GOS 1237020

From Metagenes
Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_456
Annotathon code: GOS_1237020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2010
Username : Moroldo
Annotated on : 2010-07-27 13:33:51
  • Moroldo Clément
  • Szili Noemi

Contents

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_456 GOS_1237020 Genomic DNA
AAAACAGAGGATGGAAAAATAGTTCCAATGGACGTTAAAGTTGGAGACAAAGTTCTCTTTGGTAAGTGGTCTGGAACAGAAGTAAAAATTGATGGTAAAG
AATACAGCATAATGAAAGAGTCAGACATTATGGGTATTTCAACTGGTAAATAATTTAATAAAAGGAGTTAATTAATGTCTAAAATTGTCAAATTCGATTC
AGAAGCAAGATCAGCAATGCTTAAAGGGGTAGATATTCTTGCAAACACTGTCAAAACAACTTTAGGTCCAAAAGGTAGAAATGTAGTAATAGATAAATCA
TACGGAGCGCCTAGAACCACAAAAGATGGAGTTACAGTTGCTAAAGAAATAGATCTAGAAGATAAGTTTGAAAATATGGGAGCGCAAATGGTTAAGGAAG
TTGCTAGCAAAACTAATGATGAAGCTGGCGATGGAACAACTACTGCCACTATATTAGCACAAGCTATTGTCAAGGAAGGTTGTAAATATGTTACAGCTGG
AATGAATCCTATGGATGTGAAAAGAGGAATTGATGCTGCTGTAGAACAAGTAAAAGAAAAATTAATTTCATCTGCAAAAAAAGTAAAAGATAGTGACGAG
ATTGCACAAGTTGGAACAATTTCTGCAAATGGAGATAAAGAGATTGGTAACATGATTGCTAAAGCAATGCAGAAAGTTGGTAATGAAGGGGTAATTACAG
TCGAGGAAGCAAAAGGGATAGAAACTGAGCTCGATGTTGTTGAGGGTATGCAGTTTGATAGAGGATATCTGTCACCTTATTTCATTACTAATGGAGATAA
AATGACAACAGAATTAGAAAACCCACTTATTCTTCTTCATGAGAAAAAATAAACAATCTACAACCAATGGTTCCACTTTTA

Translation

[175 - 849/881]   direct strand
>GOS_1237020 Translation [175-849   direct strand]
MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVK
EGCKYVTAGMNPMDVKRGIDAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAKGIETELDVVEGMQFDRGYLS
PYFITNGDKMTTELENPLILLHEKK

Annotator commentaries

The sequence analysed is the second ORF in the 1st reading frame on the direct strand. This protein has been identified by InterPro and BLAST as a chaperonin either belonging to the 60kDa chaperonins (possibly 60kDa heat shock proteins), GroEL chaperonins (which are a subgroup of 60kDa chaperonins so is a little more specific as result) based on the slight differences on the gene. The BLAST gave a very high number of homologous sequences with very high scores showing that the type of protein encoded by the query sequence is widespread, this makes the results on function and biological process even more reliable. Chaperons are essential in all cellular organisms but it seems that our sequence has mainly the characteristics of those of procaryotes with a lower lmevel of resemblance to the eucaryotic members of the same protein superfamily.

InterPro gives also the clear biological process: cellular protein metabolic process (GO:0044267), and two molecular functions: protein binding (GO:0005515) and ATP binding (GO:0005524) - both corresponding to the chaperonin function. As the newly synthesized proteins fold, their sites of secondary bonds has to be preliminary covered by these chaperonine enzymes to prevent unwanted ligations from forming. With the chaperons attached at a given moment only certain sidechains are able to form bonds at strictly given positions establishing the secondary, functional structure of the molecule. Once these bonds are formed the other reactive chains released from the chaperonines can participate in a next step towards the final functional form. ATP is bound on an ATP-binding subunit of the protein and is necessary for binding on the potein being shaped and also for releasing it from the cage like binding structures of the chaperons.

Based on the tree constructed and the results of BLAST we can squarely place the analysed sequence in a-proteobacteria. The organism with the closes sequences to our query, Candidatus Pelagibacter (of order Rickettsiales) contains proteins with the three highest scores in the BLAST analyse followed by a relatively big gap, while on the tree they form a quite separated branch at a low class rooting point with a relatively high branch length, giving a distinct taxonomic group. Still because of not having a clear organisation of orders of a-proteobacteria, we can`t conclude that the analysed sequence belonged to Rickettsiales, this might be due to the lack of information and/or the high resemblance of the aligned sequences.

Still the problem of having a STOP codon at the end of our query sequence while all the aligned proteins are 2-3 times longer is disturbing. This could have been caused by a mistake in sequencing, most likely a change of an entire part of the sequence. An other possibility is that the genome or origin - unlike most other organisms with the same kind of protein - at this point has an internal noncoding or filling sequence or a characteristic part in its genome which can not be fully determined without knowing the origin of the sequence for sure.

Still the level of resemblance and the nature of the proteic domains leave no doubt in me that the ORF in question codes for at least a part of the protein type mentioned above and belongs to Alphaproteobacteria.



ORF finding

PROTOCOLE:


a) SMS ORFinder / strand direct / frames 1, 2 & 3 / min 60 AA / initiation 'any codon' / genetic code 'Standard'

b) SMS ORFinder / strand indirect / frames 1, 2 & 3 / min 60 AA / initiation 'any codon' / genetic code 'Standard'



ANALYSE DES RÉSULTATS:


SMS ORFinder offered the following ORFs:


a) on the strand direct: ORF 1 in frame 1 from base 172 to 852

no ORFs found in frame 2 & 3


b) on the strand indirect: ORF 1 in frame 1 from base 106 to 714

no ORFs found in frame 2

ORF 1 in frame 3 from base 111 to 314



The first ORF in the 1st frame of the direct strand is the longest so had been chosen as the subject of analyse.

I've marked the forst Methionine as the start codon so cut the first three bases from the sequence. This choice of the position of the initialisation was also confirmed by the double alignments by BLAST.

The ORF ends with a STP codon so eventually the last base before the codon stop is 3 bases from the end of the ORF.






RÉSULTATS BRUTS:

a)

>ORF number 1 in reading frame 1 on the direct strand extends from base 172 to base 852.
TTAATGTCTAAAATTGTCAAATTCGATTCAGAAGCAAGATCAGCAATGCTTAAAGGGGTA
GATATTCTTGCAAACACTGTCAAAACAACTTTAGGTCCAAAAGGTAGAAATGTAGTAATA
GATAAATCATACGGAGCGCCTAGAACCACAAAAGATGGAGTTACAGTTGCTAAAGAAATA
GATCTAGAAGATAAGTTTGAAAATATGGGAGCGCAAATGGTTAAGGAAGTTGCTAGCAAA
ACTAATGATGAAGCTGGCGATGGAACAACTACTGCCACTATATTAGCACAAGCTATTGTC
AAGGAAGGTTGTAAATATGTTACAGCTGGAATGAATCCTATGGATGTGAAAAGAGGAATT
GATGCTGCTGTAGAACAAGTAAAAGAAAAATTAATTTCATCTGCAAAAAAAGTAAAAGAT
AGTGACGAGATTGCACAAGTTGGAACAATTTCTGCAAATGGAGATAAAGAGATTGGTAAC
ATGATTGCTAAAGCAATGCAGAAAGTTGGTAATGAAGGGGTAATTACAGTCGAGGAAGCA
AAAGGGATAGAAACTGAGCTCGATGTTGTTGAGGGTATGCAGTTTGATAGAGGATATCTG
TCACCTTATTTCATTACTAATGGAGATAAAATGACAACAGAATTAGAAAACCCACTTATT
CTTCTTCATGAGAAAAAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI
DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI
DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA
KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.




b)

>ORF number 1 in reading frame 1 on the reverse strand extends from base 106 to base 714.
GGTGACAGATATCCTCTATCAAACTGCATACCCTCAACAACATCGAGCTCAGTTTCTATC
CCTTTTGCTTCCTCGACTGTAATTACCCCTTCATTACCAACTTTCTGCATTGCTTTAGCA
ATCATGTTACCAATCTCTTTATCTCCATTTGCAGAAATTGTTCCAACTTGTGCAATCTCG
TCACTATCTTTTACTTTTTTTGCAGATGAAATTAATTTTTCTTTTACTTGTTCTACAGCA
GCATCAATTCCTCTTTTCACATCCATAGGATTCATTCCAGCTGTAACATATTTACAACCT
TCCTTGACAATAGCTTGTGCTAATATAGTGGCAGTAGTTGTTCCATCGCCAGCTTCATCA
TTAGTTTTGCTAGCAACTTCCTTAACCATTTGCGCTCCCATATTTTCAAACTTATCTTCT
AGATCTATTTCTTTAGCAACTGTAACTCCATCTTTTGTGGTTCTAGGCGCTCCGTATGAT
TTATCTATTACTACATTTCTACCTTTTGGACCTAAAGTTGTTTTGACAGTGTTTGCAAGA
ATATCTACCCCTTTAAGCATTGCTGATCTTGCTTCTGAATCGAATTTGACAATTTTAGAC
ATTAATTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
GDRYPLSNCIPSTTSSSVSIPFASSTVITPSLPTFCIALAIMLPISLSPFAEIVPTCAIS
SLSFTFFADEINFSFTCSTAASIPLFTSIGFIPAVTYLQPSLTIACANIVAVVVPSPASS
LVLLATSLTICAPIFSNLSSRSISLATVTPSFVVLGAPYDLSITTFLPFGPKVVLTVFAR
ISTPLSIADLASESNLTILDIN*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 111 to base 314.
CAGATATCCTCTATCAAACTGCATACCCTCAACAACATCGAGCTCAGTTTCTATCCCTTT
TGCTTCCTCGACTGTAATTACCCCTTCATTACCAACTTTCTGCATTGCTTTAGCAATCAT
GTTACCAATCTCTTTATCTCCATTTGCAGAAATTGTTCCAACTTGTGCAATCTCGTCACT
ATCTTTTACTTTTTTTGCAGATGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
QISSIKLHTLNNIELSFYPFCFLDCNYPFITNFLHCFSNHVTNLFISICRNCSNLCNLVT
IFYFFCR*

Multiple Alignement

PROTOCOLE:

MUSCLE (3.7) multiple sequence alignment

Run on the query sequence GOS_1237020 and the in- and out-groups shown above.

then Curation with GBlocks



ANALYSE DES RÉSULTATS:


On the aligned parts the alignement is almost perfect, in most places we see matching or highly resembling amino acids, with also a number of differences showing mutations in the query sequence that give us enough informations to proceed to the tree-constructing step.

