADVAVVWARDTS
gi|1692370      EAVGCFGLTEPEHGSNPSAMETTAEPDGDE---YVLNGSKTWITNSPIADVAVVWARDHG
gi|1579126      EAVGCFGLTEPEHGSNPSAMETTAEPDGDE---YVLNGSKTWITNSPIADVAVVWARDHG
gi|2398259      EKIGAFGLTEPNAGSDVASISTTAVRDGDY---YILNGQKTWISLCDIADHFIVFAYTDK
gi|2377453      EKLGAFGLTEPNAGSDAGGTETTAVKEGDY---YILNGEKIFITNADVAETYVVFAVTTP
gi|2517792      EKIGAFGLTEPNAGSDAGGTETTAVLDGDY---YILNGGKIFITNADKADTYVVFAVTTP
                . :*.*****.: **:  .  :           : : * * :*:    .   :::     

gi|1149859      -----DGKIKG---FIVERGT--KG-FQ------------------QTAITKKASMRAGS
gi|1483586      -----EAGIRG---FIVDTKS--EG-MS------------------CPEIKLKMSLRASI
gi|1499217      FGSD-APVIRG---FVVERGM--KG-LS------------------TPETHGKLSLRASI
gi|1637531      -----EGRIHG---LIVERGM--EG-FS------------------TPETHNKWSLRASA
gi|2418906      -----EGKVKG---IIVERGM--NG-FT------------------TPETHNKWSLRASK
gi|2388457      -----DGKIRG---FVIERDQCPPGTLS------------------TPAIKNKTALRASI
gi|1341138      NGE--KGKVRG---FLVEKGT--AG-LS------------------APAIKNKMSLRASI
gi|2683169      HPDD-EGEIMG---FILERDM--PG-LS------------------TPETKNKMSLRASS
gi|1675241      -----DGDIRG---FVVERDGS-EG-LT------------------TPKIEGKLSLRASI
GOS_123901      H----ENKIKG---FILEKNF--KG-LE------------------TKKIPGKLSLRASV
gi|8385914      -----DGEIRG---FIVDKGT--EG-FD------------------CPKIEGKLSLRASI
gi|8331233      H----EGKIKG---FIVEKGI--KG-FT------------------TPKIEGKLSLRASI
gi|1841569      AEGN-VGDIRG---FILEKGW--EG-LS------------------APAIHGKVGLRASI
gi|1455890      -----EGIIRG---YILEKGM--KG-LS------------------APKISGKLGLRASI
gi|7745634      -----AGDIRG---FVLEKGW--KG-LS------------------APAIHGKVGLRASI
gi|1638578      GDY--DGKIRG---FILEKGM--KG-LS------------------APAIHGKVGLRASI
gi|8881172      -----DGEIRG---FILERDM--TG-LE------------------TPKIEGKFALRASV
gi|2209212      H----DNQIRG---FILEKGM--KG-LS------------------APKIKGKLSLRASV
gi|2269418      -----AGDIRG---FVLERGM--AG-LS------------------TPKIEGKFSLRASV
gi|2840951      H----EGKIKG---FILEKGM--KG-LT------------------APKIEGKMSLRASI
gi|4722027      -----DDRVRG---FILERGM--KG-FS------------------TPKIEGKFSLRTSA
gi|1091235      -----DGCIRG---FLLEKGM--RG-LS------------------APRIQGKFSLRASA
gi|1497568      -----DGRIRG---FLLEKGM--RG-LS------------------APKIEGKFSLRASA
gi|2813530      -----DSCIRG---FLLEKGM--RG-LS------------------APKIEGKFSLRASS
gi|1992083      -----DGKVRG---FLVDRKISGKG-LE------------------TPKIEGKFSLRASP
gi|1571071      -----DGRVRG---FIVDREQSSTG-LS------------------TPKIQGKFSLRASD
gi|2840424      -----DDGVRG---FLVPRGT--PG-FS------------------APEIHKKLSLRASV
gi|2399321      -----DEGIRG---FVVPTDS--AG-FS------------------APEIRHKWSLRASV
gi|2380623      -----EEGVRG---FAVPLDA--PG-VS------------------VREMRRKMSLRASV
gi|2262278      STD--DSSIRG---FIVPTDT--PG-FQ------------------ARDQKGKLSLRASD
gi|7822328      -----DDGVRG---FLVEKGT--PG-FS------------------APKMHGKWSLRASV
gi|2573871      GDAETDDPVRG---VLVDLDS--EG-VSEEQGETEPRQTDRSGGVETSEIDGKLSMRASS
gi|5537869      AD---GDPVRG---FLVETDR--DG-VT------------------TNKIDEKLSLRASI
gi|2895825      SE---DNPVRG---FLVETDR--DG-VS------------------TNKITEKLSLRASI
gi|2841637      DP---DTPVRG---FLVETDR--DG-VS------------------TNKITEKLSLRASI
gi|2224809      EE---GTPVRG---FLVETDR--DG-VT------------------TNKIDEKLSLRASI
gi|7680344      AD---DTPVRG---FLVETDR--DG-VT------------------TNKIDEKLSLRASI
gi|1692370      ED---GTPVRG---FLVETDR--DG-VT------------------TNEIDEKLSLRASI
gi|1579126      ED---GTPVRG---FLVETDR--DG-VT------------------TNEIDEKLSLRASI
gi|2398259      -----SKKHRGISAFIVERTM--PG-FS------------------SKAIKGKLGIRAGN
gi|2377453      -----DIGTKGISAFIVEKGW--EG-FT------------------FGDHYDKLGIRSSS
gi|2517792      -----DIGVRGISAFIVEKGW--EG-FT------------------FGDHYDKLGIRSSS
                          *     :       * .                         * .:*:. 

gi|1149859      VGELGLVNCRVPEE-NRLPEA-RGLGAPLSCLNQARFGISWGAIGAAMDCYETALNYTKE
gi|1483586      TGELVFDNVFVPDE-NLLPKSEKGLGAALSCLSQARYGIAWGAMGAAMACFDIARNYLLE
gi|1499217      TGEIVLDDVRVPKE-NMLPGV-RGLKGPLSCLTQARYGIGWGGVGAAMDVYERARRYTLE
gi|1637531      TGELIFDNVKVPKE-NLLPNK-SGLGAPLGCLDSARFGIAWGAIGAAMDCYDTALRYSKE
gi|2418906      TGELIFEDVRIPQA-NILPDV-SSMKGPLSCLNSARYGISWGVIGAAVDCYQTALRYSLE
gi|2388457      TGMIQMDNCPVPEA-NMFPEV-SGLVGPFTCLNSARLGIAFGTMGALEDCISRAREYALE
gi|1341138      TGSIFMEDVKVSDD-AVLPKS-NGLGSPFSCLNNARYGISWGVMGALEDCIARARDYAIE
gi|2683169      TGEIVMEDVFVPDA-NVLPGV-RGLRGPFSCLSNARYGIAWGTVGAAEDCYQRTRRYVME
gi|1675241      TGQIMLDNVFVPEE-NLFPTV-KGLKGPFGCLNNARYGIAWGALGAAESCFEVARQYTLD
GOS_123901      TGEISFNNVFVPEE-N--------------------------------------------
gi|8385914      TGSISLNDAFVPEE-NLLPHV-KGLRGPFSCLNKARYGIAWGAMGAAEFCLHAARDYAME
gi|8331233      TGEIVLDEAFVPDE-ALMPNA-SGLGGPFGCLNKARYGIAWGVIGAAEFCWHAARQYMLD
gi|1841569      TGEIVMDNVFVPEE-NAFPEI-RGLKGPFTCLNSARYGIAWGAMGAAEFCWHTAHQYTMD
gi|1455890      TGEIVMDEVFVPDE-NEFPEV-TGLKGPFTCLNSARYGISWGALGAAEWCWHAARQYTLD
gi|7745634      TGEIVMDNVFVPEE-NIFPDV-RGLKGPFTCLNSARYGISWGALGAAEFCWHTARQYTLD
gi|1638578      TGEIVMDEVEVSAE-QMLPDV-SGLRGPFTCLNSARYGIAWGALGAAEACWHTARQYTLD
gi|8881172      TGQIHMDEVFVPEA-NALL-V-EGLKGPFSCLSKARYGIIWGSMGAAEFCWQAARRYSLE
gi|2209212      TGEIVMDGVEVPES-ALLPNV-SGLKGPFGCLNRARYGISWGAMGAAEDCWHRARQYTLD
gi|2269418      TGEIVMDGVMVPDS-HCLPGV-RGLKGPFSCLNKARYGIALGALGAAESCWHTARQYVLD
gi|2840951      TGSIGMDDVHVPVE-NLLPHA-SGLGGPFSCLNSARYGIAWGALGAAEYCFHTARQYQID
gi|4722027      TGMILMDEVEVPKD-NLLPNA-SGLAGPFGCLNNARYGISWGALGAAEFCFHTARQYTLD
gi|1091235      TGMIIMDGVEVPEE-NMLPGA-SSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALD
gi|1497568      TGLIVMDDVEVPEE-NVLPNA-SGLAGPFGCLNNARYGITWGVLGAAEFCLHTARQYTLD
gi|2813530      TGMIVMDSVEVPEE-NVLPDV-SGLAGPFGCLNNARFGIAWGVLGAAEFCLHTARQYTLD
gi|1992083      TGMILMDEVRVPEE-QLLPNV-AGFSGPFSCLNNARYGIAWGALGAAETCVEIARQYTLD
gi|1571071      TGMILMDEVRIPED-NILPNV-SGMRGPFGCLNNARYGIAWGALGAAESCLKVARQYTLD
gi|2840424      TSELVLDDVRLPDS-ARLPEA-TSLRGPLSCLNEARYGIVWGAAGAARACFEAALDYSKT
gi|2399321      TSELVLDDVRLPAD-AVLPEA-TGLKGPLSCLSHARYGIVWGAMGAARSCFEAAVDYAKS
gi|2380623      TGEIALDDVRLPAD-ALLPGA-AGLKAPLSCLTEARHGIVWGALGAARDCLETTLGYATT
gi|2262278      TSELVLSDVHLPAD-AILPHS-NGLKSPLMCLTQARYGISWGVLGAAMACLEEAVSYSKS
gi|7822328      TSELVFEDVIVDEEKSLLPNV-KGLKGPLGCLTQARYGIAWGALGAADACYQAALEYALS
gi|2573871      TGEIHLRDAWVPED-ALLPGV-EGMKGPLSCLTEARYGIAWGAVGAARDCFEAAREYATD
gi|5537869      TGEISLQNAHVPEE-NVLPGV-EGMKGPLSCLTQARYGIAWGTVGAAMDCFETAHEYATD
gi|2895825      TGEIGLNNVHVPEE-NVLPGV-SGMKGPLSCLTQARYGIAWGAIGAARDAFEEARQYAQD
gi|2841637      TGEIGLNDVHVPEE-NVLPGV-SGMKGPLSCLTQARYGIAWGAVGAARDCFEEARQYAKD
gi|2224809      TGEISLQDVHVPAE-NVLPEV-TGMKGPLSCLTQARYGIAWGAVGAAMDCFEVAREYATD
gi|7680344      TGEIGLQNVRVPET-NVLPEV-EGMKGPLSCLTQARYGIAWGAIGAARDCFETAREYATD
gi|1692370      TGEISLRNVRVPAE-SRLPGV-EGMKGPLSCLTQARYGIAWGAVGAARNCFETAREYATD
gi|1579126      TGEISLRNVRVPAE-SRLPGV-EGMKGPLSCLTQARYGIAWGAVGAARNCFETAREYATD
gi|2398259      TGELFFDNVRVPKE-NLLGEEGEGFKIAMSALDNGRFTVAAGAVGLIMACLEASVKYCHE
gi|2377453      TCQLLFNNVKVPKE-NLLGKEGDGFKIAMSTLDGGRIGIAAQALGIAQGAFEHALEYAKE
gi|2517792      TAELIFNNVKVPKE-NLLGKEGQGFKISMQTLDGGRIGIASQALGIAQGAYENALEYSKE
                .  : :    :                                                 

gi|1149859      RKQF-GAPLASYQLVQEKLVNMLIEITKGQLLAWRLAKLMDE-GKATTEQISMAKKNNVR
gi|1483586      RKQF-AKPLASFQLIQKDLADMYTEIIKAQCLNLQIGRLKDQ-HRETPTMISLAKGNACR
gi|1499217      RVQF-GKPIAGFQLTQQKLVEMHNAIGKGLLLAHHCGRLKQE-GKLDPVQVSFIKRDNIQ
gi|1637531      RIQF-GKPIGQFQLQQKKLAEMITEITKAQLLAWRLGVLREN-GKATSAQISMAKRNNVE
gi|2418906      RQQF-GKPVASYQLQQKKLAEFLTEITKAQLLSWRLGVLKNE-GKATPQQISMAKRNNVN
gi|2388457      RKQFKGNPLAKYQLVQKKLADAATDAAYGTLAAVQVARLKDE-GKAVPEMISMIKRQNCD
gi|1341138      RNQF-KRPLASFQLIQKKLADASTAATLGLLGALQLGRLKDK-GEWSSDMVSMMKRNNCG
gi|2683169      RTQF-GYPLAAMQLIQTKLANMLTEITQMQLLVFRLGQLADE-GKVTPAQISLAKRNNAG
gi|1675241      RQQF-GRPLAANQLMQKKFADMLTEINIGLQACLRVGRLREEHGEFTPDLVSMIKRNSCG
GOS_123901      ------------------------------------------------------------
gi|8385914      RVVF-GKPIAGTQLVQKKLADMQTEIALGYQGALALGRMLDQ-GAWIPEAISMMKRNNCG
gi|8331233      RKQF-GRPLAANQIPQLKLANMMTEITLGLQACVRVGRMMDD-HTWAPEAVSLIKRNNCG
gi|1841569      RKQF-GRPLAANQLIQKKLADMQTEIALGLQAALRFGRMKDE-GIASVEGTSLIKRNNCG
gi|1455890      RKQF-GKPLAANQLIQKKLADMQTEIALGLQGCLRLGRMKDE-GIAAPEITSIMKRNSCG
gi|7745634      RQQF-GRPLAATQLIQKKLADMQTEITLALQGCLRLGRMKDE-GTAAVEITSIMKRNSCG
gi|1638578      RKQF-GRPLAANQLIQKKLADMQTEITLGLQGCLRLGRMKDE-GTAAVEITSIMKRNSCG
gi|8881172      RTQF-GRPLAANQLIQKKLADMQTEITLGLQAALRLGRLIDA-DRWAPEMVSLLKRNNCG
gi|2209212      RTQF-GRPLAQTQLVQRKLADMQTEIALGLQASLRVGRLFDE-GRVAPEMISIVKRNNCG
gi|2269418      RLQF-GRPLAANQLVQWKLAEMQTEIALGLQAALQVGRLMDA-GTAAPEMVSLIKRNNCG
gi|2840951      RKQF-GRPLAQNQLPQKKMADMLTEISLGLVSCVQLGRLKDK-GEWAPEMISMLKRNNAG
gi|4722027      RIQF-GVPLARNQLMQKKMADMLTEITIGLQSCLALGRLIDQ-KKAVPEMISMLKRNSCG
gi|1091235      RMQF-GVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQ-DKAAPEMVSLLKRNNCG
gi|1497568      RIQF-GVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQ-DKATPEMISLLKRNNCG
gi|2813530      RIQF-GAPLARNQLIQKKLADMLTEITLGLHTCLQLGRLKDQ-DKATPEMVSLLKRNNCG
gi|1992083      RKQF-GRPLAANQLIQKKLADAITEIALGLQACLHVGRLKDQ-KLHTPDMISLLKRNNTG
gi|1571071      RKQF-KKPLAANQLMQKKMADMLTEISLGLTACLHVGRLKDQ-KLHTPEMISMLKRNNAG
gi|2840424      RIQF-DKPIASFQLVQQRLAEMAVKVNQSTLLALHLGRLKDA-GTLRPEHVSMGKLANVN
gi|2399321      REQF-GRPIGGFQLTQAKLADMAVELHKGILLAHHLGRRMDA-GRLRPEQVSFGKLNNVR
gi|2380623      RTQF-GRPLAGFQLTQAKLADMAVEWQKGFLLALHLGRLADA-GRLRPEQVSVGKLNNVR
gi|2262278      RVMF-DKPIGGFQIQQVRLADMFTELVKGQLVSLHLGRLKDA-GNFTPVQVSLAKRNNCD
gi|7822328      RIQF-DKPIASYQLQQRKLAEMVTEITKGQLLVMQLGRLKDQ-GNYSPAQVSMAKMNNVH
gi|2573871      REQF-GGPIARFQLQQEKLAEMATRITTAQLLADRLATLKAR-GDLRPQQVSMAKRNNVR
gi|5537869      REQF-GKPIAGYQLQQEKLAEMATQISLGQLLAHRLADLKER-GDLRPEQVSMAKRNNAR
gi|2895825      REQF-GGPIGRFQLQQRKLAEMATQITLAQLLAYRLAELKER-GDMQPHHVSLSKRNNVR
gi|2841637      RDQF-GGPIGRFQLQQRKLAEMGTQITLAQLLAYRLAELKER-GEMRPQHVSMAKRNNVR
gi|2224809      REQF-GKPIGGFQMQQQKLAEMATQITLAQLLAHRLADLKEA-GEMRPQHVSMAKRNNVR
gi|7680344      REQF-GTPIGQFQLQQDKLAEMATQISLAQLLAHRLAELKER-GDMRPQHVSMSKRNNVR
gi|1692370      REQF-DQPIGGFQMQQDKLAEMATQITTSQLLAHRLAGLKER-GDLRPQHVSMAKRNNVR
gi|1579126      REQF-DQPIGGFQMQQDKLAEMATQITTSQLLAHRLAGLKER-GDLRPQHVSMAKRNNVR
gi|2398259      RKTF-GKEIGRHQLVQQMIARMEAGLQISRLLVYKVGFLKNQ-GRRTTREASLAKWIACD
gi|2377453      REQF-GKPIAFQQAISFKLADMATKIRTARFLIYSAAELKEH-HEPYGMESAMAKQYASD
gi|2517792      RVQF-GKPICQQQVISFKLADMATKIRAARLLVYSAAELKEN-HESYSMEAAMAKQYASD
                                                                            

gi|1149859      VARYCARTARELLGANGISLDYSPIRHMANIESVYTYEGTDDIHTLILGRAITG------
gi|1483586      EALKIARKCRNLMGGNGISLEYHVIRHMLNLESVFTYEGTDNVHTLVLGRHITG------
gi|1499217      LARECAKTARTMLGGNGIMGEFHIMRHLCNLETVYTYEGTHEIHTLAIGRALTG------
gi|1637531      MALKIAREARQMLGGMGISGEYSIMRHMMNLESVVTYEGTHDIHLLITGLDVTG------
gi|2418906      MALQIARESRQMLGAMGIVGEFPIMRHMMNLESVITYEGTHDIHLLITGQDITG------
gi|2388457      RALAGARTLQEIFGGNAASDEYHIGRHVANLFVAQTYEGQSDIHSLILGRAITG------
gi|1341138      EALHHSRVLLDILGGNACSDEYHIGRHAANLQVANTYEGTNDIHALILGKAITG------
gi|2683169      KALEIARMARDMHGANGIVGEYRVIHHMVNLESVNTYEGTYDIHGLILGREITG------
gi|1675241      KALDIARMTRDMLGGNGISEDYHVLRHAINLETVNTYEGTHDIHALILGRAITG------
GOS_123901      ------------------------------------------------------------
gi|8385914      KALAIAREARDIHGGNGIAEEYHILRHAINLETVNTYEGTHDVHALILGRAMTG------
gi|8331233      KALDIARMARDMHGGNGISEEFHVIRHMVNLETVNTYEGAHDVHALILGRAMTG------
gi|1841569      KALDIARMARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|1455890      KSLDIARMARDMHGGNGISDEYGVARHMMNLEVVNTYEGTHDIHALILGRAQTG------
gi|7745634      KSLEIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|1638578      KALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTG------
gi|8881172      KALEIARTARDIHGGNGIVDEYHVIRHMLNLEAVNTYEGTHDIHALILGRAQTG------
gi|2209212      KALAIAREARDMHGGNGIMGEYHVMRHAQNLETVNTYEGTHDVHALILGRAQTG------
gi|2269418      KALGIARMARDMLGGNGISDEFGVIRHVLNLEAVNTYEGTHDIHALILGRAQTG------
gi|2840951      KALEIARVCRDMLGGNGIADEYHIIRHSANLESVNTYEGTHDIHALILGRSITG------
gi|4722027      KALDIARQARDMLGGNGISDEYHIIRHVMNLESVNTYEGTHDIHALILGRAITG------
gi|1091235      KALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG------
gi|1497568      KALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG------
gi|2813530      KALDIARQARDILGGNGISDEYHVIRHAMNLEAVNTYEG---------------------
gi|1992083      KSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALILGRAITG------
gi|1571071      KALEIARVARDMLGGNGIADEYHIIRHVMNLEAVNTYEGTHDIHALILGRAITG------
gi|2840424      AALDVARTARQVLGANGITLEYPVIRHMNNLESVVTYEGTADVHALVIGHALTG------
gi|2399321      EAIDICRTARTVLGANGISLAYPVMRHATNLESVLTYEGTVEMHQLVLGKALTG------
gi|2380623      EALAIARQCRTILGANGVSGEYPIMRHANNLESVLTYEGTSEIHQLVIGQRLTG------
gi|2262278      IATNIARETRRLLGANGILAEYSAMRHMANLESVYTYEGTHDVHSLILGQALTG------
gi|7822328      VAINICRTARTILGANGIMSEYPIMRHANNLEAVYTYEGTHDMHLLIIGEKVTG------
gi|2573871      MAREVAQTAREMLGGNGITTDYPPMRHAANMETVYTYEGTHDIHTLILGADLTG------
gi|5537869      MAREQSRVAREMLGGNGITADYSPMRHLTNLETVYTYEGTHDIHSLIIGHDLTG------
gi|2895825      MARDQTRVAREMLGGNGITTDYSPMRHMANMETVYTYEGTHDIHTLVLGEELTG------
gi|2841637      TARDQARIAREMLGGNGITTDYSPMRHMANMETVYTYEGTHDIHTLVLGEEFTG------
gi|2224809      TARDQSRIAREMLGGNGITADYSPMRHMTNMETVYTYEGTHDIHTLIIGEDLTG------
gi|7680344      MARNQSRIAREMLGGNGITADYSPMRHMANLETVYTYEGTHDIHTLILGEDLTG------
gi|1692370      MARDQARVAREMLGGNGITTDYPPMRHMANMETVYTYEGTHDIHTLILGEDLTG------
gi|1579126      MARDQARVAREMLGGNGITTDYPPMRHMANMETVYTYEGTHDIHTLILGEDLTG------
gi|2398259      FANQAADDAVQIHGAYGYSNEYPVERYLRNSKAPVIYEGTREIHTIMQAEYVLG------
gi|2377453      IALEVVNDALQIFGGAGYLKGMEVERAYRDAKITTIYEGTNEIQRVVIAAHLIGKPPKTD
gi|2517792      ICLEVVNDSLQIFGGNGYLKGMDVERAYRDAKICTIYEGTNEIQRMVIASHIIGKMPKNE
                                                                            

gi|1149859      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|1499217      ------------------------------------------------------------
gi|1637531      ------------------------------------------------------------
gi|2418906      ------------------------------------------------------------
gi|2388457      ------------------------------------------------------------
gi|1341138      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|1675241      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|2840951      ------------------------------------------------------------
gi|4722027      ------------------------------------------------------------
gi|1091235      ------------------------------------------------------------
gi|1497568      ------------------------------------------------------------
gi|2813530      ------------------------------------------------------------
gi|1992083      ------------------------------------------------------------
gi|1571071      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2380623      ------------------------------------------------------------
gi|2262278      ------------------------------------------------------------
gi|7822328      ------------------------------------------------------------
gi|2573871      ------------------------------------------------------------
gi|5537869      ------------------------------------------------------------
gi|2895825      ------------------------------------------------------------
gi|2841637      ------------------------------------------------------------
gi|2224809      ------------------------------------------------------------
gi|7680344      ------------------------------------------------------------
gi|1692370      ------------------------------------------------------------
gi|1579126      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      VPGLVKKKKGPVTGPRKNIIFKDGSAKEKVAALVAALKADGYDFTVGIPLDTPIGKSERV
gi|2517792      NRDRKTSSREPLTGVRKKIIIKDGTAEERVFKLVEVLKADGYDFTVGIDINTPISKAERV
                                                                            

gi|1149859      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|1499217      ------------------------------------------------------------
gi|1637531      ------------------------------------------------------------
gi|2418906      ------------------------------------------------------------
gi|2388457      ------------------------------------------------------------
gi|1341138      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|1675241      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|2840951      ------------------------------------------------------------
gi|4722027      ------------------------------------------------------------
gi|1091235      ------------------------------------------------------------
gi|1497568      ------------------------------------------------------------
gi|2813530      ------------------------------------------------------------
gi|1992083      ------------------------------------------------------------
gi|1571071      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2380623      ------------------------------------------------------------
gi|2262278      ------------------------------------------------------------
gi|7822328      ------------------------------------------------------------
gi|2573871      ------------------------------------------------------------
gi|5537869      ------------------------------------------------------------
gi|2895825      ------------------------------------------------------------
gi|2841637      ------------------------------------------------------------
gi|2224809      ------------------------------------------------------------
gi|7680344      ------------------------------------------------------------
gi|1692370      ------------------------------------------------------------
gi|1579126      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      VSAGKGIGDKKNMKLIENLAKQAGASIGSSRPVAETLQYVPLDRYVGMSGQKFVGNLYIA
gi|2517792      VSVGKGIGEEKNMELAKSLAVQAGAAIGSSRPVAETLKYLPLNRYVGMSGQKFNGNLYIA
                                                                            

gi|1149859      ------------------------------------------------------------
gi|1483586      ------------------------------------------------------------
gi|1499217      ------------------------------------------------------------
gi|1637531      ------------------------------------------------------------
gi|2418906      ------------------------------------------------------------
gi|2388457      ------------------------------------------------------------
gi|1341138      ------------------------------------------------------------
gi|2683169      ------------------------------------------------------------
gi|1675241      ------------------------------------------------------------
GOS_123901      ------------------------------------------------------------
gi|8385914      ------------------------------------------------------------
gi|8331233      ------------------------------------------------------------
gi|1841569      ------------------------------------------------------------
gi|1455890      ------------------------------------------------------------
gi|7745634      ------------------------------------------------------------
gi|1638578      ------------------------------------------------------------
gi|8881172      ------------------------------------------------------------
gi|2209212      ------------------------------------------------------------
gi|2269418      ------------------------------------------------------------
gi|2840951      ------------------------------------------------------------
gi|4722027      ------------------------------------------------------------
gi|1091235      ------------------------------------------------------------
gi|1497568      ------------------------------------------------------------
gi|2813530      ------------------------------------------------------------
gi|1992083      ------------------------------------------------------------
gi|1571071      ------------------------------------------------------------
gi|2840424      ------------------------------------------------------------
gi|2399321      ------------------------------------------------------------
gi|2380623      ------------------------------------------------------------
gi|2262278      ------------------------------------------------------------
gi|7822328      ------------------------------------------------------------
gi|2573871      ------------------------------------------------------------
gi|5537869      ------------------------------------------------------------
gi|2895825      ------------------------------------------------------------
gi|2841637      ------------------------------------------------------------
gi|2224809      ------------------------------------------------------------
gi|7680344      ------------------------------------------------------------
gi|1692370      ------------------------------------------------------------
gi|1579126      ------------------------------------------------------------
gi|2398259      ------------------------------------------------------------
gi|2377453      CGISGALQHLKGIKDATTIVAINTNANAPIFKNADYGIVGDLVEILPLLTKELDNGEAKK
gi|2517792      CGISGAGQHLKGIKDATTIVAINNNPNAPIFKNSDYGIIGDILEIMPLLAAALDNGEPKK
                                                                            

gi|1149859      ----------------YQAFRRELR-----------------------------------
gi|1483586      ----------------INAFG---------------------------------------
gi|1499217      ----------------LSAFN---------------------------------------
gi|1637531      ----------------LNAFK---------------------------------------
gi|2418906      ----------------ISAF----------------------------------------
gi|2388457      ----------------VQAFV---------------------------------------
gi|1341138      ----------------LQAFAN--------------------------------------
gi|2683169      ----------------IQAFVPRGNDLPPKKKPAPATAS---------------------
gi|1675241      ----------------LQSFKP--------------------------------------
GOS_123901      ------------------------------------------------------------
gi|8385914      ----------------LQAFS---------------------------------------
gi|8331233      ----------------IQAFS---------------------------------------
gi|1841569      ----------------IAAFSN--------------------------------------
gi|1455890      ----------------IQAFS---------------------------------------
gi|7745634      ----------------LQAFY---------------------------------------
gi|1638578      ----------------IQAFS---------------------------------------
gi|8881172      ----------------IPAFTG--------------------------------------
gi|2209212      ----------------LQAFF---------------------------------------
gi|2269418      ----------------IQAFV---------------------------------------
gi|2840951      ----------------LAAF----------------------------------------
gi|4722027      ----------------LQSFTVGK------------------------------------
gi|1091235      ----------------IQAFTASK------------------------------------
gi|1497568      ----------------IQAFTASK------------------------------------
gi|2813530      ------------------------------------------------------------
gi|1992083      ----------------LAAFAN--------------------------------------
gi|1571071      ----------------IQAFA---------------------------------------
gi|2840424      ----------------IQAFR---------------------------------------
gi|2399321      ----------------IDAFR---------------------------------------
gi|2380623      ----------------LNAFA---------------------------------------
gi|2262278      ----------------LSAFK---------------------------------------
gi|7822328      ----------------ISAFR---------------------------------------
gi|2573871      ----------------IDAFE---------------------------------------
gi|5537869      ----------------IPAFE---------------------------------------
gi|2895825      ----------------IKAYQ---------------------------------------
gi|2841637      ----------------IPAYE---------------------------------------
gi|2224809      ----------------IPAYQ---------------------------------------
gi|7680344      ----------------LQAYQ---------------------------------------
gi|1692370      ----------------MQAYQ---------------------------------------
gi|1579126      ----------------MQAYQ---------------------------------------
gi|2398259      ------YRQDKPLRKMLPPWNPDSVKL---------------------------------
gi|2377453      DAPPMKKM-KRVIPRVVYSPHVYVCSGCGHEYNPDLGDEDSDIKPGTRFKDLPEDWTCPD
gi|2517792      EAPPMKKMKKRVSEKVIPNWKRYVCDGCGYEYDPAIGDLENDIVPGTLFEALPDEWICPD
                                                                            

gi|1149859      -------------
gi|1483586      -------------
gi|1499217      -------------
gi|1637531      -------------
gi|2418906      -------------
gi|2388457      -------------
gi|1341138      -------------
gi|2683169      -------------
gi|1675241      -------------
GOS_123901      -------------
gi|8385914      -------------
gi|8331233      -------------
gi|1841569      -------------
gi|1455890      -------------
gi|7745634      -------------
gi|1638578      -------------
gi|8881172      -------------
gi|2209212      -------------
gi|2269418      -------------
gi|2840951      -------------
gi|4722027      -------------
gi|1091235      -------------
gi|1497568      -------------
gi|2813530      -------------
gi|1992083      -------------
gi|1571071      -------------
gi|2840424      -------------
gi|2399321      -------------
gi|2380623      -------------
gi|2262278      -------------
gi|7822328      -------------
gi|2573871      -------------
gi|5537869      -------------
gi|2895825      -------------
gi|2841637      -------------
gi|2224809      -------------
gi|7680344      -------------
gi|1692370      -------------
gi|1579126      -------------
gi|2398259      -------------
gi|2377453      CGDPKSGYIDAKK
gi|2517792      CGEEKDMFIEI

Protein Domains

PROTOCOLE:


InterPro, default parameters




ANALYSE DES RÉSULTATS:


On observe:


> par comparaison de séquence protéique 11 domaines extrait des banques de données.

> deux fonctions représentées dans ces domaines :


- Acyl-CoA oxidase/déhydrogenase : 10 fois

- electron transport oxidoreductase : 1 fois


On s'intéressera à la fonction la plus représentée car la plus probable donc l'Acyl-CoA déhydrogenase.


Pour les domaines protéiques, on choisira :


- ceux d'une longueur significative, donc pas IPR006089.

- ceux qui ne se chevauchent pas et qui permettent un englobement maximale de la séquence protéique.


Il ne nous reste plus que 3 domaines: IPR 009075 complémentaire de IPR 009100 et PTHR10909:SF10.

On a choisi de coupler IPR 009075 et IPR 009100 car ils ont un meilleur recouvrement protéique.

Le domaine PTHR10909:SF10 ne recouvre pas la séquence en "N-ter" et "C-ter" or notre séquence est incomplète, le domaine le plus pertinent devrait donc recouvrir la séquence en ces extrémités ce qui n'est pas le cas pour ce domaine.

Cependant, son e-value est de l'ordre de -118, bien plus faible que l'e-value des domaines choisis ce qui devrait en temps normal motive notre choix pour ce dernier. Or, ce domaine n'est pas classé dans InterPro car il n'a pas été assez analysé.


Hypothèse : ce domaine pourrait être de la même famille que ceux choisis.


Ce domaine n'est donc pas envisageable.

RÉSULTATS BRUTS:

GOS_1239010	11DC12F526521C38	300	Gene3D	G3DSA:1.10.540.10	no description	1	99	6.3e-27	T	10-Feb-2010	IPR013786	Acyl-CoA dehydrogenase/oxidase, N-terminal	Biological Process: metabolic process (GO:0008152), Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Molecular Function: FAD binding (GO:0050660), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	Gene3D	G3DSA:2.40.110.10	no description	100	206	3.2e-29	T	10-Feb-2010	IPR006091	Acyl-CoA oxidase/dehydrogenase, central region	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	Gene3D	G3DSA:1.20.140.10	no description	206	300	6.9e-22	T	10-Feb-2010	IPR013764	Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal	Molecular Function: electron carrier activity (GO:0009055), Molecular Function: oxidoreductase activity (GO:0016491), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	superfamily	SSF56645	Acyl-CoA dehydrogenase NM domain-like	3	205	4.9e-66	T	10-Feb-2010	IPR009100	Acyl-CoA dehydrogenase/oxidase	Biological Process: metabolic process (GO:0008152), Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	superfamily	SSF47203	Acyl-CoA dehydrogenase C-terminal domain-like	206	300	1.6e-21	T	10-Feb-2010	IPR009075	Acyl-CoA dehydrogenase/oxidase C-terminal	Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	HMMPanther	PTHR10909:SF10	ACYL-COA DEHYDROGENASE	55	284	2.3e-118	T	10-Feb-2010	NULL	NULL	
GOS_1239010	11DC12F526521C38	300	HMMPanther	PTHR10909	ELECTRON TRANSPORT OXIDOREDUCTASE	55	284	2.3e-118	T	10-Feb-2010	NULL	NULL	
GOS_1239010	11DC12F526521C38	300	HMMPfam	PF02771	Acyl-CoA_dh_N	7	97	5.6e-26	T	10-Feb-2010	IPR006092	Acyl-CoA dehydrogenase, N-terminal	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	HMMPfam	PF02770	Acyl-CoA_dh_M	101	151	4e-18	T	10-Feb-2010	IPR006091	Acyl-CoA oxidase/dehydrogenase, central region	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	HMMPfam	PF00441	Acyl-CoA_dh_1	207	296	5.4e-14	T	10-Feb-2010	IPR006090	Acyl-CoA oxidase/dehydrogenase, type 1	Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627), Biological Process: oxidation reduction (GO:0055114)
GOS_1239010	11DC12F526521C38	300	PatternScan	PS00072	ACYL_COA_DH_1	103	115	NA	T	10-Feb-2010	IPR006089	Acyl-CoA dehydrogenase, conserved site	Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995), Biological Process: oxidation reduction (GO:0055114)

Phylogeny

PROTOCOLE:


Hyphothèse 1  : La protéine codée par notre séquence est homologue à une (ou plusieurs) séquence mitochondriale eucaryote: "a-proteobacteria" et "eucaryotes" vs "b-proteobacteria" et "g-proteobacteria"


a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur : "b-proteobacteria" et "g-proteobacteria" _ alignement multiple


b) Phylogeny.fr / méthode BioNJ / pas de bootstrap / default substitution model / groupe extérieur : "b-proteobacteria" et "g-proteobacteria" _ alignement multiple



Hypothèse 2 :La protéine n'est pas homologue à une (ou plusieurs) protéine mitochondriale eucaryote: "proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria" vs "othersb bacteria" : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria"


a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria" _ alignement multiple


b) Phylogeny.fr / méthode BioNJ / pas de bootstrap / default substitution model / groupe extérieur : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria" _ alignement multiple


Hypothèse 3 :La protéine codée par notre séquence a des homologues dans différents groupes phylogénétiques ceci est peut être du à des transferts horizontaux intervenu lors de l'évolution des espèces : "proteobacteria","others bacteria", "eucaryotes","archaea"


a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model/ pas de groupe exterieur_ alignement multiple




ANALYSE DES RÉSULTATS:


Nous avons réalisé les arbres phylogénétiques avec nos deux hypothèses.


Hypothèse 1 : protéine mitochondrial : "a-proteobacteria" et "eucaryotes" vs "b-proteobacteria" et "g-proteobacteria"


Par la méthode PhyML, on observe sur l'arbre que les Eucaryotes ainsi qu'une béta-protéobactéries : Laribacter hongkongensis et une gamma-protéobactérie : Shewanella benthica sont regroupés sur la même branche. Donc les séquences des différents organismes sont plus proches en comparaison aux autres séquences.Cette intrusion de g et b-protéobacteries parmi les eucaryotes pourraient s'expliquer par l'hypothése 3.


Nous avons enraciné l'arbre de façon à s'éparer le groupe extérieur au mieux :


-Acinetobacter baumannii [g-proteobacteria]

-Rhizobium leguminosarum [a-proteobacteria]

-Pseudomonas fluorescens [g-proteobacteria]

-Polynucleobacter sp [b-proteobacteria]


Enfin, notre séquence est regroupée avec les alpha-protéobactérie et une séquence gamma-protéobactérie : Xanthobacter autotrophicus.

Avec la méthode BioNJ, on retrouve les mêmes observations.


Hypothèse 2 : protéine non mitochondriale : "proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria" vs "others bacteria" : "CFB group bacteria" , " Gram +" , "firmicutes et "fusobacteria"


Par la méthode PhyML, on observe sur l'arbre que les protéobactéries sont regroupés sur une même branche avec notre séquence protéique. Or, notre séquence est plus proche des proteobactéries en générale :


-Dechloromonas aromatica [b-proteobacteria]

-Acinetobacter baumanni [g-proteobacteria]

-Rhizobium leguminosarum [a-proteobacteria]

-Bordetella petrii [b-proteobacteria]

-Pseudomonas fluorescens [g-proteobacteria]

-Polynucleobacter sp. [b-proteobacteria]


Deux séquences de protéobactéries sont dégroupés : Xanthomonas campestris et Legionella pneumophila et classées avec des organismes de notre groupe extérieur.


Nous avons enraciné de façon à s'éparer le groupe extérieur au mieux :

-Kordia algicida [CFB group bactéria]

-Geobacillus sp. [firmicute]

-Fusobacterium sp. [fusobacteria]

-Clostridium botulinum [firmicute]


Mais certain organisme de notre groupe extérieur sont regroupé avec les protéobacteries, en amont sur le lignage.

Avec la méthode BioNJ, on retrouve les mêmes observations. Hormis que notre séquence est plus proche des alpha-protéobactéries :


-Magnetospirillum magneticum [a-proteobacteria]

-Xanthobacter autotrophicus [a-proteobacteria]

-Oceanicaulis alexandrii [a-proteobacteria]


En comparant les deux hypothèses, on peut voir que peut importe la méthode utilisée PhyML ou BioNJ, les arbres sont relativement semblable, les résultats obtenus ne sont pas du à un problème d'artéfact des logiciels.