The aligned sequence starts where the shortest of the homologs (a few amino acids after the start of our GOS sequence) and lasts until the last amino acid of our ORF so every amino acid of it is at least in close resemblance with those of the other sequences being aligned. In most cases we see almost perfect identity between most of the sequences or only a small degree or variation which suggets that our protein is very well conserved. Still at ceratin points the different taxa given as in and out groups possess different amino acids that are identic in the group itself which helps distinguishing between these grouops and placing our query in a right place on the tree.

When observing the alignments though we see the same problem mentioned above at the BLAST results: our sequence starts at the 31th amino acid of the most aligned sequences and ends hundreds of amino acids earlier. Interesting point that the following amino acid in almost all aligned sequences is a leucin that can be coded by codons differing in only one base from a codon stop (codes given on DNA, not mRNA!):

Leu: TTA STOP: TGA, TAA

TTG TAG

(CTT

CTC,

CTA,

CTG,

TTG)

So even one base mis-sequencing could have caused the appearance of an end codon in our analysed sequence.

Even after our query sequence has ended, the other in- and out-group sequences keep the very high resemblance to each other.

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|9450071      -MAKDVKFGDSARSKMLKGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|438206|      MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI
gi|1340471      MAAKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
gi|2124131      MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
gi|2552593      MAAKDVKFHDAARAKMVVGVNILADAVKVTLGPKGRNVVLDRSYGSPTITKDGVSVAKEI
gi|2567586      MAAKDVIFGADARARMVEGVNILANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
gi|8270346      MAAKEVKFSDSARHKMVNGVNILADAVKVTLGPKGRNVVLERSYGSPTITKDGVSVAKEI
gi|5647606      MAAKEVKFGDSARDRMVAGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
gi|8571184      MAAKEVKFGNNARQRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|2269434      MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|2542933      MAAKLVHFGSEARNEMLEGVDILANAVKVTLGPKGRNVVIDKSFGAPRTTKDGVTVAKEI
gi|1496887      ------------------------------LGPKGRNVVIDKSYGAPRITKDGVSVAKEI
GOS_123702      -MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI
gi|8570955      MAAKDVKFSREAREGILKGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
gi|8719806      MAAKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|8359192      MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEI
gi|8449975      MSAKDVKFNTDARNKMLKGVNVLADAVKVTLGPKGRNVVLEKSFGSPRITKDGVSVAKEI
gi|8395057      MAAKDVKFDTDARNKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|2604257      MAAKDVKFDTDARTRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|2209207      MAAKDVRFASDARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI
gi|8470159      MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI
gi|1145691      MAAKDVLFGSDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI
gi|2544211      MAAKIVQFNTDARDKMLRGVNVLANAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEI
gi|1971066      MAAKDVYFSSDARDRMLRGVNTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEI
gi|5804033      MAAKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|1147058      MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|4947459      MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|1826787      MAAKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
gi|2179769      MAAKDVRFSSDARDRMLRGIDILNNAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI
gi|1542481      MAAKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
gi|1347218      MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
gi|2398349      MAAKEVKFHTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
                                              *********::.::*.*  *****:*****

gi|9450071      ELEDKFENMGAQMVKEVASQANDKAGDGTTTATVLAQAIINEGLKSVAAGMNPMDLKRGI
gi|438206|      ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI
gi|1340471      ELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGI
gi|2124131      ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI
gi|2552593      ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVQEGMKFVAAGMNPMDLKRGI
gi|2567586      ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI
gi|8270346      ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVKEGMKYVAAGMNPMDLKRGI
gi|5647606      ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI
gi|8571184      ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGVKAVAAGMNPMDLKRGI
gi|2269434      ELKDKFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
gi|2542933      ELENKFQNMGAQMVREVASKANDVAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGI
gi|1496887      DLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGI
GOS_123702      DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI
gi|8570955      ELKDKFENMGAQMLKEVASKTNDLAGDGTTTATVLGQAIAREGMTAVAAGMNPMDLKRGI
gi|8719806      ELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGI
gi|8359192      ELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGI
gi|8449975      ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI
gi|8395057      ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI
gi|2604257      ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI
gi|2209207      ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI
gi|8470159      ELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI
gi|1145691      ELADKFENMGAQMLREVASKTNDVAGDGTTTATVLAQSIVREGMKSVAAGMNPMDLKRGI
gi|2544211      ELEDAFENMGAQMIREVASKTNDKAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGI
gi|1971066      ELSDKFENLGAQLIREVASKTNDKAGDGTTTATVLAQAIVVEGLKSVAAGMNPMDLKRGV
gi|5804033      ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGI
gi|1147058      ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGI
gi|4947459      ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI
gi|1826787      ELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGI
gi|2179769      ELSDKFENLGAQLIREVASKQNDAAGDGTTTATILAASIVREGTKAVAAGLNPMDLKRGI
gi|1542481      ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI
gi|1347218      ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI
gi|2398349      ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI
                :* : ::*:***::.:***.  : *********:*. ::  ** . *::*:** *:***:

gi|9450071      DKATAAVVEELAKLSRPCTDSKNIAQVGTISANSDKTVGDLIAQAMEKVGKEGVITVEEG
gi|438206|      DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG
gi|1340471      DKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEG
gi|2124131      DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG
gi|2552593      DQAVIAAVAELKKISKPCTTTKEIAQVGSISANSDTVIGEKIAAAMEKVGKEGVITIEDG
gi|2567586      DKAVTTLVEQLKKASKPCSTSKEIAQVGSISANSDANVGQIIAEAMDKVGKEGVITVEDG
gi|8270346      DKAVVATVEELKKLSKPCTTGKEIAQVGSISANSDPEIGKIIADAMEKVGKEGVITVEDG
gi|5647606      DKAVIAVTEELKKLSKPCSTNKEIAQVGSISANSDADIGEIIAKSMDKVGKEGVITVEDG
gi|8571184      DKAVTAAVEELKKISQPCADSKAIAQVGTISANSDSTIGEIIAKAMDKVGQEGVITVEEG
gi|2269434      DKATIAIVAELKSLAKPCSDSKAIAQVGTISANSDESIGNIIAEAMNKVGKEGVITVEEG
gi|2542933      DKAVAEVVATLESNSKKVKTNEEIAQVGAISANGEREIGDMIAKAMEKVGNEGVITVEEA
gi|1496887      DSAVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA
GOS_123702      DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA
gi|8570955      DLATTKVVENLKARSKDVSGSEEIAQVGVISANGDREVGEKIAEAMEKVGKEGVITVEEA
gi|8719806      DIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEA
gi|8359192      DLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEA
gi|8449975      DLATSKVVEAIKSAARDVTDSDEVAQVGTISANGEASIGRMIADAMQKVGNEGVITVEEN
gi|8395057      DMATSKVVEAIKAAARDVTDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN
gi|2604257      DLATAKVVEAIKAAARPVNDTNEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN
gi|2209207      DLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEA
gi|8470159      DLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEES
gi|1145691      DKAVAIVMDDIKASSTPVKDSSEVAQVGTISANGASDIGEMIAKAMDKVGKEGVITVEEA
gi|2544211      DKAVTAVLADIKASAKKVENNSEIAQVGTISANGDAEVGEMIAKAMAKVGNEGVITVEEA
gi|1971066      DKAVAKVIEEIKATSKKVSANSEIAQVGTISANGDVEVGEMIARAMEKVGNEGVITVEEA
gi|5804033      DKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEA
gi|1147058      DAAIAKVVEALGEAARSIDTSDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEA
gi|4947459      DAAVEEVVGNLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA
gi|1826787      DHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEA
gi|2179769      DIAVAAVVADLKANSKKVTSNEEIAQVGTISANGDKSVGEMISTAMQKVGNEGVITVEEA
gi|1542481      DLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEA
gi|1347218      DKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEA
gi|2398349      DLAVDAVVKELKTNARKITSNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA
                * *       :   :        : *** ****.   :*  :: :* ***.*****:*: 

gi|9450071      QGLADELEVVEGMQFDRGYLSPYFINNQEKMNVELENPLILLADKKIDNLQEIIPLLENV
gi|438206|      KSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFEKKISNIRDLLPVLEKV
gi|1340471      SGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDPFILLHDKKISNVRDLLPILEGV
gi|2124131      SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV
gi|2552593      QGLEDELDIVEGMQFDRGYLSPYFINNADKQIAAMENPFILLHDKKISNIRDLLPLLEQV
gi|2567586      KSLENELDIVEGMQFDRGYLSPYFINNQDKQVAVLENPYVLLHDKKISNIRDLLPALEQV
gi|8270346      SGLQNELEVVEGMQFDRGYLSPYFINNADRQIALLESPFILLHDKKISNIRDLLPVLEQV
gi|5647606      KSLQNELDVVEGMQFDRGYLSPYFINNPDKQVAILENPFILLFDKKISNIRDLLPVLEQV
gi|8571184      QALQDELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLVDKKVSNIRELLPVLEGV
gi|2269434      SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEAV
gi|2542933      KSLETELDVVEGMQFDRGYLSPYFITDAEKMTVALDDPYILLHESKLTSLQPMLPILEAV
gi|1496887      KGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAV
GOS_123702      KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK--------------
gi|8570955      KGLEFELDVVEGMQFDRGYLSPYFITNPDKMQVELDNPYILIHEKKLSNLQAMLPVLEAA
gi|8719806      KGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSSLQAMLPILEAV
gi|8359192      KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAV
gi|8449975      KGMETEVDVVEGMQFDRGYLSPYFVTNPDKMLTELEDCMILLHEKKLSSLQPLVPLLESV
gi|8395057      KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCMILLHEKKLSSLQPMVPLLEQV
gi|2604257      KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPMVPLLESV
gi|2209207      KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV
gi|8470159      KTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILLHEKKLSNLQSMLPLLESA
gi|1145691      KSLETELDVVEGMQFDRGYLSPYFITDADKMQVEMEEPYILLFEKKLTSLQPMLPILEAV
gi|2544211      KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQAMLPILEAV
gi|1971066      KTAETELDVVEGMQFDRGYLSPYFITNAEKMEADLEEPLILLFEKKLSSLQPLLPVLEAV
gi|5804033      KGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSPYILIHEKKLSSLQPMLPLLESV
gi|1147058      KTAETELEVVEGMQFDRGYLSPYFVTNGEKMVAELEDAYILLHEKKLSNLQAMLPVLESV
gi|4947459      KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLDDPYILIHEKKLSNLQSLLPVLEAV
gi|1826787      KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAV
gi|2179769      KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPFILVHEKKLSSLQALLPVLEAV
gi|1542481      KTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAV
gi|1347218      KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAV
gi|2398349      KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV
                .    * .:**********:****:.. :   . ::.  :*: :.*              

gi|9450071      AKSGRPLLIVAEDVEGQALATLVVNTMRGTFKVAAVKAPGFGDRRKAMLQDIATLTGGKV
gi|438206|      AKASRPLLIIAENVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTV
gi|1340471      AKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDMAILTGGTV
gi|2124131      AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV
gi|2552593      AKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAVLTGGTV
gi|2567586      AKASRPLLIIAEDVEGEALATLVVNSIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGKV
gi|8270346      AKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTV
gi|5647606      AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTCSVKAPGFGDRRKAMLEDIAVLTGGQV
gi|8571184      SKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV
gi|2269434      AKSGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGATV
gi|2542933      VQSGKPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDISVLTGGTV
gi|1496887      VQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQV
GOS_123702      ------------------------------------------------------------
gi|8570955      VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM
gi|8719806      VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLGDIATLTAGEM
gi|8359192      VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|8449975      IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|8395057      IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|2604257      IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|2209207      VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM
gi|8470159      VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV
gi|1145691      VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDLAILTGGQV
gi|2544211      VQSGRPLVIIAEDIEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|1971066      VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQL
gi|5804033      VQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|1147058      VQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV
gi|4947459      VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV
gi|1826787      VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTL
gi|2179769      VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGTL
gi|1542481      VQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTV
gi|1347218      VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA
gi|2398349      VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV
                                                                            

gi|9450071      ISEEVGMSLETTSLEDLGTAKKVVIDKENTVMVGGAGSDADVTARCEQIRSEIETTTSDY
gi|438206|      ISEEVGLFLEKATLDNLGQAKRIEIGKENTTIIDGFGDAAQIEARFAEIRQQIETATSDY
gi|1340471      ISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTADIEARIKQIKAQIEETTSDY
gi|2124131      ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY
gi|2552593      IAEEVGLSLEKATLAEMGQAKRIEVGKENTTIIDGAGKHEAILGRVGEIKKLAEESTSDY
gi|2567586      IAEEVGLTLEKVTLADLGQAKRIEVGKENTIIIDGAGVAADIEARVKQIRIQIEEATSDY
gi|8270346      IAEEVGLSLEKATLAELGQAKRVEVGKEETTIIDGAGDTQNIEGRVKQIRAQIEEATSDY
gi|5647606      IAEEVGLTLEKATLAELGQAARIEIGKENTIIIDGAGEGSRIEGRVKQIRAQIEEATSDY
gi|8571184      VSEEIGMELEKTQLEDLGTAKRVVITKDNTTVVDGNGDDAAIEGRVTQIKQQMEETSSDY
gi|2269434      ISEEVGLSLESATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEETSSDY
gi|2542933      ISEDLGIKLENVSLEMLGTAKRVSITKDETVIVDGAGDKADIEGRVAQIRAQIENTTSEY
gi|1496887      ISEDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDY
GOS_123702      ------------------------------------------------------------
gi|8570955      ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVGEIRTQIDNTTSDY
gi|8719806      ISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAEEIKARVEQIRAQIEVTTSDY
gi|8359192      ISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDY
gi|8449975      ISEDLGMKLENVTMDMLGTAKKVSITKDETTIVDGNGDKAEIEARVSQINTQIQETTSDY
gi|8395057      ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY
gi|2604257      ISEDLGMKLENVTVDMLGSAKKVSITKDETTIVDGAGEKAEIEARVSQIRTQIEETTSDY
gi|2209207      IAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIKAQIEETTSDY
gi|8470159      VSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKDDIEGRTAQLRKQIEDTSSDY
gi|1145691      ISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIRRQSEETTSDY
gi|2544211      ISEDLGIKLENVTIDMLGKAKKVTITKDDTTIVDGVGGKEEIEARIGQIKRQIEDTTSDY
gi|1971066      ISEDLGIKLENVSLDMLGRAKKVTITKEDTTIVDGSGDKSGIEGRIAQIKKQIEDTTSDY
gi|5804033      ISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDY
gi|1147058      VSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIKAQIEETTSDY
gi|4947459      ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGKKAEINARVNQIKVQIEETTSDY
gi|1826787      ISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDY
gi|2179769      ISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIKSQIAETTSDY
gi|1542481      ISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDY
gi|1347218      ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDY
gi|2398349      ISEDLGIKLENVTLNMLGRAKRVAIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY
                                                                            

gi|9450071      DKEKLQERLAKLAGGVAVIKVGAGSEIEMKEKKDRVEDALQATRAAVEEGVVAGGGVALI
gi|438206|      DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRLEDALHATRAAVEEGVVAGGGVALL
gi|1340471      DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI
gi|2124131      DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|2552593      DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|2567586      DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL
gi|8270346      DKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|5647606      DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|8571184      DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|2269434      DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|2542933      DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
gi|1496887      DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALL
GOS_123702      ------------------------------------------------------------
gi|8570955      DREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
gi|8719806      DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
gi|8359192      DREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL
gi|8449975      DREKLQERVAKLAGGVAVIRVGGMTETEVKERKDRVDDALNATRAAVQEGVIVGGGVALV
gi|8395057      DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV
gi|2604257      DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV
gi|2209207      DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGTALL
gi|8470159      DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
gi|1145691      DREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
gi|2544211      DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL
gi|1971066      DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
gi|5804033      DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA
gi|1147058      DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL
gi|4947459      DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL
gi|1826787      DREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL
gi|2179769      DREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALL
gi|1542481      DREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL
gi|1347218      DKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL
gi|2398349      DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL
                                                                            

gi|9450071      RAISNVT-VTGDNEDQNVGIALALRAMEAPIRQIAYNAGDEASVVVDKVKSGEG-SFGYN
gi|438206|      RARAALENLHTGNADKDAGVQIVLRAVESSLRQIVANAGGEPSVVVNKVLEGKG-NYGYN
gi|1340471      RAKAAIAELKGANEDQNHGIAIALRAMEAPLREIVTNAGDEPSVVLNRVAEGTG-AFGYN
gi|2124131      RALVAVGDLKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEGTG-NYGYN
gi|2552593      RAKAAVAGLKGANHDQDAGITIVLRAMESPIRAITMNAGDEPSVVVNKVLEGKG-SFGYN
gi|2567586      RARQAVGEIKGDNHDQEAGIKIVLRAIEQPLREIVANSGGEPSVVINKVLEGKG-NFGFN
gi|8270346      RTRSAVSNLKGDNHDQDAGIKIVLRALEEPLRQIVANCGDEPSVVINKVLEGTE-NFGYN
gi|5647606      RARANLGTLKGDNHDQDAGIKIVLRALEQPLREIVANAGDEPSVVVNRVVEGTG-NFGYN
gi|8571184      RAASKLAELTGDNEEQNVGIRMMLRAMEAPLRQIAYNAGAEASVVANRVREGEG-NFGYN
gi|2269434      RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKVKQGSG-NFGFN
gi|2542933      RASSALK-VKGSNVDEQAGIDIVTKALQAPLRQIVQNAGVEGSVVVNAILADKSISYGFD
gi|1496887      YASQSLDTLKVKGDDQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYD
GOS_123702      ------------------------------------------------------------
gi|8570955      YATKVLEGLKGDNDDQTRGIDIVRRAIMAPVRQIAQNAGHDGAVVSGNLLREDNESQGFN
gi|8719806      YATKALEGLKGANDDQTKGIDIVRRAIQAPIRQIAANAGHDGAVVSGNLLRENDENQGFN
gi|8359192      HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYN
gi|8449975      QGGKALEGLTGANPDQEAGIAIVRRALEAPLRQIAENAGVDGAVVAGKVRESDDVKYGFN
gi|8395057      QAGKSLDGLEGANADQNAGIAIVRRAIEAPLRQIAENAGVDGAVVAGKVRESSDLSFGFN
gi|2604257      QGAKSLDGLEGANSDQNAGITIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN
gi|2209207      RARDAIKDLKSDNADVQAGIKIIVKALEAPIRQIAANAGVEGSIVVGKVSENGSATFGFD
gi|8470159      YAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENAGQEGSIVVGKLLEQDDTKFGFN
gi|1145691      KASAKLAGLEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPSATFGFN
gi|2544211      KATKALDGLTGDNADQTAGIAIIRRAIQAPIRQIVENAGVEGSIVVGKVLENSSATYGFN
gi|1971066      KASKVLDGFKGDNDDQEAGIAIVRRALQAPIRQISENAGVEGSIVVGKVLENASPTFGFN
gi|5804033      RASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFD
gi|1147058      RASNAVD-LKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESLSFGYN
gi|4947459      RAANALA-IKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYN
gi|1826787      RAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYN
gi|2179769      RAIKALEGLTVENADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYN
gi|1542481      RSIKALEGLKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYN
gi|1347218      RAAKALDSVQAENEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWN
gi|2398349      RAVKALEGLPIANDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTDFSYGWN
                                                                            

gi|9450071      ASTGEYGDMIELGIIDPTKVTRSSLQAAASVGGLMITTEAMVADIPEENGGA-------P
gi|438206|      AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPENKPAM-------P
gi|1340471      AANGEFGDMIEFGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKEEPA------AP
gi|2124131      AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKDEPA------LP
gi|2552593      ASSSEYGDMLVMGVVDPTKVTRVALQNAASIAGLMLTTACMVAELPEDKPAG---GMGGG
gi|2567586      AANDTYGDMLEMGIIDPTKVTRTALQNAASVAGLMLTTECMVAEAPKDESAP-----AMP
gi|8270346      AASSEYGDMVQMGVLDPTKVTRYALQHAASIAGLMLTTDALVAEVPKEEGAGGGMGGGMG
gi|5647606      AATGEYGDLVDMGVLDPTKVERIALQNAASVAGLMLTTDCMVGELAEEKPSM----GGMG
gi|8571184      AGNDTYGDMLEMGILDPTKVTRSALQFAASVGSLMITTEAMVAEIPKDDESA----GGMG
gi|2269434      AASGVYGDMIEMGILDPAKVTRSALQAASSIGGLMITTEAMVADIVEDKAAP-----AMP
gi|2542933      AQKEEYCDLVAAGIIDPTKVVRSSLQNAASIASLIITTEAAICDAPVKDAPA---GGGMP
gi|1496887      AQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPHNKDSG--------
GOS_123702      ------------------------------------------------------------
gi|8570955      AATDTYEDLVKAGVIDPTKVVRTALQDAASVAGLLITTEAAITDAPEDDKAA----PAMP
gi|8719806      AATDTYENLKAAGVIDPTKVVRTALQDAASVSGLLITTEAAISEKPDDKPAM------PP
gi|8359192      AQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAM-----PSP
gi|8449975      AQTEEYGDMFKFGVIDPAKVVRTALEDAASISGLLITTEAMVADKPQKEGAG-AAAGGMP
gi|8395057      AQTEEYGDMFKFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPAKEGAG--AGGGMP
gi|2604257      AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQKDAPA---GGGMP
gi|2209207      AQTETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKEAPP-----AMP
gi|8470159      AQTEEYGNLLDMGIVDPAKVVRHALQDAASVAGLLITTEAMIAEAPKKDSGG--AGGGMP
gi|1145691      AQTEEYGDMLAFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKEEGAG----GGMP
gi|2544211      AQTEEYGDLVAMGVIDPAKVVRTALTDAASVASILITTEAAVADAPKKGGSS------AP
gi|1971066      AQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAIVEAPKKGGAG-------G
gi|5804033      AQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPEKKAPA--------
gi|1147058      AQTGEYGDMIQMGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPKKDNGG--GGMPAG
gi|4947459      TATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDTPM--PPMPG-
gi|1826787      AQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAPL--PPMGG-
gi|2179769      AQTDEYGDLVKLGIIDPTKVVRTALQDAASVGGLLITTEAIIAEQPKKDSPA------MP
gi|1542481      AQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNAPA------AP
gi|1347218      AQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKKEPAV-------P
gi|2398349      AQTGEYGDLYAQGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKEAT---------
                                                                            