Pour l'hypothèse 1 avec les deux méthodes, les eucaryotes (groupe intérieur) sont séparées des alpha-protéobactéries mais regroupé avec une séquence de béta-protéobactérie et une de gamma-protéobactérie. La seule conclusion que nous pouvons faire avec cette première hypothèse est que notre séquence est fortement similaires aux alpha-protéobactéries.


Pour l'hypothèse 2, comme pour l'hypothèse précédente les différentes familles d'organisme se regroupent. Par exemple, notre groupe extérieur pour l'enracinage contient une protéobactérie. La seule conclusion que nous pouvons déduire est que notre séquence n'appartient pas forcément à une alpha- protéobactérie d'après la méthode BioNJ.


Pour l'hypothèse 3 il a été impossible de réaliser l'enracinement de l'arbre.Cependant meme si notre arbre est très flou nous pouvons voir que notre séquence se retrouve avec celle des protéobacterie et à proximité de celle des eucaryotes. Nous avons donc une séquence homologue à celle des séquences mitochondriales. Il est à noté que la répartition des protéobacteries dans notre arbre n'est pas la même que celle dans l'arbre du vivant. On peut alors supposer que notre protéine est très transférée entre les bactéries même avec les archée.


D'une manière générale nous pouvons retenir que notre séquence est celle d'une protéobacterie.

RÉSULTATS BRUTS:

Hyphothèse 1  : La protéine codée par notre séquence est homologue à une (ou plusieurs) séquence mitochondriale eucaryote: "a-proteobacteria" et "eucaryotes" vs "b-proteobacteria" et "g-proteobacteria"

a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur : "b-proteobacteria" et "g-proteobacteria" _ alignement multiple 

                                                                                                         ----0.2---
 
            +-----Brucella_suis_1330_gi_23501963  [a-proteobacteria]
         +--+
         |  +------Methylobacterium_nodulans_ORS_2060_gi_220921271  [a-proteobacteria]
         |
         | +------Roseobacter_denitrificans_OCh_114_gi_110681089  [a-proteobacteria]
    +----+ |
    |    |++ +---Roseovarius_sp._TM1035_gi_149202583  [a-proteobacteria]
    |    ||+-+
    |    ||  +-----Thalassiobium_sp._R2A62_gi_255263522  [a-proteobacteria]
    |    ++
    |     |
    |     |+---------Jannaschia_sp._CCS1_gi_89055304  [a-proteobacteria]
    |     ++
    |      +--------------GOS_1239010_Traduction_3-902_sens_direct
    |
    |         +----------------------------------------Xanthomonas_campestris_pv._campestris_str._ATCC_33913_gi_21230885  [g-proteobacteria]
    |   +-----+
    |   |     +--Xanthobacter_autotrophicus_Py2_gi_154248630  [a-proteobacteria]
 +--+ +-+
 |  | | |+------------Oceanicaulis_alexandrii_HTCC2633_gi_83859140  [a-proteobacteria]
 |  | | ++
 |  | |  +-------Magnetospirillum_magneticum_AMB-1_gi_83312330  [a-proteobacteria]
 |  | |
 |  | |                                +--Paracoccidioides_brasiliensis_Pb01_gi_226279371  [eukaryota]
 |  | |                             +--+
 |  | |                             |  +--Ajellomyces_dermatitidis_SLH#14081_gi_261198997  [eukaryota]
 |  | |                            ++
 |  | |                            ||
 |  | |                +-----------++------Aspergillus_flavus_NRRL3357_gi_238506004  [eukaryota]
 |  | |                |           |
 |  | |        +-------+           +--Microsporum_canis_CBS_113480_gi_238845720  [eukaryota]
 |  +-+        |       |
 |    |      +-+       +--------Cryptococcus_neoformans_var._neoformans_B-3501A_gi_134113889  [eukaryota]
 |    |      | |
 |    |      | +--------Naegleria_gruberi_gi_284095113  [eukaryota]
 |    |    +-+
 |    |    | | +------------Drosophila_melanogaster_gi_19920834  [eukaryota]
 |    |    | | |
 |    |  +-+ +-+   +----Ornithorhynchus_anatinus_gi_149635580  [eukaryota]
 |    |  | |   +---+
 |    |  | |       +---Equus_caballus_gi_149756844 [eukaryota]
 |    |+-+ |
 |    || | +------------Monosiga_brevicollis_MX1_gi_167524186  [eukaryota]
 |    || |
 |    ++ +-----------Laribacter_hongkongensis_HLHK9_gi_226941807  [b-proteobacteria]
 |     |
 |     |
 |     +---------Shewanella_benthica_KT99_gi_163750079  [g-proteobacteria]
 |
 |  +----Acinetobacter_baumannii_ACICU_gi_184156982  [g-proteobacteria]
 |  |
 +--+ +--------Rhizobium_leguminosarum_bv._trifolii_WSM2304_gi_209546212  [a-proteobacteria]
    +-+
      |+---Pseudomonas_fluorescens_PfO-1_gi_77456345 [g-proteobacteria]
      ++
       +------Polynucleobacter_sp._QLW-P1DMWA-1_gi_145589003  [b-proteobacteria]


b) Phylogeny.fr / méthode BioNJ / pas de bootstrap / default substitution model / groupe extérieur : "b-proteobacteria" et "g-proteobacteria" _ alignement multiple 

                                                                                                   -------0.2------
 
            +--------Brucella_suis_1330_gi_23501963  [a-proteobacteria]
        +---+
        |   +-------Methylobacterium_nodulans_ORS_2060_gi_220921271  [a-proteobacteria]
        |
    +---++-----------------GOS_1239010_Traduction_3-902_sens_direct
    |   ||
    |   +++-----------Jannaschia_sp._CCS1_gi_89055304  [a-proteobacteria]
    |    ||
    |    ++ +--------Roseobacter_denitrificans_OCh_114_gi_110681089  [a-proteobacteria]
    |     | |
    |     +-+
    |       |+-----Roseovarius_sp._TM1035_gi_149202583  [a-proteobacteria]
    |       ++
    |        +---------Thalassiobium_sp._R2A62_gi_255263522  [a-proteobacteria]
    |
 +--+  +-------------Magnetospirillum_magneticum_AMB-1_gi_83312330  [a-proteobacteria]
 |  |  |
 |  | +++----------------Oceanicaulis_alexandrii_HTCC2633_gi_83859140  [a-proteobacteria]
 |  | |||
 |  | |++  +-------------------------------------------Xanthomonas_campestris_pv._campestris_str._ATCC_33913_gi_21230885  [g-proteobacteria]
 |  | | +--+
 |  | |    +---------Xanthobacter_autotrophicus_Py2_gi_154248630  [a-proteobacteria]
 |  | |
 |  | |+---------------Laribacter_hongkongensis_HLHK9_gi_226941807  [b-proteobacteria]
 |  | ||
 |  | ||  +--------------Monosiga_brevicollis_MX1_gi_167524186  [eukaryota]
 |  | ||  |
 |  +-+|  |
 |    |+  |                       +-------Aspergillus_flavus_NRRL3357_gi_238506004  [eukaryota]
 |    ||  |       +---------------+
 |    ||  |       |               |------Microsporum_canis_CBS_113480_gi_238845720  [eukaryota]
 |    ||  |       |               |
 |    |+--+       |               |   +--Paracoccidioides_brasiliensis_Pb01_gi_226279371  [eukaryota]
 |    |   | +-----+               +---+
 |    |   | |     |                   +---Ajellomyces_dermatitidis_SLH#14081_gi_261198997  [eukaryota]
 |    |   |++     |
 |    |   |||     +-------------Cryptococcus_neoformans_var._neoformans_B-3501A_gi_134113889  [eukaryota]
 |    |   |||
 |    |   ||+------------Naegleria_gruberi_gi_284095113  [eukaryota]
 |    |   ++
 |    |    | +-----------------Drosophila_melanogaster_gi_19920834  [eukaryota]
 |    |    | |
 |    |    +-+     +------Ornithorhynchus_anatinus_gi_149635580  [eukaryota]
 |    |      +-----+
 |    |            +------Equus_caballus_gi_149756844  [eukaryota]
 |    |
 |    |
 |    +--------------Shewanella_benthica_KT99_gi_163750079  [g-proteobacteria]
 |
 |  +---------Acinetobacter_baumannii_ACICU_gi_184156982  [g-proteobacteria]
 |  |
 +--++----------Rhizobium_leguminosarum_bv._trifolii_WSM2304_gi_209546212  [a-proteobacteria]
    ++
     |+------Pseudomonas_fluorescens_PfO-1_gi_77456345  [g-proteobacteria]
     ++
      +------Polynucleobacter_sp._QLW-P1DMWA-1_gi_145589003  [b-proteobacteria]

Hypothèse 2 : La protéine n'est pas homologue à une (ou plusieurs) protéine mitochondriale eucaryote : "proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria" vs "othersb bacteria" :  "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria"

a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria" _ alignement multiple 


                                                                                                        -----0.2---
 
                                                        +------Fusobacterium_sp._7_1_gi_237745307  [fusobacteria]
                              +-------------------------+
                              |                         +-----Clostridium_botulinum_E1_str._'BoNT_E_Beluga'_gi_251779239  [firmicute]
     +------------------------+
 +---+                        +----------------------------Geobacillus_sp._WCH70_gi_239825998  [firmicute]
 |   |
 |   +----------------Kordia_algicida_OT-1_gi_163753133  [CFB group bactéria]
 |
 |                             +-----------Streptomyces_ghanaensis_ATCC_14672_gi_239932184  [Gram +]
 |                +------------+
 |                |            |
 |         +------+            +------------Conexibacter_woesei_DSM_14684_gi_284042455  [Gram +]
 |         |      |
 |   +-----+      +----------------------Xanthomonas_campestris_pv._campestris_str._ATCC_33913_gi_21230885  [g-proteobacteria]
 |   |     |
 |   |     +------------Legionella_pneumophila_str._Corby_gi_148358690  [g-proteobacteria]
 |   |
 |   |        +---------------Rhodothermus_marinus_DSM_4252_gi_268316992  [CFB group bactéria]
 +---+        |
     |        |        +------------Oceanicaulis_alexandrii_HTCC2633_gi_83859140  [a-proteobacteria]
     |        |        |
     |        |        |        +----------Dechloromonas_aromatica_RCB_gi_71906179  [b-proteobacteria]
     +--------+        |        |
              |        |    +---+ +-----Acinetobacter_baumannii_ACICU_gi_184156982  [g-proteobacteria]
              |        |    |   | |
              |        |    |   +-++--------Rhizobium_leguminosarum_bv._trifolii_WSM2304_gi_209546212  [a-proteobacteria]
              |        |    |     ||
              +--------+    |     +++------Bordetella_petrii_DSM_12804_gi_163857879  [b-proteobacteria]
                       |  +-+      ||
                       |  | |      ++
                       |  | |       |+--Pseudomonas_fluorescens_PfO-1_gi_77456345  [g-proteobacteria]
                       |  | |       ++
                       |  | |        +------Polynucleobacter_sp._QLW-P1DMWA-1_gi_145589003  [b-proteobacteria]
                       |  | |
                       |  | +----------------GOS_1239010_Traduction_3-902_sens_direct
                       |  |
                       +--++---------------Nitrococcus_mobilis_Nb-231_gi_88811721  [g-proteobacteria]
                          ||
                          ||      +------------Laribacter_hongkongensis_HLHK9_gi_226941807  [b-proteobacteria]
                          ||   +--+
                          ||   |  +------Chromobacterium_violaceum_ATCC_12472_gi_34499373  [b-proteobacteria]
                          ||  ++
                          ||  ||   +------Shewanella_benthica_KT99_gi_163750079  [g-proteobacteria]
                          ++  |+---+
                           |  |    +--------Idiomarina_loihiensis_L2TR_gi_56459289  [g-proteobacteria]
                           | ++
                           | ||   +--------Methylobacterium_nodulans_ORS_2060_gi_220921271  [a-proteobacteria]
                           | ||   |
                           | |+---+
                           | |    |   +---Roseovarius_sp._TM1035_gi_149202583  [a-proteobacteria]
                           +-+    +---+
                             |        |  +------Roseobacter_denitrificans_OCh_114_gi_110681089  [a-proteobacteria]
                             |        +--+
                             |           +------Thalassiobium_sp._R2A62_gi_255263522 [a-proteobacteria]
                             |
                             | +-----------Magnetospirillum_magneticum_AMB-1_gi_83312330  [a-proteobacteria]
                             +-+
                               +----------Xanthobacter_autotrophicus_Py2_gi_154248630  [a-proteobacteria]

b) Phylogeny.fr / méthode BioNJ / pas de bootstrap / default substitution model / groupe extérieur : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria" _ alignement multiple  

                                                                                                   -------0.2-----
 
                        +--------------Nitrococcus_mobilis_Nb-231_gi_88811721  [g-proteobacteria]
                      +-+
                      | +-----------Laribacter_hongkongensis_HLHK9_gi_226941807  [b-proteobacteria]
                     ++
                     |+--------Chromobacterium_violaceum_ATCC_12472_gi_34499373  [b-proteobacteria]
                    ++
                    || +----------Shewanella_benthica_KT99_gi_163750079  [g-proteobacteria]
                    |+-+
                    |  +--------Idiomarina_loihiensis_L2TR_gi_56459289  [g-proteobacteria]
                    |
                    |
                    |   +--------Methylobacterium_nodulans_ORS_2060_gi_220921271  [a-proteobacteria]
                    |---+
                    |   |  +-----Roseovarius_sp._TM1035_gi_149202583  [a-proteobacteria]
                    |   +--+
                   ++      |+------Roseobacter_denitrificans_OCh_114_gi_110681089  [a-proteobacteria]
                   ||      ++
                   ||       +--------Thalassiobium_sp._R2A62_gi_255263522  [a-proteobacteria]
                   ||
                   ||     +-----------Dechloromonas_aromatica_RCB_gi_71906179  [b-proteobacteria]
                   ||     |
                   |+-----+-------Acinetobacter_baumannii_ACICU_gi_184156982  [g-proteobacteria]
                   |      |
                   |      |---------Rhizobium_leguminosarum_bv._trifolii_WSM2304_gi_209546212  [a-proteobacteria]
                  ++      |
                  ||      |+------Polynucleobacter_sp._QLW-P1DMWA-1_gi_145589003  [b-proteobacteria]
                  ||      ||
                  ||      +++----Pseudomonas_fluorescens_PfO-1_gi_77456345  [g-proteobacteria]
                  ||       ++
                  ||        |
           +------+|        +------Bordetella_petrii_DSM_12804_gi_163857879  [b-proteobacteria]
           |      ||
           |      ||+------------Magnetospirillum_magneticum_AMB-1_gi_83312330  [a-proteobacteria]
           |      |++
           |      | +------------Xanthobacter_autotrophicus_Py2_gi_154248630  [a-proteobacteria]
     +-----+      |
     |     |      |+-------------Oceanicaulis_alexandrii_HTCC2633_gi_83859140  [a-proteobacteria]
     |     |      ++
     |     |       +----------------GOS_1239010_Traduction_3-902_sens_direct
     |     |
     |     +-----------------Rhodothermus_marinus_DSM_4252_gi_268316992  [CFB group bactéria]
 +---+
 |   |                +-------------Streptomyces_ghanaensis_ATCC_14672_gi_239932184  [Gram +]
 |   |     +----------+
 |   |     |          +--------------Conexibacter_woesei_DSM_14684_gi_284042455  [Gram +]
 |   | +---+
 |   | |   +-----------------------Xanthomonas_campestris_pv._campestris_str._ATCC_33913_gi_21230885  [g-proteobacteria]
 |   +-+
 |     |
 |     +-----------------Legionella_pneumophila_str._Corby_gi_148358690  [g-proteobacteria]
 |
 |   +------------------Kordia_algicida_OT-1_gi_163753133  [CFB group bactéria]
 |   |
 +---+                    +-------------------------------Geobacillus_sp._WCH70_gi_239825998  [firmicute]
     +--------------------+
                          |                            +-------Fusobacterium_sp._7_1_gi_237745307  [fusobacteria]
                          +----------------------------+
                                                       +------Clostridium_botulinum_E1_str._'BoNT_E_Beluga'_gi_251779239  [firmicute]

 

Hypothèse 3 :La protéine codée par notre séquence a des homologues dans différents groupes phylogénétiques ceci est peut être du à des transferts horizontaux intervenu lors de l'évolution des espèces : "proteobacteria","others bacteria", "eucaryotes","archaea" 

a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model/ pas de groupe exterieur_ alignement multiple



 ------0.2-----
 
                                                         +----Fusobacterium_sp._7_1_gi_237745307 [fusobacteria]
                                   +---------------------+
                                   |                     +----Clostridium_botulinum_E1_str._'BoNT_E_Beluga'_gi_251779239 [firmicute]
         +-------------------------+
 +-------+                         +---------------------Geobacillus_sp._WCH70_gi_239825998[firmicute]
 |       |
 |       +-----------------------Archaeoglobus_fulgidus_DSM_4304_gi_11498596 [Archaea]
 |
 |            +------------------Kordia_algicida_OT-1_gi_163753133 [CFB group bactéria]
 |   +--------+
 |   |        +-----------Sphingobacterium_spiritivorum_ATCC_33861_gi_241890696 [CFB group bactéria]
 |   |
 |   |                     +------Conexibacter_woesei_DSM_14684_gi_284042455 [Gram +]
 |   |                     |
 |   |                     |
 |   |         +-----------+--------Streptomyces_ghanaensis_ATCC_14672_gi_239932184 [Gram +]
 |   |         |           |
 |   |     +---+           +----------Micromonospora_sp._ATCC_39149_gi_238062332 [Gram +]
 |   |     |   |
 |   |     |   |    +-------------Gemmatimonas_aurantiaca_T-27_gi_226227877 [bacteria]
 |+--+     |   +----+
 ||  |  +--+        +--------------Geobacter_metallireducens_GS-15_gi_78223282 [d-proteobacteria]
 ||  |  |  |
 ||  |  |  |               +-----------------Halomicrobium_mukohataei_DSM_12286_gi_257387180 [Archaea]
 ||  |  |  |               |
 ||  |  |  +---------------+    +------Haloarcula_marismortui_ATCC_43049_gi_55378695 [Archaea]
 ||  |  |                  |    |
 ||  |  |                  +----+ +---Halorubrum_lacusprofundi_ATCC_49239_gi_222480983 [Archaea]
 ||  |  |                       | |
 ||  |  |                       | |  +----Natrialba_magadii_ATCC_43099_gi_289582554 [Archaea]
 ||  +--+                       +-++-+
 ||     |                         || +--Haloterrigena_turkmenica_DSM_5511_gi_284163794 [Archaea]
 ||     |                         ++
 ||     |                          | +-Natronomonas_pharaonis_DSM_2160_gi_76803447 [Archaea]
 ++     |                          | |
  |     |                          +-+   +Halobacterium_salinarum_R1_gi_169237018 [Archaea]
  |     |                            +---+
  |     |                                +Halobacterium_sp._NRC-1_gi_15791260 [Archaea]
  |     |
  |     +--------------------Plesiocystis_pacifica_SIR-1_gi_149921726 [d-proteobacteria]
  |
  |    +--------------Legionella_pneumophila_str._Corby_gi_148358690 [g-proteobacteria]
  |    |
  |    |
  |    |     +--------Rhodothermus_marinus_DSM_4252_gi_268316992 [CFB group bactéria]
  |    |     |
  |    |     |             +-------------Cryptococcus_neoformans_var._neoformans_B-3501A_gi_134113889 [eukaryota]
  |    |     |             |
  |    |     |           +-+             +-----------Drosophila_melanogaster_gi_19920834 [eukaryota]
  +----+     |           | |      +------+
       |     |           | |      |      +-------Aedes_aegypti_gi_157107100 [eukaryota]
       |     |           | +------+
       |     |           |        | +-------------------------Microsporum_canis_CBS_113480_gi_238845720 [eukaryota]
       |     |           |        | |
       |     |           |        +-+ +------------Tetraodon_nigroviridis_gi_47220275 [eukaryota]
       |     |    +------+          | |
       |     |    |      |          +-+ +---Macaca_mulatta_gi_109123596 [eukaryota]
       +-----+    |      |            | |
             |    |      |            +-++--Equus_caballus_gi_149756844 [eukaryota]
             |    |      |              ++
             |    |      |               +--Ailuropoda_melanoleuca_gi_281353034 [eukaryota]
             |    |      |
             |    |      +------Naegleria_gruberi_gi_284095113 [eukaryota]
             |    |
             |    |    +-----------------GOS_1239010_Traduction_3-902_sens_direct
             |    |    |
             |    |    |       +-Pseudomonas_fluorescens_PfO-1_gi_77456345 [g-proteobacteria]
             |    |----+       |
             |    |    |    +--++------Polynucleobacter_sp._QLW-P1DMWA-1_gi_145589003 [b-proteobacteria]
             |    |    |    |  ++
             +----+    +----+   +----------Bordetella_petrii_DSM_12804_gi_163857879 [b-proteobacteria]
                  |         |
                  |         |
                  |         +----Acinetobacter_baumannii_ACICU_gi_184156982 [g-proteobacteria]
                  |
                  | +-------------Monosiga_brevicollis_MX1_gi_167524186 [eukaryota]
                  | |
                  | |      +---------Methylobacterium_nodulans_ORS_2060_gi_220921271 [a-proteobacteria]
                  +-+ +----+
                    | |    |    +----------------------Nitrococcus_mobilis_Nb-231_gi_88811721 [g-proteobacteria]
                    | |    +----+
                    +-+         +------Laribacter_hongkongensis_HLHK9_gi_226941807 [b-proteobacteria]
                      |
                      |    +-------------Oceanicaulis_alexandrii_HTCC2633_gi_83859140 [a-proteobacteria]
                      +----+
                           +------Magnetospirillum_magneticum_AMB-1_gi_83312330 [a-proteobacteria]

Taxonomy report

PROTOCOLE:


BLASTp vs NR, default NCBI parameters or " Max target sequences _ 1000 "




ANALYSE DES RÉSULTATS:


BLASTp vs NR, default NCBI parameters or " Max target sequences _ 1000 "


Pour les "a-proteobacteria" les résultats sont compris entre 456 bits et 174 bits.

Pour les "b-proteobacteria", "d-proteobacteria" "g-proteobacteria", les résultats sont compris entre 431 et 173 bits.

Pour les "CFB group bactéria", les résultats sont compris entre 347 bits et 241 bits.

Pour les " Gram +", les résultats sont compris entre 280 bits et 176 bits.

Pour les "firmicutes", les résultats sont compris entre 204 bits et 173 bits.

Pour les "fusobacteria", les résultats sont compris entre 181 bits et 180 bits.

Pour les "eukaryotes", les résultats sont compris entre 378 bits et 176 bits.

Pour les "euryarchaeotes" les résultats sont compris entre 295 bits et 269 bits


On observe que les "a-proteobacteria" et "b,g-proteobacteria" ont des résultats qui se regroupent fortement. Mais les "a-proteobacteria" ont un meilleur regroupement avec les "eukaryotes" et "euryarchaeotes" par rapport aux autres bactéries.


Trois hypothèses sont possibles :

- La protéine codée par notre séquence est homologue à une (ou plusieurs) séquence mitochondriale eucaryote. Sachant que les mitochondries eucaryotes sont issues des "a-proteobacteria". Cette théorie expliquerait que les scores de similarité avec les eucaryotes soit supérieurs à ceux des autres bactéries. Mais ceci n'explique pas les hauts scores trouvés avec les "d,b,g-protéobactéries".

Si on admet cette hypothèse, les groupes d'études et extérieurs sont les suivants :



Groupe d'étude : "a-proteobacteria" et "eukaryotes"


gb|EDM31899.1| Rhodobacterales 1e-126 Roseovarius sp. TM10 [a-proteobacteria]

gb|ABD55730.1| Rhodobacterales 3e-120 Jannaschia sp. CCS [a-proteobacteria]

gb|EAP90440.1| Rhodobacterales 1e-114 Oceanicaulis alexandrii HTCC263 [a-proteobacteria]

ref|ZP_05168556.1| Rhizobiales 4e-121 Brucella suis [a-proteobacteria]

gb|ACL56269.1| Rhizobiales 6e-117 Methylobacterium nodulans [a-proteobacteria]

gb|ABS69931.1| Rhizobiales 1e-111 Xanthobacter autotrophicus [a-proteobacteria]

gb|ABG33410.1| Rhodobacterales 1e-120 Roseobacter denitrificans [a-proteobacteria]

gb|EET48531.1| Rhodobacterales 3e-122 Thalassiobium sp. [a-proteobacteria]

gb|ACI59002.1| Rhizobiales 5e-108 Rhizobium leguminosarum [a-proteobacteria]

dbj|BAE52035.1| Rhodospirillales 2e-113 Magnetospirillum magneticum [a-proteobacteria]

gb|EFC48745.1| Heterolobosea 5e-103 Naegleria gruberi [eukaryota]

ref|XP_001510278.1| Prothotheria 7e-98 Ornithorhynchus anatinus [eukaryota]

gb|AAL13534.1| Panarthropoda 8e-89 Drosophila melanogaster [eukaryota]

gb|EAL19545.1| Basidiomycota 1e-86 Cryptococcus neoformans [eukaryota]

ref|XP_001504933.1| Theria 4e-95 Equus caballus [eukaryota]

gb|EEH34937.1| Onygenales 3e-84 Paracoccidioides brasiliensis [eukaryota]

gb|EER40132.1| Onygenales 3e-82 Ajellomyces dermatitidis [eukaryota]

gb|EEQ35382.1| Onygenales 2e-7 Microsporum canis [eukaryota]

gb|EED46668.1| Onygenales 3e-62 Aspergillus flavus [eukaryota]

gb|EDQ88816.1| Choanoflagellida 5e-99 Monosiga brevicollis [eukaryota]



Groupe extérieur: "b-proteobacteria" et "g-proteobacteria"


gb|ABP34036.1| Burkholderiales 3e-118 Polynucleobacter sp. [b-proteobacteria]

gb|ACO75872.1| Neisseriales 1e-103 Laribacter hongkongensis [b-proteobacteria]

gb|ACC55974.1| Pseudomonadales 3e-115 Acinetobacter baumannii [g-proteobacteria]

gb|AAY95534.1| Pseudomonadales 5e-119 Pseudomonas fluorescens [g-proteobacteria]

gb|AAM40726.1| Xanthomodales 5e-72 Xanthomonas campestris [g-proteobacteria]

gb|EDQ01118.1| Alteromonadales 3e-105 Shewanella benthica [g-proteobacteria]


- Deuxième hypothèse : La protéine n'est pas homologue à une (ou plusieurs) protéine mitochondriale eucaryote. Donc notre groupe d'étude n'inclus pas les Eucaryotes. D'où les groupes suivant :


Groupe d'étude : "proteobacteria" : "a-proteobacteria" , "b-proteobacteria" et "g-proteobacteria"


gb|EDM31899.1| Rhodobacterales 1e-126 Roseovarius sp. TM103 [a-proteobacteria]

gb|EAP90440.1| Rhodobacterales 1e-114 Oceanicaulis alexandrii HTCC2633 [a-proteobacteria]

gb|ACL56269.1| Rhizobiales 6e-117 Methylobacterium nodulans [a-proteobacteria]

gb|ABS69931.1| Rhizobiales 1e-111 Xanthobacter autotrophicus [a-proteobacteria]

gb|ABG33410.1| Rhodobacterales 1e-120 Roseobacter denitrificans [a-proteobacteria]

gb|EET48531.1| Rhodobacterales 3e-122 Thalassiobium sp. [a-proteobacteria]

gb|ACI59002.1| Rhizobiales 5e-108 Rhizobium leguminosarum [a-proteobacteria]

dbj|BAE52035.1| Rhodospirillales 2e-113 Magnetospirillum magneticum [a-proteobacteria]

gb|ABP34036.1| Burkholderiales 3e-118 Polynucleobacter sp. [b-proteobacteria]

gb|ACO75872.1| Neisseriales 1e-103 Laribacter hongkongensis [b-proteobacteria]

gb|ACC55974.1| Pseudomonadales 3e-115 Acinetobacter baumannii [g-proteobacteria]

gb|AAY95534.1| Pseudomonadales 5e-119 Pseudomonas fluorescens [g-proteobacteria]

gb|AAM40726.1| Xanthomodales 5e-72 Xanthomonas campestris [g-proteobacteria]

gb|EDQ01118.1| Alteromonadales 3e-105 Shewanella benthica [g-proteobacteria]

gb|AAZ45296.1| Rhodocyclale 6e-114 Dechloromonas aromatica [b-proteobacteria]

emb|CAP43909.1| Burkholderiales 1e-110 Bordetella petrii [b-proteobacteria]

gb|AAQ61579.1| Neisseriales 3e-110 Chromobacterium violaceum [b-proteobacteria]

gb|EAR22225.1| Pseudomonadales 7e-109 Nitrococcus mobilis [g-proteobacteria]

gb|AAV81021.1| Alteromonadales 1e-108 Idiomarina loihiensis [g-proteobacteria]

gb|ABQ54551.1| Legionellales 1e-81 Legionella pneumophila [g-proteobacteria]


Groupe extérieur : "others bacteria" : "CFB group bactéria" , " Gram +" , "firmicutes et "fusobacteria"


gb|ACY48323.1| Sphingobacteria 1e-93 Rhodothermus marinus [CFB group bactéria]

gb|EDP98190.1| Flavobacteria 1e-74 Kordia algicida [CFB group bactéria]

ref|ZP_04689137.1| Actinobacteridae 1e-73 Streptomyces ghanaensis [Gram +]

gb|ADB49420.1| Rubrobacteridae 8e-68 Conexibacter woesei [Gram +]

gb|ACS23356.1| Bacilli 1e-50 Geobacillus sp. [firmicute]

gb|ACD52346.1| Clostridia 8e-42 Clostridium botulinum [firmicute]

gb|EFD80203.1| Fusobacteria 9e-44 Fusobacterium sp. [fusobacteria]


Troisième hypothèse :


- La protéine codée par notre séquence a des homologues dans différents groupes phylogénétiques ceci est peut être du à des transferts horizontaux intervenu lors de l'évolution des espèces. C'est pourquoi nous avons réalisé une analyse phylogénétique de notre séquence mais le résultat n'est pas congruent avec l'arbre de référence. cf Arbre phylogénétique hypothèse 3. Nous avons essayé de faire un arbre en utilisant les séquences des 3 différents ordres du vivant : Eucaryotes, Bactéries, Archae.


Protéobactéries :


gb|EAP90440.1| Rhodobacterales 1e-114 Oceanicaulis alexandrii HTCC263 [a-proteobacteria]

dbj|BAE52035.1| Rhodospirillales 2e-113 Magnetospirillum magneticum [a-proteobacteria]

gb|ACL56269.1| Rhizobiales 6e-117 Methylobacterium nodulans [a-proteobacteria]

gb|ACO75872.1| Neisseriales 1e-103 Laribacter hongkongensis [b-proteobacteria]

gb|ABP34036.1| Burkholderiales 3e-118 Polynucleobacter sp. [b-proteobacteria]

emb|CAP43909.1| Burkholderiales 1e-110 Bordetella petrii [b-proteobacteria]

gb|ACC55974.1| Pseudomonadales 3e-115 Acinetobacter baumannii [g-proteobacteria]

gb|EAR22225.1| Pseudomonadales 7e-109 Nitrococcus mobilis [g-proteobacteria]

gb|AAY95534.1| Pseudomonadales 5e-119 Pseudomonas fluorescens [g-proteobacteria]

gb|ABQ54551.1| Legionellales 1e-81 Legionella pneumophila [g-proteobacteria]

gb|ABB32304.1| Desulfuromonadales 3e-79 Geobacter metallireducens [d-proteobacteria]

gb|EDM76936.1| Myxococcale 4e-76 Plesiocystis pacifica [d-proteobacteria]


Autres bactéries :


dbj|BAH39513.1| Gemmatimonadetes 1e-72 Gemmatimonas aurantiaca [bacteria]

gb|EER73406.1| Sphingobacteria 1e-80 Sphingobacterium spiritivorum [CFB group bacteria]

gb|EEP72971.1| Actinobacteridae 1e-71 Micromonospora sp. [Gram +]

gb|ACY48323.1| Sphingobacteria 1e-93 Rhodothermus marinus [CFB group bactéria]

gb|EDP98190.1| Flavobacteria 1e-74 Kordia algicida [CFB group bactéria]

ref|ZP_04689137.1| Actinobacteridae 1e-73 Streptomyces ghanaensis [Gram +]

gb|ADB49420.1| Rubrobacteridae 8e-68 Conexibacter woesei [Gram +]

gb|ACS23356.1| Bacilli 1e-50 Geobacillus sp. [firmicute]

gb|ACD52346.1| Clostridia 8e-42 Clostridium botulinum [firmicute]

gb|EFD80203.1| Fusobacteria 9e-44 Fusobacterium sp. [fusobacteria]




Eucaryotes :

gb|EFC48745.1| Heterolobosea 5e-103 Naegleria gruberi [eukaryota]

gb|AAL13534.1| Brachycera 8e-89 Drosophila melanogaster [eukaryota]

gb|EAL19545.1| Basidiomycota 1e-86 Cryptococcus neoformans [eukaryota]

ref|XP_001504933.1| Theria 4e-95 Equus caballus [eukaryota]

gb|EEQ35382.1| Onygenales 2e-7 Microsporum canis [eukaryota]

gb|EDQ88816.1| Choanoflagellida 5e-99 Monosiga brevicollis [eukaryota]

ref|XP_001110430.1| Cercopithecoidea 1e-94 Macaca mulatta [eukaryota]

gb|EAT34089.1| Nematocera 4e-88 Aedes aegypti [eukaryota]

gb|EFB28618.1| Sarcopterygii 1e-95 Ailuropoda melanoleuca [eukaryota]

emb|CAG03309.1| Euteleostomi 4e-94 Tetraodon nigroviridis [eukaryota]


Archae :


gb|AAV46839.1 Haloarcula 5e-78 Haloarcula marismortui [Archaea]

gb|ACM58150.1| Halorubrum 8e-79 Halorubrum lacusprofundi [Archaea]

gb|ADD06458.1| Natrialba 1e-77 Natrialba magadii [Archaea]

emb|CAI50870.1| Natronomonas 4e-76 Natronomonas pharaonis [Archaea]

gb|AAB90252.1| Archaeoglobi 5e-75 Archaeoglobus fulgidus [Archaea]

emb|CAP14872.1| Halobacterium 1e-73 Halobacterium salinarum [Archaea]

gb|AAG20564.1| Halobacterium 3e-73 Halobacterium sp [Archaea]

gb|ACV47246.1| Halomicrobium 3e-70 Halomicrobium mukohataei [Archaea]

gb|ADB59400.1| Haloterrigena 4e-76 Haloterrigena turkmenica [Archaea]


RÉSULTATS BRUTS:

BLASTp vs NR, defaut NCBI parameters or "Max target sequences = 1000"