gi|9450071      DMGGM-GGMGGM-PGMM
gi|438206|      DMGGM-GGMGGM----M
gi|1340471      G-GGM-GGMGGM-D--F
gi|2124131      AGGGM-GGMGGM-D--F
gi|2552593      DMGGM-GGMGGM----M
gi|2567586      G-GGM-GGMGDM-G--M
gi|8270346      GMGGM-GGMGGM-D--M
gi|5647606      GMGGM-GGMGGM-DMGM
gi|8571184      DMGGM-GGMGGM----M
gi|2269434      DMGGM-GGMGGM----M
gi|2542933      DMGGM-GGMGGMGGMGF
gi|1496887      -AGGMPGGM--------
GOS_123702      -----------------
gi|8570955      DMGGM-GGMGGMGG--F
gi|8719806      MGGGM-GGMGGM-D--F
gi|8359192      DMGGM-GGMGGM-G--F
gi|8449975      DMGGM-GGM-------M
gi|8395057      DMGGM-GGM-------M
gi|2604257      DMGGM-GGM-------M
gi|2209207      GGGGM-GGMD------F
gi|8470159      DMGGM-GGM-------M
gi|1145691      DMGGM-GGMGGM-GGMM
gi|2544211      DMGGM-GGMGGM-D--F
gi|1971066      APGGMPGGMGDM-D--F
gi|5804033      --AAP-GGMGDM-D--F
gi|1147058      GMGGM-GGMGGM-D--F
gi|4947459      --GGM-GGMGGM-D--F
gi|1826787      --GGM-GGMGGM-D--F
gi|2179769      GGGGM-GGMGGM-D--F
gi|1542481      AMPG--GGMD------F
gi|1347218      AMPA--GGMD------F
gi|2398349      --PAL-PASAGM-D--F
                                 




Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 32
Alignment assumed to be: Protein
New number of positions: 196 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  -MAKDVKFGDSARSKMLKGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|438206|emb|C  MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI
gi|134047129|re  MAAKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
gi|21241313|ref  MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
gi|255259323|re  MAAKDVKFHDAARAKMVVGVNILADAVKVTLGPKGRNVVLDRSYGSPTITKDGVSVAKEI
gi|256758655|re  MAAKDVIFGADARARMVEGVNILANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
gi|82703461|ref  MAAKEVKFSDSARHKMVNGVNILADAVKVTLGPKGRNVVLERSYGSPTITKDGVSVAKEI
gi|56476061|ref  MAAKEVKFGDSARDRMVAGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
gi|85711845|ref  MAAKEVKFGNNARQRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|226943476|re  MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
gi|254293331|re  MAAKLVHFGSEARNEMLEGVDILANAVKVTLGPKGRNVVIDKSFGAPRTTKDGVTVAKEI
gi|149688742|gb  ------------------------------LGPKGRNVVIDKSYGAPRITKDGVSVAKEI
GOS_1237020_Tra  -MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI
gi|85709559|ref  MAAKDVKFSREAREGILKGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
gi|87198061|ref  MAAKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|83591926|ref  MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEI
gi|84499753|ref  MSAKDVKFNTDARNKMLKGVNVLADAVKVTLGPKGRNVVLEKSFGSPRITKDGVSVAKEI
gi|83950579|ref  MAAKDVKFDTDARNKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|260425778|re  MAAKDVKFDTDARTRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|220920707|re  MAAKDVRFASDARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI
gi|84701593|ref  MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI
gi|114569155|re  MAAKDVLFGSDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI
gi|254421167|re  MAAKIVQFNTDARDKMLRGVNVLANAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEI
gi|197106643|re  MAAKDVYFSSDARDRMLRGVNTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEI
gi|58040332|ref  MAAKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
gi|114705804|re  MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|49474597|ref  MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
gi|182678711|re  MAAKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
gi|217976980|re  MAAKDVRFSSDARDRMLRGIDILNNAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI
gi|154248184|re  MAAKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
gi|13472184|ref  MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
gi|239834971|re  MAAKEVKFHTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
                                               ##############################


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  ELEDKFENMGAQMVKEVASQANDKAGDGTTTATVLAQAIINEGLKSVAAGMNPMDLKRGI
gi|438206|emb|C  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI
gi|134047129|re  ELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGI
gi|21241313|ref  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI
gi|255259323|re  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVQEGMKFVAAGMNPMDLKRGI
gi|256758655|re  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI
gi|82703461|ref  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVKEGMKYVAAGMNPMDLKRGI
gi|56476061|ref  ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI
gi|85711845|ref  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGVKAVAAGMNPMDLKRGI
gi|226943476|re  ELKDKFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
gi|254293331|re  ELENKFQNMGAQMVREVASKANDVAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGI
gi|149688742|gb  DLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGI
GOS_1237020_Tra  DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI
gi|85709559|ref  ELKDKFENMGAQMLKEVASKTNDLAGDGTTTATVLGQAIAREGMTAVAAGMNPMDLKRGI
gi|87198061|ref  ELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGI
gi|83591926|ref  ELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGI
gi|84499753|ref  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI
gi|83950579|ref  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI
gi|260425778|re  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI
gi|220920707|re  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI
gi|84701593|ref  ELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI
gi|114569155|re  ELADKFENMGAQMLREVASKTNDVAGDGTTTATVLAQSIVREGMKSVAAGMNPMDLKRGI
gi|254421167|re  ELEDAFENMGAQMIREVASKTNDKAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGI
gi|197106643|re  ELSDKFENLGAQLIREVASKTNDKAGDGTTTATVLAQAIVVEGLKSVAAGMNPMDLKRGV
gi|58040332|ref  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGI
gi|114705804|re  ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGI
gi|49474597|ref  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI
gi|182678711|re  ELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGI
gi|217976980|re  ELSDKFENLGAQLIREVASKQNDAAGDGTTTATILAASIVREGTKAVAAGLNPMDLKRGI
gi|154248184|re  ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI
gi|13472184|ref  ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI
gi|239834971|re  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI
                 ############################################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  DKATAAVVEELAKLSRPCTDSKNIAQVGTISANSDKTVGDLIAQAMEKVGKEGVITVEEG
gi|438206|emb|C  DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG
gi|134047129|re  DKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEG
gi|21241313|ref  DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG
gi|255259323|re  DQAVIAAVAELKKISKPCTTTKEIAQVGSISANSDTVIGEKIAAAMEKVGKEGVITIEDG
gi|256758655|re  DKAVTTLVEQLKKASKPCSTSKEIAQVGSISANSDANVGQIIAEAMDKVGKEGVITVEDG
gi|82703461|ref  DKAVVATVEELKKLSKPCTTGKEIAQVGSISANSDPEIGKIIADAMEKVGKEGVITVEDG
gi|56476061|ref  DKAVIAVTEELKKLSKPCSTNKEIAQVGSISANSDADIGEIIAKSMDKVGKEGVITVEDG
gi|85711845|ref  DKAVTAAVEELKKISQPCADSKAIAQVGTISANSDSTIGEIIAKAMDKVGQEGVITVEEG
gi|226943476|re  DKATIAIVAELKSLAKPCSDSKAIAQVGTISANSDESIGNIIAEAMNKVGKEGVITVEEG
gi|254293331|re  DKAVAEVVATLESNSKKVKTNEEIAQVGAISANGEREIGDMIAKAMEKVGNEGVITVEEA
gi|149688742|gb  DSAVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA
GOS_1237020_Tra  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA
gi|85709559|ref  DLATTKVVENLKARSKDVSGSEEIAQVGVISANGDREVGEKIAEAMEKVGKEGVITVEEA
gi|87198061|ref  DIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEA
gi|83591926|ref  DLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEA
gi|84499753|ref  DLATSKVVEAIKSAARDVTDSDEVAQVGTISANGEASIGRMIADAMQKVGNEGVITVEEN
gi|83950579|ref  DMATSKVVEAIKAAARDVTDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN
gi|260425778|re  DLATAKVVEAIKAAARPVNDTNEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN
gi|220920707|re  DLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEA
gi|84701593|ref  DLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEES
gi|114569155|re  DKAVAIVMDDIKASSTPVKDSSEVAQVGTISANGASDIGEMIAKAMDKVGKEGVITVEEA
gi|254421167|re  DKAVTAVLADIKASAKKVENNSEIAQVGTISANGDAEVGEMIAKAMAKVGNEGVITVEEA
gi|197106643|re  DKAVAKVIEEIKATSKKVSANSEIAQVGTISANGDVEVGEMIARAMEKVGNEGVITVEEA
gi|58040332|ref  DKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEA
gi|114705804|re  DAAIAKVVEALGEAARSIDTSDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEA
gi|49474597|ref  DAAVEEVVGNLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA
gi|182678711|re  DHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEA
gi|217976980|re  DIAVAAVVADLKANSKKVTSNEEIAQVGTISANGDKSVGEMISTAMQKVGNEGVITVEEA
gi|154248184|re  DLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEA
gi|13472184|ref  DKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEA
gi|239834971|re  DLAVDAVVKELKTNARKITSNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA
                 ############################################################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  QGLADELEVVEGMQFDRGYLSPYFINNQEKMNVELENPLILLADKKIDNLQEIIPLLENV
gi|438206|emb|C  KSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFEKKISNIRDLLPVLEKV
gi|134047129|re  SGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDPFILLHDKKISNVRDLLPILEGV
gi|21241313|ref  SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV
gi|255259323|re  QGLEDELDIVEGMQFDRGYLSPYFINNADKQIAAMENPFILLHDKKISNIRDLLPLLEQV
gi|256758655|re  KSLENELDIVEGMQFDRGYLSPYFINNQDKQVAVLENPYVLLHDKKISNIRDLLPALEQV
gi|82703461|ref  SGLQNELEVVEGMQFDRGYLSPYFINNADRQIALLESPFILLHDKKISNIRDLLPVLEQV
gi|56476061|ref  KSLQNELDVVEGMQFDRGYLSPYFINNPDKQVAILENPFILLFDKKISNIRDLLPVLEQV
gi|85711845|ref  QALQDELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLVDKKVSNIRELLPVLEGV
gi|226943476|re  SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEAV
gi|254293331|re  KSLETELDVVEGMQFDRGYLSPYFITDAEKMTVALDDPYILLHESKLTSLQPMLPILEAV
gi|149688742|gb  KGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAV
GOS_1237020_Tra  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK--------------
gi|85709559|ref  KGLEFELDVVEGMQFDRGYLSPYFITNPDKMQVELDNPYILIHEKKLSNLQAMLPVLEAA
gi|87198061|ref  KGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSSLQAMLPILEAV
gi|83591926|ref  KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAV
gi|84499753|ref  KGMETEVDVVEGMQFDRGYLSPYFVTNPDKMLTELEDCMILLHEKKLSSLQPLVPLLESV
gi|83950579|ref  KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCMILLHEKKLSSLQPMVPLLEQV
gi|260425778|re  KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPMVPLLESV
gi|220920707|re  KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV
gi|84701593|ref  KTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILLHEKKLSNLQSMLPLLESA
gi|114569155|re  KSLETELDVVEGMQFDRGYLSPYFITDADKMQVEMEEPYILLFEKKLTSLQPMLPILEAV
gi|254421167|re  KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQAMLPILEAV
gi|197106643|re  KTAETELDVVEGMQFDRGYLSPYFITNAEKMEADLEEPLILLFEKKLSSLQPLLPVLEAV
gi|58040332|ref  KGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSPYILIHEKKLSSLQPMLPLLESV
gi|114705804|re  KTAETELEVVEGMQFDRGYLSPYFVTNGEKMVAELEDAYILLHEKKLSNLQAMLPVLESV
gi|49474597|ref  KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLDDPYILIHEKKLSNLQSLLPVLEAV
gi|182678711|re  KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAV
gi|217976980|re  KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPFILVHEKKLSSLQALLPVLEAV
gi|154248184|re  KTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAV
gi|13472184|ref  KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAV
gi|239834971|re  KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV
                 ##############################################              


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  AKSGRPLLIVAEDVEGQALATLVVNTMRGTFKVAAVKAPGFGDRRKAMLQDIATLTGGKV
gi|438206|emb|C  AKASRPLLIIAENVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTV
gi|134047129|re  AKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDMAILTGGTV
gi|21241313|ref  AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV
gi|255259323|re  AKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAVLTGGTV
gi|256758655|re  AKASRPLLIIAEDVEGEALATLVVNSIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGKV
gi|82703461|ref  AKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTV
gi|56476061|ref  AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTCSVKAPGFGDRRKAMLEDIAVLTGGQV
gi|85711845|ref  SKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV
gi|226943476|re  AKSGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGATV
gi|254293331|re  VQSGKPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDISVLTGGTV
gi|149688742|gb  VQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQV
GOS_1237020_Tra  ------------------------------------------------------------
gi|85709559|ref  VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM
gi|87198061|ref  VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLGDIATLTAGEM
gi|83591926|ref  VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|84499753|ref  IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|83950579|ref  IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|260425778|re  IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
gi|220920707|re  VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM
gi|84701593|ref  VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV
gi|114569155|re  VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDLAILTGGQV
gi|254421167|re  VQSGRPLVIIAEDIEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|197106643|re  VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQL
gi|58040332|ref  VQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV
gi|114705804|re  VQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV
gi|49474597|ref  VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV
gi|182678711|re  VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTL
gi|217976980|re  VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGTL
gi|154248184|re  VQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTV
gi|13472184|ref  VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA
gi|239834971|re  VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  ISEEVGMSLETTSLEDLGTAKKVVIDKENTVMVGGAGSDADVTARCEQIRSEIETTTSDY
gi|438206|emb|C  ISEEVGLFLEKATLDNLGQAKRIEIGKENTTIIDGFGDAAQIEARFAEIRQQIETATSDY
gi|134047129|re  ISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTADIEARIKQIKAQIEETTSDY
gi|21241313|ref  ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY
gi|255259323|re  IAEEVGLSLEKATLAEMGQAKRIEVGKENTTIIDGAGKHEAILGRVGEIKKLAEESTSDY
gi|256758655|re  IAEEVGLTLEKVTLADLGQAKRIEVGKENTIIIDGAGVAADIEARVKQIRIQIEEATSDY
gi|82703461|ref  IAEEVGLSLEKATLAELGQAKRVEVGKEETTIIDGAGDTQNIEGRVKQIRAQIEEATSDY
gi|56476061|ref  IAEEVGLTLEKATLAELGQAARIEIGKENTIIIDGAGEGSRIEGRVKQIRAQIEEATSDY
gi|85711845|ref  VSEEIGMELEKTQLEDLGTAKRVVITKDNTTVVDGNGDDAAIEGRVTQIKQQMEETSSDY
gi|226943476|re  ISEEVGLSLESATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEETSSDY
gi|254293331|re  ISEDLGIKLENVSLEMLGTAKRVSITKDETVIVDGAGDKADIEGRVAQIRAQIENTTSEY
gi|149688742|gb  ISEDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDY
GOS_1237020_Tra  ------------------------------------------------------------
gi|85709559|ref  ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVGEIRTQIDNTTSDY
gi|87198061|ref  ISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAEEIKARVEQIRAQIEVTTSDY
gi|83591926|ref  ISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDY
gi|84499753|ref  ISEDLGMKLENVTMDMLGTAKKVSITKDETTIVDGNGDKAEIEARVSQINTQIQETTSDY
gi|83950579|ref  ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY
gi|260425778|re  ISEDLGMKLENVTVDMLGSAKKVSITKDETTIVDGAGEKAEIEARVSQIRTQIEETTSDY
gi|220920707|re  IAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIKAQIEETTSDY
gi|84701593|ref  VSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKDDIEGRTAQLRKQIEDTSSDY
gi|114569155|re  ISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIRRQSEETTSDY
gi|254421167|re  ISEDLGIKLENVTIDMLGKAKKVTITKDDTTIVDGVGGKEEIEARIGQIKRQIEDTTSDY
gi|197106643|re  ISEDLGIKLENVSLDMLGRAKKVTITKEDTTIVDGSGDKSGIEGRIAQIKKQIEDTTSDY
gi|58040332|ref  ISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDY
gi|114705804|re  VSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIKAQIEETTSDY
gi|49474597|ref  ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGKKAEINARVNQIKVQIEETTSDY
gi|182678711|re  ISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDY
gi|217976980|re  ISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIKSQIAETTSDY
gi|154248184|re  ISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDY
gi|13472184|ref  ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDY
gi|239834971|re  ISEDLGIKLENVTLNMLGRAKRVAIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  DKEKLQERLAKLAGGVAVIKVGAGSEIEMKEKKDRVEDALQATRAAVEEGVVAGGGVALI
gi|438206|emb|C  DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRLEDALHATRAAVEEGVVAGGGVALL
gi|134047129|re  DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI
gi|21241313|ref  DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|255259323|re  DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|256758655|re  DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL
gi|82703461|ref  DKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|56476061|ref  DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
gi|85711845|ref  DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|226943476|re  DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
gi|254293331|re  DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
gi|149688742|gb  DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALL
GOS_1237020_Tra  ------------------------------------------------------------
gi|85709559|ref  DREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
gi|87198061|ref  DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
gi|83591926|ref  DREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL
gi|84499753|ref  DREKLQERVAKLAGGVAVIRVGGMTETEVKERKDRVDDALNATRAAVQEGVIVGGGVALV
gi|83950579|ref  DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV
gi|260425778|re  DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV
gi|220920707|re  DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGTALL
gi|84701593|ref  DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
gi|114569155|re  DREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
gi|254421167|re  DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL
gi|197106643|re  DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
gi|58040332|ref  DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA
gi|114705804|re  DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL
gi|49474597|ref  DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL
gi|182678711|re  DREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL
gi|217976980|re  DREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALL
gi|154248184|re  DREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL
gi|13472184|ref  DKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL
gi|239834971|re  DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  RAISNVT-VTGDNEDQNVGIALALRAMEAPIRQIAYNAGDEASVVVDKVKSGEG-SFGYN
gi|438206|emb|C  RARAALENLHTGNADKDAGVQIVLRAVESSLRQIVANAGGEPSVVVNKVLEGKG-NYGYN
gi|134047129|re  RAKAAIAELKGANEDQNHGIAIALRAMEAPLREIVTNAGDEPSVVLNRVAEGTG-AFGYN
gi|21241313|ref  RALVAVGDLKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEGTG-NYGYN
gi|255259323|re  RAKAAVAGLKGANHDQDAGITIVLRAMESPIRAITMNAGDEPSVVVNKVLEGKG-SFGYN
gi|256758655|re  RARQAVGEIKGDNHDQEAGIKIVLRAIEQPLREIVANSGGEPSVVINKVLEGKG-NFGFN
gi|82703461|ref  RTRSAVSNLKGDNHDQDAGIKIVLRALEEPLRQIVANCGDEPSVVINKVLEGTE-NFGYN
gi|56476061|ref  RARANLGTLKGDNHDQDAGIKIVLRALEQPLREIVANAGDEPSVVVNRVVEGTG-NFGYN
gi|85711845|ref  RAASKLAELTGDNEEQNVGIRMMLRAMEAPLRQIAYNAGAEASVVANRVREGEG-NFGYN
gi|226943476|re  RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKVKQGSG-NFGFN
gi|254293331|re  RASSALK-VKGSNVDEQAGIDIVTKALQAPLRQIVQNAGVEGSVVVNAILADKSISYGFD
gi|149688742|gb  YASQSLDTLKVKGDDQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYD
GOS_1237020_Tra  ------------------------------------------------------------
gi|85709559|ref  YATKVLEGLKGDNDDQTRGIDIVRRAIMAPVRQIAQNAGHDGAVVSGNLLREDNESQGFN
gi|87198061|ref  YATKALEGLKGANDDQTKGIDIVRRAIQAPIRQIAANAGHDGAVVSGNLLRENDENQGFN
gi|83591926|ref  HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYN
gi|84499753|ref  QGGKALEGLTGANPDQEAGIAIVRRALEAPLRQIAENAGVDGAVVAGKVRESDDVKYGFN
gi|83950579|ref  QAGKSLDGLEGANADQNAGIAIVRRAIEAPLRQIAENAGVDGAVVAGKVRESSDLSFGFN
gi|260425778|re  QGAKSLDGLEGANSDQNAGITIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN
gi|220920707|re  RARDAIKDLKSDNADVQAGIKIIVKALEAPIRQIAANAGVEGSIVVGKVSENGSATFGFD
gi|84701593|ref  YAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENAGQEGSIVVGKLLEQDDTKFGFN
gi|114569155|re  KASAKLAGLEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPSATFGFN
gi|254421167|re  KATKALDGLTGDNADQTAGIAIIRRAIQAPIRQIVENAGVEGSIVVGKVLENSSATYGFN
gi|197106643|re  KASKVLDGFKGDNDDQEAGIAIVRRALQAPIRQISENAGVEGSIVVGKVLENASPTFGFN
gi|58040332|ref  RASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFD
gi|114705804|re  RASNAVD-LKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESLSFGYN
gi|49474597|ref  RAANALA-IKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYN
gi|182678711|re  RAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYN
gi|217976980|re  RAIKALEGLTVENADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYN
gi|154248184|re  RSIKALEGLKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYN
gi|13472184|ref  RAAKALDSVQAENEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWN
gi|239834971|re  RAVKALEGLPIANDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTDFSYGWN
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
gi|94500716|ref  ASTGEYGDMIELGIIDPTKVTRSSLQAAASVGGLMITTEAMVADIPEE-------NGGAP
gi|438206|emb|C  AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEN-------KPAMP
gi|134047129|re  AANGEFGDMIEFGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKE------EPAAP
gi|21241313|ref  AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD------EPALP
gi|255259323|re  ASSSEYGDMLVMGVVDPTKVTRVALQNAASIAGLMLTTACMVAELPEDKP-----AGGMG
gi|256758655|re  AANDTYGDMLEMGIIDPTKVTRTALQNAASVAGLMLTTECMVAEAPKDES-----APAMP
gi|82703461|ref  AASSEYGDMVQMGVLDPTKVTRYALQHAASIAGLMLTTDALVAEVPKEEGAGGGMGGGMG
gi|56476061|ref  AATGEYGDLVDMGVLDPTKVERIALQNAASVAGLMLTTDCMVGELAEEKPS----MGGMG
gi|85711845|ref  AGNDTYGDMLEMGILDPTKVTRSALQFAASVGSLMITTEAMVAEIPKDDES----AGGMG
gi|226943476|re  AASGVYGDMIEMGILDPAKVTRSALQAASSIGGLMITTEAMVADIVEDKA-----APAMP
gi|254293331|re  AQKEEYCDLVAAGIIDPTKVVRSSLQNAASIASLIITTEAAICDAPVKDAPA---GGGMP
gi|149688742|gb  AQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPHNKDSG---AGGMP
GOS_1237020_Tra  ------------------------------------------------------------
gi|85709559|ref  AATDTYEDLVKAGVIDPTKVVRTALQDAASVAGLLITTEAAITDAPEDDKA----APAMP
gi|87198061|ref  AATDTYENLKAAGVIDPTKVVRTALQDAASVSGLLITTEAAISEKPDD-------KPAMP
gi|83591926|ref  AQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKD-----AMPSP
gi|84499753|ref  AQTEEYGDMFKFGVIDPAKVVRTALEDAASISGLLITTEAMVADKPQKEGAGAA-AGGMP
gi|83950579|ref  AQTEEYGDMFKFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPAKEGAG-A-GGGMP
gi|260425778|re  AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQKDAPA---GGGMP
gi|220920707|re  AQTETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKEA-----PPAMP
gi|84701593|ref  AQTEEYGNLLDMGIVDPAKVVRHALQDAASVAGLLITTEAMIAEAPKKDSGG-A-GGGMP
gi|114569155|re  AQTEEYGDMLAFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKEEGA----GGGMP
gi|254421167|re  AQTEEYGDLVAMGVIDPAKVVRTALTDAASVASILITTEAAVADAPKKG------GSSAP
gi|197106643|re  AQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAIVEAPKKGG-----AGGAP
gi|58040332|ref  AQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPEKK------APAAA
gi|114705804|re  AQTGEYGDMIQMGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPKKDNG----GGGMP
gi|49474597|ref  TATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDTP----MPPMP
gi|182678711|re  AQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAP----LPPMG
gi|217976980|re  AQTDEYGDLVKLGIIDPTKVVRTALQDAASVGGLLITTEAIIAEQPKKD------SPAMP
gi|154248184|re  AQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNAPA---APAMP
gi|13472184|ref  AQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKKEPA----VPAMP
gi|239834971|re  AQTGEYGDLYAQGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKEA-----TPALP
                                                                             