Lineage Report

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Alphaproteobacteria [a-proteobacteria]
. . . . . Rhodobacterales     [a-proteobacteria]
. . . . . . Rhodobacteraceae    [a-proteobacteria]
. . . . . . . Roseovarius         [a-proteobacteria]
. . . . . . . . Roseovarius sp. TM1035 --------------------------------  456  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseovarius sp. TM1035] >gi|149
. . . . . . . . Roseovarius sp. 217 ...................................  450  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseovarius sp. 217] >gi|856720
. . . . . . . . Roseovarius sp. HTCC2601 ..............................  442  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseovarius sp. HTCC2601] >gi|1
. . . . . . . . Roseovarius nubinhibens ISM ...........................  416  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseovarius nubinhibens ISM] >g
. . . . . . . Loktanella vestfoldensis SKA53 --------------------------  451  4 hits [a-proteobacteria]      putative acyl-CoA dehydrogenase [Loktanella vestfoldensis S
. . . . . . . Roseobacter sp. CCS2 ....................................  449  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like protein [Roseobacter sp. CCS2] 
. . . . . . . Sagittula stellata E-37 .................................  448  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Sagittula stellata E-37] >gi|12
. . . . . . . Octadecabacter antarcticus 307 ..........................  447  6 hits [a-proteobacteria]      Acyl-CoA dehydrogenase, N-terminal domain protein [Octadeca
. . . . . . . Rhodobacteraceae bacterium KLH11 ........................  446  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodobacteraceae bacterium KLH1
. . . . . . . Citreicella sp. SE45 ....................................  445  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Citreicella sp. SE45] >gi|26042
. . . . . . . Roseobacter sp. AzwK-3b .................................  444  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Roseobacter sp. AzwK
. . . . . . . Oceanicola granulosus HTCC2516 ..........................  442  2 hits [a-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [Oceanicola gra
. . . . . . . Oceanibulbus indolifex HEL-45 ...........................  442  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Oceanibulbus indolifex HEL-45] 
. . . . . . . Thalassiobium sp. R2A62 .................................  442  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Thalassiobium sp. R2A62] >gi|25
. . . . . . . Oceanicola batsensis HTCC2597 ...........................  442  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Oceanicola batsensis HTCC2597] 
. . . . . . . Octadecabacter antarcticus 238 ..........................  441  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Octadecabacter antarcticus 238]
. . . . . . . Roseobacter sp. GAI101 ..................................  441  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseobacter sp. GAI101] >gi|214
. . . . . . . Sulfitobacter sp. NAS-14.1 ..............................  440  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Sulfitobacter sp. NAS-14.1] >gi
. . . . . . . Sulfitobacter sp. EE-36 .................................  440  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Sulfitobacter sp. NAS-14.1] >gi
. . . . . . . Ruegeria pomeroyi DSS-3 .................................  439  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Ruegeria pomeroyi DSS-3] >gi|56
. . . . . . . Phaeobacter gallaeciensis BS107 .........................  437  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like protein [Phaeobacter gallaecien
. . . . . . . Phaeobacter gallaeciensis 2.10 ..........................  437  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like protein [Phaeobacter gallaecien
. . . . . . . Roseobacter litoralis Och 149 ...........................  437  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseobacter litoralis Och 149] 
. . . . . . . Pseudovibrio sp. JE062 ..................................  437  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudovibrio sp. JE062] >gi|211
. . . . . . . Ruegeria sp. R11 ........................................  436  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Ruegeria sp. R11] >gi|214031977
. . . . . . . Roseobacter denitrificans OCh 114 .......................  436  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseobacter denitrificans OCh 1
. . . . . . . Rhodobacter sp. SW2 .....................................  435  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Rhodobacter sp. SW2]
. . . . . . . Jannaschia sp. CCS1 .....................................  435  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Jannaschia sp. CCS1] >gi|88864
. . . . . . . Labrenzia alexandrii DFL-11 .............................  431  2 hits [a-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal domain protein [Labrenzi
. . . . . . . Dinoroseobacter shibae DFL 12 ...........................  431  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase [Dinoroseobacter shibae DFL 12] >gi|
. . . . . . . Labrenzia aggregata IAM 12614 ...........................  430  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Stappia aggregata IAM 12614] >g
. . . . . . . Rhodobacter sphaeroides ATCC 17025 ......................  427  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . . . . . . Paracoccus denitrificans PD1222 .........................  425  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Paracoccu
. . . . . . . Rhodobacter sphaeroides KD131 ...........................  421  4 hits [a-proteobacteria]      Acyl-CoA dehydrogenase domain protein [Rhodobacter sphaeroi
. . . . . . . Rhodobacter sphaeroides ATCC 17029 ......................  420  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Rhodobact
. . . . . . . Rhodobacter sphaeroides 2.4.1 ...........................  417  4 hits [a-proteobacteria]      putative acyl-CoA dehydrogenase [Rhodobacter sphaeroides 2.
. . . . . . . Ruegeria sp. TM1040 .....................................  410  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Ruegeria sp. TM1040] >gi|99037
. . . . . . . Roseobacter sp. MED193 ..................................  409  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseobacter sp. MED193] >gi|858
. . . . . . . Roseobacter sp. SK209-2-6 ...............................  409  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Roseobacter sp. SK209-2-6] >gi|
. . . . . . . Silicibacter lacuscaerulensis ITI-1157 ..................  272  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Silicibacter lacuscaerulensis I
. . . . . . . Silicibacter sp. TrichCH4B ..............................  184  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Silicibacter sp. TrichCH4B] >gi
. . . . . . Maricaulis maris MCS10 ------------------------------------  451  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Maricauli
. . . . . . Rhodobacterales bacterium HTCC2150 ........................  434  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodobacterales bacterium HTCC2
. . . . . . Rhodobacterales bacterium HTCC2083 ........................  431  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodobacterales bacterium HTCC2
. . . . . . Rhodobacterales bacterium HTCC2654 ........................  431  2 hits [a-proteobacteria]      glutaryl Co-A dehydrogenase [Rhodobacterales bacterium HTCC
. . . . . . Rhodobacterales bacterium HTCC2255 ........................  426  2 hits [a-proteobacteria]      Acyl-CoA dehydrogenase [alpha proteobacterium HTCC2255] >gi
. . . . . . Oceanicaulis alexandrii HTCC2633 ..........................  416  4 hits [a-proteobacteria]      Glutaryl-CoA dehydrogenase [Oceanicaulis alexandrii HTCC263
. . . . . . Rhodobacterales bacterium Y4I .............................  412  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodobacterales bacterium Y4I] 
. . . . . . Hirschia baltica ATCC 49814 ...............................  369  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Hirschia baltica ATC
. . . . . Sinorhizobium medicae WSM419 --------------------------------  455  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Sinorhizo
. . . . . Sinorhizobium meliloti 1021 .................................  454  2 hits [a-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [Sinorhizobium 
. . . . . Rhizobium sp. NGR234 ........................................  451  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhizobium sp. NGR234] >gi|22733
. . . . . Chelativorans sp. BNC1 ......................................  448  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Mesorhizobium sp. BNC1] >gi|11
. . . . . Brucella sp. 83/13 ..........................................  439  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella sp. 83/13] >gi|2659841
. . . . . Brucella abortus bv. 1 str. 9-941 ...........................  439  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella melitensis biovar Abortus 2308 .....................  439  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus S19 ........................................  439  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus str. 2308 A ................................  439  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus bv. 6 str. 870 .............................  439  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus bv. 3 str. Tulya ...........................  439  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus bv. 2 str. 86/8/59 .........................  439  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus bv. 4 str. 292 .............................  439  3 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus bv. 9 str. C68 .............................  439  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella abortus NCTC 8038 ..................................  439  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella abortus bv. 1 str. 9-9
. . . . . Brucella melitensis bv. 3 str. Ether ........................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella melitensis bv. 3 str. 
. . . . . Ochrobactrum intermedium LMG 3301 ...........................  438  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Ochrobactrum interme
. . . . . Mesorhizobium opportunistum WSM2075 .........................  438  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Mesorhizobium opport
. . . . . Brucella suis 1330 ..........................................  438  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella suis ATCC 23445 ....................................  438  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella ceti str. Cudo .....................................  438  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella suis bv. 3 str. 686 ................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella pinnipedialis M163/99/10 ...........................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella pinnipedialis B2/94 ................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella ceti M644/93/1 .....................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella ceti M13/05/1 ......................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella pinnipedialis M292/94/1 ............................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella neotomae 5K33 ......................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella microti CCM 4915 ...................................  438  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella sp. F5/99 ..........................................  438  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis 1330] >gi|1638433
. . . . . Brucella melitensis ATCC 23457 ..............................  438  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella melitensis ATCC 23457]
. . . . . Brucella melitensis bv. 2 str. 63/9 .........................  438  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella melitensis ATCC 23457]
. . . . . Ochrobactrum anthropi ATCC 49188 ............................  437  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Ochrobact
. . . . . Brucella melitensis bv. 1 str. 16M ..........................  436  8 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella melitensis 16M] >gi|25
. . . . . Brucella melitensis bv. 1 str. Rev.1 ........................  436  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella melitensis 16M] >gi|25
. . . . . Brucella suis bv. 5 str. 513 ................................  436  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella suis bv. 5 str. 513] >
. . . . . Brucella canis ATCC 23365 ...................................  436  4 hits [a-proteobacteria]      Acyl-CoA dehydrogenase [Brucella canis ATCC 23365] >gi|2605
. . . . . Brucella suis bv. 4 str. 40 .................................  436  4 hits [a-proteobacteria]      Acyl-CoA dehydrogenase [Brucella canis ATCC 23365] >gi|2605
. . . . . Brucella ceti M490/95/1 .....................................  434  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella ceti M490/95/1] >gi|25
. . . . . Brucella ceti B1/94 .........................................  434  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Brucella ceti M490/95/1] >gi|25
. . . . . Mesorhizobium loti MAFF303099 ...............................  433  2 hits [a-proteobacteria]      glutaryl Co-A dehydrogenase [Mesorhizobium loti MAFF303099]
. . . . . Hoeflea phototrophica DFL-43 ................................  432  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like protein [Hoeflea phototrophica 
. . . . . Sphingomonas wittichii RW1 ..................................  431  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Sphingomo
. . . . . Rhizobium etli GR56 .........................................  430  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Rhizobium etli GR56]
. . . . . Rhodopseudomonas palustris DX-1 .............................  429  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Rhodopseudomonas pal
. . . . . Rhizobium etli CIAT 652 .....................................  429  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Rhizobium etli CIAT 652
. . . . . Bradyrhizobium japonicum USDA 110 ...........................  428  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Bradyrhizobium japonicum USDA 1
. . . . . Azospirillum sp. B510 .......................................  427  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Azospirillum sp. B510] >gi|2889
. . . . . Agrobacterium tumefaciens str. C58 ..........................  426  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Agrobacterium tumefaciens str. 
. . . . . Rhodopseudomonas palustris CGA009 ...........................  426  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodopseudomonas palustris CGA0
. . . . . Rhodopseudomonas palustris TIE-1 ............................  426  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodopseudomonas palustris CGA0
. . . . . Methylobacterium sp. 4-46 ...................................  425  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . . . . Methylobacterium radiotolerans JCM 2831 .....................  425  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Methyloba
. . . . . Methylobacterium nodulans ORS 2060 ..........................  424  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Methylobacterium nod
. . . . . Bradyrhizobium sp. BTAi1 ....................................  424  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Bradyrhizobium sp. BTAi1] >gi|1
. . . . . Agrobacterium vitis S4 ......................................  424  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Agrobacterium vitis S4] >gi|221
. . . . . Rhodopseudomonas palustris BisB5 ............................  423  6 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . . . . Bradyrhizobium sp. ORS278 ...................................  422  4 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Bradyrhizobium sp. ORS278] >gi|
. . . . . Rhodomicrobium vannielii ATCC 17100 .........................  422  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Rhodomicrobium vanni
. . . . . Rhodopseudomonas palustris BisA53 ...........................  422  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Rhodopseu
. . . . . Asticcacaulis excentricus CB 48 .............................  422  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Asticcacaulis excent
. . . . . Magnetospirillum gryphiswaldense MSR-1 ......................  420  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Magnetospirillum gryphiswaldens
. . . . . Rhodopseudomonas palustris HaA2 .............................  420  4 hits [a-proteobacteria]      Acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris HaA
. . . . . Oligotropha carboxidovorans OM5 .............................  420  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase, (GCD) [Oligotropha carboxidovor
. . . . . Erythrobacter sp. SD-21 .....................................  417  4 hits [a-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [Erythrobacter 
. . . . . Parvibaculum lavamentivorans DS-1 ...........................  417  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Parvibacu
. . . . . Novosphingobium aromaticivorans DSM 12444 ...................  417  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Novosphin
. . . . . Rhodopseudomonas palustris BisB18 ...........................  417  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Rhodopseudomonas palustris Bis
. . . . . Nitrobacter hamburgensis X14 ................................  414  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like [Nitrobacter hamburgensis X14] 
. . . . . Erythrobacter sp. NAP1 ......................................  414  2 hits [a-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [Erythrobacter 
. . . . . alpha proteobacterium BAL199 ................................  413  2 hits [a-proteobacteria]      Acyl-CoA dehydrogenase [alpha proteobacterium BAL199] >gi|1
. . . . . Rhodospirillum rubrum ATCC 11170 ............................  413  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodospirillum rubrum ATCC 1117
. . . . . Magnetospirillum magneticum AMB-1 ...........................  412  2 hits [a-proteobacteria]      Acyl-CoA dehydrogenase [Magnetospirillum magneticum AMB-1] 
. . . . . Nitrobacter sp. Nb-311A .....................................  412  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase [Nitrobacter sp. Nb-311A] >gi|856994
. . . . . Nitrobacter winogradskyi Nb-255 .............................  412  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase [Nitrobacter winogradskyi Nb-255] >g
. . . . . Acidiphilium cryptum JF-5 ...................................  406  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Acidiphil
. . . . . Xanthobacter autotrophicus Py2 ..............................  406  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Xanthobac
. . . . . Aurantimonas manganoxydans SI85-9A1 .........................  403  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase [Aurantimonas manganoxydans SI85-9A1
. . . . . Erythrobacter litoralis HTCC2594 ............................  402  4 hits [a-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [Erythrobacter 
. . . . . Rhizobium leguminosarum bv. viciae 3841 .....................  400  2 hits [a-proteobacteria]      putative acyl-CoA dehydrogenase [Rhizobium leguminosarum bv
. . . . . Agrobacterium radiobacter K84 ...............................  399  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Agrobacterium radiobact
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ................  398  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . . . . Phenylobacterium zucineum HLK1 ..............................  397  6 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Phenylobacterium zucineum HLK1]
. . . . . Azorhizobium caulinodans ORS 571 ............................  397  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Azorhizobium caulinodans ORS 57
. . . . . Rhizobium etli CFN 42 .......................................  395  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Rhizobium etli CFN 42] 
. . . . . Rhodospirillum centenum SW ..................................  395  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase [Rhodospirillum centenum SW] >gi
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ................  394  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Rhizobium leguminosa
. . . . . Sphingopyxis alaskensis RB2256 ..............................  394  2 hits [a-proteobacteria]      acyl-CoA dehydrogenase-like protein [Sphingopyxis alaskensi
. . . . . Brevundimonas subvibrioides ATCC 15264 ......................  394  4 hits [a-proteobacteria]      acyl-CoA dehydrogenase domain protein [Brevundimonas subvib
. . . . . Rhizobium etli 8C-3 .........................................  392  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Rhizobium etli 8C-3]
. . . . . Magnetospirillum magnetotacticum MS-1 .......................  355  2 hits [a-proteobacteria]      COG1960: Acyl-CoA dehydrogenases [Magnetospirillum magnetot
. . . . . Rhizobium etli Kim 5 ........................................  351  2 hits [a-proteobacteria]      glutaryl-CoA dehydrogenase protein [Rhizobium etli Kim 5]
. . . . . Brucella ovis ATCC 25840 ....................................  174  2 hits [a-proteobacteria]      isovaleryl-CoA dehydrogenase [Brucella ovis ATCC 25840] >gi
. . . . Pseudomonas fluorescens Pf-5 ----------------------------------  431  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas fluorescens Pf-5] >
. . . . Pseudomonas fluorescens Pf0-1 .................................  431  4 hits [g-proteobacteria]      Acyl-CoA dehydrogenase-like [Pseudomonas fluorescens Pf0-1]
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .  428  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Polynucle
. . . . Pseudomonas syringae pv. tomato T1 ............................  428  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase [Pseudomonas syringae pv. tomato T1]
. . . . Pseudomonas syringae pv. oryzae str. 1_6 ......................  427  1 hit  [g-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . . . Pseudomonas fluorescens SBW25 .................................  427  2 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Pseudomonas fluorescens SB
. . . . Burkholderia thailandensis MSMB43 .............................  427  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia thailande
. . . . Pseudomonas syringae pv. tomato str. DC3000 ...................  427  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase, putative [Pseudomonas syringae pv. 
. . . . Burkholderia thailandensis TXDOH ..............................  427  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia thailandensis TXDO
. . . . Burkholderia thailandensis Bt4 ................................  427  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia thailandensis TXDO
. . . . Burkholderia multivorans ATCC 17616 ...........................  427  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Burkholderia multivorans CGD1 .................................  427  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Ralstonia eutropha JMP134 .....................................  427  2 hits [b-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . . . Pseudomonas syringae pv. syringae B728a .......................  427  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ....................  427  1 hit  [g-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . . . Ralstonia eutropha H16 ........................................  427  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Ralstonia eutropha H16] >gi|113
. . . . Acinetobacter sp. ADP1 ........................................  427  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter sp. ADP1] >gi|495
. . . . Burkholderia sp. CCGE1002 .....................................  427  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . . . Pseudomonas putida GB-1 .......................................  426  6 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . . . Burkholderia multivorans CGD2M ................................  426  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia multivora
. . . . Burkholderia multivorans CGD2 .................................  426  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia multivora
. . . . Pseudomonas putida W619 .......................................  426  8 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . . . Pseudomonas putida KT2440 .....................................  426  8 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . . . Burkholderia ambifaria MEX-5 ..................................  426  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . . . Pseudomonas putida F1 .........................................  426  8 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . . . Burkholderia pseudomallei 668 .................................  426  4 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Cupriavidus taiwanensis .......................................  426  2 hits [b-proteobacteria]      GLUTARYL-COA DEHYDROGENASE [Cupriavidus taiwanensis] >gi|19
. . . . Burkholderia oklahomensis EO147 ...............................  425  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia oklahomen
. . . . Burkholderia oklahomensis C6786 ...............................  425  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia oklahomen
. . . . Burkholderia pseudomallei 14 ..................................  425  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Burkholderia pseudomallei 406e ................................  425  4 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Burkholderia cenocepacia PC184 ................................  425  4 hits [b-proteobacteria]      Acyl-CoA dehydrogenase [Burkholderia cenocepacia PC184] >gi
. . . . Pseudomonas entomophila L48 ...................................  425  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas entomophila L48] >g
. . . . Burkholderia dolosa AUO158 ....................................  425  2 hits [b-proteobacteria]      Acyl-CoA dehydrogenase [Burkholderia dolosa AUO158] >gi|124
. . . . Burkholderia cenocepacia J2315 ................................  425  4 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia cenocepac
. . . . Burkholderia cenocepacia MC0-3 ................................  425  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Cupriavidus metallidurans CH34 ................................  424  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like protein [Ralstonia metalliduran
. . . . Burkholderia pseudomallei B7210 ...............................  424  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Burkholderia pseudomallei S13 .................................  424  4 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Pseudomonas aeruginosa PA7 ....................................  424  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PA7] >gi
. . . . Pseudomonas aeruginosa PAO1 ...................................  424  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Pseudomonas aeruginosa PACS2 ..................................  424  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Pseudomonas aeruginosa UCBPP-PA14 .............................  424  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Pseudomonas aeruginosa LESB58 .................................  424  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Pseudomonas aeruginosa C3719 ..................................  424  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Pseudomonas aeruginosa 2192 ...................................  424  6 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas aeruginosa PAO1] >g
. . . . Burkholderia sp. 383 ..........................................  424  4 hits [b-proteobacteria]      Acyl-CoA dehydrogenase-like [Burkholderia sp. 383] >gi|7796
. . . . Burkholderia pseudomallei 1710b ...............................  424 28 hits [b-proteobacteria]      Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Deh
. . . . Burkholderia pseudomallei K96243 ..............................  424  4 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Burkholderia thailandensis E264 ...............................  424  6 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia thailandensis E264
. . . . Burkholderia pseudomallei 1710a ...............................  424  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia pseudomallei 1710b
. . . . Burkholderia vietnamiensis G4 .................................  424  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Burkholderia mallei ATCC 23344 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei GB8 horse 4 ...............................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei SAVP1 .....................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei NCTC 10229 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei NCTC 10247 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 1106a ...............................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 305 .................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei PRL-20 ....................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 91 ..................................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 9 ...................................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 7894 ................................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei NCTC 13177 ..........................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 112 .................................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei BCC215 ..............................  423  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 576 .................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei Pakistan 9 ..........................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei MSHR346 .............................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 1106b ...............................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei ATCC 10399 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei 1655 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia pseudomallei Pasteur 52237 .......................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei FMH .......................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei JHU .......................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia mallei 2002721280 ................................  423  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Burkholderia mallei ATCC 23344]
. . . . Burkholderia ubonensis Bu .....................................  423  1 hit  [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia ubonens
. . . . Burkholderia cenocepacia AU 1054 ..............................  423  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . . . Burkholderia cenocepacia HI2424 ...............................  423  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like [Burkholderia cenocepacia AU 10
. . . . Burkholderia pseudomallei DM98 ................................  423  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia pseudomal
. . . . Burkholderia phymatum STM815 ..................................  423  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Pseudomonas stutzeri A1501 ....................................  423  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudomonas stutzeri A1501] >gi
. . . . Burkholderia ambifaria MC40-6 .................................  422  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Pseudomonas mendocina ymp .....................................  421  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Pseudomon
. . . . Ralstonia pickettii 12J .......................................  421  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . . . Kangiella koreensis DSM 16069 .................................  420  4 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain protein [Kangiella koreensis 
. . . . Burkholderia sp. H160 .........................................  420  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia sp. H16
. . . . Burkholderia ambifaria AMMD ...................................  420  6 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Burkholde
. . . . Ralstonia solanacearum UW551 ..................................  420  2 hits [b-proteobacteria]      Glutaryl-CoA dehydrogenase [Ralstonia solanacearum UW551] >
. . . . Ralstonia solanacearum IPO1609 ................................  420  2 hits [b-proteobacteria]      glutaryl-coa dehydrogenase protein [Ralstonia solanacearum 
. . . . Ralstonia solanacearum MolK2 ..................................  420  2 hits [b-proteobacteria]      glutaryl-coa dehydrogenase protein [Ralstonia solanacearum 
. . . . Ralstonia solanacearum GMI1000 ................................  419  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase oxidoreductase [Ralstonia solana
. . . . Burkholderia ambifaria IOP40-10 ...............................  419  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia ambifar
. . . . Burkholderia sp. CCGE1001 .....................................  419  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia sp. CCG
. . . . Burkholderia xenovorans LB400 .................................  419  2 hits [b-proteobacteria]      putative glutaryl-CoA dehydrogenase [Burkholderia xenovoran
. . . . Burkholderia graminis C4D1M ...................................  419  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia gramini
. . . . Burkholderia phytofirmans PsJN ................................  419  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Burkholderia phytofi
. . . . Ralstonia pickettii 12D .......................................  418  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Ralstonia pickettii 
. . . . Acinetobacter baumannii ACICU .................................  418  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Acinetobacter baumannii ACICU] >gi|
. . . . Marinobacter aquaeolei VT8 ....................................  418  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Marinobac
. . . . Acinetobacter radioresistens SK82 .............................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter radioresistens SK
. . . . Acinetobacter radioresistens SH164 ............................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter radioresistens SK
. . . . Acinetobacter baumannii ATCC 17978 ............................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii ATCC 17
. . . . Acinetobacter baumannii AB900 .................................  417  1 hit  [g-proteobacteria]      Glutaryl-CoA dehydrogenase (GCD) [Acinetobacter baumannii A
. . . . Acinetobacter baumannii AYE ...................................  417  1 hit  [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii AYE] >g
. . . . Acinetobacter baumannii AB0057 ................................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii AYE] >g
. . . . Acinetobacter baumannii AB307-0294 ............................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii AYE] >g
. . . . Acinetobacter baumannii ATCC 19606 ............................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii AYE] >g
. . . . Acinetobacter baumannii .......................................  417  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii AYE] >g
. . . . Alcanivorax sp. DG881 .........................................  417  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal domain protein [Alcanivo
. . . . Acinetobacter lwoffii SH145 ...................................  416  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter lwoffii SH145] >g
. . . . Acinetobacter sp. RUH2624 .....................................  416  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter sp. RUH2624] >gi|
. . . . Acinetobacter calcoaceticus RUH2202 ...........................  416  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter calcoaceticus RUH
. . . . Burkholderia glumae BGR1 ......................................  416  2 hits [b-proteobacteria]      Acyl-CoA dehydrogenase-like protein [Burkholderia glumae BG
. . . . Aromatoleum aromaticum EbN1 ...................................  416  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Aromatoleum aromaticum EbN1] >g
. . . . Acinetobacter baumannii SDF ...................................  415  1 hit  [g-proteobacteria]      glutaryl-CoA dehydrogenase [Acinetobacter baumannii SDF] >g
. . . . Dechloromonas aromatica RCB ...................................  414  2 hits [b-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, 
. . . . Acidovorax citrulli AAC00-1 ...................................  412  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . . . Alcanivorax borkumensis SK2 ...................................  412  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Alcanivorax borkumensis SK2] >g
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ....................  412  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Acidovorax avenae su
. . . . Delftia acidovorans SPH-1 .....................................  410  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Delftia a
. . . . Acidovorax ebreus TPSY ........................................  410  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Acidovorax ebreus TP
. . . . marine gamma proteobacterium HTCC2143 .........................  410  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [marine gamma proteobacterium HT
. . . . Acidovorax sp. JS42 ...........................................  410  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Acidovora
. . . . Colwellia psychrerythraea 34H .................................  409  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Colwellia psychrerythraea 34H] 
. . . . Lutiella nitroferrum 2002 .....................................  408  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Lutiella nitroferrum
. . . . Psychrobacter sp. PRwf-1 ......................................  408  4 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Psychroba
. . . . Azoarcus sp. CIB ..............................................  408  1 hit  [b-proteobacteria]      GcdH [Azoarcus sp. CIB]
. . . . Acidovorax delafieldii 2AN ....................................  407  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Acidovorax delafield
. . . . Pseudoalteromonas atlantica T6c ...............................  407  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Pseudoalteromonas atlantica T6c
. . . . Marinomonas sp. MED121 ........................................  406  2 hits [g-proteobacteria]      Glutaryl-CoA dehydrogenase [Marinomonas sp. MED121] >gi|861
. . . . Thauera sp. MZ1T ..............................................  406  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Thauera sp. MZ1T] >g
. . . . Verminephrobacter eiseniae EF01-2 .............................  406  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Vermineph
. . . . Comamonas testosteroni CNB-2 ..................................  406  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like protein [Comamonas testosteroni
. . . . Comamonas testosteroni KF-1 ...................................  406  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Comamonas testostero
. . . . Azotobacter vinelandii DJ .....................................  405  2 hits [g-proteobacteria]      Glutaryl-CoA dehydrogenase [Azotobacter vinelandii DJ] >gi|
. . . . Leptothrix cholodnii SP-6 .....................................  405  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Leptothri
. . . . marine gamma proteobacterium HTCC2148 .........................  405  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase, C-terminal domain protein [marine g
. . . . Marinobacter sp. ELB17 ........................................  404  4 hits [g-proteobacteria]      Glutaryl-CoA dehydrogenase [Marinobacter sp. ELB17] >gi|126
. . . . Variovorax paradoxus S110 .....................................  404  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Variovorax paradoxus
. . . . Bordetella petrii DSM 12804 ...................................  403  1 hit  [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella petrii DSM 12804] >g
. . . . Bordetella petrii .............................................  403  1 hit  [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella petrii DSM 12804] >g
. . . . gamma proteobacterium NOR51-B .................................  403  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [gamma proteobacterium NOR51-B] 
. . . . Methylibium petroleiphilum PM1 ................................  403  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Methylibium petroleiphilum PM1]
. . . . Bordetella bronchiseptica RB50 ................................  403  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella bronchiseptica RB50]
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 .........  403  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Polynucleobacter nec
. . . . Hahella chejuensis KCTC 2396 ..................................  402  4 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Hahella chejuensis KCTC 2396] >gi|8
. . . . Bordetella pertussis Tohama I .................................  402  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella pertussis Tohama I] 
. . . . Bordetella avium 197N .........................................  402  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella avium 197N] >gi|1154
. . . . Chromobacterium violaceum ATCC 12472 ..........................  402  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Chromobacterium violaceum ATCC 
. . . . Thiomonas intermedia K12 ......................................  401  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Thiomonas intermedia
. . . . Polaromonas naphthalenivorans CJ2 .............................  400  4 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Polaromon
. . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ......  400  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase domain protein [Candidatus Accumulib
. . . . Bordetella parapertussis 12822 ................................  400  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella parapertussis 12822]
. . . . Bordetella parapertussis ......................................  400  2 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Bordetella parapertussis 12822]
. . . . Psychrobacter cryohalolentis K5 ...............................  399  6 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Psychrobacter cryohalolentis K5
. . . . Psychrobacter arcticus 273-4 ..................................  399  6 hits [g-proteobacteria]      putative glutaryl-CoA dehydrogenase [Psychrobacter arcticus
. . . . Reinekea blandensis MED297 ....................................  399  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Reinekea sp. MED297] >gi|88776109|g
. . . . gamma proteobacterium HTCC2207 ................................  397  2 hits [g-proteobacteria]      putative glutaryl-CoA dehydrogenase protein [marine gamma p
. . . . Nitrococcus mobilis Nb-231 ....................................  397  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Nitrococcus mobilis Nb-231] >gi|887
. . . . Azoarcus sp. BH72 .............................................  397  4 hits [b-proteobacteria]      glutaryl-CoA dehydrogenase [Azoarcus sp. BH72] >gi|11967062
. . . . Idiomarina loihiensis L2TR ....................................  397  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Idiomarina loihiensis L2TR] >gi
. . . . Congregibacter litoralis KT71 .................................  396  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Congregibacter litoralis KT71] 
. . . . gamma proteobacterium NOR5-3 ..................................  395  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [gamma proteobacterium NOR5-3] >
. . . . Idiomarina baltica OS145 ......................................  395  4 hits [g-proteobacteria]      Glutaryl-CoA dehydrogenase [Idiomarina baltica OS145] >gi|8
. . . . Shewanella loihica PV-4 .......................................  393  4 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . . . marine gamma proteobacterium HTCC2080 .........................  393  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [marine gamma proteobacterium HT
. . . . Shewanella woodyi ATCC 51908 ..................................  393  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . . . Haliangium ochraceum DSM 14365 ................................  392  2 hits [d-proteobacteria]      acyl-CoA dehydrogenase domain protein [Haliangium ochraceum
. . . . Shewanella amazonensis SB2B ...................................  392  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase-like protein [Shewanella amazonensis
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 ..............  391  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Aeromonas hydrophila subsp. hyd
. . . . Polaromonas sp. JS666 .........................................  390  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like [Polaromonas sp. JS666] >gi|916
. . . . Shewanella sediminis HAW-EB3 ..................................  390  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Shewanell
. . . . Rhodoferax ferrireducens T118 .................................  390  2 hits [b-proteobacteria]      acyl-CoA dehydrogenase-like [Rhodoferax ferrireducens T118]
. . . . Marinobacter algicola DG893 ...................................  388  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Marinobacter algicola DG893] >g
. . . . Shewanella denitrificans OS217 ................................  385  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase-like protein [Shewanella denitrifica
. . . . Shewanella benthica KT99 ......................................  385  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Shewanella benthica KT99] >gi|16133
. . . . Laribacter hongkongensis HLHK9 ................................  380  2 hits [b-proteobacteria]      Probable glutaryl-CoA dehydrogenase [Laribacter hongkongens
. . . . Legionella drancourtii LLAP12 .................................  315  2 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Legionella drancourtii LLAP12] 
. . . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 .  309  4 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Legionella pneumophila subsp. p
. . . . Legionella pneumophila str. Lens ..............................  309  4 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Legionella pneumophila subsp. p
. . . . Legionella pneumophila str. Paris .............................  309  4 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Legionella pneumophila subsp. p
. . . . Legionella pneumophila str. Corby .............................  307  4 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Legionella pneumophila str. Cor
. . . . Geobacter metallireducens GS-15 ...............................  299  4 hits [d-proteobacteria]      Acyl-CoA dehydrogenase-like [Geobacter metallireducens GS-1
. . . . Legionella longbeachae D-4968 .................................  296  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Legionella longbeachae D-4968] 
. . . . Legionella longbeachae NSW150 .................................  296  4 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Legionella longbeachae D-4968] 
. . . . Plesiocystis pacifica SIR-1 ...................................  288  2 hits [d-proteobacteria]      probable glutaryl-CoA dehydrogenase [Plesiocystis pacifica 
. . . . Stenotrophomonas maltophilia K279a ............................  287  2 hits [g-proteobacteria]      putative glutaryl-CoA dehydrogenase [Stenotrophomonas malto
. . . . Sorangium cellulosum 'So ce 56' ...............................  286  2 hits [d-proteobacteria]      glutaryl-CoA dehydrogenase [Sorangium cellulosum 'So ce 56'
. . . . Stenotrophomonas maltophilia R551-3 ...........................  285  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase domain protein [Stenotrophomonas mal
. . . . Xanthomonas oryzae pv. oryzicola BLS256 .......................  284  1 hit  [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas oryzae pv. oryzicol
. . . . Xanthomonas axonopodis pv. citri str. 306 .....................  284  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas axonopodis pv. citr
. . . . Xanthomonas campestris pv. vesicatoria str. 85-10 .............  283  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. vesi
. . . . Xanthomonas oryzae pv. oryzae PXO99A ..........................  282  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase 1 [Xanthomonas oryzae pv. oryzae PXO
. . . . Stenotrophomonas sp. SKA14 ....................................  281  2 hits [g-proteobacteria]      glutaryl CoA dehydrogenase [Stenotrophomonas sp. SKA14] >gi
. . . . Xanthomonas oryzae pv. oryzae KACC10331 .......................  281  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas oryzae pv. oryzae K
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 .....................  281  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas oryzae pv. oryzae K
. . . . Xanthomonas campestris pv. campestris str. ATCC 33913 .........  275  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. camp
. . . . Xanthomonas campestris pv. campestris str. 8004 ...............  275  2 hits [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. camp
. . . . Xanthomonas campestris pv. campestris str. B100 ...............  275  1 hit  [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. camp
. . . . Xanthomonas campestris pv. campestris .........................  275  1 hit  [g-proteobacteria]      glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. camp
. . . . Alteromonadales bacterium TW-7 ................................  196  2 hits [g-proteobacteria]      Isovaleryl-CoA dehydrogenase [Alteromonadales bacterium TW-
. . . . Pseudoalteromonas haloplanktis TAC125 .........................  189  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Pseudoalteromonas haloplankti
. . . . Pseudoalteromonas tunicata D2 .................................  184  2 hits [g-proteobacteria]      Isovaleryl-CoA dehydrogenase [Pseudoalteromonas tunicata D2
. . . . Vibrio parahaemolyticus RIMD 2210633 ..........................  180  4 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RI
. . . . Vibrio parahaemolyticus K5030 .................................  180  2 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RI
. . . . Vibrio parahaemolyticus AN-5034 ...............................  180  2 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RI
. . . . Vibrio parahaemolyticus Peru-466 ..............................  180  2 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RI
. . . . Vibrio parahaemolyticus AQ4037 ................................  180  2 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RI
. . . . Vibrio alginolyticus 12G01 ....................................  179  4 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio alginolyticus 12G01
. . . . Vibrio sp. Ex25 ...............................................  179  4 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Vibrio sp. Ex25] >gi|262395677|ref|
. . . . Vibrio alginolyticus 40B ......................................  178  4 hits [g-proteobacteria]      putative acyl-CoA dehydrogenase [Vibrio alginolyticus 40B] 
. . . . Vibrio parahaemolyticus AQ3810 ................................  177  4 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Vibrio parahaemolyticus AQ381
. . . . Vibrio coralliilyticus ATCC BAA-450 ...........................  177  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Vibrio coralliilyticus ATCC B
. . . . Vibrio vulnificus CMCP6 .......................................  176  2 hits [g-proteobacteria]      Acyl-CoA dehydrogenase [Vibrio vulnificus CMCP6] >gi|273584
. . . . Vibrio vulnificus YJ016 .......................................  176  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase [Vibrio vulnificus YJ016] >gi|372012
. . . . Shewanella sp. MR-4 ...........................................  176  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Shewanella sp. MR-4] >gi|1138
. . . . Shewanella sp. ANA-3 ..........................................  176  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Shewanella sp. ANA-3] >gi|117
. . . . Shewanella sp. MR-7 ...........................................  176  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Shewanella sp. MR-7] >gi|1138
. . . . Enhydrobacter aerosaccus SK60 .................................  175  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase 2 [Enhydrobacter aerosaccus SK
. . . . Geobacter uraniireducens Rf4 ..................................  174  2 hits [d-proteobacteria]      acyl-CoA dehydrogenase domain-containing protein [Geobacter
. . . . Vibrio parahaemolyticus 16 ....................................  174  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase,   (IVD) [Vibrio parahaemolyti
. . . . Shewanella putrefaciens 200 ...................................  174  2 hits [g-proteobacteria]      acyl-CoA dehydrogenase-like [Shewanella putrefaciens 200] >
. . . . Shewanella oneidensis MR-1 ....................................  173  2 hits [g-proteobacteria]      isovaleryl-CoA dehydrogenase [Shewanella oneidensis MR-1] >
. . . Rhodothermus marinus DSM 4252 -----------------------------------  347  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain protein [Rhodothermus marinus
. . . Cytophaga hutchinsonii ATCC 33406 ...............................  314  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Cytophaga hutchinsonii ATCC 33406] 
. . . Chitinophaga pinensis DSM 2588 ..................................  313  4 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain protein [Chitinophaga pinensi
. . . Sphingobacterium spiritivorum ATCC 33300 ........................  310  4 hits [CFB group bacteria]    Glutaryl-CoA dehydrogenase [Sphingobacterium spiritivorum A
. . . Pedobacter heparinus DSM 2366 ...................................  308  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain protein [Pedobacter heparinus
. . . Flavobacterium psychrophilum JIP02/86 ...........................  307  2 hits [CFB group bacteria]    glutaryl-CoA dehydrogenase [Flavobacterium psychrophilum JI
. . . Microscilla marina ATCC 23134 ...................................  305  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase  1 [Microscilla marina ATCC 23134] >
. . . Flavobacteriales bacterium HTCC2170 .............................  305  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Flavobacteriales bacte
. . . Dyadobacter fermentans DSM 18053 ................................  304  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain protein [Dyadobacter fermenta
. . . Robiginitalea biformata HTCC2501 ................................  304  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Robiginitalea biformat
. . . Flavobacterium johnsoniae UW101 .................................  304  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain-containing protein [Flavobact
. . . Sphingobacterium spiritivorum ATCC 33861 ........................  303  4 hits [CFB group bacteria]    Glutaryl-CoA dehydrogenase [Sphingobacterium spiritivorum A
. . . Algoriphagus sp. PR1 ............................................  303  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Algoriphagus sp. PR1] 
. . . Flavobacteria bacterium BAL38 ...................................  302  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Flavobacteria bacterium BAL38] >gi|
. . . Pedobacter sp. BAL39 ............................................  301  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Pedobacter sp. BAL39] >gi|149228844
. . . Chryseobacterium gleum ATCC 35910 ...............................  301  2 hits [CFB group bacteria]    glutaryl-CoA dehydrogenase [Chryseobacterium gleum ATCC 359
. . . Flavobacteriaceae bacterium 3519-10 .............................  300  2 hits [CFB group bacteria]    Glutaryl-CoA dehydrogenase [Flavobacteriaceae bacterium 351
. . . Gramella forsetii KT0803 ........................................  300  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Gramella forsetii KT0803] >gi|11757
. . . Deinococcus deserti VCD115 ......................................  300  2 hits [bacteria]              putative glutaryl-CoA dehydrogenase [Deinococcus deserti VC
. . . Spirosoma linguale DSM 74 .......................................  293  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain protein [Spirosoma linguale D
. . . Psychroflexus torquis ATCC 700755 ...............................  293  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Psychroflexus torquis 
. . . Leeuwenhoekiella blandensis MED217 ..............................  293  4 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like [Leeuwenhoekiella blandensis ME
. . . Deinococcus radiodurans R1 ......................................  293  2 hits [bacteria]              glutaryl-CoA dehydrogenase [Deinococcus radiodurans R1] >gi
. . . Dokdonia donghaensis MED134 .....................................  291  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like [Dokdonia donghaensis MED134] >
. . . Polaribacter sp. MED152 .........................................  290  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Polaribacter sp. MED152] >gi|858220
. . . Deinococcus geothermalis DSM 11300 ..............................  290  2 hits [bacteria]              acyl-CoA dehydrogenase-like [Deinococcus geothermalis DSM 1
. . . Croceibacter atlanticus HTCC2559 ................................  288  2 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Croceibacter atlanticu
. . . Polaribacter irgensii 23-P ......................................  287  4 hits [CFB group bacteria]    Acyl-CoA dehydrogenase-like protein [Polaribacter irgensii 
. . . Flavobacteria bacterium BBFL7 ...................................  287  2 hits [CFB group bacteria]    glutaryl-CoA dehydrogenase [Flavobacteria bacterium BBFL7] 
. . . Meiothermus ruber DSM 1279 ......................................  286  4 hits [bacteria]              acyl-CoA dehydrogenase [Meiothermus ruber DSM 1279] >gi|227
. . . unidentified eubacterium SCB49 ..................................  284  4 hits [CFB group bacteria]    acyl-CoA dehydrogenase [unidentified eubacterium SCB49] >gi
. . . Kordia algicida OT-1 ............................................  284  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Kordia algicida OT-1] >gi|161326865
. . . Flavobacteriales bacterium ALC-1 ................................  282  4 hits [CFB group bacteria]    acyl-CoA dehydrogenase [Flavobacteriales bacterium ALC-1] >
. . . Acidobacterium capsulatum ATCC 51196 ............................  281  2 hits [bacteria]              glutaryl-CoA dehydrogenase [Acidobacterium capsulatum ATCC 
. . . Streptomyces ghanaensis ATCC 14672 ..............................  280  3 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces ghanaensis ATCC 14672]
. . . Salinibacter ruber DSM 13855 ....................................  280  2 hits [CFB group bacteria]    acyl-CoA dehydrogenase domain-containing protein [Salinibac
. . . Streptomyces griseoflavus Tu4000 ................................  278  3 hits [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces griseoflavus Tu4000]
. . . Gemmatimonas aurantiaca T-27 ....................................  277  4 hits [bacteria]              glutaryl-CoA dehydrogenase [Gemmatimonas aurantiaca T-27] >
. . . Micromonospora sp. L5 ...........................................  275  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Micromonospora sp. L
. . . Micromonospora aurantiaca ATCC 27029 ............................  275  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Micromonospora auran
. . . Streptomyces sviceus ATCC 29083 .................................  275  4 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces sviceus ATCC 29083] >g
. . . Streptomyces scabiei 87.22 ......................................  275  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Streptomyces scabiei 87.22]
. . . Candidatus Koribacter versatilis Ellin345 .......................  274  2 hits [bacteria]              acyl-CoA dehydrogenase-like [Candidatus Koribacter versatil
. . . Micromonospora sp. ATCC 39149 ...................................  274  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Micromonospora sp. ATCC 39149] >gi|
. . . Streptomyces avermitilis MA-4680 ................................  272  4 hits [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces avermitilis MA-4680] >
. . . Streptomyces viridochromogenes DSM 40736 ........................  272  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces viridochromogenes DSM 