                        550
                 =========+========
gi|94500716|ref  D--MGGMGGMGGMPGM-M
gi|438206|emb|C  D--MGGMGGMGGM----M
gi|134047129|re  G---GGMGGMGGMD---F
gi|21241313|ref  A--GGGMGGMGGMD---F
gi|255259323|re  GGDMGGMGGMGGM----M
gi|256758655|re  G---GGMGGMGDMG---M
gi|82703461|ref  G--MGGMGGMGGMD---M
gi|56476061|ref  G--MGGMGGMGGMDMG-M
gi|85711845|ref  D--MGGMGGMGGM----M
gi|226943476|re  D--MGGMGGMGGM----M
gi|254293331|re  D--MGGMGGMGGMGGMGF
gi|149688742|gb  G----GM-----------
GOS_1237020_Tra  ------------------
gi|85709559|ref  D--MGGMGGMGGMGG--F
gi|87198061|ref  P-MGGGMGGMGGMD---F
gi|83591926|ref  D--MGGMGGMGGMG---F
gi|84499753|ref  D--MGGMGGM-------M
gi|83950579|ref  D--MGGMGGM-------M
gi|260425778|re  D--MGGMGGM-------M
gi|220920707|re  G--GGGMGGMD------F
gi|84701593|ref  D--MGGMGGM-------M
gi|114569155|re  D--MGGMGGMGGMGGM-M
gi|254421167|re  D--MGGMGGMGGMD---F
gi|197106643|re  GGMPGGMGDMD------F
gi|58040332|ref  P---GGMGDMD------F
gi|114705804|re  AGGMGGMGGMGGMD---F
gi|49474597|ref  G---GGMGGMGGMD---F
gi|182678711|re  G---GGMGGMGGMD---F
gi|217976980|re  G--GGGMGGMGGMD---F
gi|154248184|re  G---GGMD---------F
gi|13472184|ref  A---GGMD---------F
gi|239834971|re  A--SAGMD---------F
                                   
Parameters used
Minimum Number Of Sequences For A Conserved Position: 17
Minimum Number Of Sequences For A Flanking Position: 27
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 1 selected block(s)
Flanks: [31  226]  

New number of positions in input.fasta-gb:  196  (35% of the original 558 positions)


Protein Domains

PROTOCOLE:


InterPro, default parameters at EBI.



ANALYSE DES RÉSULTATS:


3 domains found on submitted sequence (ie. sequence 1)

- Chaperonin Cpn60/TCP-1 (ie. domain no.1)

in PANTHER: CHAPERONIN family between amino acids 2-225 with an e-value 3.8e-144

in Pfam: TCP-1/cpn60 chaperonin family between aas 22-224 with an e-value 1.1e-57

in SUPERFAMILY: GroEL equatorial domain-like superfamily between aas 1-225 with an e-value 6e-68

> covers the entire sequence from 1-225

> no parent found, the following sequence noted as child

> Chaperonins are a subfamily of chaperons that are enzymes helping the correct folding of newly synthesized proyeins. The above domain is a basic chaperonin structure, consists of two cage subunits and 6 ATPase sites and its main function is binding and covering certain sites of non matureated proteins to ensure that the secondary bonds form at the right places in the molecule giving its final functional structure. The Cpn 60 chaperonins belong to this chaperonin family alongside with Cpn10 proteins and are mostly found in eucaryotic mitochoindria and chloroplasts; and procaryotic cells, they are required for normal cell growth. Stress conditions such qs heqt induce the synthesis of these proteins since they can restore the original structure of denaturated proteins. Because of this characteristic, they are also referred top as heat shock proteins - HSPs.


- Chaperone, tailless complex polypeptide 1: in 3 fragments between amino acids 24-40, 46-64, 80-99 with an e-value

3.9e-29

> has domain no. 1 noted as parent

> The tailless complex polypeptide 1 is one of the most conserved chaperonic structures located in the cytosol. Due to it's ability to bind to microtubules it has an important role in mitotic spindle formation. Also has a double cage or ring structure that is similar to that of the 10kDa and 60kDa chaperonins. The amino acid sequence is usually similar to that of Cpn 60 which explains why we find the two domains overlaping on our ORF.


(- unintegrated domain

in PANTHER: subfamily CHAPERONIN-60KDA of family CHAPERONIN: from aa 2 to 225 with an e-value 3.8e-144

> this result refers to the same fragment as in result no. 1 with the same e-value

in CATH database: Homologous Superfamily: 1.10.560.10 - GroEl, domain 1

> covers the entire sequence from 1-225

> matches the result superfamily: GroEl equatorial domain-like of result no. 1 on the same

sequence 1-225 but with an e-value of 2.6e-72)


Since the second - chaperone - domain is completely integrated in (so is the child of) the first - chaperonin - domain, I'll consider this latter. Also the two domains does not differ a lot in function that also supports my decision. Also it was matched by a very good e-value that gives the result a great significance.