. . . Corynebacterium jeikeium K411 ...................................  271  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Corynebacterium jeikeium K411] >gi|
. . . Corynebacterium jeikeium ATCC 43734 .............................  271  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Corynebacterium jeikeium ATCC 4
. . . Salinispora tropica CNB-440 .....................................  268  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Salinispo
. . . Saccharomonospora viridis DSM 43017 .............................  268  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Saccharomonospora viridis DSM 43017
. . . Streptomyces sp. SPB78 ..........................................  267  2 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces sp. SPB78]
. . . Saccharopolyspora erythraea NRRL 2338 ...........................  267  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Saccharopolyspora erythraea NRR
. . . Streptomyces flavogriseus ATCC 33331 ............................  265  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Streptomyces flavogr
. . . Salinispora arenicola CNS-205 ...................................  265  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Salinispo
. . . Streptomyces pristinaespiralis ATCC 25486 .......................  265  4 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces pristinaespiralis ATCC
. . . Streptomyces sp. ACTE ...........................................  265  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Streptomyces sp. ACT
. . . Meiothermus silvanus DSM 9946 ...................................  264  4 hits [bacteria]              acyl-CoA dehydrogenase [Meiothermus silvanus DSM 9946] >gi|
. . . Candidatus Solibacter usitatus Ellin6076 ........................  264  2 hits [bacteria]              acyl-CoA dehydrogenase domain-containing protein [Solibacte
. . . Streptomyces hygroscopicus ATCC 53653 ...........................  264  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces hygroscopicus ATCC 536
. . . Streptomyces sp. SPB74 ..........................................  264  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Streptomyces sp. SPB74] >gi|197
. . . Mycobacterium intracellulare ATCC 13950 .........................  263  1 hit  [high GC Gram+]         putative acyl-CoA dehydrogenase [Mycobacterium intracellula
. . . Streptomyces coelicolor A3(2) ...................................  263  4 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces coelicolor A3(2)] >gi|
. . . Streptomyces lividans TK24 ......................................  263  2 hits [high GC Gram+]         acyl CoA dehydrogenase [Streptomyces coelicolor A3(2)] >gi|
. . . Streptomyces sp. AA4 ............................................  263  1 hit  [high GC Gram+]         glutaryl-CoA dehydrogenase [Streptomyces sp. AA4]
. . . Streptomyces roseosporus NRRL 15998 .............................  263  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Streptomyces roseosporus N
. . . Streptomyces roseosporus NRRL 11379 .............................  263  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Streptomyces roseosporus N
. . . Mycobacterium avium subsp. avium ATCC 25291 .....................  262  1 hit  [high GC Gram+]         putative acyl-CoA dehydrogenase [Mycobacterium avium subsp.
. . . Thermomonospora curvata DSM 43183 ...............................  262  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Thermomonospora curv
. . . Streptosporangium roseum DSM 43021 ..............................  261  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Streptosporangium ro
. . . Mycobacterium avium 104 .........................................  261  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Mycobacterium avium 104] >
. . . Conexibacter woesei DSM 14684 ...................................  261  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Conexibacter woesei 
. . . Catenulispora acidiphila DSM 44928 ..............................  261  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Catenulispora acidip
. . . Streptomyces griseus subsp. griseus NBRC 13350 ..................  261  4 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Streptomyces griseus subsp
. . . Rubrobacter xylanophilus DSM 9941 ...............................  260  8 hits [high GC Gram+]         acyl-CoA dehydrogenase-like protein [Rubrobacter xylanophil
. . . Arthrobacter aurescens TC1 ......................................  260  2 hits [high GC Gram+]         putative glutaryl-CoA dehydrogenase [Arthrobacter aurescens
. . . Mycobacterium ulcerans Agy99 ....................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FadE7 [Mycobacterium ulcerans Agy99]
. . . Mycobacterium marinum M .........................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FadE7 [Mycobacterium ulcerans Agy99]
. . . Mycobacterium kansasii ATCC 12478 ...............................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FadE7 [Mycobacterium kansasii ATCC 1
. . . Brevibacterium linens BL2 .......................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Brevibacterium linen
. . . Streptomyces sp. ACT-1 ..........................................  259  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Streptomyces sp. ACT
. . . Mycobacterium tuberculosis H37Rv ................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium bovis AF2122/97 ...................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium bovis BCG str. Pasteur 1173P2 .....................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis H37Ra ................................  259  3 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis F11 ..................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis 02_1987 ..............................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis 94_M4241A ............................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis T92 ..................................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis EAS054 ...............................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis T85 ..................................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis GM 1503 ..............................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis T17 ..................................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium bovis BCG str. Tokyo 172 ..........................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis str. Haarlem .........................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis '98-R604 INH-RIF-EM' .................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis T46 ..................................  259  2 hits [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis K85 ..................................  259  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase FADE7 [Mycobacterium tuberculosis H3
. . . Mycobacterium tuberculosis CDC1551 ..............................  258  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase, putative [Mycobacterium tubercu
. . . Mycobacterium tuberculosis KZN 1435 .............................  258  2 hits [high GC Gram+]         acyl-CoA dehydrogenase fadE7 [Mycobacterium tuberculosis KZ
. . . Mycobacterium tuberculosis KZN 4207 .............................  258  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase fadE7 [Mycobacterium tuberculosis KZ
. . . Mycobacterium tuberculosis KZN 605 ..............................  258  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase fadE7 [Mycobacterium tuberculosis KZ
. . . Thermus thermophilus HB27 .......................................  258  4 hits [bacteria]              glutaryl-CoA dehydrogenase [Thermus thermophilus HB27] >gi|
. . . Mycobacterium vanbaalenii PYR-1 .................................  258  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Mycobacte
. . . Gordonia bronchialis DSM 43247 ..................................  258  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Gordonia bronchialis
. . . Thermobifida fusca YX ...........................................  258  4 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Thermobifida fusca YX] >gi|7191
. . . Nocardioides sp. JS614 ..........................................  258  4 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Nocardioi
. . . Mycobacterium tuberculosis C ....................................  258  2 hits [high GC Gram+]         acyl-CoA dehydrogenase fadE7 [Mycobacterium tuberculosis C]
. . . Mycobacterium avium subsp. paratuberculosis K-10 ................  258  2 hits [high GC Gram+]         FadE7 [Mycobacterium avium subsp. paratuberculosis K-10] >g
. . . Thermus thermophilus HB8 ........................................  258  4 hits [bacteria]              putative glutaryl-CoA dehydrogenase [Thermus thermophilus H
. . . Thermus thermophilus ............................................  258 10 hits [bacteria]              putative glutaryl-CoA dehydrogenase [Thermus thermophilus H
. . . Mycobacterium tuberculosis CPHL_A ...............................  257  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase, putative [Mycobacterium tubercu
. . . Janibacter sp. HTCC2649 .........................................  256  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Janibacter sp. HTCC2649] >
. . . Rhodococcus opacus B4 ...........................................  256  6 hits [high GC Gram+]         putative glutaryl-CoA dehydrogenase [Rhodococcus opacus B4]
. . . Thermus aquaticus Y51MC23 .......................................  256  2 hits [bacteria]              acyl-CoA dehydrogenase domain protein [Thermus aquaticus Y5
. . . Kribbella flavida DSM 17836 .....................................  255  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Kribbella flavida DS
. . . Aeromicrobium marinum DSM 15272 .................................  255  1 hit  [high GC Gram+]         glutaryl-CoA dehydrogenase [Aeromicrobium marinum DSM 15272]
. . . Mycobacterium sp. KMS ...........................................  254  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Mycobacte
. . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 .........  254  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Nocardiopsis dassonvillei subsp. da
. . . Mycobacterium sp. MCS ...........................................  253  2 hits [high GC Gram+]         acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
. . . Mycobacterium sp. JLS ...........................................  253  2 hits [high GC Gram+]         acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
. . . Mycobacterium smegmatis str. MC2 155 ............................  253  6 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC
. . . Nakamurella multipartita DSM 44233 ..............................  253  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Nakamurella multipar
. . . Rhodococcus jostii RHA1 .........................................  253  4 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Rhodococcus jostii RHA1] >gi|11
. . . Tsukamurella paurometabola DSM 20162 ............................  252  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Tsukamurella paurometabola DSM 2016
. . . Kocuria rhizophila DC2201 .......................................  251  4 hits [high GC Gram+]         putative glutaryl-CoA dehydrogenase [Kocuria rhizophila DC2
. . . Mycobacterium abscessus ATCC 19977 ..............................  250  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase FadE [Mycobacterium abscess
. . . Mycobacterium abscessus .........................................  250  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase FadE [Mycobacterium abscess
. . . Rhodococcus erythropolis PR4 ....................................  250  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Rhodococcus erythropolis PR4] >
. . . Rhodococcus erythropolis SK121 ..................................  249  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Rhodococcus erythropolis SK121]
. . . Arthrobacter chlorophenolicus A6 ................................  249  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Arthrobacter chlorop
. . . Nocardia farcinica IFM 10152 ....................................  247  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [Nocardia farcinica IFM 101
. . . Arthrobacter sp. FB24 ...........................................  247  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Arthrobac
. . . Renibacterium salmoninarum ATCC 33209 ...........................  246  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Renibacterium salmoninarum ATCC
. . . Mycobacterium gilvum PYR-GCK ....................................  246  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain-containing protein [Mycobacte
. . . Micrococcus luteus NCTC 2665 ....................................  243  5 hits [high GC Gram+]         acyl-CoA dehydrogenase [Micrococcus luteus NCTC 2665] >gi|2
. . . Streptomyces sp. C ..............................................  241  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces sp. C]
. . . uncultured bacterium ............................................  241  1 hit  [bacteria]              acyl-CoA dehydrogenase [uncultured bacterium]
. . . Corynebacterium efficiens YS-314 ................................  241  8 hits [high GC Gram+]         putative glutaryl-CoA dehydrogenase [Corynebacterium effici
. . . Corynebacterium aurimucosum ATCC 700975 .........................  241  3 hits [high GC Gram+]         acyl-CoA dehydrogenase [Corynebacterium aurimucosum ATCC 70
. . . Streptomyces sp. Mg1 ............................................  241  6 hits [high GC Gram+]         acyl-CoA dehydrogenase [Streptomyces sp. Mg1] >gi|254387164
. . . Streptomyces albus J1074 ........................................  236  2 hits [high GC Gram+]         putative glutaryl-CoA dehydrogenase [Streptomyces albus J10
. . . marine actinobacterium PHSC20C1 .................................  227  2 hits [high GC Gram+]         putative acyl-CoA dehydrogenase [marine actinobacterium PHS
. . . Corynebacterium genitalium ATCC 33030 ...........................  221  2 hits [high GC Gram+]         glutaryl-CoA dehydrogenase [Corynebacterium genitalium ATCC
. . . Geobacillus sp. WCH70 ...........................................  204  6 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Geobacillus sp. WCH7
. . . Geobacillus kaustophilus HTA426 .................................  204  4 hits [firmicutes]            acyl-CoA dehydrogenase [Geobacillus kaustophilus HTA426] >g
. . . Geobacillus sp. G11MC16 .........................................  202  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Geobacillus sp. G11M
. . . Geobacillus thermodenitrificans NG80-2 ..........................  202  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Geobacillus thermodenitrificans NG8
. . . Bacillus coagulans 36D1 .........................................  202  6 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Bacillus coagulans 3
. . . Chloroflexus aggregans DSM 9485 .................................  202  2 hits [GNS bacteria]          acyl-CoA dehydrogenase domain protein [Chloroflexus aggrega
. . . Geobacillus sp. Y412MC52 ........................................  202  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Geobacillus sp. Y412
. . . Geobacillus sp. Y412MC61 ........................................  202  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Geobacillus sp. Y412
. . . Chloroflexus aurantiacus J-10-fl ................................  199  4 hits [GNS bacteria]          acyl-CoA dehydrogenase domain-containing protein [Chlorofle
. . . Chloroflexus sp. Y-400-fl .......................................  199  4 hits [GNS bacteria]          acyl-CoA dehydrogenase domain-containing protein [Chlorofle
. . . Geobacillus sp. Y4.1MC1 .........................................  197  6 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Geobacillus sp. Y4.1
. . . Bacillus pseudofirmus OF4 .......................................  197  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus pseudofirmus OF4] >gi|2885
. . . Anoxybacillus flavithermus WK1 ..................................  196  6 hits [firmicutes]            Acyl-CoA dehydrogenase [Anoxybacillus flavithermus WK1] >gi
. . . Bacillus mycoides Rock3-17 ......................................  195  6 hits [firmicutes]            Acyl-CoA dehydrogenase domain protein [Bacillus mycoides Ro
. . . Bacillus mycoides Rock1-4 .......................................  195  6 hits [firmicutes]            Acyl-CoA dehydrogenase domain protein [Bacillus mycoides Ro
. . . Oceanobacillus iheyensis HTE831 .................................  195  6 hits [firmicutes]            acyl-CoA dehydrogenase [Oceanobacillus iheyensis HTE831] >g
. . . Bacillus subtilis ...............................................  194  4 hits [firmicutes]            similar to product encoded by Bacillus subtilis short chain
. . . Bacillus pseudomycoides DSM 12442 ...............................  194  6 hits [firmicutes]            Acyl-CoA dehydrogenase domain protein [Bacillus pseudomycoi
. . . Bacillus subtilis subsp. subtilis str. 168 ......................  193  7 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus subtilis subsp. subtilis s
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ................  193  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus subtilis subsp. subtilis s
. . . Bacillus subtilis subsp. subtilis str. JH642 ....................  193  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus subtilis subsp. subtilis s
. . . Bacillus subtilis subsp. subtilis str. SMY ......................  193  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus subtilis subsp. subtilis s
. . . Lysinibacillus sphaericus C3-41 .................................  192  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Lysinibacillus sphaericus C3-41] >g
. . . Bacillus sp. B14905 .............................................  192  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus sp. 
. . . Bacillus sp. NRRL B-14911 .......................................  192  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus sp. NRRL B-14911] >gi|8908
. . . Brevibacillus brevis NBRC 100599 ................................  192  2 hits [firmicutes]            probable acyl-CoA dehydrogenase short-chain specific [Brevi
. . . Kineococcus radiotolerans SRS30216 ..............................  191  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Kineococcus radiotol
. . . Bacillus clausii KSM-K16 ........................................  191  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus clausii KSM-K16] >gi|56911
. . . Bacillus cellulosilyticus DSM 2522 ..............................  191  4 hits [firmicutes]            Butyryl-CoA dehydrogenase [Bacillus cellulosilyticus DSM 25
. . . Bacillus sp. SG-1 ...............................................  191  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus sp. 
. . . Bacillus thuringiensis IBL 200 ..................................  188  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis IBL 200] >gi
. . . Fusobacterium mortiferum ATCC 9817 ..............................  187  2 hits [fusobacteria]          acyl-COA dehydrogenase [Fusobacterium mortiferum ATCC 9817]
. . . Bacillus cereus R309803 .........................................  187  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus R309803] >gi|228619
. . . Bacillus cereus AH1271 ..........................................  187  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus AH1271] >gi|2291760
. . . Bacillus cereus MM3 .............................................  187  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus AH1271] >gi|2291760
. . . Desulfitobacterium hafniense Y51 ................................  187  2 hits [firmicutes]            hypothetical protein DSY1716 [Desulfitobacterium hafniense 
. . . Desulfitobacterium hafniense DCB-2 ..............................  187  2 hits [firmicutes]            hypothetical protein DSY1716 [Desulfitobacterium hafniense 
. . . Anaerococcus tetradius ATCC 35098 ...............................  187  4 hits [firmicutes]            acyl-CoA dehydrogenase [Anaerococcus tetradius ATCC 35098] 
. . . Bacillus cereus AH1273 ..........................................  187  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus AH1273] >gi|2290267
. . . Bacillus cereus AH1272 ..........................................  187  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus AH1273] >gi|2290267
. . . Bacillus weihenstephanensis KBAB4 ...............................  187  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus mycoides DSM 2048 ......................................  187  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus cereus AH603 ...........................................  187  6 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus cereus BDRD-ST196 ......................................  187  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus cereus AH621 ...........................................  187  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Clostridium botulinum A3 str. Loch Maree ........................  186  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum Bf ........................................  186  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum Ba4 str. 657 ..............................  186  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 .............  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar puls
. . . Bacillus cereus Rock4-2 .........................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock4-2] >gi|228700
. . . Bacillus cereus ATCC 14579 ......................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus B4264 ...........................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus thuringiensis serovar pakistani str. T13001 ............  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus AH676 ...........................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus Rock1-15 ........................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus BDRD-Cer4 .......................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus BDRD-ST24 .......................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 .........  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar anda
. . . Bacillus cereus m1293 ...........................................  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar anda
. . . Thermobaculum terrenum ATCC BAA-798 .............................  186  2 hits [bacteria]              acyl-CoA dehydrogenase domain protein [Thermobaculum terren
. . . Anaerococcus prevotii DSM 20548 .................................  186  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Anaerococcus prevoti
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ........  186  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar pond
. . . Bacillus cereus Rock3-42 ........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock3-42] >gi|22868
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ..........  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar huaz
. . . Bacillus cereus ATCC 10876 ......................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar huaz
. . . Bacillus cereus Rock3-44 ........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock3-44] >gi|22869
. . . Bacillus cereus F65185 ..........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus F65185] >gi|2287102
. . . Bacillus thuringiensis serovar berliner ATCC 10792 ..............  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar berl
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 ........  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar berl
. . . Bacillus thuringiensis Bt407 ....................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar berl
. . . Bacillus coahuilensis m4-4 ......................................  185  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus cereus Rock4-18 ........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock4-18] >gi|22911
. . . Bacillus cereus Rock1-3 .........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock4-18] >gi|22911
. . . Clostridium botulinum NCTC 2916 .................................  185  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum A2 str. Kyoto .............................  185  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Faecalibacterium prausnitzii M21/2 ..............................  185  2 hits [firmicutes]            hypothetical protein FAEPRAM212_00328 [Faecalibacterium pra
. . . Bacillus cereus Rock3-29 ........................................  185  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock3-29] >gi|22868
. . . Clostridium tetani E88 ..........................................  185  2 hits [firmicutes]            acyl-CoA dehydrogenase [Clostridium tetani E88] >gi|2820350
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ...  185  2 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Alicyclobacillus aci
. . . Bacillus licheniformis ATCC 14580 ...............................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus licheniformis ATCC 14580] 
. . . Bacillus cereus G9842 ...........................................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus G9842] >gi|22890509
. . . Bacillus thuringiensis IBL 4222 .................................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus G9842] >gi|22890509
. . . Bacillus thuringiensis serovar sotto str. T04001 ................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus G9842] >gi|22890509
. . . Bacillus cereus AH820 ...........................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus AH820] >gi|21853671
. . . Bacillus cereus ATCC 4342 .......................................  184  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus ATCC 4342] >gi|2286
. . . Bacillus cereus G9241 ...........................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus H3081.97 ........................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus AH187 ...........................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus Q1 ..............................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ............  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus BDRD-ST26 .......................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase, short-chain specific [Bacillus cere
. . . Bacillus cereus E33L ............................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus E33L] >gi|51973688|
. . . Bacillus cereus Rock3-28 ........................................  184  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus Rock3-28] >gi|22867
. . . Bacillus anthracis str. Ames ....................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. 'Ames Ancestor' .........................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. Sterne ..................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A2012 ...................................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0488 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0442 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0193 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0465 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0389 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0174 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis Tsiankovskii-I ...............................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus cereus W ...............................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. CDC 684 .................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ..............  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus cereus 95/8201 .........................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A0248 ...................................  184  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. CNEVA-9066 ..............................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. A1055 ...................................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. Western North America USA6153 ...........  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. Kruger B ................................  184  1 hit  [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. Vollum ..................................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Bacillus anthracis str. Australia 94 ............................  184  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus anthracis str. Ames] >gi|4
. . . Carboxydothermus hydrogenoformans Z-2901 ........................  184  6 hits [firmicutes]            butyryl-CoA dehydrogenase [Carboxydothermus hydrogenoforman
. . . Geodermatophilus obscurus DSM 43160 .............................  183  4 hits [high GC Gram+]         Glutaryl-CoA dehydrogenase [Geodermatophilus obscurus DSM 4
. . . Clostridium botulinum A str. ATCC 3502 ..........................  183  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum A str. ATCC 19397 .........................  183  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum A str. Hall ...............................  183  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Bacillus thuringiensis serovar konkukian str. 97-27 .............  183  4 hits [firmicutes]            butyryl-CoA dehydrogenase (short-chain acyl-CoA dehydrogena
. . . Anaerotruncus colihominis DSM 17241 .............................  183  2 hits [firmicutes]            hypothetical protein ANACOL_01114 [Anaerotruncus colihomini
. . . Bacillus cereus ATCC 10987 ......................................  183  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus ATCC 10987] >gi|427
. . . Bacillus cereus AH1134 ..........................................  183  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus AH1134] >gi|2067349
. . . Bacillus cereus 172560W .........................................  182  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus 172560W] >gi|228601
. . . Bacillus cereus m1550 ...........................................  182  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus cereus m1550] >gi|22863010
. . . Alicyclobacillus acidocaldarius LAA1 ............................  182  2 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Alicyclobacillus aci
. . . Anaerococcus lactolyticus ATCC 51172 ............................  182  2 hits [firmicutes]            acyl-CoA dehydrogenase [Anaerococcus lactolyticus ATCC 5117
. . . Bacillus cereus NVH0597-99 ......................................  182  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus cereus NVH0597-99] >gi|196
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 ............  182  4 hits [firmicutes]            Acyl-CoA dehydrogenase [Bacillus thuringiensis serovar kurs
. . . Bacillus thuringiensis str. Al Hakam ............................  182  2 hits [firmicutes]            butyryl-CoA dehydrogenase [Bacillus thuringiensis str. Al H
. . . Bacillus cereus 03BB108 .........................................  182  2 hits [firmicutes]            butyryl-CoA dehydrogenase [Bacillus thuringiensis str. Al H
. . . Bacillus cereus 03BB102 .........................................  182  4 hits [firmicutes]            butyryl-CoA dehydrogenase [Bacillus thuringiensis str. Al H
. . . Bacillus cereus BGSC 6E1 ........................................  182  2 hits [firmicutes]            butyryl-CoA dehydrogenase [Bacillus thuringiensis str. Al H
. . . Acidaminococcus fermentans DSM 20731 ............................  182  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Acidaminococcus ferm
. . . Anaerococcus hydrogenalis DSM 7454 ..............................  182  2 hits [firmicutes]            hypothetical protein ANHYDRO_01369 [Anaerococcus hydrogenal
. . . Peptoniphilus lacrimalis 315-B ..................................  182  2 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Peptoniph
. . . Thermotoga lettingae TMO ........................................  181  2 hits [thermotogales]         acyl-CoA dehydrogenase domain-containing protein [Thermotog
. . . Acidaminococcus sp. D21 .........................................  181  2 hits [firmicutes]            conserved hypothetical protein [Acidaminococcus sp. D21] >g
. . . Clostridium botulinum F str. Langeland ..........................  181  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Clostridium botulinum B1 str. Okra ..............................  181  2 hits [firmicutes]            acyl-CoA dehydrogenase family protein/electron transfer pro
. . . Fusobacterium sp. 3_1_36A2 ......................................  181  2 hits [fusobacteria]          acyl-CoA dehydrogenase [Fusobacterium sp. 3_1_36A2] >gi|256
. . . Fusobacterium sp. 3_1_33 ........................................  181  2 hits [fusobacteria]          acyl-CoA dehydrogenase [Fusobacterium sp. 3_1_33] >gi|26019
. . . Fusobacterium sp. 4_1_13 ........................................  181  2 hits [fusobacteria]          acyl-COA dehydrogenase [Fusobacterium sp. 4_1_13] >gi|22943
. . . Actinosynnema mirum DSM 43827 ...................................  181  2 hits [high GC Gram+]         acyl-CoA dehydrogenase domain protein [Actinosynnema mirum 
. . . Fusobacterium sp. 7_1 ...........................................  181  2 hits [fusobacteria]          acyl-COA dehydrogenase [Fusobacterium sp. 7_1] >gi|22943253
. . . Fusobacterium sp. D11 ...........................................  181  1 hit  [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Thermosinus carboxydivorans Nor1 ................................  181  4 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Thermosinus carboxyd
. . . Clostridium sporogenes ATCC 15579 ...............................  181  2 hits [firmicutes]            hypothetical protein CLOSPO_02164 [Clostridium sporogenes A
. . . Anaerococcus vaginalis ATCC 51170 ...............................  181  2 hits [firmicutes]            butyryl-CoA dehydrogenase [Anaerococcus vaginalis ATCC 5117
. . . Fusobacterium nucleatum subsp. polymorphum ATCC 10953 ...........  180  2 hits [fusobacteria]          acyl-CoA dehydrogenase [Fusobacterium nucleatum subsp. poly
. . . Fusobacterium varium ATCC 27725 .................................  180  2 hits [fusobacteria]          acyl-coA dehydrogenase [Fusobacterium varium ATCC 27725] >g
. . . Bacillus amyloliquefaciens FZB42 ................................  180  2 hits [firmicutes]            MmgC [Bacillus amyloliquefaciens FZB42] >gi|154352525|gb|AB
. . . Fusobacterium gonidiaformans ATCC 25563 .........................  180  1 hit  [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Fusobacterium sp. 3_1_5R ........................................  180  1 hit  [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Bacillus selenitireducens MLS10 .................................  180  2 hits [firmicutes]            oligopeptide/dipeptide ABC transporter, ATPase subunit [Bac
. . . Fusobacterium periodonticum ATCC 33693 ..........................  180  1 hit  [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Fusobacterium nucleatum subsp. nucleatum ATCC 25586 .............  180  2 hits [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Herpetosiphon aurantiacus ATCC 23779 ............................  179  2 hits [GNS bacteria]          acyl-CoA dehydrogenase domain-containing protein [Herpetosi
. . . Bacillus halodurans C-125 .......................................  179  4 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus halodurans C-125] >gi|1017
. . . Treponema vincentii ATCC 35580 ..................................  179  2 hits [spirochetes]           acyl-coa dehydrogenase, short-chain specific [Treponema vin
. . . Eubacterium dolichum DSM 3991 ...................................  179  4 hits [firmicutes]            hypothetical protein EUBDOL_01350 [Eubacterium dolichum DSM
. . . Rhodococcus sp. TFB .............................................  179  1 hit  [high GC Gram+]         acyl-CoA dehydrogenase [Rhodococcus sp. TFB]
. . . Bacillus cytotoxicus NVH 391-98 .................................  179  4 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Bacillus 
. . . Bacillus pumilus ATCC 7061 ......................................  179  2 hits [firmicutes]            acyl-CoA dehydrogenase [Bacillus pumilus ATCC 7061] >gi|194
. . . Fusobacterium sp. D12 ...........................................  178  1 hit  [fusobacteria]          acyl-COA dehydrogenase, short-chain specific [Fusobacterium
. . . Bacillus pumilus SAFR-032 .......................................  178  2 hits [firmicutes]            acyl-CoA dehydrogenase (NADP(+)) [Bacillus pumilus SAFR-032
. . . Anaerostipes caccae DSM 14662 ...................................  178  2 hits [firmicutes]            hypothetical protein ANACAC_00523 [Anaerostipes caccae DSM 
. . . Fusobacterium sp. 2_1_31 ........................................  177  2 hits [fusobacteria]          acyl-COA dehydrogenase [Fusobacterium sp. 2_1_31] >gi|22942
. . . Anaerofustis stercorihominis DSM 17244 ..........................  177  2 hits [firmicutes]            hypothetical protein ANASTE_00112 [Anaerofustis stercorihom
. . . Fusobacterium ulcerans ATCC 49185 ...............................  176  1 hit  [fusobacteria]          acyl-coA dehydrogenase [Fusobacterium ulcerans ATCC 49185]
. . . Clostridium botulinum D str. 1873 ...............................  176  2 hits [firmicutes]            acyl-coa dehydrogenase, short-chain specific [Clostridium b
. . . Clostridium kluyveri DSM 555 ....................................  176  2 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Clostridium k
. . . Clostridium kluyveri NBRC 12016 .................................  176  2 hits [firmicutes]            Acyl-CoA dehydrogenase, short-chain specific [Clostridium k
. . . Heliobacterium modesticaldum Ice1 ...............................  176  2 hits [firmicutes]            butyryl-coa dehydrogenase [Heliobacterium modesticaldum Ice
. . . Stackebrandtia nassauensis DSM 44728 ............................  176  2 hits [high GC Gram+]         acyl-CoA dehydrogenase [Stackebrandtia nassauensis DSM 4472
. . . Thermosipho melanesiensis BI429 .................................  176  2 hits [thermotogales]         acyl-CoA dehydrogenase domain-containing protein [Thermosip
. . . Roseburia inulinivorans DSM 16841 ...............................  175  2 hits [firmicutes]            hypothetical protein ROSEINA2194_00109 [Roseburia inulinivo
. . . Clostridium carboxidivorans P7 ..................................  175  2 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Clostridium carboxid
. . . Clostridium botulinum E1 str. 'BoNT E Beluga' ...................  174  2 hits [firmicutes]            acyl-coA dehydrogenase [Clostridium botulinum E1 str. 'BoNT
. . . Clostridium botulinum E3 str. Alaska E43 ........................  174  2 hits [firmicutes]            acyl-coA dehydrogenase [Clostridium botulinum E3 str. Alask
. . . Dethiobacter alkaliphilus AHT 1 .................................  174  2 hits [firmicutes]            acyl-CoA dehydrogenase domain protein [Dethiobacter alkalip
. . . Clostridium beijerinckii NCIMB 8052 .............................  173  2 hits [firmicutes]            acyl-CoA dehydrogenase domain-containing protein [Clostridi
. . Naegleria gruberi -------------------------------------------------  378  2 hits [eukaryotes]            glutaryl-coenzyme A dehydrogenase [Naegleria gruberi]
. . Ciona intestinalis ................................................  372  1 hit  [tunicates]             PREDICTED: similar to glutaryl-Coenzyme A dehydrogenase [Ci
. . Danio rerio (zebra fish) ..........................................  368  6 hits [bony fishes]           glutaryl-Coenzyme A dehydrogenase, like [Danio rerio] >gi|5
. . Monosiga brevicollis MX1 ..........................................  365  4 hits [choanoflagellates]     hypothetical protein [Monosiga brevicollis MX1] >gi|1637751
. . Dictyostelium discoideum AX4 ......................................  363  4 hits [cellular slime molds]  glutaryl-CoA dehydrogenase [Dictyostelium discoideum AX4] >
. . Dictyostelium discoideum ..........................................  363  1 hit  [cellular slime molds]  glutaryl-CoA dehydrogenase [Dictyostelium discoideum AX4] >
. . Nematostella vectensis ............................................  362  2 hits [sea anemones]          predicted protein [Nematostella vectensis] >gi|156227336|gb
. . Xenopus laevis (common platanna) ..................................  362  2 hits [frogs & toads]         glutaryl-Coenzyme A dehydrogenase [Xenopus laevis] >gi|5060
. . Ornithorhynchus anatinus (duck-billed platypus) ...................  360  1 hit  [monotremes]            PREDICTED: similar to Glutaryl-Coenzyme A dehydrogenase [Or
. . Caenorhabditis elegans (nematode) .................................  360  3 hits [nematodes]             hypothetical protein F54D5.7 [Caenorhabditis elegans] >gi|2
. . Paramecium tetraurelia strain d4-2 ................................  360  6 hits [ciliates]              hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Paramecium tetraurelia ............................................  360  6 hits [ciliates]              hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Xenopus (Silurana) tropicalis .....................................  357  4 hits [frogs & toads]         glutaryl-Coenzyme A dehydrogenase [Xenopus (Silurana) tropi
. . Rattus norvegicus (brown rat) .....................................  357  2 hits [rodents]               glutaryl-Coenzyme A dehydrogenase [Rattus norvegicus] >gi|1
. . Tetrahymena thermophila ...........................................  357  2 hits [ciliates]              Acyl-CoA dehydrogenase, C-terminal domain containing protei
. . Tetrahymena thermophila SB210 .....................................  357  2 hits [ciliates]              Acyl-CoA dehydrogenase, C-terminal domain containing protei
. . Canis lupus familiaris (dogs) .....................................  356  1 hit  [carnivores]            PREDICTED: similar to Glutaryl-CoA dehydrogenase, mitochond
. . Tribolium castaneum (rust-red flour beetle) .......................  356  2 hits [beetles]               PREDICTED: similar to acyl-coa dehydrogenase [Tribolium cas
. . Caenorhabditis briggsae ...........................................  356  2 hits [nematodes]             Hypothetical protein CBG02861 [Caenorhabditis briggsae] >gi
. . Trypanosoma cruzi strain CL Brener ................................  353  2 hits [kinetoplastids]        hypothetical protein [Trypanosoma cruzi strain CL Brener] >
. . Trypanosoma cruzi .................................................  353  2 hits [kinetoplastids]        hypothetical protein [Trypanosoma cruzi strain CL Brener] >
. . Ailuropoda melanoleuca ............................................  353  1 hit  [carnivores]            hypothetical protein PANDA_009866 [Ailuropoda melanoleuca]
. . Salmo salar .......................................................  353  1 hit  [bony fishes]           Glutaryl-CoA dehydrogenase, mitochondrial precursor [Salmo 
. . Mus musculus (mouse) ..............................................  352 10 hits [rodents]               glutaryl-Coenzyme A dehydrogenase, isoform CRA_b [Mus muscu
. . Phytophthora infestans T30-4 ......................................  352  2 hits [oomycetes]             glutaryl-CoA dehydrogenase, putative [Phytophthora infestan
. . Equus caballus (equine) ...........................................  352  1 hit  [odd-toed ungulates]    PREDICTED: similar to Glutaryl-Coenzyme A dehydrogenase [Eq
. . Trichoplax adhaerens ..............................................  350  2 hits [placozoans]            expressed hypothetical protein [Trichoplax adhaerens] >gi|1
. . Monodelphis domestica .............................................  350  1 hit  [marsupials]            PREDICTED: hypothetical protein [Monodelphis domestica]
. . Ixodes scapularis (shoulder tick) .................................  350  4 hits [mites & ticks]         glutaryl-CoA dehydrogenase, putative [Ixodes scapularis] >g
. . Macaca mulatta (rhesus macaque) ...................................  350  3 hits [primates]              PREDICTED: glutaryl-Coenzyme A dehydrogenase isoform 2 [Mac
. . Homo sapiens (man) ................................................  350 20 hits [primates]              glutaryl-CoA dehydrogenase, GCDH [human, liver, Peptide, 43
. . Tetraodon nigroviridis ............................................  348  2 hits [bony fishes]           unnamed protein product [Tetraodon nigroviridis]
. . Bos taurus (cow) ..................................................  348  3 hits [even-toed ungulates]   glutaryl-Coenzyme A dehydrogenase precursor [Bos taurus] >g
. . Phaeodactylum tricornutum CCAP 1055/1 .............................  347  2 hits [diatoms]               predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. . Pongo abelii (Orang-utan) .........................................  347  2 hits [primates]              glutaryl-Coenzyme A dehydrogenase [Pongo abelii] >gi|557325
. . Macaca fascicularis (cynomolgus monkey) ...........................  345  3 hits [primates]              RecName: Full=Glutaryl-CoA dehydrogenase, mitochondrial; Sh
. . Coprinopsis cinerea okayama7#130 ..................................  345  4 hits [basidiomycetes]        hypothetical protein CC1G_09349 [Coprinopsis cinerea okayam
. . Strongylocentrotus purpuratus (purple urchin) .....................  344  2 hits [sea urchins]           PREDICTED: similar to glutaryl-Coenzyme A dehydrogenase [St
. . Sus scrofa (wild boar) ............................................  340  2 hits [even-toed ungulates]   RecName: Full=Glutaryl-CoA dehydrogenase, mitochondrial; Sh
. . Branchiostoma floridae ............................................  340  4 hits [lancelets]             hypothetical protein BRAFLDRAFT_281524 [Branchiostoma flori
. . Thalassiosira pseudonana CCMP1335 .................................  337  2 hits [diatoms]               precursor of hydrogenase glutaryl-coa dehydrogenase [Thalas
. . Laccaria bicolor S238N-H82 ........................................  335  2 hits [basidiomycetes]        glutaryl-CoA dehydrogenase [Laccaria bicolor S238N-H82] >gi
. . Pan troglodytes ...................................................  332 10 hits [primates]              PREDICTED: glutaryl-Coenzyme A dehydrogenase isoform 7 [Pan
. . Postia placenta Mad-698-R .........................................  332  6 hits [basidiomycetes]        predicted protein [Postia placenta Mad-698-R] >gi|220728726
. . Drosophila simulans ...............................................  331  2 hits [flies]                 GD22569 [Drosophila simulans] >gi|194190392|gb|EDX03968.1| 
. . Drosophila melanogaster ...........................................  330  4 hits [flies]                 CG9547 [Drosophila melanogaster] >gi|194862544|ref|XP_00197
. . Drosophila erecta .................................................  330  2 hits [flies]                 CG9547 [Drosophila melanogaster] >gi|194862544|ref|XP_00197
. . Drosophila sechellia ..............................................  330  4 hits [flies]                 GM17931 [Drosophila sechellia] >gi|194132958|gb|EDW54526.1|
. . Drosophila yakuba .................................................  330  2 hits [flies]                 GE18434 [Drosophila yakuba] >gi|194174275|gb|EDW87886.1| GE
. . Aedes aegypti .....................................................  328  6 hits [flies]                 acyl-coa dehydrogenase [Aedes aegypti] >gi|108868733|gb|EAT
. . Ustilago maydis 521 ...............................................  328  4 hits [basidiomycetes]        hypothetical protein UM01335.1 [Ustilago maydis 521] >gi|46
. . Drosophila willistoni .............................................  325  2 hits [flies]                 GK18689 [Drosophila willistoni] >gi|194165471|gb|EDW80372.1
. . Cryptococcus neoformans var. neoformans JEC21 .....................  325  4 hits [basidiomycetes]        Glutaryl-CoA dehydrogenase, mitochondrial precursor [Crypto
. . Anopheles gambiae str. PEST .......................................  325  4 hits [flies]                 AGAP008501-PA [Anopheles gambiae str. PEST] >gi|157014764|g
. . Drosophila pseudoobscura pseudoobscura ............................  324  2 hits [flies]                 GA21870 [Drosophila pseudoobscura pseudoobscura] >gi|195156
. . Drosophila persimilis .............................................  324  2 hits [flies]                 GA21870 [Drosophila pseudoobscura pseudoobscura] >gi|195156
. . Drosophila ananassae ..............................................  324  2 hits [flies]                 GF15703 [Drosophila ananassae] >gi|190616665|gb|EDV32189.1|
. . Drosophila grimshawi ..............................................  324  2 hits [flies]                 GH13244 [Drosophila grimshawi] >gi|193900196|gb|EDV99062.1|
. . Cryptococcus neoformans var. neoformans B-3501A ...................  323  4 hits [basidiomycetes]        hypothetical protein CNBG1740 [Cryptococcus neoformans var.
. . Culex quinquefasciatus ............................................  323  2 hits [flies]                 glutaryl-CoA dehydrogenase, mitochondrial [Culex quinquefas
. . Drosophila mojavensis .............................................  323  2 hits [flies]                 GI17285 [Drosophila mojavensis] >gi|193912833|gb|EDW11700.1
. . Apis mellifera (bee) ..............................................  319  2 hits [bees]                  PREDICTED: similar to CG9547-PA [Apis mellifera]
. . Perkinsus marinus ATCC 50983 ......................................  319  2 hits [eukaryotes]            Glutaryl-CoA dehydrogenase, putative [Perkinsus marinus ATC
. . Drosophila virilis ................................................  319  2 hits [flies]                 GJ17894 [Drosophila virilis] >gi|194141466|gb|EDW57885.1| G
. . Acyrthosiphon pisum ...............................................  318  2 hits [aphids]                hypothetical protein LOC100163339 [Acyrthosiphon pisum] >gi
. . Yarrowia lipolytica CLIB122 .......................................  317  2 hits [ascomycetes]           YALI0F23749p [Yarrowia lipolytica] >gi|49651671|emb|CAG7861
. . Yarrowia lipolytica ...............................................  317  2 hits [ascomycetes]           YALI0F23749p [Yarrowia lipolytica] >gi|49651671|emb|CAG7861
. . Paracoccidioides brasiliensis Pb01 ................................  315  1 hit  [ascomycetes]           glutaryl-CoA dehydrogenase [Paracoccidioides brasiliensis P
. . Uncinocarpus reesii 1704 ..........................................  311  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Uncinocarpus reesii 1704] >gi|2
. . Paracoccidioides brasiliensis Pb18 ................................  311  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Paracoccidioides brasiliensis P
. . Neurospora crassa OR74A ...........................................  310  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, mitochondrial precursor [Neuros
. . Ajellomyces dermatitidis ER-3 .....................................  310  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Ajellomyces dermatitidis ER-3]
. . Coccidioides immitis RS ...........................................  309  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Coccidioides immitis RS]
. . Ajellomyces capsulatus H143 .......................................  309  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Ajellomyces capsulatus H143]
. . Ajellomyces dermatitidis SLH14081 .................................  309  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Ajellomyces dermatitidis SLH140
. . Coccidioides posadasii C735 delta SOWgp ...........................  308  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Coccidioides posadasi
. . Ajellomyces capsulatus G186AR .....................................  307  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Ajellomyces capsulatus G186AR]
. . Verticillium albo-atrum VaMs.102 ..................................  307  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Verticillium albo-atrum VaMs.10
. . Ajellomyces capsulatus NAm1 .......................................  306  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, mitochondrial precursor [Ajello
. . Aspergillus clavatus NRRL 1 .......................................  305  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Aspergillus clavatus 
. . Sclerotinia sclerotiorum 1980 UF-70 ...............................  305  2 hits [ascomycetes]           hypothetical protein SS1G_11174 [Sclerotinia sclerotiorum 1
. . Aspergillus fumigatus Af293 .......................................  304  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Aspergillus fumigatus Af293] >g
. . Aspergillus oryzae RIB40 ..........................................  304  2 hits [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|8377319
. . Aspergillus oryzae ................................................  304  3 hits [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|8377319
. . Gibberella zeae PH-1 ..............................................  304  3 hits [ascomycetes]           hypothetical protein FG10804.1 [Gibberella zeae PH-1]
. . Neosartorya fischeri NRRL 181 .....................................  304  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Neosartorya fischeri 
. . Aspergillus fumigatus A1163 .......................................  304  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Aspergillus fumigatus
. . Botryotinia fuckeliana B05.10 .....................................  303  4 hits [ascomycetes]           conserved hypothetical protein [Botryotinia fuckeliana B05.
. . Magnaporthe grisea 70-15 ..........................................  303  2 hits [ascomycetes]           hypothetical protein MGG_06561 [Magnaporthe grisea 70-15] >
. . Pediculus humanus corporis (human body lice) ......................  301  2 hits [lice]                  glutaryl-CoA dehydrogenase, putative [Pediculus humanus cor
. . Penicillium marneffei ATCC 18224 ..................................  301 10 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Penicillium marneffei
. . Talaromyces stipitatus ATCC 10500 .................................  301  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Talaromyces stipitatu
. . Pyrenophora tritici-repentis Pt-1C-BFP ............................  301  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, mitochondrial precursor [Pyreno
. . Penicillium chrysogenum Wisconsin 54-1255 .........................  299  4 hits [ascomycetes]           Pc20g07920 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. . Phaeosphaeria nodorum SN15 ........................................  298  4 hits [ascomycetes]           hypothetical protein SNOG_02750 [Phaeosphaeria nodorum SN15
. . Halorubrum lacusprofundi ATCC 49239 ...............................  297  2 hits [euryarchaeotes]        acyl-CoA dehydrogenase domain protein [Halorubrum lacusprof
. . Nectria haematococca mpVI 77-13-4 .................................  297  2 hits [ascomycetes]           predicted protein [Nectria haematococca mpVI 77-13-4]
. . Polysphondylium pallidum PN500 ....................................  296  2 hits [cellular slime molds]  glutaryl-CoA dehydrogenase [Polysphondylium pallidum PN500]
. . Microsporum canis CBS 113480 ......................................  296  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Microsporum canis CBS 113480]
. . Aspergillus terreus NIH2624 .......................................  296  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, mitochondrial precursor [Asperg
. . Aspergillus nidulans FGSC A4 ......................................  295  6 hits [ascomycetes]           hypothetical protein AN2762.2 [Aspergillus nidulans FGSC A4
. . Haloarcula marismortui ATCC 43049 .................................  295  2 hits [euryarchaeotes]        glutaryl-CoA dehydrogenase [Haloarcula marismortui ATCC 430
. . Natrialba magadii ATCC 43099 ......................................  293  2 hits [euryarchaeotes]        acyl-CoA dehydrogenase domain protein [Natrialba magadii AT
. . Aspergillus niger CBS 513.88 ......................................  292  2 hits [ascomycetes]           hypothetical protein An11g10470 [Aspergillus niger] >gi|134
. . Aspergillus niger .................................................  292  2 hits [ascomycetes]           hypothetical protein An11g10470 [Aspergillus niger] >gi|134
. . Natronomonas pharaonis DSM 2160 ...................................  288  6 hits [euryarchaeotes]        acyl-CoA dehydrogenase 8 [Natronomonas pharaonis DSM 2160] 
. . Haloterrigena turkmenica DSM 5511 .................................  288  4 hits [euryarchaeotes]        acyl-CoA dehydrogenase domain protein [Haloterrigena turkme
. . Moniliophthora perniciosa FA553 ...................................  286  2 hits [basidiomycetes]        hypothetical protein MPER_00969 [Moniliophthora perniciosa 
. . Archaeoglobus fulgidus DSM 4304 ...................................  285  2 hits [euryarchaeotes]        glutaryl-CoA dehydrogenase (gcdH) [Archaeoglobus fulgidus D
. . Halobacterium salinarum R1 ........................................  280  2 hits [euryarchaeotes]        acyl-CoA dehydrogenase [Halobacterium salinarum R1] >gi|167
. . Paracoccidioides brasiliensis Pb03 ................................  280  2 hits [ascomycetes]           glutaryl-CoA dehydrogenase [Paracoccidioides brasiliensis P
. . Halobacterium sp. NRC-1 ...........................................  279  2 hits [euryarchaeotes]        GcdH [Halobacterium sp. NRC-1] >gi|10581893|gb|AAG20564.1| 
. . Halomicrobium mukohataei DSM 12286 ................................  269  2 hits [euryarchaeotes]        acyl-CoA dehydrogenase domain protein [Halomicrobium mukoha
. . Hydra magnipapillata ..............................................  255  1 hit  [hydrozoans]            PREDICTED: similar to Glutaryl-Coenzyme A dehydrogenase, pa
. . Chaetomium globosum CBS 148.51 ....................................  251  4 hits [ascomycetes]           hypothetical protein CHGG_09606 [Chaetomium globosum CBS 14
. . Aspergillus flavus NRRL3357 .......................................  243  4 hits [ascomycetes]           glutaryl-CoA dehydrogenase, putative [Aspergillus flavus NR
. . Caligus clemensi ..................................................  214  2 hits [crustaceans]           Glutaryl-CoA dehydrogenase, mitochondrial precursor [Caligu
. . Nasonia vitripennis ...............................................  210  1 hit  [wasps &c.]             PREDICTED: similar to ENSANGP00000019312, partial [Nasonia 
. . Physcomitrella patens subsp. patens ...............................  192  2 hits [mosses]                predicted protein [Physcomitrella patens subsp. patens] >gi
. . Oryza sativa Indica Group (Indian rice) ...........................  190  1 hit  [monocots]              hypothetical protein OsI_18277 [Oryza sativa Indica Group]
. . Emericella nidulans ...............................................  189  2 hits [ascomycetes]           isovaleryl-coenzyme A dehydrogenase [Emericella nidulans] >
. . Oryza sativa Japonica Group (Japanese rice) .......................  189  6 hits [monocots]              Os05g0125500 [Oryza sativa (japonica cultivar-group)] >gi|4
. . Solanum tuberosum (potatoes) ......................................  187  4 hits [eudicots]              RecName: Full=Isovaleryl-CoA dehydrogenase 1, mitochondrial
. . Zea mays (maize) ..................................................  187  6 hits [monocots]              unknown [Zea mays]
. . Sorghum bicolor (milo) ............................................  186  2 hits [monocots]              hypothetical protein SORBIDRAFT_09g002260 [Sorghum bicolor]
. . Vitis vinifera (wine grape) .......................................  178  2 hits [eudicots]              PREDICTED: hypothetical protein [Vitis vinifera]
. . Arabidopsis thaliana (thale-cress) ................................  176 27 hits [eudicots]              Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabido
. . Podospora anserina DSM 980 ........................................  176  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170942493|
. . Podospora anserina ................................................  176  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170942493|
. . Beta vulgaris (beet) ..............................................  176  1 hit  [eudicots]              isovaleryl-CoA dehydrogenase [Beta vulgaris]
. synthetic construct -------------------------------------------------  424  9 hits [other sequences]       PA0447 [synthetic construct]
. uncultured marine microorganism HF4000_APKG10F13 ....................  276  1 hit  [unclassified]          putative acyl-CoA dehydrogenase, C-terminal domain protein 


BLAST

PROTOCOLE:


a) BLASTp vs SWISSPROT, default NCBI parameters or " Max target sequences _ 1000 "

b) BLASTp vs NR, default NCBI parameters or " Max target sequences _ 1000 "

c) BLASTp vs NR, default NCBI parameters or " Max target sequences _ 5000 "




ANALYSE DES RÉSULTATS:


a) BLASTp vs SWISSPROT


Le meilleur score obtenu est de 363, avec une e value de 5e-100. Il est obtenu pour la Glutaryl CoA deshydrogenase.

Le moins bon score obtenu est de 31.2 avec une e value de 9.2. Il est obtenu pour l'Acyl CoA oxydase.

31.2 < score < 363

9.2 > E-value > 5e-100



Notre BLAST révèle les fonctions suivantes:


- Glutaryl-CoA dehydrogenase 363 < score< 340 , 5e-100 < evalue < 6e-93

- Acyl-CoA dehydrogenase 193 < score < 47.4 , 1e-48 < evalue < 1e-04

- Isovaleryl-CoA dehydrogenase 187 < score < 159 , 5e-47 < evalue < 2e-38

- Isobutyryl-CoA dehydrogenase 125 < score < 103 , 3e-28 < evalue < 1e-21

- Crotonobetainyl-CoA dehydrogenase 83.2 < score < 81.3 , 2e-15 < evalue < 7e-15

- (R)-benzylsuccinyl-CoA dehydrogenase score 79.3 evalue 3e-14

- Acyl-coenzyme A oxidase 45.8 < score < 31.2 , 3e-04 < evalue < 9.2

- Peroxisomal acyl-coenzyme 43.1 < score < 33.5 , 0.002 < evalue < 1.9


Comme nous avons pu le voir dans InterPro en fonction de la taille de l'Acyl CoA différentes enzymes seront utilisées.

D'où les fonctions suivantes décrites par SWISSPROT:


- Short/branched chain specific

- Very long-chain specific

- Short-chain specific acyl CoA

- Long-chain specific acyl CoA


Toutes les enzymes trouvées par SWISSPROT correspondent à des CoA dehydrogenase. Les séquences correspondant à une fonction de CoA deshydrogenase possèdent les plus petit evalue et les plus important hits. Il est fort probable que la fonction de notre protéine est celle d'une CoA dehydrogenase.


b) BLASTp vs NR à 1000 séquences


Nous avons réalisé un premier BLAST avec un nombre maximale de séquence égale à 1000.

On a obtenu des scores assez élevés, et des E-value assez faibles. Il semblerait que les séquences trouvées dans les banques de données soient presque toutes homologues, au vu des résultats.

Il n'y a pas tous les résultats, mais pour ceux obtenus : 456 > score > 173 et 1e-126 < E-value < 2e-41.

On voit qu'il n'y a presque que des CoA dehydrogenase, ce qui est en accord avec ce qui a été trouvé précédemment.

On veut trouver le score seuil. On va s'aider des alignements deux à deux : on regarde le pourcentage de "gaps", d'"identities" et la longueur des séquences. Les pourcentages des identities sont toujours assez élevés, il y a peu de gaps.Il est donc difficile de se fier à la longueur des alignements pour déterminer le score seuil.

N'ayant pas de hits non homologues il est difficile de définir de valeur seuil de score




c) BLAST vs NR à 5000 séquences


Pour trouver une valeur seuil, nous avons réalisé un second BLAST avec un nombre de séquence égale à 5000. Mais même avec 5000 séquences, le dernier alignement a 29% d'identité et un score de 97.4 bits.


Nous avons alors concentré notre analyse sur le BLAST à 1000 séquences sachant que nous n'avons pas de valeur seuil.


N'ayant pas de hits non homologues il est difficile de définir de valeur seuil de score.


Il est à noter que pour tous les alignements 2 à 2 fait par le logiciel BLAST de notre protéine (QUERY) avec les séquences des banques NR ou SWISSPROT (SUJECT); on observe que la comparaison commence à environ 50 à 80 acides aminées sur la séquence subject. Ceci confirmerai l'hypothèse formulée durant la Recherche d'ORF, notre séquence serait imcomplète en N-terminale.

RÉSULTATS BRUTS:

a) BLASTp vs SWISSPROT
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q54R47.1|GCDH_DICDI  RecName: Full=Glutaryl-CoA dehydrogena...   363    5e-100
sp|Q20772.1|GCDH_CAEEL  RecName: Full=Probable glutaryl-CoA de...   360    4e-99  Gene info
sp|Q92947.1|GCDH_HUMAN  RecName: Full=Glutaryl-CoA dehydrogena...   349    1e-95  Gene info
sp|Q60759.1|GCDH_MOUSE  RecName: Full=Glutaryl-CoA dehydrogena...   348    2e-95  Gene info
sp|Q2KHZ9.1|GCDH_BOVIN  RecName: Full=Glutaryl-CoA dehydrogena...   348    3e-95  Gene info
sp|Q8HXX8.1|GCDH_MACFA  RecName: Full=Glutaryl-CoA dehydrogena...   345    2e-94 
sp|P81140.1|GCDH_PIG  RecName: Full=Glutaryl-CoA dehydrogenase...   340    6e-93 
sp|P45857.3|ACDB_BACSU  RecName: Full=Acyl-CoA dehydrogenase        193    1e-48 
sp|Q9FS88.1|IVD1_SOLTU  RecName: Full=Isovaleryl-CoA dehydroge...   187    5e-47 
sp|P45867.1|ACDA_BACSU  RecName: Full=Acyl-CoA dehydrogenase        185    3e-46 
sp|Q96329.1|ACOX4_ARATH  RecName: Full=Acyl-coenzyme A oxidase...   176    2e-43 
sp|Q9FS87.1|IVD2_SOLTU  RecName: Full=Isovaleryl-CoA dehydroge...   175    3e-43 
sp|Q9SWG0.2|IVD_ARATH  RecName: Full=Isovaleryl-CoA dehydrogen...   174    4e-43 
sp|P12007.2|IVD_RAT  RecName: Full=Isovaleryl-CoA dehydrogenas...   166    2e-40  Gene info
sp|O32176.1|FADE_BACSU  RecName: Full=Probable acyl-CoA dehydr...   164    6e-40 
sp|Q9JHI5.1|IVD_MOUSE  RecName: Full=Isovaleryl-CoA dehydrogen...   163    1e-39  Gene info
sp|O34421.1|ACDC_BACSU  RecName: Full=Probable acyl-CoA dehydr...   163    2e-39 
sp|Q5RAS0.1|ACADS_PONAB  RecName: Full=Short-chain specific ac...   162    2e-39  Gene info
sp|P52042.1|ACDS_CLOAB  RecName: Full=Acyl-CoA dehydrogenase, ...   162    2e-39 
sp|Q5EAD4.1|ACDSB_BOVIN  RecName: Full=Short/branched chain sp...   161    5e-39  Gene info
sp|P16219.1|ACADS_HUMAN  RecName: Full=Short-chain specific ac...   160    9e-39  Gene info
sp|Q5RBD5.1|IVD_PONAB  RecName: Full=Isovaleryl-CoA dehydrogen...   160    1e-38  Gene info
sp|Q3SZI8.1|IVD_BOVIN  RecName: Full=Isovaleryl-CoA dehydrogen...   159    1e-38  Gene info
sp|Q07417.1|ACADS_MOUSE  RecName: Full=Short-chain specific ac...   159    2e-38  Gene info
sp|P26440.1|IVD_HUMAN  RecName: Full=Isovaleryl-CoA dehydrogen...   159    2e-38  Gene info
sp|P15651.2|ACADS_RAT  RecName: Full=Short-chain specific acyl...   159    2e-38  Gene info
sp|Q9H845.1|ACAD9_HUMAN  RecName: Full=Acyl-CoA dehydrogenase ...   157    6e-38  Gene info
sp|P49748.1|ACADV_HUMAN  RecName: Full=Very long-chain specifi...   157    6e-38  Gene info
sp|P45954.1|ACDSB_HUMAN  RecName: Full=Short/branched chain sp...   157    8e-38  Gene info
sp|Q5RF40.1|ACDSB_PONAB  RecName: Full=Short/branched chain sp...   156    2e-37  Gene info
sp|Q8JZN5.1|ACAD9_MOUSE  RecName: Full=Acyl-CoA dehydrogenase ...   155    2e-37  Gene info
sp|Q8HXY7.1|ACADV_MACFA  RecName: Full=Very long-chain specifi...   155    2e-37 
sp|P48818.3|ACADV_BOVIN  RecName: Full=Very long-chain specifi...   155    4e-37  Gene info
sp|Q9DBL1.1|ACDSB_MOUSE  RecName: Full=Short/branched chain sp...   151    4e-36  Gene info
sp|P79273.1|ACADS_PIG  RecName: Full=Short-chain specific acyl...   151    4e-36  Gene info
sp|P45953.1|ACADV_RAT  RecName: Full=Very long-chain specific ...   151    5e-36  Gene info
sp|Q54RR5.1|ACDSB_DICDI  RecName: Full=Probable short/branched...   150    9e-36 
sp|P50544.3|ACADV_MOUSE  RecName: Full=Very long-chain specifi...   149    2e-35  Gene info
sp|P70584.1|ACDSB_RAT  RecName: Full=Short/branched chain spec...   148    5e-35  Gene info
sp|Q3ZBF6.1|ACADS_BOVIN  RecName: Full=Short-chain specific ac...   146    2e-34  Gene info
sp|Q06319.1|ACDS_MEGEL  RecName: Full=Acyl-CoA dehydrogenase, ...   145    4e-34 
sp|P63430.1|Y897_MYCBO  RecName: Full=Uncharacterized protein ...   135    4e-31 
sp|Q60HI0.1|ACADL_MACFA  RecName: Full=Long-chain specific acy...   129    3e-29 
sp|P28330.2|ACADL_HUMAN  RecName: Full=Long-chain specific acy...   127    9e-29  Gene info
sp|Q54IM8.1|ACAD8_DICDI  RecName: Full=Isobutyryl-CoA dehydrog...   125    3e-28 
sp|Q9VSA3.1|ACADM_DROME  RecName: Full=Probable medium-chain s...   124    6e-28  Gene info
sp|P51174.2|ACADL_MOUSE  RecName: Full=Long-chain specific acy...   124    9e-28  Gene info
sp|P79274.1|ACADL_PIG  RecName: Full=Long-chain specific acyl-...   124    9e-28  Gene info
sp|P15650.1|ACADL_RAT  RecName: Full=Long-chain specific acyl-...   123    2e-27  Gene info
sp|P41367.3|ACADM_PIG  RecName: Full=Medium-chain specific acy...   122    3e-27  Gene info
sp|P45952.1|ACADM_MOUSE  RecName: Full=Medium-chain specific a...   119    2e-26  Gene info
sp|P63428.1|ACDP_MYCBO  RecName: Full=Probable acyl-CoA dehydr...   118    4e-26 
sp|P11310.1|ACADM_HUMAN  RecName: Full=Medium-chain specific a...   118    5e-26  Gene info
sp|A5A6I0.1|ACADM_PANTR  RecName: Full=Medium-chain specific a...   118    6e-26  Gene info
sp|P08503.1|ACADM_RAT  RecName: Full=Medium-chain specific acy...   117    9e-26  Gene info
sp|P46703.1|ACDP_MYCLE  RecName: Full=Probable acyl-CoA dehydr...   115    3e-25 
sp|Q22347.1|ACADM_CAEEL  RecName: Full=Probable medium-chain s...   115    4e-25  Gene info
sp|Q0NXR6.1|ACAD8_BOVIN  RecName: Full=Isobutyryl-CoA dehydrog...   112    3e-24  Gene info
sp|Q9UKU7.1|ACAD8_HUMAN  RecName: Full=Isobutyryl-CoA dehydrog...   110    8e-24  Gene info
sp|Q3SZB4.1|ACADM_BOVIN  RecName: Full=Medium-chain specific a...   110    1e-23  Gene info
sp|Q8HXY8.1|ACADM_MACFA  RecName: Full=Medium-chain specific a...   110    1e-23 
sp|Q9D7B6.2|ACAD8_MOUSE  RecName: Full=Isobutyryl-CoA dehydrog...   103    1e-21  Gene info
sp|P34275.2|IVD_CAEEL  RecName: Full=Probable acyl coa dehydro...  92.4    3e-18  Gene info
sp|Q7U0Y2.1|ACDC_MYCBO  RecName: Full=Acyl-CoA dehydrogenase f...  92.0    4e-18 
sp|P71539.2|ACDC_MYCTU  RecName: Full=Acyl-CoA dehydrogenase f...  92.0    4e-18 
sp|P0A9V0.1|YDIO_ECO57  RecName: Full=Uncharacterized protein ...  86.3    2e-16 
sp|Q0T8F5.1|CAIA_SHIF8  RecName: Full=Crotonobetainyl-CoA dehy...  83.2    2e-15  Gene info
sp|P60584.1|CAIA_ECOLI  RecName: Full=Crotonobetainyl-CoA dehy...  82.8    2e-15 
sp|Q0TLV0.1|CAIA_ECOL5  RecName: Full=Crotonobetainyl-CoA dehy...  82.0    4e-15  Gene info
sp|Q8GB20.1|CAIA_PROSL  RecName: Full=Crotonobetainyl-CoA dehy...  82.0    4e-15 
sp|Q8ZRX2.1|CAIA_SALTY  RecName: Full=Crotonobetainyl-CoA dehy...  82.0    5e-15 
sp|Q8Z9L2.1|CAIA_SALTI  RecName: Full=Crotonobetainyl-CoA dehy...  81.6    5e-15 
sp|B7M0D6.1|CAIA_ECO8A  RecName: Full=Crotonobetainyl-CoA dehy...  81.6    5e-15  Gene info
sp|A9MQH5.1|CAIA_SALAR  RecName: Full=Crotonobetainyl-CoA dehy...  81.3    7e-15  Gene infoAcyl
sp|A8ALR4.1|CAIA_CITK8  RecName: Full=Crotonobetainyl-CoA dehy...  81.3    7e-15  Gene info
sp|Q9KJE8.1|BBSG_THAAR  RecName: Full=(R)-benzylsuccinyl-CoA d...  79.3    3e-14 
sp|Q73ZP8.1|MBTN_MYCPA  RecName: Full=Acyl-[acyl-carrier-prote...  57.8    8e-08 
sp|Q8K370.1|ACD10_MOUSE  RecName: Full=Acyl-CoA dehydrogenase ...  57.4    1e-07  Gene info
sp|Q8Z937.1|FADE_SALTI  RecName: Full=Acyl-coenzyme A dehydrog...  56.6    2e-07 
sp|Q8ZBY6.1|FADE_YERPE  RecName: Full=Acyl-coenzyme A dehydrog...  56.2    2e-07 
sp|Q8ZRJ7.1|FADE_SALTY  RecName: Full=Acyl-coenzyme A dehydrog...  56.2    2e-07 
sp|Q47146.2|FADE_ECOLI  RecName: Full=Acyl-coenzyme A dehydrog...  55.5    4e-07 
sp|Q8X7R2.2|FADE_ECO57  RecName: Full=Acyl-coenzyme A dehydrog...  55.5    4e-07 
sp|B3DMA2.1|ACD11_RAT  RecName: Full=Acyl-CoA dehydrogenase fa...  55.5    4e-07  Gene info
sp|Q1BBA3.1|MBTN_MYCSS  RecName: Full=Acyl-[acyl-carrier-prote...  55.1    5e-07  Gene info
sp|P54998.1|SOXC_RHOSG  RecName: Full=Dibenzothiophene desulfu...  55.1    5e-07 
sp|O65201.2|ACOX2_ARATH  RecName: Full=Acyl-coenzyme A oxidase...  54.7    7e-07 
sp|P63432.1|MBTN_MYCBO  RecName: Full=Acyl-[acyl-carrier-prote...  54.3    1e-06 
sp|Q6JQN1.1|ACD10_HUMAN  RecName: Full=Acyl-CoA dehydrogenase ...  53.9    1e-06  Gene info
sp|O64894.1|ACOX2_CUCMA  RecName: Full=Acyl-coenzyme A oxidase...  53.1    2e-06 
sp|Q80XL6.2|ACD11_MOUSE  RecName: Full=Acyl-CoA dehydrogenase ...  51.6    6e-06  Gene info
sp|P33224.3|AIDB_ECOLI  RecName: Full=Protein aidB                 49.7    2e-05 
sp|Q5ZHT1.1|ACD11_CHICK  RecName: Full=Acyl-CoA dehydrogenase ...  49.3    3e-05  Gene info
sp|Q5R778.2|ACD11_PONAB  RecName: Full=Acyl-CoA dehydrogenase ...  49.3    3e-05  Gene info
sp|P26698.1|PIGM_RHOST  RecName: Full=Pigment production hydro...  48.5    5e-05 
sp|Q709F0.2|ACD11_HUMAN  RecName: Full=Acyl-CoA dehydrogenase ...  48.5    6e-05  Gene info
sp|P96608.1|YDBM_BACSU  RecName: Full=Putative acyl-CoA dehydr...  47.4    1e-04 
sp|O74936.1|ACOX3_YARLI  RecName: Full=Acyl-coenzyme A oxidase...  45.8    3e-04 
sp|Q9NUZ1.3|ACOXL_HUMAN  RecName: Full=Acyl-coenzyme A oxidase...  43.1    0.002  Gene info
sp|Q9EPL9.2|ACOX3_MOUSE  RecName: Full=Peroxisomal acyl-coenzy...  43.1    0.002  Gene info
sp|O74934.1|ACOX1_YARLI  RecName: Full=Acyl-coenzyme A oxidase...  42.0    0.005 
sp|Q9LLH9.2|ACOX3_ARATH  RecName: Full=Acyl-coenzyme A oxidase...  41.2    0.009 
sp|Q756A9.1|ACOX_ASHGO  RecName: Full=Acyl-coenzyme A oxidase;...  40.4    0.014 
sp|Q9DBS4.1|ACOXL_MOUSE  RecName: Full=Acyl-coenzyme A oxidase...  40.0    0.016  Gene info
sp|Q9LMI7.1|ACO32_ARATH  RecName: Full=Putative acyl-coenzyme ...  39.7    0.025 
sp|Q63448.1|ACOX3_RAT  RecName: Full=Peroxisomal acyl-coenzyme...  38.9    0.045  Gene info
sp|P13711.2|ACOX_YEAST  RecName: Full=Acyl-coenzyme A oxidase;...  37.4    0.11   Gene info
sp|O74935.1|ACOX2_YARLI  RecName: Full=Acyl-coenzyme A oxidase...  35.4    0.44  
sp|A0KZA9.1|DXS_SHESA  RecName: Full=1-deoxy-D-xylulose-5-phos...  34.7    0.76   Gene info
sp|Q0HSW6.1|DXS_SHESR  RecName: Full=1-deoxy-D-xylulose-5-phos...  34.7    0.83   Gene info
sp|Q5RAU0.1|ACOX3_PONAB  RecName: Full=Peroxisomal acyl-coenzy...  33.9    1.3    Gene info
sp|O15254.2|ACOX3_HUMAN  RecName: Full=Peroxisomal acyl-coenzy...  33.5    1.9    Gene info
sp|Q54QM5.1|GPR89_DICDI  RecName: Full=Protein GPR89 homolog       32.7    2.5   
sp|A6YGD3.1|RR11_LEPTE  RecName: Full=30S ribosomal protein S1...  32.7    3.1    Gene info
sp|Q6CKK7.1|ACOX_KLULA  RecName: Full=Acyl-coenzyme A oxidase;...  32.0    4.4   
sp|P82264.1|DHE3_CHAAC  RecName: Full=Glutamate dehydrogenase,...  32.0    5.0   
sp|Q9Y7B1.1|ACOX_PICPA  RecName: Full=Acyl-coenzyme A oxidase;...  31.6    6.3   
sp|Q6BRD5.2|ACOX_DEBHA  RecName: Full=Acyl-coenzyme A oxidase;...  31.2    9.2   

>sp|Q54R47.1|GCDH_DICDI  RecName: Full=Glutaryl-CoA dehydrogenase, mitochondrial; Short=GCD; 
Flags: Precursor
Length=420

 Score =  363 bits (933),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 222/300 (74%), Gaps = 6/300 (2%)

Query  2    ELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSG  61
            EL  R++ AY +E  D  I +  G+ G+LG TIP  +GG+  ++V YGL+   +EKVDSG
Sbjct  67   ELMPRIQMAYRDEKFDREIMREYGKMGMLGATIPA-YGGV--SHVAYGLMANAVEKVDSG  123

Query  62   YRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA-  120
            YRS MSVQSSLVM+PI+ FG+  QK KYL  LASG+ +GCFGLTE N+GSDPA M T+A 
Sbjct  124  YRSAMSVQSSLVMHPINTFGTDAQKSKYLDGLASGDLVGCFGLTEPNAGSDPAGMQTRAV  183

Query  121  KKVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLS  180
            K   G + LNG+K WI+N+PIADVFV+WAK E     I+GF+LEK  KGL   KI GKLS
Sbjct  184  KNSAGNYVLNGTKTWITNSPIADVFVVWAKVE--NGDIRGFVLEKGMKGLSAPKIEGKLS  241

Query  181  LRASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDY  240
            LRAS+TG I   +V VP   +  +V+GL+GPFSCLN ARYGI WG++GAAEFC+  AR Y
Sbjct  242  LRASITGMIVMEDVEVPPTAMFPEVKGLRGPFSCLNKARYGIGWGSLGAAEFCYSTARQY  301

Query  241  GLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
            GL RKQF KPLA  QL+QKKLADM TEISLG+Q   ++GRLID G+  PE ISL+KRN+C
Sbjct  302  GLDRKQFGKPLAANQLYQKKLADMATEISLGLQACYQVGRLIDAGKATPERISLIKRNSC  361


>sp|Q20772.1|GCDH_CAEEL Gene info RecName: Full=Probable glutaryl-CoA dehydrogenase, mitochondrial; 
Short=GCD; Flags: Precursor
Length=409

 GENE ID: 174768 F54D5.7 | hypothetical protein [Caenorhabditis elegans]
(10 or fewer PubMed links)

 Score =  360 bits (925),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/297 (59%), Positives = 220/297 (74%), Gaps = 3/297 (1%)

Query  6    RVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSGYRSM  65
            RV  AY  E  D  +   MG  GLLG    + +G  G + V YGLI RE+E+VDSGYRS 
Sbjct  54   RVTEAYRTEKFDPSLIPEMGSMGLLGAPY-QGYGCAGTSTVGYGLIAREVERVDSGYRST  112

Query  66   MSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA--KKV  123
            MSVQ+SLV+ PI  +GS++QK+KY+P LASG+ IGCFGLTE N GS+P  M TKA   + 
Sbjct  113  MSVQTSLVIGPIYNYGSEDQKQKYIPDLASGKKIGCFGLTEPNHGSNPGGMETKATWDET  172

Query  124  NGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLSLRA  183
               ++LNGSK WISN+P++DV V+WA+S  H NKIKGFILE+  KGL T KI GKLSLRA
Sbjct  173  TKTYKLNGSKTWISNSPVSDVMVVWARSARHNNKIKGFILERGMKGLTTPKIEGKLSLRA  232

Query  184  SVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYGLS  243
            S+TG+I+ ++V VPEEN+L + EGL+GPF CLN AR GIAWGA+GAAE C+H AR Y L 
Sbjct  233  SITGQIAMDDVPVPEENLLPNAEGLQGPFGCLNNARLGIAWGALGAAEECFHLARQYTLD  292

Query  244  RKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
            R+QF +PLA  QL Q K+ADM TEISLG+QG LR+ RL DEG+   E IS++KRN+C
Sbjct  293  RQQFGRPLAQNQLMQLKMADMLTEISLGLQGCLRVSRLKDEGKVQSEQISIIKRNSC  349


>sp|Q92947.1|GCDH_HUMAN Gene info RecName: Full=Glutaryl-CoA dehydrogenase, mitochondrial; Short=GCD; 
Flags: Precursor
Length=438

 GENE ID: 2639 GCDH | glutaryl-Coenzyme A dehydrogenase [Homo sapiens]
(Over 10 PubMed links)

 Score =  349 bits (896),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/302 (56%), Positives = 215/302 (71%), Gaps = 5/302 (1%)

Query  1    KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDS  60
            + L  R+  A   E+    I   MGE G+LG TI + +G  G + V YGL+ RE+E+VDS
Sbjct  77   ERLMPRILLANRNEVFHREIISEMGELGVLGPTI-KGYGCAGVSSVAYGLLARELERVDS  135

Query  61   GYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA  120
            GYRS MSVQSSLVM+PI  +GS+EQ++KYLP+LA GE +GCFGLTE NSGSDP+SM T+A
Sbjct  136  GYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA  195

Query  121  K--KVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGK  178
                 N  + LNG+K WI+N+P+AD+FV+WA+ E  +  I+GF+LEK  +GL   +I GK
Sbjct  196  HYNSSNKSYTLNGTKTWITNSPMADLFVVWARCE--DGCIRGFLLEKGMRGLSAPRIQGK  253

Query  179  LSLRASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAAR  238
             SLRAS TG I  + V VPEEN+L     L GPF CLN ARYGIAWG +GA+EFC H AR
Sbjct  254  FSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTAR  313

Query  239  DYGLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRN  298
             Y L R QF  PLA  QL QKKLADM TEI+LG+   L+LGRL D+ + APE +SL+KRN
Sbjct  314  QYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRN  373

Query  299  NC  300
            NC
Sbjct  374  NC  375

[...]