Sequence_1	77E1CDF630C1F254	225	Gene3D	G3DSA:1.10.560.10	no description	1	225	2.6e-72	T	10-Feb-2010	NULL	NULL	
Sequence_1	77E1CDF630C1F254	225	HMMPanther	PTHR11353:SF10	CHAPERONIN-60KDA, CH60	2	225	3.8e-144	T	10-Feb-2010	NULL	NULL	
Sequence_1	77E1CDF630C1F254	225	HMMPanther	PTHR11353	CHAPERONIN	2	225	3.8e-144	T	10-Feb-2010	IPR002423	Chaperonin Cpn60/TCP-1	Molecular Function: protein binding (GO:0005515), Molecular Function: ATP binding (GO:0005524), Biological Process: cellular protein metabolic process (GO:0044267)
Sequence_1	77E1CDF630C1F254	225	FPrintScan	PR00304	TCOMPLEXTCP1	24	40	3.9e-29	T	10-Feb-2010	IPR017998	Chaperone, tailless complex polypeptide 1	
Sequence_1	77E1CDF630C1F254	225	FPrintScan	PR00304	TCOMPLEXTCP1	46	64	3.9e-29	T	10-Feb-2010	IPR017998	Chaperone, tailless complex polypeptide 1	
Sequence_1	77E1CDF630C1F254	225	FPrintScan	PR00304	TCOMPLEXTCP1	80	99	3.9e-29	T	10-Feb-2010	IPR017998	Chaperone, tailless complex polypeptide 1	
Sequence_1	77E1CDF630C1F254	225	superfamily	SSF48592	GroEL equatorial domain-like	1	225	6e-68	T	10-Feb-2010	IPR002423	Chaperonin Cpn60/TCP-1	Molecular Function: protein binding (GO:0005515), Molecular Function: ATP binding (GO:0005524), Biological Process: cellular protein metabolic process (GO:0044267)
Sequence_1	77E1CDF630C1F254	225	HMMPfam	PF00118	Cpn60_TCP1	22	224	1.1e-57	T	10-Feb-2010	IPR002423	Chaperonin Cpn60/TCP-1	Molecular Function: protein binding (GO:0005515), Molecular Function: ATP binding (GO:0005524), Biological Process: cellular protein metabolic process (GO:0044267)

Phylogeny

PROTOCOLE:


Phylogeny.fr / PhyML method / Approximate Likelihood-Ratio Test (aLRT): SH-like / Substitution model: Default / Tree Rendering: TreeDyn



ANALYSE DES RÉSULTATS:


On the tree generated by TreeDyn the 3 different groups of Proteobacteria are easily identifiable and they are clearly separated from each other. However the analyse marks the species Sideroxydans lithotrophicus with a color correpsonding to g-proteobacteria while placing it in the branch for b-proteobacteria - where it taxonomically belongs. Since this was the only one miscolored taxon, I decided not to change the out-groups and rerun the test.

The total separation of the a-proteobacteria group from the two others places the analysed sequence squarely in a-proteobacteria.

My sequence named GOS_1237020 on the tree was placed as a close sister of Candidatus sp. TThe couple Candidatus pelagibacter - GOS is quite separated even from it's closest sisters and roots in a 5th class branching point, and the branch itself is relatively long. This result was also provided by the BLAST tax. report giving the first three results (ie. best scores) at Candidatus Pelagibacter then followed by an almost 50 gap in score before the listing of other species/taxons.

Still because of the very high ration of mixing of the different orders of a-proteobacteria this result might have been obtained only by chance, we can~t conclude that our sequence belongs to the order Rickettsiales. Thish high level of disorder in the organisation of a-proteobacteria might be due to horizontal gene transfer between its elements an such as well the lack of enough information on the specificity of the sequences corresponding to the different orders. The aligned sequences were so alike that it`s difficult to find characteristic differences on such a taxonomic level between them.


(When first constructing the tree, the program put one of the members of my g-proteobacteria out-group in a a totally different taxonomic category, the original Acidithiobacillus ferrooxidans appeared on the tree as Leptospirillum ferrooxidans that belongs to the Nitrospirae phylum when I chose the option showing species names on the branches that caused some confusion when drawing the tree. So I decided to eliminate this species from the out-group and replaced it with an other species.)


Regarding the quesion raised on GroEL\GroL and 60kDa chaperonin functions at the BLAST analyse I found the following:

To construct the in-group I`ve selected the members of all the orders belonging to the a-proteobacteria with the highest score (and amongst them I tried to select as many different falmilies as possible, but members of different families not necessary represent the highest score coming from the given family). These species (in fact almost all species of the in-group) has the analysed sequence in a GroEL function, and also later on the list (tax. report of BLAST) in a 60kDa chaperonin function with a lower score. Also the result with the highest score at Candidatus Pelagibacter possesses all 3 functions listed around ttop 10 best scores (ie. 60kDa chaperonin, HSP 60, Chaperonin GroEL). This shows that these proteins belong to 2-3 only slightly different variants of the same type of sequence with cloesly resembling functions in the same organism (most of the cases) so there`s no point in differenciating the BLAST function reuslts.

RESULTATS BRUTS

                                                                                                         ----0.05---
   branches of a-proteobacteria                                                 Order:

   +-----------------------Rhodospirillum_rubrum_ATCC_11170_gi_83591926   Rhodospirillales
   |
   |                 +--------------------------Hirschia_baltica_ATCC_49814_gi_254293331   Rhodobacterales
   |                 |
   |            +----+       +----------------------Parvularcula_bermudensis_HTCC2503_gi_84701593   Parvularcula bermudiensis (given as separate species by the tree of life)
   |            |    |       |
   |            |    +-------+      +------------------------Maricaulis_maris_MCS10_gi_114569155   Rhodobacterales
   |            |            |      |
   |            |            +------+           +---------------Brevundimonas_sp._BAL3_gi_254421167   Caulobacterales
   |            |                   +-----------+
   |            |                               +--------------Phenylobacterium_zucineum_HLK1_gi_197106643   Caulobacterales
   |            |
   |            |
   |            |                                +-----Beijerinckia_indica_subsp._indica_ATCC_9039_gi_182678711     Rhizobiales
   |            |         +----------------------+
 +-+            |         |                      +-----Methylocella_silvestris_BL2_gi_217976980      Rhizobiales
 | |      +-----+      +--+
 | |      |     |      |  |    +---------------Methylobacterium_nodulans_ORS_2060_gi_220920707       Rhizobiales
 | |      |     |      |  |    |
 | |      |     |      |  +----+      +------------------------------Bartonella_quintana_str._Toulouse_gi_49474597   Rhizobiales
 | |      |     |      |       |      |
 | |      |     |      |       +------+         +------------Xanthobacter_autotrophicus_Py2_gi_154248184       Rhizobiales
 | |      |     | +----+              |         |
 | |      |     | |    |              +---------+      +----------Mesorhizobium_loti_MAFF303099_gi_13472184    Rhizobiales
 | |      |     | |    |                        +------+
 | |      |     | |    |                               +--------Ochrobactrum_intermedium_LMG_3301_gi_239834971 Rhizobiales
 | |      |     | |    |
 | |      |     | |    +-----------------------------Gluconobacter_oxydans_621H_gi_58040332        Rhodospirillales
 | |a-pr. |     +-+
 | +------+       |                                   +------Candidatus_Pelagibacter_ubique_gi_149688742    Rickettsiales
 |        |       |       +---------------------------+
 |        |       |       |                           +--------GOS_1237020_Translation_175-849_direct_strand
 |        |       |       |
 |        |       |       |
 |        |       +-------+                            +---------Oceanicola_batsensis_HTCC2597_gi_84499753    Rhodobacterales
 |        |               |        +-------------------+
 |        |               |        |                   |  +----Roseovarius_nubinhibens_ISM_gi_83950579       Rhodobacterales
 |        |               +--------+                   +--+
 |        |                        |                      +-------Citricella_sp._SE45_gi_260425778     Rhodobacterales
 |        |                        |
 |        |                        +------------------------Fulvimarina_pelagi_HTCC2506_gi_114705804    Rhizobiales
 |        |
 |        |                 +-------------Erythrobacter_sp._NAP1_gi_85709559     Sphingomonadales
 |        +-----------------+
 |                          +-----------Novosphingobium_aromaticivorans_DSM_12444_gi_87198061  Sphingomonadales            
 |
 |                          +------------------------------Neisseria_meningitidis_gi_438206                   
 |       branch of          |
 |       b-proteobacteria   |         +-------------------Sideroxydans_lithotrophicus_ES-1_gi_255259323   
 |                +---------+   +-----+
 |                |         |   |     +---------------Nitrosospira_multiformis_ATCC_25196_gi_82703461
 |                |         +---+
 |                |             |      +-------------------Thiobacillus_intermedius_K12_gi_256758655
 |                |             +------+
 |                |                    |
 +----------------+                    +-----------Azoarcus_sp._EbN1_gi_56476061
                  |
                  |               +----------Salmonella_enterica_subsp._enterica_serovar_Newport_str._SL254_gi_134047129
                  |     +---------+
                  |     |         +---------------------Xanthomonas_axonopodis_pv._citri_str._306_gi_21241313
                  |     |
        branch of +-----+                  +-------------------------Oceanobacter_sp._RED65_gi_94500716
        g-proteobacteria|         +--------+
                        +---------+        +------------Idiomarina_baltica_OS145_gi_85711845
                                  |
                                  +------------------------Azotobacter_vinelandii_AvOP_gi_226943476

Taxonomy report

PROTOCOLE:

a) analyse BLASTp of Translation of ORF number 2 in reading frame 1 on the direct strand - database: NR

> set `max target sequences` _ 5000

b) analyse BLASTp of Translation of ORF number 2 in reading frame 1 on the direct strand - database: SWISSPROT

> set `max target sequences` _ 5000



ANALYSE DES RÉSULTATS:


To define the in and out groups of the analyse I`ve listed the score ranges belonging to the different groups of source organisms provided by the BLAST search (I've worked only with the results on NR database):


a-proteobacteria score: 422-296

other proteobacteria: 335-294

all other bacteria: 320-294

eucaryotes: 308-294


We can see that the group a-proteobacteria yields far the best scores followed by the group of other proteobacteria (it`s taxonomical sisters clads) by a gap of almost 100 score points which makes evident the choice of a-proteobacteria as in-group.

When chosing the final 20 sequences used for the analyse I was trying to get sequences from the most diverse groups possible and finally managed to include at least one sequence from all the 6 orders of a-proteobacteria listed by the tree of life (tol) and a 7th listed by the tol as a species.

ie.:

  1. Rhodospirillales
  1. Rickettsiales
  1. Rhodobacterales
  1. Sphingomonadales
  1. Caulobacterales
  1. Rhizobiales
  1. Parvularcula bermudensis

With this information I consider my in-group a complete one.