b) BLASTp vs NR

Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01879555.1|  glutaryl-CoA dehydrogenase [Roseovarius sp...   456    1e-126
ref|YP_001313401.1|  acyl-CoA dehydrogenase domain-containing ...   455    2e-126 Gene info
ref|NP_437387.1|  putative glutaryl-CoA dehydrogenase protein ...   454    4e-126 Gene info
ref|ZP_01002876.1|  putative acyl-CoA dehydrogenase [Loktanell...   451    4e-125
ref|YP_002823539.1|  glutaryl-CoA dehydrogenase [Rhizobium sp....   451    4e-125 Gene info
ref|YP_756891.1|  acyl-CoA dehydrogenase domain-containing pro...   451    5e-125 Gene info
ref|ZP_01034223.1|  glutaryl-CoA dehydrogenase [Roseovarius sp...   450    7e-125
ref|ZP_01751305.1|  acyl-CoA dehydrogenase-like protein [Roseo...   449    2e-124
ref|ZP_01748292.1|  glutaryl-CoA dehydrogenase [Sagittula stel...   448    3e-124
ref|YP_675030.1|  acyl-CoA dehydrogenase-like [Mesorhizobium s...   448    4e-124 Gene info
ref|ZP_05050233.1|  Acyl-CoA dehydrogenase, N-terminal domain ...   447    6e-124
ref|ZP_05121803.1|  glutaryl-CoA dehydrogenase [Rhodobacterace...   446    1e-123
ref|ZP_05781418.1|  glutaryl-CoA dehydrogenase [Citreicella sp...   445    2e-123
ref|ZP_01903387.1|  acyl-CoA dehydrogenase domain protein [Ros...   444    5e-123
ref|ZP_01156341.1|  putative glutaryl-CoA dehydrogenase protei...   442    1e-122
ref|ZP_02153154.1|  glutaryl-CoA dehydrogenase [Oceanibulbus i...   442    2e-122
ref|ZP_01444851.1|  glutaryl-CoA dehydrogenase [Roseovarius sp...   442    2e-122
ref|ZP_05342864.1|  glutaryl-CoA dehydrogenase [Thalassiobium ...   442    3e-122
ref|ZP_00998629.1|  glutaryl-CoA dehydrogenase [Oceanicola bat...   442    3e-122
ref|ZP_05067022.1|  glutaryl-CoA dehydrogenase [Octadecabacter...   441    3e-122
ref|ZP_05101008.1|  glutaryl-CoA dehydrogenase [Roseobacter sp...   441    4e-122
ref|ZP_00948283.1|  glutaryl-CoA dehydrogenase [Sulfitobacter ...   440    1e-121
ref|YP_167190.1|  glutaryl-CoA dehydrogenase [Ruegeria pomeroy...   439    1e-121 Gene info
ref|ZP_05180962.1|  glutaryl-CoA dehydrogenase [Brucella sp. 8...   439    1e-121
ref|YP_221793.1|  glutaryl-CoA dehydrogenase [Brucella abortus...   439    2e-121 Gene info
ref|ZP_05454454.1|  glutaryl-CoA dehydrogenase [Brucella melit...   438    3e-121
ref|ZP_04680232.1|  acyl-CoA dehydrogenase domain protein [Och...   438    3e-121
ref|ZP_05812835.1|  acyl-CoA dehydrogenase domain protein [Mes...   438    3e-121
ref|NP_698090.1|  glutaryl-CoA dehydrogenase [Brucella suis 13...   438    4e-121 Gene info
ref|YP_002732821.1|  glutaryl-CoA dehydrogenase [Brucella meli...   438    4e-121 Gene info
ref|ZP_02143862.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   437    6e-121
ref|ZP_02141969.1|  glutaryl-CoA dehydrogenase [Roseobacter li...   437    7e-121
ref|YP_001370715.1|  acyl-CoA dehydrogenase domain-containing ...   437    8e-121 Gene info
ref|ZP_05085692.1|  glutaryl-CoA dehydrogenase [Pseudovibrio s...   437    8e-121
ref|ZP_05051004.1|  Acyl-CoA dehydrogenase, N-terminal domain ...   437    9e-121
ref|NP_539814.1|  glutaryl-CoA dehydrogenase [Brucella meliten...   436    1e-120 Gene info
ref|ZP_05091120.1|  glutaryl-CoA dehydrogenase [Ruegeria sp. R...   436    1e-120
ref|ZP_05163660.1|  glutaryl-CoA dehydrogenase [Brucella suis ...   436    1e-120
ref|YP_001592923.1|  Acyl-CoA dehydrogenase [Brucella canis AT...   436    1e-120 Gene info
ref|YP_684096.1|  glutaryl-CoA dehydrogenase [Roseobacter deni...   436    1e-120 Gene info
ref|ZP_05842070.1|  acyl-CoA dehydrogenase domain protein [Rho...   435    2e-120
ref|YP_510755.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   435    3e-120 Gene info
ref|ZP_05068638.1|  glutaryl-CoA dehydrogenase [Octadecabacter...   435    3e-120
ref|ZP_01740634.1|  glutaryl-CoA dehydrogenase [Rhodobacterale...   434    4e-120
ref|ZP_05457547.1|  glutaryl-CoA dehydrogenase [Brucella ceti ...   434    7e-120
ref|NP_104115.1|  glutaryl Co-A dehydrogenase [Mesorhizobium l...   433    9e-120 Gene info
ref|ZP_02167606.1|  acyl-CoA dehydrogenase-like protein [Hoefl...   432    3e-119
ref|ZP_05073589.1|  glutaryl-CoA dehydrogenase [Rhodobacterale...   431    3e-119
ref|ZP_01013053.1|  glutaryl Co-A dehydrogenase [Rhodobacteral...   431    4e-119
ref|ZP_05115528.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   431    4e-119
ref|YP_001261327.1|  acyl-CoA dehydrogenase domain-containing ...   431    5e-119 Gene info
ref|YP_257269.1|  glutaryl-CoA dehydrogenase [Pseudomonas fluo...   431    5e-119 Gene info
ref|YP_345850.1|  Acyl-CoA dehydrogenase-like [Pseudomonas flu...   431    5e-119 Gene info
ref|YP_001533694.1|  acyl-CoA dehydrogenase [Dinoroseobacter s...   431    6e-119 Gene info
ref|ZP_01547754.1|  glutaryl-CoA dehydrogenase [Stappia aggreg...   430    8e-119
ref|ZP_02168269.1|  acyl-CoA dehydrogenase-like protein [Hoefl...   430    1e-118
ref|ZP_03525066.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   430    1e-118
ref|ZP_06358546.1|  acyl-CoA dehydrogenase domain protein [Rho...   429    2e-118
ref|YP_001978440.1|  glutaryl-CoA dehydrogenase protein [Rhizo...   429    2e-118 Gene info
ref|YP_001155600.1|  acyl-CoA dehydrogenase domain-containing ...   428    3e-118 Gene info
ref|NP_769256.1|  glutaryl-CoA dehydrogenase [Bradyrhizobium j...   428    3e-118 Gene info
ref|ZP_03396707.1|  acyl-CoA dehydrogenase [Pseudomonas syring...   428    4e-118
ref|ZP_04590279.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   427    5e-118
ref|YP_002869811.1|  putative acyl-CoA dehydrogenase [Pseudomo...   427    6e-118 Gene info
ref|ZP_02464559.1|  putative glutaryl-CoA dehydrogenase [Burkh...   427    7e-118
ref|NP_795186.1|  acyl-CoA dehydrogenase, putative [Pseudomona...   427    8e-118 Gene info
ref|ZP_02373656.1|  glutaryl-CoA dehydrogenase [Burkholderia t...   427    8e-118
ref|YP_001580751.1|  acyl-CoA dehydrogenase domain-containing ...   427    8e-118 Gene info
ref|YP_295028.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   427    8e-118 Gene info
ref|YP_238079.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   427    8e-118 Gene info
ref|ZP_01003463.1|  putative acyl-CoA dehydrogenase [Loktanell...   427    9e-118
ref|ZP_05639775.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-Co...   427    9e-118
ref|YP_727264.1|  glutaryl-CoA dehydrogenase [Ralstonia eutrop...   427    9e-118 Gene info
ref|YP_046327.1|  glutaryl-CoA dehydrogenase [Acinetobacter sp...   427    9e-118 Gene info
ref|YP_001168920.1|  acyl-CoA dehydrogenase domain-containing ...   427    1e-117 Gene info
ref|YP_003452786.1|  glutaryl-CoA dehydrogenase [Azospirillum ...   427    1e-117
ref|YP_511011.1|  acyl-CoA dehydrogenase-like [Jannaschia sp. ...   427    1e-117 Gene info
ref|ZP_06223600.1|  acyl-CoA dehydrogenase domain protein [Bur...   427    1e-117
ref|YP_001666427.1|  acyl-CoA dehydrogenase domain-containing ...   426    1e-117 Gene info
ref|ZP_01447301.1|  Acyl-CoA dehydrogenase [alpha proteobacter...   426    1e-117
ref|ZP_03574064.1|  putative glutaryl-CoA dehydrogenase [Burkh...   426    2e-117
ref|YP_001751913.1|  acyl-CoA dehydrogenase domain-containing ...   426    2e-117 Gene info
ref|NP_356237.1|  glutaryl-CoA dehydrogenase [Agrobacterium tu...   426    2e-117 Gene info
ref|NP_742327.1|  acyl-CoA dehydrogenase domain-containing pro...   426    2e-117 Gene info
ref|ZP_02909459.1|  acyl-CoA dehydrogenase domain protein [Bur...   426    2e-117
ref|YP_001265536.1|  acyl-CoA dehydrogenase domain-containing ...   426    2e-117 Gene info
ref|NP_946445.1|  glutaryl-CoA dehydrogenase [Rhodopseudomonas...   426    2e-117 Gene info
ref|YP_001060196.1|  putative glutaryl-CoA dehydrogenase [Burk...   426    2e-117 Gene info
ref|YP_002006304.1|  GLUTARYL-COA DEHYDROGENASE [Cupriavidus t...   426    2e-117 Gene info
ref|YP_001768576.1|  acyl-CoA dehydrogenase domain-containing ...   425    3e-117 Gene info
ref|ZP_02356818.1|  putative glutaryl-CoA dehydrogenase [Burkh...   425    3e-117
ref|YP_918172.1|  acyl-CoA dehydrogenase domain-containing pro...   425    3e-117 Gene info
ref|ZP_02417286.1|  putative glutaryl-CoA dehydrogenase [Burkh...   425    3e-117
ref|ZP_04939530.1|  Acyl-CoA dehydrogenase [Burkholderia cenoc...   425    3e-117
ref|YP_605923.1|  glutaryl-CoA dehydrogenase [Pseudomonas ento...   425    4e-117 Gene info
ref|ZP_04946448.1|  Acyl-CoA dehydrogenase [Burkholderia dolos...   425    4e-117
ref|YP_002232300.1|  putative glutaryl-CoA dehydrogenase [Burk...   425    4e-117 Gene info
ref|YP_001757735.1|  acyl-CoA dehydrogenase domain-containing ...   425    4e-117 Gene info
ref|YP_001764082.1|  acyl-CoA dehydrogenase domain-containing ...   425    4e-117 Gene info
ref|YP_584797.1|  acyl-CoA dehydrogenase-like protein [Ralston...   424    5e-117 Gene info
ref|ZP_02472568.1|  putative glutaryl-CoA dehydrogenase [Burkh...   424    5e-117
ref|YP_001345944.1|  glutaryl-CoA dehydrogenase [Pseudomonas a...   424    5e-117 Gene info
gb|AAT51570.1|  PA0447 [synthetic construct]                        424    6e-117
ref|NP_249138.1|  glutaryl-CoA dehydrogenase [Pseudomonas aeru...   424    6e-117 Gene info
ref|YP_002496572.1|  acyl-CoA dehydrogenase domain protein [Me...   424    6e-117 Gene info
ref|YP_001238524.1|  glutaryl-CoA dehydrogenase [Bradyrhizobiu...   424    6e-117 Gene info
ref|YP_368149.1|  Acyl-CoA dehydrogenase-like [Burkholderia sp...   424    7e-117 Gene info
pdb|3EOM|A  Chain A, 2.4 A Crystal Structure Of Native Glutary...   424    7e-117 Related structures
ref|YP_109343.1|  putative glutaryl-CoA dehydrogenase [Burkhol...   424    8e-117 Gene info
ref|YP_441936.1|  glutaryl-CoA dehydrogenase [Burkholderia tha...   424    8e-117 Gene info
ref|YP_002547660.1|  glutaryl-CoA dehydrogenase [Agrobacterium...   424    8e-117 Gene info
ref|YP_334609.1|  glutaryl-CoA dehydrogenase [Burkholderia pse...   424    8e-117 Gene info
ref|YP_001118596.1|  acyl-CoA dehydrogenase domain-containing ...   424    9e-117 Gene info
ref|YP_103644.1|  glutaryl-CoA dehydrogenase [Burkholderia mal...   423    9e-117 Gene info
pdb|3GQT|A  Chain A, Crystal Structure Of Glutaryl-Coa Dehydro...   423    9e-117 Related structures
ref|ZP_02378679.1|  acyl-CoA dehydrogenase domain protein [Bur...   423    1e-116
ref|YP_568403.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   423    1e-116 Gene info
ref|YP_620215.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   423    1e-116 Gene info
ref|ZP_02404207.1|  putative glutaryl-CoA dehydrogenase [Burkh...   423    1e-116
ref|YP_001858657.1|  acyl-CoA dehydrogenase domain-containing ...   423    1e-116 Gene info
ref|YP_001170990.1|  glutaryl-CoA dehydrogenase [Pseudomonas s...   423    1e-116 Gene info
ref|YP_001204223.1|  glutaryl-CoA dehydrogenase [Bradyrhizobiu...   422    2e-116 Gene info
ref|ZP_06348155.1|  acyl-CoA dehydrogenase domain protein [Rho...   422    2e-116
ref|YP_783260.1|  acyl-CoA dehydrogenase domain-containing pro...   422    3e-116 Gene info
ref|ZP_04771086.1|  acyl-CoA dehydrogenase domain protein [Ast...   422    3e-116
ref|YP_001807423.1|  acyl-CoA dehydrogenase domain-containing ...   422    3e-116 Gene info
ref|YP_001189908.1|  acyl-CoA dehydrogenase domain-containing ...   421    4e-116 Gene info
ref|YP_001898289.1|  acyl-CoA dehydrogenase domain protein [Ra...   421    5e-116 Gene info
ref|YP_002527056.1|  Acyl-CoA dehydrogenase domain protein [Rh...   421    7e-116 Gene info
ref|YP_003146394.1|  acyl-CoA dehydrogenase domain protein [Ka...   420    8e-116 Gene info
ref|ZP_03266475.1|  acyl-CoA dehydrogenase domain protein [Bur...   420    8e-116
ref|YP_772587.1|  acyl-CoA dehydrogenase domain-containing pro...   420    8e-116 Gene info
emb|CAM74921.1|  glutaryl-CoA dehydrogenase [Magnetospirillum ...   420    8e-116
ref|ZP_00945997.1|  Glutaryl-CoA dehydrogenase [Ralstonia sola...   420    1e-115
ref|YP_001044829.1|  acyl-CoA dehydrogenase domain-containing ...   420    1e-115 Gene info
ref|YP_002260449.1|  glutaryl-coa dehydrogenase protein [Ralst...   420    1e-115 Gene info
ref|YP_002256602.1|  glutaryl-coa dehydrogenase protein [Ralst...   420    1e-115 Gene info
ref|YP_484783.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   420    1e-115 Gene info
ref|YP_002289894.1|  glutaryl-CoA dehydrogenase, (GCD) [Oligot...   420    1e-115 Gene info
ref|NP_518877.1|  glutaryl-CoA dehydrogenase oxidoreductase [R...   419    1e-115 Gene info
ref|ZP_02893395.1|  acyl-CoA dehydrogenase domain protein [Bur...   419    1e-115
ref|ZP_06296630.1|  acyl-CoA dehydrogenase domain protein [Bur...   419    2e-115
ref|YP_557145.1|  putative glutaryl-CoA dehydrogenase [Burkhol...   419    2e-115 Gene info
ref|ZP_02882479.1|  acyl-CoA dehydrogenase domain protein [Bur...   419    2e-115
ref|YP_001894423.1|  acyl-CoA dehydrogenase domain protein [Bu...   419    2e-115 Gene info
ref|YP_002980745.1|  acyl-CoA dehydrogenase domain protein [Ra...   418    3e-115 Gene info
ref|YP_001845321.1|  Acyl-CoA dehydrogenase [Acinetobacter bau...   418    3e-115 Gene info
ref|YP_960580.1|  acyl-CoA dehydrogenase domain-containing pro...   418    4e-115 Gene info
ref|ZP_05361653.1|  glutaryl-CoA dehydrogenase [Acinetobacter ...   417    5e-115
ref|YP_354377.1|  putative acyl-CoA dehydrogenase [Rhodobacter...   417    5e-115 Gene info
ref|YP_001083763.1|  glutaryl-CoA dehydrogenase [Acinetobacter...   417    6e-115 Gene info
ref|ZP_01864492.1|  putative glutaryl-CoA dehydrogenase protei...   417    6e-115
ref|ZP_04660659.1|  Glutaryl-CoA dehydrogenase (GCD) [Acinetob...   417    7e-115
gb|ABO11161.2|  glutaryl-CoA dehydrogenase [Acinetobacter baum...   417    7e-115 Gene info
ref|YP_001714883.1|  glutaryl-CoA dehydrogenase [Acinetobacter...   417    7e-115 Gene info
ref|YP_001412101.1|  acyl-CoA dehydrogenase domain-containing ...   417    8e-115 Gene info
ref|ZP_05042338.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   417    8e-115
ref|YP_001165805.1|  acyl-CoA dehydrogenase domain-containing ...   417    8e-115 Gene info
ref|YP_534139.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   417    1e-114 Gene info
ref|ZP_00952661.1|  Glutaryl-CoA dehydrogenase [Oceanicaulis a...   416    1e-114
ref|ZP_06069689.1|  glutaryl-CoA dehydrogenase [Acinetobacter ...   416    1e-114
ref|ZP_05826094.1|  glutaryl-CoA dehydrogenase [Acinetobacter ...   416    1e-114
ref|ZP_06059263.1|  glutaryl-CoA dehydrogenase [Acinetobacter ...   416    2e-114
ref|YP_002910586.1|  Acyl-CoA dehydrogenase-like protein [Burk...   416    2e-114 Gene info
ref|ZP_00960738.1|  glutaryl-CoA dehydrogenase [Roseovarius nu...   416    2e-114
ref|YP_158711.1|  glutaryl-CoA dehydrogenase [Aromatoleum arom...   416    2e-114 Gene info
ref|YP_001707937.1|  glutaryl-CoA dehydrogenase [Acinetobacter...   415    3e-114 Gene info
ref|YP_576095.1|  acyl-CoA dehydrogenase-like [Nitrobacter ham...   414    4e-114 Gene info
ref|YP_283766.1|  Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA ...   414    6e-114 Gene info
ref|ZP_01041522.1|  putative glutaryl-CoA dehydrogenase protei...   414    7e-114
ref|ZP_02187183.1|  Acyl-CoA dehydrogenase [alpha proteobacter...   413    1e-113
ref|YP_427092.1|  glutaryl-CoA dehydrogenase [Rhodospirillum r...   413    1e-113 Gene info
ref|YP_422594.1|  Acyl-CoA dehydrogenase [Magnetospirillum mag...   412    2e-113 Gene info
ref|YP_970340.1|  acyl-CoA dehydrogenase domain-containing pro...   412    2e-113 Gene info
ref|YP_692704.1|  glutaryl-CoA dehydrogenase [Alcanivorax bork...   412    2e-113 Gene info
ref|ZP_06211523.1|  acyl-CoA dehydrogenase domain protein [Aci...   412    2e-113
ref|ZP_01044535.1|  acyl-CoA dehydrogenase [Nitrobacter sp. Nb...   412    2e-113
ref|YP_317227.1|  acyl-CoA dehydrogenase [Nitrobacter winograd...   412    2e-113 Gene info
ref|ZP_05077723.1|  glutaryl-CoA dehydrogenase [Rhodobacterale...   412    3e-113
ref|YP_001563232.1|  acyl-CoA dehydrogenase domain-containing ...   410    7e-113 Gene info
ref|YP_002553844.1|  acyl-CoA dehydrogenase domain protein [Ac...   410    7e-113 Gene info
ref|ZP_01616119.1|  glutaryl-CoA dehydrogenase [marine gamma p...   410    8e-113
ref|YP_987191.1|  acyl-CoA dehydrogenase domain-containing pro...   410    1e-112 Gene info
ref|YP_613250.1|  acyl-CoA dehydrogenase-like [Ruegeria sp. TM...   410    1e-112 Gene info
ref|ZP_01057479.1|  glutaryl-CoA dehydrogenase [Roseobacter sp...   409    1e-112
ref|ZP_01753570.1|  glutaryl-CoA dehydrogenase [Roseobacter sp...   409    2e-112
ref|YP_271311.1|  glutaryl-CoA dehydrogenase [Colwellia psychr...   409    2e-112 Gene info
ref|ZP_03700097.1|  acyl-CoA dehydrogenase domain protein [Lut...   408    4e-112
ref|YP_001280427.1|  acyl-CoA dehydrogenase domain-containing ...   408    4e-112 Gene info
gb|ABM69268.1|  GcdH [Azoarcus sp. CIB]                             408    4e-112
ref|ZP_04763657.1|  acyl-CoA dehydrogenase domain protein [Aci...   407    5e-112
ref|YP_663547.1|  glutaryl-CoA dehydrogenase [Pseudoalteromona...   407    6e-112 Gene info
ref|ZP_01077471.1|  Glutaryl-CoA dehydrogenase [Marinomonas sp...   406    1e-111
ref|YP_002354094.1|  acyl-CoA dehydrogenase domain protein [Th...   406    1e-111 Gene info
ref|YP_996506.1|  acyl-CoA dehydrogenase domain-containing pro...   406    1e-111 Gene info
ref|YP_001233995.1|  acyl-CoA dehydrogenase domain-containing ...   406    1e-111 Gene info
ref|YP_001419588.1|  acyl-CoA dehydrogenase domain-containing ...   406    1e-111 Gene info
ref|YP_003279655.1|  acyl-CoA dehydrogenase-like protein [Coma...   406    1e-111 Gene info
ref|ZP_03541808.1|  acyl-CoA dehydrogenase domain protein [Com...   406    2e-111
ref|YP_002799652.1|  Glutaryl-CoA dehydrogenase [Azotobacter v...   405    3e-111 Gene info
ref|YP_001790227.1|  acyl-CoA dehydrogenase domain-containing ...   405    3e-111 Gene info
ref|ZP_05095437.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   405    3e-111
ref|ZP_01736756.1|  Glutaryl-CoA dehydrogenase [Marinobacter s...   404    7e-111
ref|YP_002942047.1|  acyl-CoA dehydrogenase domain protein [Va...   404    9e-111 Gene info
ref|YP_001632177.1|  glutaryl-CoA dehydrogenase [Bordetella pe...   403    1e-110 Gene info
ref|ZP_04958448.1|  glutaryl-CoA dehydrogenase [gamma proteoba...   403    1e-110
ref|ZP_01227346.1|  acyl-CoA dehydrogenase [Aurantimonas manga...   403    1e-110
ref|YP_001022358.1|  glutaryl-CoA dehydrogenase [Methylibium p...   403    1e-110 Gene info
ref|NP_887972.1|  glutaryl-CoA dehydrogenase [Bordetella bronc...   403    2e-110 Gene info
ref|YP_001797813.1|  acyl-CoA dehydrogenase domain protein [Po...   403    2e-110 Gene info
ref|YP_437195.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   402    2e-110 Gene info
ref|NP_880272.1|  glutaryl-CoA dehydrogenase [Bordetella pertu...   402    2e-110 Gene info
ref|YP_785428.1|  glutaryl-CoA dehydrogenase [Bordetella avium...   402    2e-110 Gene info
ref|YP_458729.1|  putative glutaryl-CoA dehydrogenase protein ...   402    2e-110 Gene info
ref|NP_903588.1|  glutaryl-CoA dehydrogenase [Chromobacterium ...   402    3e-110 Gene info
ref|ZP_01227601.1|  glutaryl-CoA dehydrogenase [Aurantimonas m...   401    4e-110
ref|YP_001264711.1|  acyl-CoA dehydrogenase domain-containing ...   401    4e-110 Gene info
ref|ZP_05499093.1|  acyl-CoA dehydrogenase domain protein [Thi...   401    5e-110
ref|YP_982360.1|  acyl-CoA dehydrogenase domain-containing pro...   400    6e-110 Gene info
ref|YP_003168234.1|  acyl-CoA dehydrogenase domain protein [Ca...   400    8e-110 Gene info
ref|ZP_04959056.1|  glutaryl-CoA dehydrogenase [gamma proteoba...   400    8e-110
ref|NP_883524.1|  glutaryl-CoA dehydrogenase [Bordetella parap...   400    9e-110 Gene info
ref|YP_771420.1|  putative acyl-CoA dehydrogenase [Rhizobium l...   400    1e-109 Gene info
ref|ZP_06349730.1|  acyl-CoA dehydrogenase domain protein [Rho...   399    2e-109
ref|YP_580082.1|  glutaryl-CoA dehydrogenase [Psychrobacter cr...   399    2e-109 Gene info
ref|YP_264092.1|  putative glutaryl-CoA dehydrogenase [Psychro...   399    2e-109 Gene info
ref|YP_002541188.1|  glutaryl-CoA dehydrogenase protein [Agrob...   399    3e-109 Gene info
ref|ZP_01116673.1|  Acyl-CoA dehydrogenase [Reinekea sp. MED29...   399    3e-109
ref|YP_530921.1|  acyl-CoA dehydrogenase-like [Rhodopseudomona...   398    3e-109 Gene info
ref|YP_002984743.1|  acyl-CoA dehydrogenase domain protein [Rh...   398    3e-109 Gene info
ref|ZP_01224684.1|  putative glutaryl-CoA dehydrogenase protei...   397    6e-109
ref|ZP_01126975.1|  Acyl-CoA dehydrogenase [Nitrococcus mobili...   397    7e-109
ref|YP_933428.1|  glutaryl-CoA dehydrogenase [Azoarcus sp. BH7...   397    7e-109 Gene info
ref|YP_933434.1|  glutaryl-CoA dehydrogenase [Azoarcus sp. BH7...   397    7e-109 Gene info
ref|ZP_03522794.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   397    7e-109
ref|YP_002129134.1|  glutaryl-CoA dehydrogenase [Phenylobacter...   397    9e-109 Gene info
ref|YP_001526474.1|  glutaryl-CoA dehydrogenase [Azorhizobium ...   397    1e-108 Gene info
ref|YP_154570.1|  glutaryl-CoA dehydrogenase [Idiomarina loihi...   397    1e-108 Gene info
ref|ZP_01103965.1|  glutaryl-CoA dehydrogenase [Congregibacter...   396    2e-108
ref|ZP_05127750.1|  glutaryl-CoA dehydrogenase [gamma proteoba...   395    2e-108
ref|YP_001985824.1|  glutaryl-CoA dehydrogenase protein [Rhizo...   395    3e-108 Gene info
ref|YP_472434.1|  glutaryl-CoA dehydrogenase protein [Rhizobiu...   395    3e-108 Gene info
ref|ZP_01041957.1|  Glutaryl-CoA dehydrogenase [Idiomarina bal...   395    3e-108
ref|YP_002296405.1|  glutaryl-CoA dehydrogenase [Rhodospirillu...   395    3e-108 Gene info
ref|ZP_01747425.1|  Acyl-CoA dehydrogenase [Sagittula stellata...   395    4e-108
ref|YP_002278102.1|  acyl-CoA dehydrogenase domain protein [Rh...   394    5e-108 Gene info
ref|YP_617917.1|  acyl-CoA dehydrogenase-like protein [Sphingo...   394    5e-108 Gene info
ref|ZP_06170522.1|  acyl-CoA dehydrogenase domain protein [Bre...   394    6e-108
ref|YP_001093030.1|  acyl-CoA dehydrogenase domain-containing ...   393    1e-107 Gene info
ref|ZP_01626572.1|  glutaryl-CoA dehydrogenase [marine gamma p...   393    1e-107
ref|YP_001759421.1|  acyl-CoA dehydrogenase domain-containing ...   393    1e-107 Gene info
ref|YP_003269271.1|  acyl-CoA dehydrogenase domain protein [Ha...   392    2e-107 Gene info
ref|ZP_03512043.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   392    2e-107
ref|YP_928668.1|  acyl-CoA dehydrogenase-like protein [Shewane...   392    3e-107 Gene info
ref|YP_855791.1|  glutaryl-CoA dehydrogenase [Aeromonas hydrop...   391    5e-107 Gene info
ref|YP_548505.1|  acyl-CoA dehydrogenase-like [Polaromonas sp....   390    7e-107 Gene info
ref|YP_001472723.1|  acyl-CoA dehydrogenase domain-containing ...   390    1e-106 Gene info
ref|YP_525299.1|  acyl-CoA dehydrogenase-like [Rhodoferax ferr...   390    1e-106 Gene info
ref|YP_981370.1|  acyl-CoA dehydrogenase domain-containing pro...   389    1e-106 Gene info
ref|ZP_01895869.1|  glutaryl-CoA dehydrogenase [Marinobacter a...   388    5e-106
ref|YP_564019.1|  acyl-CoA dehydrogenase-like protein [Shewane...   385    3e-105 Gene info
ref|ZP_02157322.1|  Acyl-CoA dehydrogenase [Shewanella benthic...   385    3e-105
ref|YP_002796881.1|  Probable glutaryl-CoA dehydrogenase [Lari...   380    1e-103 Gene info
gb|EFC48745.1|  glutaryl-coenzyme A dehydrogenase [Naegleria g...   378    5e-103
ref|XP_002130227.1|  PREDICTED: similar to glutaryl-Coenzyme A...   372    2e-101 UniGene infoGene info
ref|YP_003060882.1|  acyl-CoA dehydrogenase domain protein [Hi...   369    3e-100 Gene info
ref|NP_001006024.1|  glutaryl-Coenzyme A dehydrogenase, like [...   368    5e-100 UniGene infoGene info
ref|XP_001746429.1|  hypothetical protein [Monosiga brevicolli...   365    5e-99  Gene info
ref|XP_639044.1|  glutaryl-CoA dehydrogenase [Dictyostelium di...   363    9e-99  UniGene infoGene info
ref|XP_001640203.1|  predicted protein [Nematostella vectensis...   362    3e-98  UniGene infoGene info
ref|NP_001086623.1|  glutaryl-Coenzyme A dehydrogenase [Xenopu...   362    3e-98  UniGene infoGene info
ref|XP_001510278.1|  PREDICTED: similar to Glutaryl-Coenzyme A...   360    7e-98  UniGene infoGene info
ref|NP_496469.1|  hypothetical protein F54D5.7 [Caenorhabditis...   360    8e-98  UniGene infoGene info
ref|XP_001457575.1|  hypothetical protein [Paramecium tetraure...   360    1e-97  UniGene infoGene info
ref|NP_957180.1|  glutaryl-Coenzyme A dehydrogenase [Danio rer...   358    3e-97  UniGene infoGene info
ref|NP_887213.1|  glutaryl-CoA dehydrogenase [Bordetella bronc...   358    5e-97  Gene info
ref|NP_001016289.1|  glutaryl-Coenzyme A dehydrogenase [Xenopu...   357    7e-97  UniGene infoGene info
ref|NP_001102366.1|  glutaryl-Coenzyme A dehydrogenase [Rattus...   357    1e-96  UniGene infoGene info
ref|XP_001019797.1|  Acyl-CoA dehydrogenase, C-terminal domain...   357    1e-96  UniGene infoGene info
ref|XP_001455894.1|  hypothetical protein [Paramecium tetraure...   357    1e-96  UniGene infoGene info
gb|AAI35459.1|  glutaryl-Coenzyme A dehydrogenase [Xenopus (Si...   357    1e-96  Gene info
ref|XP_533901.2|  PREDICTED: similar to Glutaryl-CoA dehydroge...   356    1e-96  UniGene infoGene info
ref|XP_971662.1|  PREDICTED: similar to acyl-coa dehydrogenase...   356    1e-96  UniGene infoGene info
ref|XP_002631088.1|  Hypothetical protein CBG02861 [Caenorhabd...   356    2e-96  Gene info
ref|ZP_00054517.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   355    2e-96 
ref|NP_882997.1|  glutaryl-CoA dehydrogenase [Bordetella parap...   355    3e-96  Gene info
ref|XP_816465.1|  hypothetical protein [Trypanosoma cruzi stra...   353    9e-96  Gene info
gb|EFB28618.1|  hypothetical protein PANDA_009866 [Ailuropoda ...   353    1e-95 
ref|XP_808993.1|  acyl-CoA dehydrogenase [Trypanosoma cruzi st...   353    1e-95  Gene info
gb|ACI33980.1|  Glutaryl-CoA dehydrogenase, mitochondrial prec...   353    2e-95 
gb|EDL10968.1|  glutaryl-Coenzyme A dehydrogenase, isoform CRA...   352    2e-95  Gene info
gb|EDL10967.1|  glutaryl-Coenzyme A dehydrogenase, isoform CRA...   352    3e-95  Gene info
dbj|BAC37429.1|  unnamed protein product [Mus musculus]             352    3e-95  Gene info
ref|NP_032123.2|  glutaryl-Coenzyme A dehydrogenase precursor ...   352    3e-95  UniGene infoGene info
gb|EEY57306.1|  glutaryl-CoA dehydrogenase, putative [Phytopht...   352    4e-95 
ref|XP_001504933.1|  PREDICTED: similar to Glutaryl-Coenzyme A...   352    4e-95  UniGene infoGene info
ref|ZP_03503616.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   351    4e-95 
ref|XP_002113912.1|  expressed hypothetical protein [Trichopla...   350    7e-95  Gene info
ref|XP_001377762.1|  PREDICTED: hypothetical protein [Monodelp...   350    1e-94  UniGene infoGene info
ref|XP_002405433.1|  glutaryl-CoA dehydrogenase, putative [Ixo...   350    1e-94  UniGene infoGene info
ref|XP_001110384.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   350    1e-94  UniGene infoGene info
gb|AAB24226.1|  glutaryl-CoA dehydrogenase, GCDH [human, liver...   350    1e-94 
ref|NP_000150.1|  glutaryl-Coenzyme A dehydrogenase isoform a ...   349    2e-94  UniGene infoGene info
gb|AAP36673.1|  Homo sapiens glutaryl-Coenzyme A dehydrogenase...   349    2e-94 
ref|XP_001110300.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   349    2e-94  UniGene infoGene info
ref|NP_039663.1|  glutaryl-Coenzyme A dehydrogenase isoform b ...   349    3e-94  UniGene infoGene info
pdb|1SIQ|A  Chain A, The Crystal Structure And Mechanism Of Hu...   349    3e-94  Related structures
gb|EAW84325.1|  glutaryl-Coenzyme A dehydrogenase, isoform CRA...   349    3e-94  Gene info
pdb|1SIR|A  Chain A, The Crystal Structure And Mechanism Of Hu...   349    3e-94  Related structures
pdb|2R0M|A  Chain A, The Effect Of A Glu370asp Mutation In Glu...   348    3e-94  Related structures
sp|Q60759.1|GCDH_MOUSE  RecName: Full=Glutaryl-CoA dehydrogena...   348    3e-94  Gene info
emb|CAG03309.1|  unnamed protein product [Tetraodon nigroviridis]   348    4e-94 
ref|NP_001039404.1|  glutaryl-Coenzyme A dehydrogenase precurs...   348    6e-94  UniGene infoGene info
ref|XP_002186008.1|  predicted protein [Phaeodactylum tricornu...   347    6e-94  UniGene infoGene info
ref|NP_001127611.1|  glutaryl-Coenzyme A dehydrogenase [Pongo ...   347    1e-93  Gene info
ref|YP_003290711.1|  acyl-CoA dehydrogenase domain protein [Rh...   347    1e-93  Gene info
sp|Q8HXX8.1|GCDH_MACFA  RecName: Full=Glutaryl-CoA dehydrogena...   345    3e-93 
ref|XP_001830189.1|  hypothetical protein CC1G_09349 [Coprinop...   345    3e-93  Gene info
ref|XP_785958.1|  PREDICTED: similar to glutaryl-Coenzyme A de...   344    7e-93  Gene info
sp|P81140.1|GCDH_PIG  RecName: Full=Glutaryl-CoA dehydrogenase...   340    1e-91 
ref|XP_002602600.1|  hypothetical protein BRAFLDRAFT_281524 [B...   340    1e-91  UniGene infoGene info
ref|XP_002292100.1|  precursor of hydrogenase glutaryl-coa deh...   337    9e-91  Gene info
dbj|BAG59097.1|  unnamed protein product [Homo sapiens]             337    1e-90  Gene info
ref|XP_001880182.1|  glutaryl-CoA dehydrogenase [Laccaria bico...   335    3e-90  Gene info
ref|XP_001170290.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   332    2e-89  UniGene infoGene info
ref|XP_002472168.1|  predicted protein [Postia placenta Mad-69...   332    2e-89  Gene info
ref|XP_001170249.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   332    4e-89  UniGene infoGene info
ref|XP_001170352.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   332    5e-89  UniGene infoGene info
ref|XP_001170189.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   331    5e-89  UniGene infoGene info
ref|XP_002469495.1|  predicted protein [Postia placenta Mad-69...   331    7e-89  Gene info
ref|XP_002078383.1|  GD22569 [Drosophila simulans] >gb|EDX0396...   331    8e-89  UniGene infoGene info
ref|NP_609040.1|  CG9547 [Drosophila melanogaster] >ref|XP_001...   330    8e-89  UniGene infoGene info
ref|XP_002038108.1|  GM17931 [Drosophila sechellia] >gb|EDW545...   330    1e-88  Gene info
ref|XP_002088174.1|  GE18434 [Drosophila yakuba] >gb|EDW87886....   330    1e-88  Gene info
ref|XP_001649622.1|  acyl-coa dehydrogenase [Aedes aegypti] >g...   328    4e-88  UniGene infoGene info
ref|XP_001663829.1|  acyl-coa dehydrogenase [Aedes aegypti] >g...   328    4e-88  UniGene infoGene info
ref|XP_757482.1|  hypothetical protein UM01335.1 [Ustilago may...   328    5e-88  Gene info
ref|XP_001170271.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   326    2e-87  Gene info
ref|XP_002069386.1|  GK18689 [Drosophila willistoni] >gb|EDW80...   325    3e-87  Gene info
ref|XP_571996.1|  Glutaryl-CoA dehydrogenase, mitochondrial pr...   325    5e-87  UniGene infoGene info
ref|XP_316942.3|  AGAP008501-PA [Anopheles gambiae str. PEST] ...   325    5e-87  UniGene infoGene info
ref|XP_001357290.1|  GA21870 [Drosophila pseudoobscura pseudoo...   324    6e-87  Gene info
ref|XP_001962968.1|  GF15703 [Drosophila ananassae] >gb|EDV321...   324    7e-87  Gene info
ref|XP_001993137.1|  GH13244 [Drosophila grimshawi] >gb|EDV990...   324    7e-87  Gene info
ref|XP_774192.1|  hypothetical protein CNBG1740 [Cryptococcus ...   323    1e-86  UniGene infoGene info
ref|XP_001842045.1|  glutaryl-CoA dehydrogenase, mitochondrial...   323    1e-86  UniGene infoGene info
ref|XP_002002258.1|  GI17285 [Drosophila mojavensis] >gb|EDW11...   323    1e-86  Gene info
ref|XP_001170229.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   320    2e-85  Gene info
ref|XP_393736.2|  PREDICTED: similar to CG9547-PA [Apis mellif...   319    2e-85  UniGene infoGene info
ref|XP_001170163.1|  PREDICTED: glutaryl-Coenzyme A dehydrogen...   319    2e-85  Gene info
gb|EER15191.1|  Glutaryl-CoA dehydrogenase, putative [Perkinsu...   319    2e-85 
gb|EER09826.1|  Glutaryl-CoA dehydrogenase, putative [Perkinsu...   319    2e-85 
ref|XP_002057812.1|  GJ17894 [Drosophila virilis] >gb|EDW57885...   319    3e-85  Gene info
ref|NP_001155567.1|  hypothetical protein LOC100163339 [Acyrth...   318    6e-85  UniGene infoGene info
ref|XP_505801.1|  YALI0F23749p [Yarrowia lipolytica] >emb|CAG7...   317    7e-85  Gene info
ref|ZP_05110757.1|  glutaryl CoA dehydrogenase [Legionella dra...   315    3e-84 
gb|EEH34937.1|  glutaryl-CoA dehydrogenase [Paracoccidioides b...   315    3e-84 
gb|AAH50168.1|  Gcdh protein [Danio rerio]                          314    6e-84 
ref|YP_678019.1|  acyl-CoA dehydrogenase [Cytophaga hutchinson...   314    9e-84  Gene info
ref|YP_003121923.1|  acyl-CoA dehydrogenase domain protein [Ch...   313    2e-83  Gene info
dbj|BAG60914.1|  unnamed protein product [Homo sapiens]             312    3e-83  Gene info
ref|XP_002541024.1|  glutaryl-CoA dehydrogenase [Uncinocarpus ...   311    4e-83  Gene info
gb|EEH49932.1|  glutaryl-CoA dehydrogenase [Paracoccidioides b...   311    5e-83 
ref|ZP_03966494.1|  Glutaryl-CoA dehydrogenase [Sphingobacteri...   310    1e-82 
ref|XP_959935.1|  glutaryl-CoA dehydrogenase, mitochondrial pr...   310    1e-82  Gene info
gb|EEQ86823.1|  glutaryl-CoA dehydrogenase [Ajellomyces dermat...   310    2e-82 
dbj|BAE87381.1|  unnamed protein product [Macaca fascicularis]      309    2e-82 
ref|XP_001246731.1|  glutaryl-CoA dehydrogenase [Coccidioides ...   309    2e-82  Gene info
gb|EER40132.1|  glutaryl-CoA dehydrogenase [Ajellomyces capsul...   309    2e-82 
ref|YP_096585.1|  glutaryl CoA dehydrogenase [Legionella pneum...   309    3e-82  Gene info
ref|XP_002625900.1|  glutaryl-CoA dehydrogenase [Ajellomyces d...   309    3e-82  Gene info
ref|YP_003092595.1|  acyl-CoA dehydrogenase domain protein [Pe...   308    4e-82  Gene info
gb|EER24357.1|  glutaryl-CoA dehydrogenase, putative [Coccidio...   308    6e-82 
gb|EEH04694.1|  glutaryl-CoA dehydrogenase [Ajellomyces capsul...   307    7e-82 
ref|YP_001295278.1|  glutaryl-CoA dehydrogenase [Flavobacteriu...   307    7e-82  Gene info
gb|EEY17346.1|  glutaryl-CoA dehydrogenase [Verticillium albo-...   307    9e-82 
ref|YP_001249897.1|  glutaryl CoA dehydrogenase [Legionella pn...   307    1e-81  Gene info
ref|XP_001536797.1|  glutaryl-CoA dehydrogenase, mitochondrial...   306    2e-81  Gene info
ref|ZP_01692399.1|  acyl-CoA dehydrogenase  1 [Microscilla mar...   305    3e-81 
ref|ZP_01105332.1|  Acyl-CoA dehydrogenase-like protein [Flavo...   305    3e-81 
ref|XP_001270623.1|  glutaryl-CoA dehydrogenase, putative [Asp...   305    3e-81  Gene info
ref|XP_001587932.1|  hypothetical protein SS1G_11174 [Scleroti...   305    6e-81  Gene info
ref|YP_003087020.1|  acyl-CoA dehydrogenase domain protein [Dy...   304    6e-81  Gene info
ref|YP_003193852.1|  Acyl-CoA dehydrogenase-like protein [Robi...   304    6e-81  Gene info
ref|XP_755002.1|  glutaryl-CoA dehydrogenase [Aspergillus fumi...   304    7e-81  Gene info
ref|XP_001824450.1|  hypothetical protein [Aspergillus oryzae ...   304    7e-81  Gene info
ref|XP_390980.1|  hypothetical protein FG10804.1 [Gibberella z...   304    8e-81  Gene info
ref|XP_001263847.1|  glutaryl-CoA dehydrogenase, putative [Neo...   304    8e-81  Gene info
gb|EDP53131.1|  glutaryl-CoA dehydrogenase, putative [Aspergil...   304    8e-81 
ref|YP_001193641.1|  acyl-CoA dehydrogenase domain-containing ...   304    9e-81  Gene info
ref|XP_001546716.1|  conserved hypothetical protein [Botryotin...   303    1e-80  Gene info
ref|ZP_04777992.1|  Glutaryl-CoA dehydrogenase [Sphingobacteri...   303    1e-80 
ref|XP_370046.2|  hypothetical protein MGG_06561 [Magnaporthe ...   303    2e-80  UniGene infoGene info
ref|ZP_01718077.1|  Acyl-CoA dehydrogenase-like protein [Algor...   303    2e-80 
ref|ZP_01734012.1|  acyl-CoA dehydrogenase [Flavobacteria bact...   302    3e-80 
ref|ZP_01886550.1|  acyl-CoA dehydrogenase [Pedobacter sp. BAL...   301    4e-80 
ref|XP_002426222.1|  glutaryl-CoA dehydrogenase, putative [Ped...   301    4e-80  Gene info
ref|XP_002152579.1|  glutaryl-CoA dehydrogenase, putative [Pen...   301    4e-80  Gene info
ref|XP_002486284.1|  glutaryl-CoA dehydrogenase, putative [Tal...   301    5e-80  Gene info
ref|XP_001932312.1|  glutaryl-CoA dehydrogenase, mitochondrial...   301    6e-80  Gene info
ref|ZP_03850337.1|  glutaryl-CoA dehydrogenase [Chryseobacteri...   301    8e-80 
ref|YP_003095851.1|  Glutaryl-CoA dehydrogenase [Flavobacteria...   300    1e-79  Gene info
ref|YP_860198.1|  acyl-CoA dehydrogenase [Gramella forsetii KT...   300    1e-79  Gene info
ref|YP_002787911.1|  putative glutaryl-CoA dehydrogenase [Dein...   300    1e-79  Gene info
ref|XP_002563315.1|  Pc20g07920 [Penicillium chrysogenum Wisco...   299    2e-79  Gene info
ref|YP_385029.1|  Acyl-CoA dehydrogenase-like [Geobacter metal...   299    3e-79  Gene info
ref|XP_001793347.1|  hypothetical protein SNOG_02750 [Phaeosph...   298    5e-79  Gene info
ref|YP_002567220.1|  acyl-CoA dehydrogenase domain protein [Ha...   297    8e-79  Gene info
gb|EEU42485.1|  predicted protein [Nectria haematococca mpVI 7...   297    9e-79 
gb|EFA76229.1|  glutaryl-CoA dehydrogenase [Polysphondylium pa...   296    1e-78 
gb|EEQ35382.1|  glutaryl-CoA dehydrogenase [Microsporum canis ...   296    2e-78 
ref|ZP_06186403.1|  glutaryl-CoA dehydrogenase [Legionella lon...   296    2e-78 
ref|XP_001217452.1|  glutaryl-CoA dehydrogenase, mitochondrial...   296    3e-78  Gene info
ref|XP_660366.1|  hypothetical protein AN2762.2 [Aspergillus n...   295    4e-78  Gene info
ref|YP_136545.1|  glutaryl-CoA dehydrogenase [Haloarcula maris...   295    5e-78  Gene info
ref|YP_003385876.1|  acyl-CoA dehydrogenase domain protein [Sp...   293    1e-77  Gene info
ref|ZP_03693206.1|  acyl-CoA dehydrogenase domain protein [Nat...   293    1e-77 
ref|ZP_01251935.1|  Acyl-CoA dehydrogenase-like protein [Psych...   293    1e-77 
ref|ZP_01060224.1|  Acyl-CoA dehydrogenase-like [Leeuwenhoekie...   293    2e-77 
ref|NP_285660.1|  glutaryl-CoA dehydrogenase [Deinococcus radi...   293    2e-77  Gene info
ref|XP_001395004.1|  hypothetical protein An11g10470 [Aspergil...   292    3e-77  Gene info
ref|ZP_03498068.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   292    4e-77 
ref|ZP_01049374.1|  Acyl-CoA dehydrogenase-like [Dokdonia dong...   291    4e-77 
ref|XP_002152580.1|  glutaryl-CoA dehydrogenase, putative [Pen...   290    1e-76  Gene info
ref|ZP_01053732.1|  acyl-CoA dehydrogenase [Polaribacter sp. M...   290    1e-76  Gene info
ref|YP_594268.1|  acyl-CoA dehydrogenase-like [Deinococcus geo...   290    2e-76  Gene info
ref|YP_327716.1|  acyl-CoA dehydrogenase 8 [Natronomonas phara...   288    4e-76  Gene info
ref|ZP_01910174.1|  probable glutaryl-CoA dehydrogenase [Plesi...   288    4e-76 
ref|YP_003402073.1|  acyl-CoA dehydrogenase domain protein [Ha...   288    4e-76  Gene info
ref|ZP_00949881.1|  Acyl-CoA dehydrogenase-like protein [Croce...   288    6e-76 
ref|YP_001970123.1|  putative glutaryl-CoA dehydrogenase [Sten...   287    8e-76  Gene info
ref|ZP_01117537.1|  Acyl-CoA dehydrogenase-like protein [Polar...   287    8e-76 
ref|ZP_01200940.1|  glutaryl-CoA dehydrogenase [Flavobacteria ...   287    1e-75 
ref|XP_002398435.1|  hypothetical protein MPER_00969 [Moniliop...   286    2e-75  Gene info
ref|YP_001612630.1|  glutaryl-CoA dehydrogenase [Sorangium cel...   286    2e-75  Gene info
ref|ZP_04040455.1|  acyl-CoA dehydrogenase [Meiothermus ruber ...   286    2e-75 
ref|YP_326960.1|  acyl-CoA dehydrogenase 1 [Natronomonas phara...   285    4e-75  Gene info
ref|NP_069824.1|  glutaryl-CoA dehydrogenase (gcdH) [Archaeogl...   285    5e-75  Gene info
ref|YP_002026547.1|  acyl-CoA dehydrogenase domain protein [St...   285    6e-75  Gene info
ref|ZP_01891299.1|  acyl-CoA dehydrogenase [unidentified eubac...   284    8e-75 
ref|ZP_02243880.1|  glutaryl-CoA dehydrogenase [Xanthomonas or...   284    8e-75 
ref|NP_641806.1|  glutaryl-CoA dehydrogenase [Xanthomonas axon...   284    9e-75  Gene info
ref|ZP_02160257.1|  acyl-CoA dehydrogenase [Kordia algicida OT...   284    1e-74 
ref|YP_363260.1|  glutaryl-CoA dehydrogenase [Xanthomonas camp...   283    2e-74  Gene info
ref|ZP_02181703.1|  acyl-CoA dehydrogenase [Flavobacteriales b...   282    3e-74 
ref|YP_001912581.1|  acyl-CoA dehydrogenase 1 [Xanthomonas ory...   282    3e-74  Gene info
ref|YP_002753321.1|  glutaryl-CoA dehydrogenase [Acidobacteriu...   281    4e-74  Gene info
ref|ZP_05136547.1|  glutaryl CoA dehydrogenase [Stenotrophomon...   281    5e-74 
ref|YP_200156.1|  glutaryl-CoA dehydrogenase [Xanthomonas oryz...   281    9e-74  Gene info
ref|YP_001690218.1|  acyl-CoA dehydrogenase [Halobacterium sal...   280    1e-73  Gene info
gb|EEH23471.1|  glutaryl-CoA dehydrogenase [Paracoccidioides b...   280    1e-73 
ref|ZP_04689137.1|  acyl CoA dehydrogenase [Streptomyces ghana...   280    1e-73 
ref|YP_445243.1|  acyl-CoA dehydrogenase domain-containing pro...   280    2e-73  Gene info
ref|NP_281084.1|  GcdH [Halobacterium sp. NRC-1] >gb|AAG20564....   279    3e-73  Gene info
ref|ZP_05542159.1|  acyl-CoA dehydrogenase [Streptomyces grise...   278    5e-73 
ref|YP_002761983.1|  glutaryl-CoA dehydrogenase [Gemmatimonas ...   277    1e-72  Gene info
gb|ABZ10036.1|  putative acyl-CoA dehydrogenase, C-terminal do...   276    3e-72 
ref|ZP_06401012.1|  acyl-CoA dehydrogenase domain protein [Mic...   275    4e-72 
ref|ZP_06220871.1|  acyl-CoA dehydrogenase domain protein [Mic...   275    4e-72 
ref|ZP_05020077.1|  acyl CoA dehydrogenase [Streptomyces svice...   275    4e-72 
emb|CBG74208.1|  putative acyl-CoA dehydrogenase [Streptomyces...   275    5e-72 
ref|NP_636802.1|  glutaryl-CoA dehydrogenase [Xanthomonas camp...   275    5e-72  Gene info
ref|YP_589689.1|  acyl-CoA dehydrogenase-like [Candidatus Kori...   274    1e-71  Gene info
ref|ZP_04607041.1|  acyl-CoA dehydrogenase [Micromonospora sp....   274    1e-71 
ref|NP_827718.1|  acyl-CoA dehydrogenase [Streptomyces avermit...   272    3e-71  Gene info
ref|ZP_05787668.1|  glutaryl-CoA dehydrogenase [Silicibacter l...   272    3e-71 
ref|ZP_05530464.1|  acyl-CoA dehydrogenase [Streptomyces virid...   272    3e-71 
ref|YP_249964.1|  acyl-CoA dehydrogenase [Corynebacterium jeik...   271    5e-71  Gene info
ref|ZP_05846444.1|  glutaryl-CoA dehydrogenase [Corynebacteriu...   271    8e-71 
ref|YP_003176953.1|  acyl-CoA dehydrogenase domain protein [Ha...   269    3e-70  Gene info
ref|YP_001157292.1|  acyl-CoA dehydrogenase domain-containing ...   268    5e-70  Gene info
ref|YP_003133601.1|  acyl-CoA dehydrogenase [Saccharomonospora...   268    6e-70  Gene info
ref|ZP_05486712.1|  acyl CoA dehydrogenase [Streptomyces sp. S...   267    9e-70 
ref|YP_001104147.1|  glutaryl-CoA dehydrogenase [Saccharopolys...   267    9e-70  Gene info
ref|ZP_01740147.1|  Acyl-CoA dehydrogenase [Marinobacter sp. E...   266    2e-69 
ref|ZP_05804221.1|  acyl-CoA dehydrogenase domain protein [Str...   265    4e-69 
ref|YP_001535437.1|  acyl-CoA dehydrogenase domain-containing ...   265    4e-69  Gene info
ref|ZP_05011025.1|  acyl CoA dehydrogenase [Streptomyces prist...   265    5e-69 
ref|ZP_06273497.1|  acyl-CoA dehydrogenase domain protein [Str...   265    7e-69 
ref|ZP_04034210.1|  acyl-CoA dehydrogenase [Meiothermus silvan...   264    7e-69 
ref|YP_821341.1|  acyl-CoA dehydrogenase domain-containing pro...   264    8e-69  Gene info
ref|ZP_05518974.1|  acyl-CoA dehydrogenase [Streptomyces hygro...   264    9e-69 
ref|ZP_04993295.1|  glutaryl-CoA dehydrogenase [Streptomyces s...   264    1e-68 
ref|ZP_05223880.1|  putative acyl-CoA dehydrogenase [Mycobacte...   263    1e-68 
ref|NP_626022.1|  acyl CoA dehydrogenase [Streptomyces coelico...   263    2e-68  Gene info
ref|ZP_05482011.1|  glutaryl-CoA dehydrogenase [Streptomyces s...   263    2e-68 
ref|ZP_04692154.1|  putative acyl-CoA dehydrogenase [Streptomy...   263    3e-68 
ref|ZP_05218721.1|  putative acyl-CoA dehydrogenase [Mycobacte...   262    3e-68 
ref|YP_003298176.1|  acyl-CoA dehydrogenase domain protein [Th...   262    4e-68  Gene info
ref|ZP_04686853.1|  acyl-CoA dehydrogenase FadE7 [Streptomyces...   261    5e-68 
ref|YP_003344431.1|  acyl-CoA dehydrogenase domain protein [St...   261    7e-68  Gene info
ref|YP_883894.1|  putative acyl-CoA dehydrogenase [Mycobacteri...   261    8e-68  Gene info
ref|YP_003392795.1|  acyl-CoA dehydrogenase domain protein [Co...   261    8e-68  Gene info
ref|YP_003119124.1|  acyl-CoA dehydrogenase domain protein [Ca...   261    9e-68  Gene info
ref|YP_001827262.1|  putative acyl-CoA dehydrogenase [Streptom...   261    1e-67  Gene info
ref|YP_644518.1|  acyl-CoA dehydrogenase-like protein [Rubroba...   260    1e-67  Gene info
ref|YP_948732.1|  putative glutaryl-CoA dehydrogenase [Arthrob...   260    2e-67  Gene info
ref|YP_644639.1|  acyl-CoA dehydrogenase-like protein [Rubroba...   259    2e-67  Gene info
ref|YP_906584.1|  acyl-CoA dehydrogenase FadE7 [Mycobacterium ...   259    2e-67  Gene info
ref|ZP_04747520.1|  acyl-CoA dehydrogenase FadE7 [Mycobacteriu...   259    3e-67 
ref|ZP_05912295.1|  acyl-CoA dehydrogenase domain protein [Bre...   259    3e-67 
ref|ZP_06279970.1|  acyl-CoA dehydrogenase domain protein [Str...   259    3e-67 
ref|NP_214914.1|  acyl-CoA dehydrogenase FADE7 [Mycobacterium ...   259    4e-67  Gene info
ref|NP_334820.1|  glutaryl-CoA dehydrogenase, putative [Mycoba...   258    4e-67  Gene info
ref|YP_003030324.1|  acyl-CoA dehydrogenase fadE7 [Mycobacteri...   258    4e-67  Gene info
ref|YP_004410.1|  glutaryl-CoA dehydrogenase [Thermus thermoph...   258    4e-67  Gene info
ref|YP_955452.1|  acyl-CoA dehydrogenase domain-containing pro...   258    5e-67  Gene info
ref|YP_003275441.1|  acyl-CoA dehydrogenase domain protein [Go...   258    5e-67  Gene info
ref|YP_289129.1|  glutaryl-CoA dehydrogenase [Thermobifida fus...   258    6e-67  Gene info
ref|YP_925476.1|  acyl-CoA dehydrogenase domain-containing pro...   258    7e-67  Gene info
ref|ZP_04924082.1|  acyl-CoA dehydrogenase fadE7 [Mycobacteriu...   258    7e-67 
ref|NP_962812.1|  FadE7 [Mycobacterium avium subsp. paratuberc...   258    7e-67  Gene info
ref|YP_144055.1|  putative glutaryl-CoA dehydrogenase [Thermus...   258    8e-67  Gene info
ref|ZP_05762740.1|  glutaryl-CoA dehydrogenase, putative [Myco...   257    1e-66 
ref|ZP_00994635.1|  putative acyl-CoA dehydrogenase [Janibacte...   256    2e-66 
ref|YP_002779572.1|  putative glutaryl-CoA dehydrogenase [Rhod...   256    2e-66  Gene info
ref|ZP_03512933.1|  glutaryl-CoA dehydrogenase protein [Rhizob...   256    2e-66 
ref|ZP_03496465.1|  acyl-CoA dehydrogenase domain protein [The...   256    3e-66 
ref|XP_002161167.1|  PREDICTED: similar to Glutaryl-Coenzyme A...   255    3e-66  UniGene infoGene info
ref|YP_003380874.1|  acyl-CoA dehydrogenase domain protein [Kr...   255    3e-66  Gene info
ref|ZP_06046689.1|  glutaryl-CoA dehydrogenase [Aeromicrobium ...   255    4e-66 
ref|YP_003341240.1|  glutaryl-CoA dehydrogenase [Streptosporan...   255    4e-66  Gene info
ref|YP_940204.1|  acyl-CoA dehydrogenase domain-containing pro...   254    1e-65  Gene info
ref|ZP_04334499.1|  acyl-CoA dehydrogenase [Nocardiopsis dasso...   254    1e-65 
ref|YP_641308.1|  acyl-CoA dehydrogenase-like protein [Mycobac...   253    1e-65  Gene info
ref|YP_886806.1|  glutaryl-CoA dehydrogenase [Mycobacterium sm...   253    1e-65  Gene info
ref|YP_003200274.1|  acyl-CoA dehydrogenase domain protein [Na...   253    2e-65 
ref|YP_702268.1|  glutaryl-CoA dehydrogenase [Rhodococcus jost...   253    2e-65  Gene info
ref|ZP_04027819.1|  acyl-CoA dehydrogenase [Tsukamurella pauro...   252    3e-65 
ref|ZP_01118424.1|  Acyl-CoA dehydrogenase, C-terminal domain ...   252    3e-65 
ref|YP_001853925.1|  putative glutaryl-CoA dehydrogenase [Kocu...   251    6e-65  Gene info
ref|XP_001227533.1|  hypothetical protein CHGG_09606 [Chaetomi...   251    6e-65  Gene info
ref|YP_002779208.1|  putative glutaryl-CoA dehydrogenase [Rhod...   251    7e-65  Gene info
ref|YP_001705332.1|  putative acyl-CoA dehydrogenase FadE [Myc...   250    1e-64  Gene info
ref|YP_002768294.1|  glutaryl-CoA dehydrogenase [Rhodococcus e...   250    2e-64  Gene info
ref|YP_952684.1|  acyl-CoA dehydrogenase domain-containing pro...   250    2e-64  Gene info
ref|ZP_05913528.1|  glutaryl-CoA dehydrogenase [Brevibacterium...   250    2e-64 
ref|ZP_04382276.1|  glutaryl-CoA dehydrogenase [Rhodococcus er...   249    2e-64 
ref|YP_889512.1|  glutaryl-CoA dehydrogenase [Mycobacterium sm...   249    2e-64  Gene info
ref|YP_002488811.1|  acyl-CoA dehydrogenase domain protein [Ar...   249    3e-64  Gene info
ref|YP_121044.1|  putative acyl-CoA dehydrogenase [Nocardia fa...   247    9e-64  Gene info
ref|YP_832534.1|  acyl-CoA dehydrogenase domain-containing pro...   247    1e-63  Gene info
ref|YP_001624059.1|  glutaryl-CoA dehydrogenase [Renibacterium...   246    2e-63  Gene info
ref|YP_001135770.1|  acyl-CoA dehydrogenase domain-containing ...   246    3e-63  Gene info
ref|YP_001701570.1|  acyl-CoA dehydrogenase [Mycobacterium abs...   244    6e-63  Gene info
ref|YP_890894.1|  glutaryl-CoA dehydrogenase [Mycobacterium sm...   243    1e-62  Gene info
ref|YP_002958334.1|  acyl-CoA dehydrogenase [Micrococcus luteu...   243    2e-62  Gene info
ref|XP_002384204.1|  glutaryl-CoA dehydrogenase, putative [Asp...   243    3e-62  Gene info
ref|ZP_05505749.1|  acyl-CoA dehydrogenase [Streptomyces sp. C]     241    5e-62 
gb|ABK91965.1|  acyl-CoA dehydrogenase [uncultured bacterium]       241    7e-62 
ref|NP_737339.1|  putative glutaryl-CoA dehydrogenase [Coryneb...   241    8e-62  Gene info
ref|YP_002834168.1|  acyl-CoA dehydrogenase [Corynebacterium a...   241    8e-62  Gene info
ref|ZP_05001164.1|  acyl-CoA dehydrogenase [Streptomyces sp. M...   241    8e-62 
ref|XP_391660.1|  hypothetical protein FG11484.1 [Gibberella z...   240    1e-61  Gene info
ref|ZP_04701720.1|  putative glutaryl-CoA dehydrogenase [Strep...   236    2e-60 
ref|NP_739387.1|  putative acyl-CoA dehydrogenase [Corynebacte...   230    2e-58  Gene info
ref|ZP_01129414.1|  putative acyl-CoA dehydrogenase [marine ac...   227    1e-57 
ref|ZP_05708350.1|  glutaryl-CoA dehydrogenase [Corynebacteriu...   221    5e-56 
ref|YP_645127.1|  acyl-CoA dehydrogenase-like protein [Rubroba...   215    5e-54  Gene info
gb|ACO14814.1|  Glutaryl-CoA dehydrogenase, mitochondrial prec...   214    9e-54 
ref|XP_001601826.1|  PREDICTED: similar to ENSANGP00000019312,...   210    2e-52  UniGene infoGene info
ref|YP_002948622.1|  acyl-CoA dehydrogenase domain protein [Ge...   204    1e-50  Gene info
ref|YP_146298.1|  acyl-CoA dehydrogenase [Geobacillus kaustoph...   204    1e-50  Gene info
ref|ZP_03149333.1|  acyl-CoA dehydrogenase domain protein [Geo...   202    3e-50 
ref|YP_001124579.1|  Acyl-CoA dehydrogenase [Geobacillus therm...   202    3e-50  Gene info
ref|ZP_04431516.1|  acyl-CoA dehydrogenase domain protein [Bac...   202    5e-50 
ref|YP_002461466.1|  acyl-CoA dehydrogenase domain protein [Ch...   202    5e-50  Gene info
ref|ZP_04393049.1|  acyl-CoA dehydrogenase domain protein [Geo...   202    5e-50 
ref|YP_001637130.1|  acyl-CoA dehydrogenase domain-containing ...   199    4e-49  Gene info
ref|ZP_05373384.1|  acyl-CoA dehydrogenase domain protein [Geo...   197    1e-48 
ref|YP_003426360.1|  acyl-CoA dehydrogenase [Bacillus pseudofi...   197    2e-48 
ref|ZP_01614253.1|  Isovaleryl-CoA dehydrogenase [Alteromonada...   196    2e-48 
ref|ZP_05505704.1|  acyl-CoA dehydrogenase [Streptomyces sp. C]     196    3e-48 
ref|YP_002315595.1|  Acyl-CoA dehydrogenase [Anoxybacillus fla...   196    3e-48  Gene info
ref|XP_001391510.1|  hypothetical protein An07g04280 [Aspergil...   196    4e-48  Gene info
ref|ZP_04156204.1|  Acyl-CoA dehydrogenase domain protein [Bac...   195    5e-48 
ref|NP_693932.1|  acyl-CoA dehydrogenase [Oceanobacillus iheye...   195    5e-48  Gene info
gb|AAB09615.1|  similar to product encoded by Bacillus subtili...   194    7e-48 
ref|ZP_04150428.1|  Acyl-CoA dehydrogenase domain protein [Bac...   194    8e-48 
ref|XP_760980.1|  hypothetical protein UM04833.1 [Ustilago may...   194    8e-48  Gene info
gb|EEQ33847.1|  isovaleryl-CoA dehydrogenase [Microsporum cani...   194    1e-47 
ref|XP_002147339.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   193    2e-47  Gene info
ref|YP_702594.1|  butyryl-CoA dehydrogenase [Rhodococcus josti...   193    2e-47  Gene info
ref|ZP_03592182.1|  acyl-CoA dehydrogenase [Bacillus subtilis ...   193    2e-47 
ref|NP_390295.2|  short chain acyl-CoA dehydrogenase [Bacillus...   193    2e-47  Gene info
ref|XP_002147338.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   193    2e-47  Gene info
ref|YP_002779576.1|  acyl-CoA dehydrogenase [Rhodococcus opacu...   192    3e-47  Gene info
ref|YP_001696716.1|  Acyl-CoA dehydrogenase [Lysinibacillus sp...   192    4e-47  Gene info
ref|XP_001778675.1|  predicted protein [Physcomitrella patens ...   192    4e-47  UniGene infoGene info
ref|ZP_01724750.1|  Acyl-CoA dehydrogenase, short-chain specif...   192    4e-47 
ref|ZP_01168474.1|  acyl-CoA dehydrogenase [Bacillus sp. NRRL ...   192    5e-47 
ref|YP_002774977.1|  probable acyl-CoA dehydrogenase short-cha...   192    5e-47  Gene info
gb|EER27831.1|  isovaleryl-CoA dehydrogenase, putative [Coccid...   192    6e-47 
ref|XP_001446561.1|  hypothetical protein [Paramecium tetraure...   191    6e-47  UniGene infoGene info
ref|YP_001363232.1|  acyl-CoA dehydrogenase domain protein [Ki...   191    7e-47  Gene info
ref|XP_001460138.1|  hypothetical protein [Paramecium tetraure...   191    7e-47  UniGene infoGene info
ref|YP_001127422.1|  Acyl-CoA dehydrogenase (short-chain speci...   191    7e-47  Gene info
ref|ZP_03148484.1|  acyl-CoA dehydrogenase domain protein [Geo...   191    8e-47 
ref|XP_001215752.1|  isovaleryl-CoA dehydrogenase, mitochondri...   191    8e-47  Gene info
ref|XP_002481490.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   191    8e-47  Gene info
ref|ZP_05372436.1|  acyl-CoA dehydrogenase domain protein [Geo...   191    9e-47 
ref|XP_001242828.1|  hypothetical protein CIMG_06724 [Coccidio...   191    9e-47  Gene info
ref|YP_177381.1|  acyl-CoA dehydrogenase [Bacillus clausii KSM...   191    9e-47  Gene info
ref|ZP_05804276.1|  acyl-CoA dehydrogenase domain protein [Str...   191    1e-46 
ref|ZP_06364206.1|  Butyryl-CoA dehydrogenase [Bacillus cellul...   191    1e-46 
ref|ZP_01860926.1|  Acyl-CoA dehydrogenase, short-chain specif...   191    1e-46 
ref|YP_003059989.1|  acyl-CoA dehydrogenase domain protein [Hi...   190    2e-46  Gene info
gb|EEC78437.1|  hypothetical protein OsI_18277 [Oryza sativa I...   190    2e-46 
gb|EEH21701.1|  isovaleryl-CoA dehydrogenase [Paracoccidioides...   189    2e-46 
ref|YP_339970.1|  isovaleryl-CoA dehydrogenase [Pseudoalteromo...   189    2e-46  Gene info
ref|ZP_05538183.1|  putative acyl-CoA dehydrogenase [Streptomy...   189    3e-46 
ref|ZP_04706113.1|  putative acyl-CoA dehydrogenase [Streptomy...   189    3e-46 
ref|NP_693933.1|  acyl-CoA dehydrogenase [Oceanobacillus iheye...   189    3e-46  Gene info
ref|ZP_06273462.1|  Butyryl-CoA dehydrogenase [Streptomyces sp...   189    3e-46 
ref|XP_001424428.1|  hypothetical protein [Paramecium tetraure...   189    3e-46  UniGene infoGene info
ref|XP_662292.1|  hypothetical protein AN4688.2 [Aspergillus n...   189    3e-46  Gene info
gb|AAR23112.1|  isovaleryl-coenzyme A dehydrogenase [Emericell...   189    4e-46 
ref|NP_001054521.1|  Os05g0125500 [Oryza sativa (japonica cult...   189    4e-46  UniGene infoGene info
ref|ZP_04430889.1|  acyl-CoA dehydrogenase domain protein [Bac...   189    4e-46 
ref|XP_002567181.1|  Pc21g01100 [Penicillium chrysogenum Wisco...   189    4e-46  Gene info
ref|XP_001824798.1|  hypothetical protein [Aspergillus oryzae ...   189    5e-46  Gene info
dbj|BAG62492.1|  unnamed protein product [Homo sapiens]             188    5e-46  Gene info
ref|XP_002383800.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   188    5e-46  Gene info
ref|XP_001259795.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   188    7e-46  Gene info
ref|XP_753744.1|  isovaleryl-CoA dehydrogenase IvdA [Aspergill...   188    7e-46  Gene info
dbj|BAC37663.1|  unnamed protein product [Mus musculus]             188    7e-46  Gene info
ref|ZP_05530412.1|  acyl-CoA dehydrogenase [Streptomyces virid...   188    7e-46 
ref|ZP_04074986.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   188    7e-46 
ref|YP_001827311.1|  putative acyl-CoA dehydrogenase [Streptom...   188    8e-46  Gene info
sp|Q9FS88.1|IVD1_SOLTU  RecName: Full=Isovaleryl-CoA dehydroge...   187    8e-46 
gb|ACN28780.1|  unknown [Zea mays]                                  187    9e-46 
ref|ZP_05002447.1|  acyl-CoA dehydrogenase [Streptomyces sp. M...   187    9e-46 
ref|ZP_04568442.1|  acyl-COA dehydrogenase [Fusobacterium mort...   187    9e-46 
ref|YP_002317075.1|  Acyl-CoA dehydrogenase [Anoxybacillus fla...   187    1e-45  Gene info
ref|YP_149246.1|  acyl-CoA dehydrogenase [Geobacillus kaustoph...   187    1e-45  Gene info
ref|ZP_04292222.1|  Acyl-CoA dehydrogenase [Bacillus cereus R3...   187    1e-45 
ref|ZP_04188927.1|  Acyl-CoA dehydrogenase [Bacillus cereus AH...   187    1e-45 
ref|YP_517949.1|  hypothetical protein DSY1716 [Desulfitobacte...   187    1e-45  Gene info
ref|ZP_03930473.1|  acyl-CoA dehydrogenase [Anaerococcus tetra...   187    1e-45 
ref|ZP_06279920.1|  acyl-CoA dehydrogenase domain protein [Str...   187    2e-45 
ref|YP_001043050.1|  acyl-CoA dehydrogenase domain-containing ...   187    2e-45  Gene info
ref|ZP_05020929.1|  acyl-CoA dehydrogenase [Streptomyces svice...   187    2e-45 
ref|ZP_04177304.1|  Acyl-CoA dehydrogenase [Bacillus cereus AH...   187    2e-45 
ref|YP_001647913.1|  acyl-CoA dehydrogenase domain-containing ...   187    2e-45  Gene info
ref|YP_352568.1|  isovaleryl-CoA dehydrogenase [Rhodobacter sp...   186    2e-45  Gene info
ref|XP_002544217.1|  isovaleryl-CoA dehydrogenase [Uncinocarpu...   186    2e-45  Gene info
ref|NP_001136884.1|  hypothetical protein LOC100217040 [Zea ma...   186    2e-45  UniGene infoGene info
gb|ACF84257.1|  unknown [Zea mays] >gb|ACG40924.1| isovaleryl-...   186    2e-45  Gene info
ref|XP_002440512.1|  hypothetical protein SORBIDRAFT_09g002260...   186    2e-45  UniGene infoGene info
ref|YP_002525182.1|  Isovaleryl-CoA dehydrogenase [Rhodobacter...   186    2e-45  Gene info
ref|ZP_04431515.1|  acyl-CoA dehydrogenase domain protein [Bac...   186    2e-45 
ref|YP_002317074.1|  Acyl-CoA dehydrogenase [Anoxybacillus fla...   186    3e-45  Gene info
ref|YP_001788163.1|  acyl-CoA dehydrogenase family protein/ele...   186    3e-45  Gene info
ref|ZP_02619152.1|  acyl-CoA dehydrogenase family protein/elec...   186    3e-45 
ref|ZP_04159699.1|  Acyl-CoA dehydrogenase [Bacillus mycoides ...   186    3e-45 
ref|YP_002951247.1|  acyl-CoA dehydrogenase domain protein [Ge...   186    3e-45  Gene info
ref|YP_925477.1|  acyl-CoA dehydrogenase domain-containing pro...   186    3e-45  Gene info
ref|ZP_04081486.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   186    4e-45 
ref|ZP_04215018.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   186    4e-45 
ref|ZP_04153961.1|  Acyl-CoA dehydrogenase [Bacillus pseudomyc...   186    4e-45 
ref|NP_835003.1|  Acyl-CoA dehydrogenase, short-chain specific...   186    4e-45  Gene info
ref|ZP_03930934.1|  acyl-CoA dehydrogenase [Anaerococcus tetra...   186    4e-45 
ref|NP_691785.1|  acyl-CoA dehydrogenase [Oceanobacillus iheye...   186    4e-45  Gene info
ref|YP_003117456.1|  acyl-CoA dehydrogenase domain protein [Ca...   186    4e-45  Gene info
ref|ZP_04099420.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   186    4e-45 
ref|YP_003322106.1|  acyl-CoA dehydrogenase domain protein [Th...   186    4e-45 
ref|YP_003151855.1|  acyl-CoA dehydrogenase domain protein [An...   186    4e-45  Gene info
ref|ZP_04093354.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   186    4e-45 
ref|ZP_04225526.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   185    4e-45 
ref|ZP_04087353.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   185    4e-45 
ref|ZP_05010962.1|  acyl-CoA dehydrogenase [Streptomyces prist...   185    4e-45 
ref|XP_001552387.1|  hypothetical protein BC1G_08865 [Botryoti...   185    4e-45  Gene info
ref|ZP_04219948.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   185    5e-45 
ref|XP_001543631.1|  isovaleryl-CoA dehydrogenase, mitochondri...   185    5e-45  Gene info
ref|ZP_04206007.1|  Acyl-CoA dehydrogenase [Bacillus cereus F6...   185    5e-45 
ref|ZP_04105024.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   185    5e-45 
ref|ZP_03228087.1|  acyl-CoA dehydrogenase domain-containing p...   185    5e-45 
ref|ZP_04209515.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   185    5e-45 
ref|ZP_02613917.1|  acyl-CoA dehydrogenase family protein/elec...   185    5e-45 
gb|EEH02795.1|  isovaleryl-CoA dehydrogenase [Ajellomyces caps...   185    5e-45 
ref|ZP_02090091.1|  hypothetical protein FAEPRAM212_00328 [Fae...   185    5e-45 
ref|ZP_04230699.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   185    5e-45 
ref|NP_391598.1|  acyl-CoA dehydrogenase [Bacillus subtilis su...   185    5e-45  Gene info
ref|ZP_05527121.1|  acyl-CoA dehydrogenase [Streptomyces livid...   185    6e-45 
ref|YP_002956417.1|  acyl-CoA dehydrogenase [Micrococcus luteu...   185    6e-45  Gene info
ref|ZP_05080022.1|  isovaleryl-CoA dehydrogenase [Rhodobactera...   185    6e-45 
ref|NP_782009.1|  acyl-CoA dehydrogenase [Clostridium tetani E...   185    6e-45  Gene info
ref|YP_003185251.1|  acyl-CoA dehydrogenase domain protein [Al...   185    7e-45  Gene info
ref|YP_081042.1|  acyl-CoA dehydrogenase [Bacillus licheniform...   184    7e-45  Gene info
ref|YP_002448878.1|  acyl-CoA dehydrogenase [Bacillus cereus G...   184    7e-45  Gene info
ref|XP_964284.1|  isovaleryl-CoA dehydrogenase, mitochondrial ...   184    7e-45  Gene info
ref|YP_002454354.1|  acyl-CoA dehydrogenase [Bacillus cereus A...   184    8e-45  Gene info
ref|XP_002628287.1|  isovaleryl-CoA dehydrogenase [Ajellomyces...   184    8e-45  Gene info
ref|ZP_04286959.1|  Acyl-CoA dehydrogenase [Bacillus cereus AT...   184    8e-45 
gb|EER41312.1|  isovaleryl-CoA dehydrogenase [Ajellomyces caps...   184    8e-45 
ref|ZP_00240438.1|  acyl-CoA dehydrogenase, short-chain specif...   184    8e-45 
gb|EFA78120.1|  isovaleryl-CoA dehydrogenase [Polysphondylium ...   184    8e-45 
ref|YP_086610.1|  acyl-CoA dehydrogenase [Bacillus cereus E33L...   184    9e-45  Gene info
ref|ZP_04236557.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   184    9e-45 
ref|NP_625975.1|  acyl-CoA dehydrogenase [Streptomyces coelico...   184    1e-44  Gene info
ref|ZP_05740809.1|  glutaryl-CoA dehydrogenase [Silicibacter s...   184    1e-44 
ref|ZP_01133894.1|  Isovaleryl-CoA dehydrogenase [Pseudoaltero...   184    1e-44 
ref|NP_847742.1|  acyl-CoA dehydrogenase [Bacillus anthracis s...   184    1e-44  Gene info
ref|YP_360183.1|  butyryl-CoA dehydrogenase [Carboxydothermus ...   184    1e-44  Gene info
ref|ZP_05088478.1|  isovaleryl-CoA dehydrogenase [Ruegeria sp....   184    1e-44 
ref|YP_003408889.1|  Glutaryl-CoA dehydrogenase [Geodermatophi...   183    2e-44 
ref|YP_001255342.1|  acyl-CoA dehydrogenase family protein/ele...   183    2e-44  Gene info
ref|YP_039334.1|  butyryl-CoA dehydrogenase (short-chain acyl-...   183    2e-44  Gene info
ref|XP_503869.1|  YALI0E12573p [Yarrowia lipolytica] >emb|CAG7...   183    2e-44  Gene info
ref|YP_003426359.1|  acyl-CoA dehydrogenase [Bacillus pseudofi...   183    2e-44 
ref|ZP_02441833.1|  hypothetical protein ANACOL_01114 [Anaerot...   183    2e-44 
ref|NP_981764.1|  acyl-CoA dehydrogenase [Bacillus cereus ATCC...   183    2e-44  Gene info
ref|YP_579612.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   183    2e-44  Gene info
gb|EEH42549.1|  isovaleryl-CoA dehydrogenase [Paracoccidioides...   183    2e-44 
ref|ZP_03231356.1|  acyl-CoA dehydrogenase [Bacillus cereus AH...   183    2e-44 
ref|ZP_06397880.1|  Butyryl-CoA dehydrogenase [Micromonospora ...   183    2e-44 
ref|XP_001793812.1|  hypothetical protein SNOG_03241 [Phaeosph...   182    3e-44  Gene info
ref|ZP_04308915.1|  Acyl-CoA dehydrogenase [Bacillus cereus 17...   182    3e-44 
ref|ZP_05542208.1|  acyl-CoA dehydrogenase [Streptomyces grise...   182    3e-44 
ref|ZP_04281682.1|  Acyl-CoA dehydrogenase [Bacillus cereus m1...   182    3e-44 
ref|ZP_03495131.1|  acyl-CoA dehydrogenase domain protein [Ali...   182    3e-44 
ref|ZP_03916004.1|  acyl-CoA dehydrogenase [Anaerococcus lacto...   182    3e-44 
ref|ZP_03228086.1|  Acyl-CoA dehydrogenase [Bacillus coahuilen...   182    3e-44 
ref|YP_001696604.1|  acyl-CoA dehydrogenase [Lysinibacillus sp...   182    3e-44  Gene info
ref|ZP_05372437.1|  acyl-CoA dehydrogenase domain protein [Geo...   182    3e-44 
ref|ZP_03108316.1|  acyl-CoA dehydrogenase [Bacillus cereus NV...   182    3e-44 
ref|ZP_04117590.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   182    3e-44 
ref|ZP_01742968.1|  isovaleryl-CoA dehydrogenase [Rhodobactera...   182    4e-44 
ref|YP_897526.1|  butyryl-CoA dehydrogenase [Bacillus thuringi...   182    4e-44  Gene info
ref|YP_003450298.1|  isovaleryl-CoA dehydrogenase [Azospirillu...   182    4e-44 
ref|YP_003399247.1|  acyl-CoA dehydrogenase domain protein [Ac...   182    4e-44  Gene info
ref|ZP_03304935.1|  hypothetical protein ANHYDRO_01369 [Anaero...   182    5e-44 
ref|ZP_06290731.1|  acyl-CoA dehydrogenase domain-containing p...   182    5e-44 
ref|YP_002130127.1|  isovaleryl-CoA dehydrogenase [Phenylobact...   182    5e-44  Gene info
ref|ZP_02146201.1|  acyl-CoA dehydrogenase-like protein [Phaeo...   182    5e-44 
ref|YP_155263.1|  Acyl-CoA dehydrogenase [Idiomarina loihiensi...   182    5e-44  Gene info
ref|YP_263617.1|  isovaleryl-CoA dehydrogenase [Psychrobacter ...   181    6e-44  Gene info
ref|XP_001833025.1|  hypothetical protein CC1G_01087 [Coprinop...   181    6e-44  Gene info
ref|ZP_06364207.1|  Butyryl-CoA dehydrogenase [Bacillus cellul...   181    7e-44 
ref|YP_001471449.1|  acyl-CoA dehydrogenase domain-containing ...   181    7e-44  Gene info
ref|ZP_04037013.1|  butyryl-CoA dehydrogenase [Meiothermus sil...   181    7e-44 
ref|ZP_03928825.1|  conserved hypothetical protein [Acidaminoc...   181    7e-44 
ref|YP_001392122.1|  acyl-CoA dehydrogenase family protein/ele...   181    8e-44  Gene info
ref|YP_612727.1|  isovaleryl-CoA dehydrogenase [Ruegeria sp. T...   181    8e-44  Gene info
ref|ZP_05551698.1|  acyl-CoA dehydrogenase [Fusobacterium sp. ...   181    8e-44 
ref|YP_001168209.1|  acyl-CoA dehydrogenase domain-containing ...   181    8e-44  Gene info
ref|XP_641504.1|  isovaleryl-CoA dehydrogenase, mitochondrial ...   181    8e-44  UniGene infoGene info
ref|ZP_05815626.1|  acyl-CoA dehydrogenase [Fusobacterium sp. ...   181    9e-44 
ref|ZP_04571583.1|  acyl-COA dehydrogenase [Fusobacterium sp. ...   181    9e-44 
ref|YP_003099365.1|  acyl-CoA dehydrogenase domain protein [Ac...   181    9e-44  Gene info
ref|ZP_04575788.1|  acyl-COA dehydrogenase [Fusobacterium sp. ...   181    9e-44 
gb|EFC50282.1|  isovaleryl-CoA dehydrogenase [Naegleria gruberi]    181    9e-44 
ref|ZP_04040272.1|  butyryl-CoA dehydrogenase [Meiothermus rub...   181    9e-44 
ref|YP_003146248.1|  acyl-CoA dehydrogenase domain protein [Ka...   181    1e-43  Gene info
ref|ZP_01723229.1|  acyl-CoA dehydrogenase [Bacillus sp. B1490...   181    1e-43 
ref|ZP_05440474.1|  acyl-COA dehydrogenase, short-chain specif...   181    1e-43 
ref|ZP_01665241.1|  acyl-CoA dehydrogenase domain protein [The...   181    1e-43 
ref|ZP_02995042.1|  hypothetical protein CLOSPO_02164 [Clostri...   181    1e-43 
ref|YP_003152273.1|  acyl-CoA dehydrogenase domain protein [An...   181    1e-43  Gene info
ref|ZP_05472017.1|  butyryl-CoA dehydrogenase [Anaerococcus va...   181    1e-43 
ref|YP_326591.1|  acyl-CoA dehydrogenase 9 [Natronomonas phara...   181    1e-43  Gene info
ref|NP_827776.1|  acyl-CoA dehydrogenase [Streptomyces avermit...   181    1e-43  Gene info
ref|YP_645194.1|  acyl-CoA dehydrogenase-like protein [Rubroba...   181    1e-43  Gene info
ref|YP_608927.1|  isovaleryl-CoA dehydrogenase [Pseudomonas en...   180    1e-43  Gene info
ref|XP_001025535.1|  Acyl-CoA dehydrogenase, middle domain con...   180    1e-43  UniGene infoGene info
ref|ZP_04971750.1|  acyl-CoA dehydrogenase [Fusobacterium nucl...   180    1e-43 
ref|ZP_05485987.1|  acyl-CoA dehydrogenase [Streptomyces sp. S...   180    1e-43 
ref|XP_001222512.1|  conserved hypothetical protein [Chaetomiu...   180    1e-43  Gene info
ref|YP_002951248.1|  acyl-CoA dehydrogenase domain protein [Ge...   180    1e-43  Gene info
ref|YP_567495.1|  isovaleryl-CoA dehydrogenase [Rhodopseudomon...   180    2e-43  Gene info
ref|ZP_04860621.1|  acyl-coA dehydrogenase [Fusobacterium vari...   180    2e-43 
ref|YP_003405858.1|  acyl-CoA dehydrogenase domain protein [Ha...   180    2e-43  Gene info
ref|YP_001421835.1|  MmgC [Bacillus amyloliquefaciens FZB42] >...   180    2e-43  Gene info
ref|ZP_05742774.1|  isovaleryl-CoA dehydrogenase 2 domain prot...   180    2e-43 
ref|NP_800635.1|  putative acyl-CoA dehydrogenase [Vibrio para...   180    2e-43  Gene info
ref|ZP_05630709.1|  acyl-COA dehydrogenase, short-chain specif...   180    2e-43 
ref|ZP_05617833.1|  acyl-COA dehydrogenase, short-chain specif...   180    2e-43 
ref|ZP_02169378.1|  oligopeptide/dipeptide ABC transporter, AT...   180    2e-43 
ref|ZP_06026513.1|  acyl-COA dehydrogenase, short-chain specif...   180    2e-43 
ref|NP_604318.1|  acyl-COA dehydrogenase, short-chain specific...   180    2e-43  Gene info
ref|ZP_04934681.1|  hypothetical protein PA2G_02054 [Pseudomon...   180    2e-43 
ref|YP_360157.1|  butyryl-CoA dehydrogenase [Carboxydothermus ...   180    2e-43  Gene info
ref|XP_001439305.1|  hypothetical protein [Paramecium tetraure...   180    2e-43  UniGene infoGene info
ref|YP_487537.1|  Acyl-CoA dehydrogenase-like [Rhodopseudomona...   179    2e-43  Gene info
ref|YP_001546234.1|  acyl-CoA dehydrogenase domain-containing ...   179    2e-43  Gene info
ref|XP_001274161.1|  isovaleryl-CoA dehydrogenase IvdA, putati...   179    3e-43  Gene info
ref|NP_244665.1|  acyl-CoA dehydrogenase [Bacillus halodurans ...   179    3e-43  Gene info
ref|ZP_05623040.1|  acyl-coa dehydrogenase, short-chain specif...   179    3e-43 
ref|ZP_02077554.1|  hypothetical protein EUBDOL_01350 [Eubacte...   179    3e-43 
ref|YP_001647914.1|  acyl-CoA dehydrogenase domain-containing ...   179    3e-43  Gene info
gb|EEY65022.1|  short-chain specific acyl-CoA dehydrogenase, m...   179    3e-43 
gb|ACL31229.1|  acyl-CoA dehydrogenase [Rhodococcus sp. TFB]        179    3e-43 
ref|YP_349385.1|  isovaleryl-CoA dehydrogenase [Pseudomonas fl...   179    3e-43  Gene info
ref|YP_002131244.1|  isovaleryl CoA dehydrogenase [Phenylobact...   179    3e-43  Gene info
ref|ZP_01260026.1|  putative acyl-CoA dehydrogenase [Vibrio al...   179    3e-43 
ref|ZP_04921060.1|  Acyl-CoA dehydrogenase [Vibrio sp. Ex25] >...   179    3e-43  Gene info
ref|XP_567164.1|  Isovaleryl-CoA dehydrogenase 2 mitochondrial...   179    4e-43  UniGene infoGene info
ref|XP_777947.1|  hypothetical protein CNBA4160 [Cryptococcus ...   179    4e-43  UniGene infoGene info
ref|YP_001377045.1|  acyl-CoA dehydrogenase domain-containing ...   179    4e-43  Gene info
ref|ZP_03966360.1|  acyl-CoA oxidase [Sphingobacterium spiriti...   179    4e-43 
ref|ZP_01666094.1|  acyl-CoA dehydrogenase domain protein [The...   179    4e-43 
ref|YP_001280952.1|  acyl-CoA dehydrogenase domain-containing ...   179    4e-43  Gene info
ref|YP_289835.1|  putative acyl-CoA dehydrogenase [Thermobifid...   179    4e-43  Gene info
gb|EEU46835.1|  predicted protein [Nectria haematococca mpVI 7...   179    4e-43 
ref|ZP_02466751.1|  isovaleryl-CoA dehydrogenase [Burkholderia...   179    5e-43 
ref|ZP_04692099.1|  putative acyl-CoA dehydrogenase [Streptomy...   179    5e-43 
ref|XP_308965.3|  AGAP006780-PA [Anopheles gambiae str. PEST] ...   179    5e-43  UniGene infoGene info
ref|ZP_01059231.1|  acyl-CoA dehydrogenase [Leeuwenhoekiella b...   179    5e-43 
ref|YP_001749746.1|  acyl-CoA dehydrogenase domain-containing ...   179    5e-43  Gene info
ref|YP_003399151.1|  acyl-CoA dehydrogenase domain protein [Ac...   179    5e-43  Gene info
ref|ZP_03055047.1|  acyl-CoA dehydrogenase [Bacillus pumilus A...   179    5e-43 
ref|YP_435088.1|  Acyl-CoA dehydrogenase [Hahella chejuensis K...   178    5e-43  Gene info
ref|ZP_01260768.1|  putative acyl-CoA dehydrogenase [Vibrio al...   178    5e-43 
ref|ZP_05626774.1|  acyl-COA dehydrogenase, short-chain specif...   178    5e-43 
ref|YP_001488582.1|  acyl-CoA dehydrogenase (NADP(+)) [Bacillu...   178    6e-43  Gene info
ref|ZP_06178636.1|  putative acyl-CoA dehydrogenase [Vibrio al...   178    6e-43 
ref|ZP_01756055.1|  isovaleryl-CoA dehydrogenase [Roseobacter ...   178    6e-43 
ref|YP_439144.1|  isovaleryl-CoA dehydrogenase [Burkholderia t...   178    6e-43  Gene info
ref|ZP_04153962.1|  Acyl-CoA dehydrogenase [Bacillus pseudomyc...   178    6e-43 
ref|ZP_02384359.1|  isovaleryl-CoA dehydrogenase [Burkholderia...   178    6e-43 
ref|XP_002285017.1|  PREDICTED: hypothetical protein [Vitis vi...   178    7e-43  UniGene infoGene info
ref|ZP_02370450.1|  isovaleryl-CoA dehydrogenase [Burkholderia...   178    7e-43 
ref|ZP_04689173.1|  acyl-CoA dehydrogenase [Streptomyces ghana...   178    7e-43 
ref|ZP_00957825.1|  isovaleryl-CoA dehydrogenase [Oceanicaulis...   178    7e-43 
ref|ZP_02417956.1|  hypothetical protein ANACAC_00523 [Anaeros...   178    7e-43 
ref|ZP_02359013.1|  isovaleryl-CoA dehydrogenase [Burkholderia...   178    7e-43 
emb|CBG74257.1|  putative acyl-CoA dehydrogenase [Streptomyces...   178    8e-43 
ref|ZP_02366105.1|  isovaleryl-CoA dehydrogenase [Burkholderia...   178    8e-43 
emb|CBI16286.1|  unnamed protein product [Vitis vinifera]           178    8e-43 
ref|XP_002409197.1|  medium-chain acyl-CoA dehydrogenase, puta...   177    9e-43  UniGene infoGene info
ref|ZP_01989371.1|  isovaleryl-CoA dehydrogenase [Vibrio parah...   177    1e-42 
ref|ZP_01889877.1|  bytyryl-CoA dehydrogenase (short-chain-acy...   177    1e-42 
ref|ZP_04159700.1|  Acyl-CoA dehydrogenase [Bacillus mycoides ...   177    1e-42 
ref|XP_388686.1|  hypothetical protein FG08510.1 [Gibberella z...   177    1e-42  Gene info
ref|ZP_05886375.1|  isovaleryl-CoA dehydrogenase [Vibrio coral...   177    1e-42 
ref|NP_745629.1|  acyl-CoA dehydrogenase domain-containing pro...   177    1e-42  Gene info
ref|ZP_06185834.1|  isovaleryl-CoA dehydrogenase [Legionella l...   177    1e-42 
ref|XP_001663227.1|  acyl-coa dehydrogenase [Aedes aegypti] >g...   177    1e-42  UniGene infoGene info
ref|XP_001932575.1|  isovaleryl-CoA dehydrogenase, mitochondri...   177    1e-42  Gene info
ref|YP_001094695.1|  acyl-CoA dehydrogenase domain-containing ...   177    1e-42  Gene info
ref|YP_168001.1|  isovaleryl-CoA dehydrogenase [Ruegeria pomer...   177    1e-42  Gene info
ref|ZP_04569670.1|  acyl-COA dehydrogenase [Fusobacterium sp. ...   177    1e-42 
ref|XP_393211.3|  PREDICTED: similar to CG3902-PA [Apis mellif...   177    1e-42  UniGene infoGene info
ref|ZP_02860921.1|  hypothetical protein ANASTE_00112 [Anaerof...   177    1e-42 
ref|YP_001250577.1|  acyl CoA dehydrogenase [Legionella pneumo...   177    1e-42  Gene info
ref|ZP_04209516.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   177    1e-42 
ref|YP_095850.1|  acyl CoA dehydrogenase [Legionella pneumophi...   177    1e-42  Gene info
ref|NP_981765.1|  acyl-CoA dehydrogenase [Bacillus cereus ATCC...   177    1e-42  Gene info
ref|YP_001748685.1|  acyl-CoA dehydrogenase domain-containing ...   177    2e-42  Gene info
ref|ZP_04081487.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   177    2e-42 
gb|EEY15521.1|  isovaleryl-CoA dehydrogenase [Verticillium alb...   177    2e-42 
ref|ZP_04292223.1|  Acyl-CoA dehydrogenase [Bacillus cereus R3...   177    2e-42 
ref|ZP_03108346.1|  acyl-CoA dehydrogenase [Bacillus cereus NV...   177    2e-42 
ref|ZP_04177305.1|  Acyl-CoA dehydrogenase [Bacillus cereus AH...   177    2e-42 
ref|ZP_04779005.1|  acyl-CoA oxidase [Sphingobacterium spiriti...   177    2e-42 
ref|ZP_04099421.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   177    2e-42 
ref|YP_001990806.1|  acyl-CoA dehydrogenase domain protein [Rh...   176    2e-42  Gene info
ref|YP_039335.1|  short-chain acyl-CoA dehydrogenase; butyryl-...   176    2e-42  Gene info
ref|ZP_04171629.1|  Acyl-CoA dehydrogenase [Bacillus mycoides ...   176    2e-42 
ref|YP_001669889.1|  acyl-CoA dehydrogenase domain-containing ...   176    2e-42  Gene info
ref|NP_762457.1|  Acyl-CoA dehydrogenase [Vibrio vulnificus CM...   176    2e-42  Gene info
ref|NP_937102.1|  acyl-CoA dehydrogenase [Vibrio vulnificus YJ...   176    2e-42  Gene info
ref|ZP_04303513.1|  Acyl-CoA dehydrogenase [Bacillus cereus MM...   176    2e-42 
ref|ZP_05121780.1|  isovaleryl-CoA dehydrogenase [Rhodobactera...   176    2e-42 
ref|ZP_02078189.1|  hypothetical protein EUBDOL_02009 [Eubacte...   176    2e-42 
ref|ZP_05632048.1|  acyl-coA dehydrogenase [Fusobacterium ulce...   176    2e-42 
ref|YP_001636258.1|  acyl-CoA dehydrogenase domain-containing ...   176    2e-42  Gene info
ref|ZP_04863549.1|  acyl-coa dehydrogenase, short-chain specif...   176    2e-42 
ref|YP_127126.1|  hypothetical protein lpl1788 [Legionella pne...   176    2e-42  Gene info
ref|ZP_04188928.1|  Acyl-CoA dehydrogenase [Bacillus cereus AH...   176    2e-42 
emb|CAM76021.1|  isovaleryl-CoA dehydrogenase [Magnetospirillu...   176    2e-42 
ref|ZP_01056186.1|  isovaleryl-CoA dehydrogenase [Roseobacter ...   176    2e-42 
ref|YP_001668671.1|  acyl-CoA dehydrogenase domain-containing ...   176    2e-42  Gene info
emb|CAG10520.1|  unnamed protein product [Tetraodon nigroviridis]   176    2e-42 
ref|ZP_04093355.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   176    2e-42 
ref|ZP_03236836.1|  acyl-CoA dehydrogenase [Bacillus cereus H3...   176    2e-42 
ref|ZP_04254024.1|  Acyl-CoA dehydrogenase [Bacillus cereus 95...   176    3e-42 
ref|ZP_01863329.1|  isovaleryl-CoA dehydrogenase [Erythrobacte...   176    3e-42 
ref|YP_001750307.1|  acyl-CoA dehydrogenase domain-containing ...   176    3e-42  Gene info
ref|YP_001394035.1|  Acyl-CoA dehydrogenase, short-chain speci...   176    3e-42  Gene info
ref|YP_386227.1|  isovaleryl-CoA dehydrogenase [Geobacter meta...   176    3e-42  Gene info
ref|YP_001679682.1|  butyryl-coa dehydrogenase [Heliobacterium...   176    3e-42  Gene info
ref|YP_001268832.1|  acyl-CoA dehydrogenase domain-containing ...   176    3e-42  Gene info
ref|YP_001855948.1|  putative glutaryl-CoA dehydrogenase [Kocu...   176    3e-42  Gene info
ref|YP_001368597.1|  acyl-CoA dehydrogenase domain-containing ...   176    3e-42  Gene info
pdb|2IX6|A  Chain A, Short Chain Specific Acyl-Coa Oxidase Fro...   176    3e-42  Related structures
ref|NP_901436.1|  isovaleryl-CoA dehydrogenase [Chromobacteriu...   176    3e-42  Gene info
ref|YP_371183.1|  isovaleryl-CoA dehydrogenase [Burkholderia s...   176    3e-42  Gene info
ref|NP_190752.1|  ACX4 (ACYL-COA OXIDASE 4); acyl-CoA oxidase/...   176    3e-42  UniGene infoGene info
ref|YP_734450.1|  isovaleryl-CoA dehydrogenase [Shewanella sp....   176    3e-42  Gene info
ref|XP_001907474.1|  unnamed protein product [Podospora anseri...   176    3e-42  Gene info
ref|NP_946960.1|  isovaleryl-CoA dehydrogenase [Rhodopseudomon...   176    3e-42  Gene info
gb|ABH85388.1|  isovaleryl-CoA dehydrogenase [Beta vulgaris]        176    3e-42 
ref|NP_835004.1|  Acyl-CoA dehydrogenase, short-chain specific...   176    3e-42  Gene info
ref|ZP_02906545.1|  acyl-CoA dehydrogenase domain protein [Bur...   176    3e-42 
ref|ZP_04485040.1|  acyl-CoA dehydrogenase [Stackebrandtia nas...   176    4e-42 
ref|ZP_04148656.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   176    4e-42 
ref|YP_003122991.1|  Glutaryl-CoA dehydrogenase [Chitinophaga ...   176    4e-42  Gene info
ref|ZP_01990265.1|  acyl-CoA dehydrogenase [Vibrio parahaemoly...   176    4e-42 
ref|YP_001305905.1|  acyl-CoA dehydrogenase domain-containing ...   176    4e-42  Gene info
ref|NP_800128.1|  putative acyl-CoA dehydrogenase [Vibrio para...   176    4e-42  Gene info
ref|ZP_04286960.1|  Acyl-CoA dehydrogenase [Bacillus cereus AT...   176    4e-42 
ref|YP_496919.1|  isovaleryl-CoA dehydrogenase [Novosphingobiu...   176    4e-42  Gene info
ref|YP_869311.1|  isovaleryl-CoA dehydrogenase [Shewanella sp....   176    4e-42  Gene info
ref|YP_738437.1|  isovaleryl-CoA dehydrogenase [Shewanella sp....   176    4e-42  Gene info
ref|ZP_01043054.1|  Acyl-CoA dehydrogenase [Idiomarina baltica...   175    4e-42 
ref|ZP_05180053.1|  isovaleryl-CoA dehydrogenase [Brucella sp....   175    4e-42 
ref|ZP_04236558.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   175    4e-42 
ref|ZP_04308916.1|  Acyl-CoA dehydrogenase [Bacillus cereus 17...   175    4e-42 
ref|YP_086611.1|  short-chain acyl-CoA dehydrogenase; butyryl-...   175    4e-42  Gene info
ref|ZP_04200290.1|  Acyl-CoA dehydrogenase [Bacillus cereus AH...   175    4e-42 
ref|ZP_04197579.1|  Butyryl-CoA dehydrogenase [Bacillus cereus...   175    5e-42 
ref|YP_002760067.1|  acyl-CoA dehydrogenase [Gemmatimonas aura...   175    5e-42  Gene info
ref|NP_744365.1|  acyl-CoA dehydrogenase domain-containing pro...   175    5e-42  Gene info
ref|NP_847743.1|  acyl-CoA dehydrogenase [Bacillus anthracis s...   175    5e-42  Gene info
ref|YP_001267116.1|  acyl-CoA dehydrogenase domain-containing ...   175    5e-42  Gene info
ref|NP_244666.1|  acyl-CoA dehydrogenase [Bacillus halodurans ...   175    5e-42  Gene info
ref|ZP_05620000.1|  isovaleryl-CoA dehydrogenase 2 [Enhydrobac...   175    5e-42 
ref|XP_001746410.1|  hypothetical protein [Monosiga brevicolli...   175    5e-42  Gene info
ref|ZP_00390279.1|  COG1960: Acyl-CoA dehydrogenases [Bacillus...   175    5e-42 
ref|ZP_06181561.1|  putative acyl-CoA dehydrogenase [Vibrio al...   175    5e-42 
ref|ZP_04320539.1|  Acyl-CoA dehydrogenase [Bacillus cereus AT...   175    5e-42 
ref|ZP_06095936.1|  acyl-CoA dehydrogenase domain-containing p...   175    5e-42 
ref|YP_001242464.1|  isovaleryl-CoA dehydrogenase [Bradyrhizob...   175    6e-42  Gene info
sp|Q9FS87.1|IVD2_SOLTU  RecName: Full=Isovaleryl-CoA dehydroge...   175    6e-42 
gb|AAL32645.1|  isovaleryl-CoA-dehydrogenase precursor (IVD) [...   175    6e-42 
ref|NP_746190.1|  acyl-CoA dehydrogenase domain-containing pro...   175    6e-42  Gene info
ref|XP_002473476.1|  predicted protein [Postia placenta Mad-69...   175    6e-42  Gene info
ref|ZP_04087354.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   175    6e-42 
ref|YP_001348634.1|  citronelloyl-CoA dehydrogenase, GnyD [Pse...   175    6e-42  Gene info
ref|ZP_00240439.1|  acyl-CoA dehydrogenase [Bacillus cereus G9...   175    6e-42 
ref|ZP_03751715.1|  hypothetical protein ROSEINA2194_00109 [Ro...   175    6e-42 
ref|ZP_05391871.1|  acyl-CoA dehydrogenase domain protein [Clo...   175    7e-42 
ref|YP_145182.1|  acyl-CoA dehydrogenase [Thermus thermophilus...   175    7e-42  Gene info
ref|ZP_06170825.1|  acyl-CoA dehydrogenase domain protein [Bre...   175    7e-42 
gb|AAD45605.1|AF160729_1  isovaleryl-CoA-dehydrogenase precurs...   175    7e-42 
ref|YP_261036.1|  isovaleryl-CoA dehydrogenase [Pseudomonas fl...   175    7e-42  Gene info
ref|YP_002370119.1|  acyl-CoA dehydrogenase [Bacillus cereus B...   175    7e-42  Gene info
ref|YP_001075993.1|  putative isovaleryl-CoA dehydrogenase [Bu...   174    7e-42  Gene info
ref|ZP_04074987.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   174    7e-42 
ref|YP_105514.1|  isovaleryl-CoA dehydrogenase [Burkholderia m...   174    8e-42  Gene info
ref|ZP_03231264.1|  acyl-CoA dehydrogenase [Bacillus cereus AH...   174    8e-42 
ref|ZP_04822159.1|  acyl-coA dehydrogenase [Clostridium botuli...   174    8e-42 
ref|YP_001156333.1|  acyl-CoA dehydrogenase domain-containing ...   174    8e-42  Gene info
ref|YP_111456.1|  acyl-CoA dehydrogenase [Burkholderia pseudom...   174    8e-42  Gene info
ref|NP_190116.1|  IVD (ISOVALERYL-COA-DEHYDROGENASE); ATP bind...   174    8e-42  UniGene infoGene info
ref|YP_776271.1|  acyl-CoA dehydrogenase domain-containing pro...   174    8e-42  Gene info
ref|ZP_06104782.1|  acyl-CoA dehydrogenase domain-containing p...   174    9e-42 
ref|ZP_05909654.1|  putative acyl-CoA dehydrogenase [Vibrio pa...   174    9e-42 
ref|YP_003409427.1|  Glutaryl-CoA dehydrogenase [Geodermatophi...   174    9e-42 
ref|ZP_05448686.1|  isovaleryl-CoA dehydrogenase [Brucella mel...   174    9e-42 
ref|YP_268345.1|  isovaleryl-CoA dehydrogenase [Colwellia psyc...   174    9e-42  Gene info
ref|YP_783214.1|  acyl-CoA dehydrogenase domain-containing pro...   174    9e-42  Gene info
ref|YP_580498.1|  acyl-CoA dehydrogenase-like [Psychrobacter c...   174    1e-41  Gene info
ref|YP_001232043.1|  acyl-CoA dehydrogenase domain-containing ...   174    1e-41  Gene info
ref|YP_001920742.1|  acyl-coA dehydrogenase [Clostridium botul...   174    1e-41  Gene info
ref|ZP_02494213.1|  putative isovaleryl-CoA dehydrogenase [Bur...   174    1e-41 
ref|YP_001811783.1|  acyl-CoA dehydrogenase domain-containing ...   174    1e-41  Gene info
ref|YP_570815.1|  isovaleryl-CoA dehydrogenase [Rhodopseudomon...   174    1e-41  Gene info
ref|YP_001258066.1|  isovaleryl-CoA dehydrogenase [Brucella ov...   174    1e-41  Gene info
ref|YP_003105991.1|  isovaleryl-CoA dehydrogenase [Brucella mi...   174    1e-41  Gene info
gb|ACO15245.1|  Isovaleryl-CoA dehydrogenase, mitochondrial pr...   174    1e-41 
ref|ZP_05778147.1|  putative acyl-CoA dehydrogenase [Vibrio pa...   174    1e-41 
ref|YP_264457.1|  acyl-CoA dehydrogenase [Psychrobacter arctic...   174    1e-41  Gene info
ref|NP_540840.1|  isovaleryl-CoA dehydrogenase [Brucella melit...   174    1e-41  Gene info
ref|NP_697062.1|  isovaleryl-CoA dehydrogenase [Brucella suis ...   174    1e-41  Gene info
ref|ZP_03735487.1|  acyl-CoA dehydrogenase domain protein [Det...   174    1e-41 
ref|ZP_02180740.1|  bytyryl-CoA dehydrogenase (short-chain-acy...   174    1e-41 
ref|YP_459246.1|  isovaleryl-CoA dehydrogenase [Erythrobacter ...   174    1e-41  Gene info
ref|ZP_05833587.1|  conserved hypothetical protein [Brucella m...   174    1e-41 
ref|ZP_05118774.1|  isovaleryl-CoA dehydrogenase,   (IVD) [Vib...   174    1e-41 
ref|ZP_01860927.1|  short-chain acyl-CoA dehydrogenase; butyry...   174    1e-41 
ref|YP_220803.1|  Ivd, isovaleryl-CoA dehydrogenase [Brucella ...   174    1e-41  Gene info
gb|AAT51580.1|  PA2015 [synthetic construct]                        174    1e-41 
ref|XP_002596024.1|  hypothetical protein BRAFLDRAFT_84110 [Br...   174    1e-41  UniGene infoGene info
ref|NP_250705.1|  putative isovaleryl-CoA dehydrogenase [Pseud...   174    1e-41  Gene info
ref|ZP_03784607.1|  acyl-CoA dehydrogenase domain protein [Bru...   174    1e-41 
ref|YP_622996.1|  acyl-CoA dehydrogenase-like [Burkholderia ce...   174    1e-41  Gene info
ref|ZP_01365361.1|  hypothetical protein PaerPA_01002483 [Pseu...   174    1e-41 
ref|ZP_04105025.1|  Acyl-CoA dehydrogenase [Bacillus thuringie...   174    1e-41 
ref|ZP_04219949.1|  Acyl-CoA dehydrogenase [Bacillus cereus Ro...   174    1e-41 
ref|ZP_01000711.1|  isovaleryl-CoA dehydrogenase [Oceanicola b...   174    1e-41 
ref|YP_002235036.1|  putative acyl-CoA dehydrogenase [Burkhold...   174    1e-41  Gene info
ref|ZP_01707039.1|  acyl-CoA dehydrogenase-like [Shewanella pu...   174    1e-41 
ref|YP_776472.1|  acyl-CoA dehydrogenase domain-containing pro...   174    2e-41  Gene info
ref|ZP_01617606.1|  Acyl-CoA dehydrogenase [marine gamma prote...   173    2e-41 
ref|XP_002042630.1|  GM14915 [Drosophila sechellia] >gb|EDW465...   173    2e-41  Gene info
gb|AAL13543.1|  GH07925p [Drosophila melanogaster]                  173    2e-41 
ref|YP_001203576.1|  isovaleryl-CoA dehydrogenase [Bradyrhizob...   173    2e-41  Gene info
ref|ZP_00960459.1|  isovaleryl-CoA dehydrogenase [Roseovarius ...   173    2e-41 
ref|ZP_00056429.1|  COG1960: Acyl-CoA dehydrogenases [Magnetos...   173    2e-41 
ref|YP_005521.1|  acyl-CoA dehydrogenase [Thermus thermophilus...   173    2e-41  Gene info
ref|YP_001377044.1|  acyl-CoA dehydrogenase domain-containing ...   173    2e-41  Gene info
ref|YP_002752702.1|  acyl-CoA dehydrogenase [Bacillus cereus 0...   173    2e-41  Gene info
ref|NP_717505.1|  isovaleryl-CoA dehydrogenase [Shewanella one...   173    2e-41  Gene info
ref|YP_001312118.1|  acyl-CoA dehydrogenase domain-containing ...   173    2e-41  Gene info
ref|YP_001267602.1|  acyl-CoA dehydrogenase domain-containing ...   173    2e-41  Gene info
ref|ZP_02889663.1|  acyl-CoA dehydrogenase domain protein [Bur...   173    2e-41 
ref|YP_360557.1|  acyl-CoA dehydrogenase, short-chain specific...   173    2e-41  Gene info
ref|YP_001115948.1|  isovaleryl-CoA dehydrogenase [Burkholderi...   173    2e-41  Gene info

>ref|ZP_01879555.1|  glutaryl-CoA dehydrogenase [Roseovarius sp. TM1035]
 gb|EDM31899.1|  glutaryl-CoA dehydrogenase [Roseovarius sp. TM1035]
Length=407

 Score =  456 bits (1174),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 214/298 (71%), Positives = 247/298 (82%), Gaps = 0/298 (0%)

Query  3    LSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSGY  62
            L  RV  AY EE +D  IFK MG+ GLLG TIPEE+GGLGANYVTYGL+ REIE+VDSGY
Sbjct  50   LQPRVIAAYREERVDPDIFKEMGQMGLLGTTIPEEYGGLGANYVTYGLVAREIERVDSGY  109

Query  63   RSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKAKK  122
            RSMMSVQSSLVMYPI  +GS+EQ+ KYLP LASG+ IGCFGLTE ++GSDPA M T+A +
Sbjct  110  RSMMSVQSSLVMYPIYAYGSEEQRRKYLPGLASGDLIGCFGLTEPDAGSDPAGMKTRAVR  169

Query  123  VNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLSLR  182
              GG+ L GSKMWISN+PIADVFV+WAKSE H+ KI+GFILEK  KGL   K+ GKLSLR
Sbjct  170  TTGGYRLTGSKMWISNSPIADVFVVWAKSEAHDGKIRGFILEKGMKGLSAPKVGGKLSLR  229

Query  183  ASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYGL  242
            ASVTGEI  +NV VPE  +L +V+GLKGPF CLN ARYGIAWG MG+AEFCWHA+R YGL
Sbjct  230  ASVTGEIVMDNVEVPESALLPNVQGLKGPFGCLNRARYGIAWGVMGSAEFCWHASRQYGL  289

Query  243  SRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
             RKQFN+PLA TQLFQ KLA+MQTEI+LG+Q ALR+GRL+DE   APE IS++KRNNC
Sbjct  290  DRKQFNRPLAQTQLFQLKLANMQTEITLGLQAALRVGRLMDEANAAPEMISMIKRNNC  347


>ref|YP_001313401.1| Gene info acyl-CoA dehydrogenase domain-containing protein [Sinorhizobium 
medicae WSM419]
 gb|ABR63468.1| Gene info acyl-CoA dehydrogenase domain protein [Sinorhizobium medicae 
WSM419]
Length=395

 GENE ID: 5318128 Smed_4671 | acyl-CoA dehydrogenase domain-containing protein
[Sinorhizobium medicae WSM419]

 Score =  455 bits (1171),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 212/300 (70%), Positives = 251/300 (83%), Gaps = 0/300 (0%)

Query  1    KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDS  60
            ++L  RV  AY EE  D  IF+ MG+ GLLG T+P+ +GG+GA+YV YGL+ RE+E+VDS
Sbjct  36   EKLQPRVIEAYREETTDPAIFREMGDLGLLGVTVPDSYGGVGASYVAYGLVAREVERVDS  95

Query  61   GYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA  120
            GYRSMMSVQSSLV+YPI  +GS++QK KYLPKL SGE IGCFGLTE ++GSDPA M T+A
Sbjct  96   GYRSMMSVQSSLVVYPIYAYGSEDQKRKYLPKLISGEWIGCFGLTEPDAGSDPAGMKTRA  155

Query  121  KKVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLS  180
             +  GG+ L GSKMWISNAP+ADVFV+WAKSE H+N I+GF+LEK  KGL   KI GKLS
Sbjct  156  IRTEGGYRLIGSKMWISNAPLADVFVVWAKSEAHDNAIRGFVLEKGTKGLSAPKIAGKLS  215

Query  181  LRASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDY  240
            LRAS+TGEI  +NV V EE +L DVEGLKGPF CLN ARYGI+WGA+GAAEFCWHAAR Y
Sbjct  216  LRASITGEIVLDNVEVGEEALLPDVEGLKGPFGCLNRARYGISWGALGAAEFCWHAARQY  275

Query  241  GLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
            GL RKQFN+PLA TQLFQKKLADMQTEI+LG+QG+LR+GRL+DEGR APE IS++KRNNC
Sbjct  276  GLDRKQFNRPLAQTQLFQKKLADMQTEIALGLQGSLRVGRLMDEGRMAPEMISIVKRNNC  335


>ref|NP_437387.1| Gene info putative glutaryl-CoA dehydrogenase protein [Sinorhizobium meliloti 
1021]
 emb|CAC49247.1| Gene info putative glutaryl-CoA dehydrogenase protein [Sinorhizobium meliloti 
1021]
Length=395

 GENE ID: 1237178 SM_b21181 | putative glutaryl-CoA dehydrogenase protein
[Sinorhizobium meliloti 1021] (10 or fewer PubMed links)

 Score =  454 bits (1169),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 251/300 (83%), Gaps = 0/300 (0%)

Query  1    KELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDS  60
            ++L  RV  AY EE  D  IF+ MG+ GLLG T+P+ +GG+GA+YV YGL+ RE+E+VDS
Sbjct  36   EKLQPRVTEAYREETTDPSIFREMGDLGLLGVTVPDTYGGVGASYVAYGLVAREVERVDS  95

Query  61   GYRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKA  120
            GYRSMMSVQSSLV+YPI  +GS+EQK KYLPKL SGE IGCFGLTE ++GSDPA M T+A
Sbjct  96   GYRSMMSVQSSLVIYPIFAYGSEEQKRKYLPKLISGEWIGCFGLTEPDAGSDPAGMKTRA  155

Query  121  KKVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLS  180
             K  GG+ L GSKMWISNAP+ADVFV+WAKSE H+N I+GF+LEK  KGL   KI GKLS
Sbjct  156  IKTEGGYRLVGSKMWISNAPLADVFVVWAKSEAHDNAIRGFVLEKGAKGLSAPKIGGKLS  215

Query  181  LRASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDY  240
            LRAS+TGEI  +NV V EE +L +VEGLKGPF CLN ARYGI+WGA+GAAEFCWHAAR Y
Sbjct  216  LRASITGEIVLDNVEVGEEALLPNVEGLKGPFGCLNRARYGISWGALGAAEFCWHAARQY  275

Query  241  GLSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
            GL RKQFN+PLA TQLFQKKLADMQTEI+LG+QG+LR+GRL+DEGR APE IS++KRNNC
Sbjct  276  GLDRKQFNRPLAQTQLFQKKLADMQTEIALGLQGSLRVGRLMDEGRMAPEMISIVKRNNC  335


>ref|ZP_01002876.1|  putative acyl-CoA dehydrogenase [Loktanella vestfoldensis SKA53]
 gb|EAQ07252.1|  putative acyl-CoA dehydrogenase [Loktanella vestfoldensis SKA53]
Length=407

 Score =  451 bits (1160),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 242/299 (80%), Gaps = 0/299 (0%)

Query  2    ELSVRVERAYNEEIIDEGIFKLMGETGLLGCTIPEEFGGLGANYVTYGLITREIEKVDSG  61
            +L  RV  AY + ++   IF LMGE GLLG TIPEE+GGLGA YVTYGL+ REIE+VDSG
Sbjct  49   KLQPRVTAAYRDALVAPEIFTLMGEAGLLGLTIPEEYGGLGAGYVTYGLVAREIERVDSG  108

Query  62   YRSMMSVQSSLVMYPISKFGSQEQKEKYLPKLASGESIGCFGLTEANSGSDPASMTTKAK  121
            YRSMMSVQSSLVMYPI  +GS  Q+EKYLP LA+G  IGCFGLTE ++GSDPA M T AK
Sbjct  109  YRSMMSVQSSLVMYPIHAYGSDAQREKYLPGLAAGTLIGCFGLTEPDAGSDPAGMKTTAK  168

Query  122  KVNGGFELNGSKMWISNAPIADVFVIWAKSEFHENKIKGFILEKNFKGLETKKIPGKLSL  181
            K  GG+ LNGSKMWISNAPIADVFV+WAKSE H  KI+GF+L+K  KGL   K+ GKLSL
Sbjct  169  KTAGGYVLNGSKMWISNAPIADVFVVWAKSEAHGGKIRGFVLDKGMKGLSAPKVGGKLSL  228

Query  182  RASVTGEISFNNVFVPEENILEDVEGLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYG  241
            RASVTGEI  +NV V E+ +L  V+GLKGPF CLN ARYGIAWG MGAAE CWHAAR YG
Sbjct  229  RASVTGEIVMDNVEVGEDALLPGVQGLKGPFGCLNRARYGIAWGVMGAAEACWHAARQYG  288

Query  242  LSRKQFNKPLAGTQLFQKKLADMQTEISLGIQGALRLGRLIDEGRGAPEAISLMKRNNC  300
            L RKQF KPLA TQLFQKKLADMQTEI+LG Q AL+LGRL++ GR APE ISLMKRNNC
Sbjct  289  LDRKQFGKPLAQTQLFQKKLADMQTEIALGTQAALQLGRLMETGRAAPEMISLMKRNNC  347

[...]

c) Resultat brut du dernier alignement du BLAST a 5000 sequences

>ref|ZP_06360151.1|  acyl-CoA dehydrogenase domain protein [Rhodopseudomonas palustris 
DX-1]
 gb|EFC23883.1|  acyl-CoA dehydrogenase domain protein [Rhodopseudomonas palustris 
DX-1]
Length=382

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 113/243 (46%), Gaps = 3/243 (1%)

Query  28   GLLGCTIPEEFGGLGANYVTYGLITREIEKVDSGYRSMMSVQSSLVMYPISKFGSQEQKE  87
            G+ G  I ++ GG         LI   +        + +S+ + +  + I  +GS  Q++
Sbjct  50   GIGGIYIRDDVGGSAMTRFDAALIFEALATGCPAVSAFISIHN-MAAWMIDSYGSDAQRQ  108

Query  88   KYLPKLASGESIGCFGLTEANSGSDPASMTTKAKKVNGGFELNGSKMWISNAPIADVFVI  147
            ++LPKL S E +  + LTE  SGSD A++ T+A +    + LNG K +IS A   D++V+
Sbjct  109  RWLPKLCSMEQVASYCLTEPGSGSDAAALRTRAVRDGDHYILNGQKQFISGAGANDLYVV  168

Query  148  WAKSEFH-ENKIKGFILEKNFKGLETKKIPGKLSLRASVTGEISFNNVFVPEENILEDVE  206
              ++       I   +++K+  GL       K+   A  T  + F N  VP  N L D  
Sbjct  169  MVRTGGDGPGGISTLVVDKDTPGLSFGANERKMGWNAQPTRTVIFENARVPVANRLGDEG  228

Query  207  -GLKGPFSCLNMARYGIAWGAMGAAEFCWHAARDYGLSRKQFNKPLAGTQLFQKKLADMQ  265
             G K   + L+  R  I   ++G A+        Y   RK F K L   Q  Q +LADM 
Sbjct  229  IGFKIAMAGLDGGRLNIGACSLGGAQAALDKTLAYMKERKAFGKRLDEFQALQFRLADMA  288

Query  266  TEI  268
            TE+
Sbjct  289  TEL  291