As for the out group based on the tree of life I`ve chosen the two closest sister clads of the in group, namely b- and g-proteobacteria. (as they together represent the same taxonomical level as a-proteobacteria)

In this case as well I was trying to choose different orders of the two groups. Of these the tree of life provides no list of orders so I`ve haphazardly chosen 5-5 different ones of each group as out-group.

of b-proteobacteria:

  1. Burkholderiales
  1. Neisseriales
  1. Nitrosomonadales
  1. Rhodocyclales
  1. Gallionellales

of g-proteobacteria

  1. Alteromonadales
  1. Pseudomonadales
  1. Xanthomonadales
  1. Enterobacteriales
  1. Acidithiobacillales


in-group:

all a-proteobacteria

gb|ABR27782.1| Candidatus Pelagibacter 371 4e-101

ref|ZP_01016168.1| Parvularcula bermudiensis 357 5e-97

ref|ZP_00959312.1| Roseovarius nubinhibens 356 8e-97

ref|YP_002496008.1| Methylobacterium nodulans 356 1e-96

ref|YP_003059354.1| Hirschia baltica 355 1e-96

ref|ZP_01438707.1| Fulvimarina pelagi 355 1e-96

ref|ZP_00998041.1| Oceanicola batsensis 352 1e-95

ref|NP_103751.1| Mesorhizobium loti 352 2e-95

ref|ZP_05779758.1| Citreicella sp. 350 4e-95

ref|ZP_05034888.1| Brevundimonas sp. 350 5e-95

ref|YP_032639.1| Bartonella quintana 348 2e-94

ref|YP_425678.1| Rhodospirillum rubrum 348 2e-94

ref|ZP_04683299.1| Ochrobactrum intermedium 347 4e-94

ref|YP_001832857.1| Beijerinckia indica 345 2e-93

ref|YP_192296.1| Gluconobacter oxydans 345 3e-93

ref|YP_001419142.1| Xanthobacter autotrophicus 341 3e-92

ref|YP_002361127.1| Methylocella silvestris 341 4e-92

ref|YP_755835.1| Maricaulis maris 340 6e-92

ref|ZP_01040624.1| Erythrobacter sp. 340 8e-92

ref|YP_002132020.1| Phenylobacterium zucineum 339 1e-91

ref|YP_495318.1| Novosphingobium aromaticivorans 337 7e-91


out-group:

b-proteobacteria

ef|ZP_05499324.1| Thiomonas intermedia 317 5e-85

emb|CAA80532.1| Neisseria meningitidis 312 2e-83

ref|YP_413027.1| Nitrosospira multiformis 311 4e-83

ref|YP_157650.1| Aromatoleum aromaticum 310 8e-83

ref|ZP_05338681.1| Sideroxydans lithotrophicus 309 2e-82


g-proteobacteria

ref|ZP_01307245.1| Oceanobacter sp. 326 1e-87

ref|YP_001102020.1| Salmonella enterica 319 2e-85

ref|NP_640895.1| Xanthomonas axonopodis 315 2e-84

ref|YP_002798549.1| Azotobacter vinelandii 315 3e-84

ref|ZP_01042900.1| Idiomarina baltica 314 4e-84




The exact sequences of in- and out-groups given in FASTA format are to be found below at the end of "RESULTATS BRUTS"





RÉSULTATS BRUTS:

DATABASE: NR
Lineage Report

Lineage Report

root
. cellular organisms
. . Bacteria                       [bacteria]
. . . Proteobacteria                 [proteobacteria]
. . . . Alphaproteobacteria            [a-proteobacteria]
. . . . . Rickettsiales                  [a-proteobacteria]
. . . . . . SAR11 cluster                  [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter        [a-proteobacteria]
. . . . . . . . Candidatus Pelagibacter ubique [a-proteobacteria]
. . . . . . . . . Candidatus Pelagibacter ubique HTCC1062 ------------------------  422   2 hits [a-proteobacteria]       60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
. . . . . . . . . Candidatus Pelagibacter ubique .................................  422   9 hits [a-proteobacteria]       60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
. . . . . . . . . Candidatus Pelagibacter ubique HTCC1002 ........................  420   3 hits [a-proteobacteria]       60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
. . . . . . . . Candidatus Pelagibacter sp. HTCC7211 -----------------------------  411   2 hits [a-proteobacteria]       chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211] >gi|
. . . . . . . alpha proteobacterium HIMB114 --------------------------------------  375   2 hits [a-proteobacteria]       chaperonin GroL [alpha proteobacterium HIMB114] >gi|2622238
. . . . . . Rickettsia canadensis str. McKiel ------------------------------------  300   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia canadensis str. McKiel] >gi|16
. . . . . . Rickettsia felis URRWXCal2 ...........................................  296   2 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia felis URRWXCal2] >gi|75536750|
. . . . . . Rickettsia felis .....................................................  296   1 hit  [a-proteobacteria]       chaperonin GroEL [Rickettsia felis URRWXCal2] >gi|75536750|
. . . . . . Rickettsia prowazekii str. Madrid E ..................................  295   1 hit  [a-proteobacteria]       chaperonin GroEL [Rickettsia prowazekii str. Madrid E] >gi|
. . . . . . Rickettsia prowazekii ................................................  295   2 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia prowazekii str. Madrid E] >gi|
. . . . . . Rickettsia typhi str. Wilmington .....................................  295   2 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia typhi str. Wilmington] >gi|254
. . . . . . Rickettsia typhi .....................................................  295   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia typhi str. Wilmington] >gi|254
. . . . . . Rickettsia rickettsii ................................................  295   2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . . Rickettsia rickettsii str. 'Sheila Smith' ............................  295   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia rickettsii str. 'Sheila Smith'
. . . . . . Rickettsia rickettsii str. Iowa ......................................  295   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia rickettsii str. 'Sheila Smith'
. . . . . . Rickettsia peacockii str. Rustic .....................................  295   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia rickettsii str. 'Sheila Smith'
. . . . . . Rickettsia conorii str. Malish 7 .....................................  294   2 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia conorii str. Malish 7] >gi|201
. . . . . . Rickettsia conorii ...................................................  294   1 hit  [a-proteobacteria]       chaperonin GroEL [Rickettsia conorii str. Malish 7] >gi|201
. . . . . . Rickettsia africae ESF-5 .............................................  294   3 hits [a-proteobacteria]       60 kD chaperonin [Rickettsia africae ESF-5] >gi|259585913|s
. . . . . . Rickettsia akari str. Hartford .......................................  294   3 hits [a-proteobacteria]       chaperonin GroEL [Rickettsia akari str. Hartford] >gi|16620
. . . . . Oceanibulbus indolifex HEL-45 ------------------------------------------  360   2 hits [a-proteobacteria]       chaperonin GroEL [Oceanibulbus indolifex HEL-45] >gi|161382
. . . . . Roseobacter sp. CCS2 ...................................................  360   2 hits [a-proteobacteria]       60 kDa chaperonin 1, putative [Roseobacter sp. CCS2] >gi|12
. . . . . Methylobacterium radiotolerans JCM 2831 ................................  357   3 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium radiotolerans JCM 2831] 
. . . . . Parvularcula bermudensis HTCC2503 ......................................  357   2 hits [a-proteobacteria]       putative heat shock protein groEL [Parvularcula bermudensis
. . . . . Methylobacterium sp. 4-46 ..............................................  357   6 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium sp. 4-46] >gi|168197832|
. . . . . Dinoroseobacter shibae DFL 12 ..........................................  357   3 hits [a-proteobacteria]       60 kDa chaperonin [Dinoroseobacter shibae DFL 12] >gi|18908
. . . . . Silicibacter lacuscaerulensis ITI-1157 .................................  357   2 hits [a-proteobacteria]       chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157] >g
. . . . . Roseovarius nubinhibens ISM ............................................  356   2 hits [a-proteobacteria]       chaperonin GroEL [Roseovarius nubinhibens ISM] >gi|83838478
. . . . . Methylobacterium nodulans ORS 2060 .....................................  356   6 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium nodulans ORS 2060] >gi|2
. . . . . Fulvimarina pelagi HTCC2506 ............................................  355   2 hits [a-proteobacteria]       chaperonin GroEL [Fulvimarina pelagi HTCC2506] >gi|11453865
. . . . . Hirschia baltica ATCC 49814 ............................................  355   2 hits [a-proteobacteria]       chaperonin GroEL [Hirschia baltica ATCC 49814] >gi|25404186
. . . . . Sulfitobacter sp. NAS-14.1 .............................................  355   2 hits [a-proteobacteria]       chaperonin GroEL [Sulfitobacter sp. NAS-14.1] >gi|83941339|
. . . . . Sulfitobacter sp. EE-36 ................................................  355   2 hits [a-proteobacteria]       chaperonin GroEL [Sulfitobacter sp. NAS-14.1] >gi|83941339|
. . . . . Roseobacter sp. GAI101 .................................................  355   2 hits [a-proteobacteria]       chaperonin GroL [Roseobacter sp. GAI101] >gi|214044332|gb|E
. . . . . Roseobacter denitrificans OCh 114 ......................................  353   6 hits [a-proteobacteria]       chaperonin GroEL [Roseobacter denitrificans OCh 114] >gi|11
. . . . . Rhodobacterales bacterium HTCC2654 .....................................  353   2 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacterales bacterium HTCC2654] >gi|8
. . . . . Ruegeria sp. TM1040 ....................................................  353   3 hits [a-proteobacteria]       chaperonin GroEL [Ruegeria sp. TM1040] >gi|118597124|sp|Q1G
. . . . . Silicibacter sp. TrichCH4B .............................................  353   2 hits [a-proteobacteria]       chaperonin GroL [Silicibacter sp. TrichCH4B] >gi|259345255|
. . . . . Ruegeria sp. R11 .......................................................  353   2 hits [a-proteobacteria]       chaperonin GroL [Ruegeria sp. R11] >gi|214032035|gb|EEB7287
. . . . . Jannaschia sp. CCS1 ....................................................  353   3 hits [a-proteobacteria]       chaperonin GroEL [Jannaschia sp. CCS1] >gi|119366245|sp|Q28
. . . . . Aurantimonas manganoxydans SI85-9A1 ....................................  353   2 hits [a-proteobacteria]       chaperonin groEL [Aurantimonas manganoxydans SI85-9A1] >gi|
. . . . . Oceanicola batsensis HTCC2597 ..........................................  352   2 hits [a-proteobacteria]       chaperonin GroEL [Oceanicola batsensis HTCC2597] >gi|843928
. . . . . Mesorhizobium opportunistum WSM2075 ....................................  352   8 hits [a-proteobacteria]       chaperonin GroEL [Mesorhizobium opportunistum WSM2075] >gi|
. . . . . Mesorhizobium loti MAFF303099 ..........................................  352  10 hits [a-proteobacteria]       chaperonin GroEL [Mesorhizobium loti MAFF303099] >gi|254528
. . . . . Mesorhizobium loti .....................................................  352   6 hits [a-proteobacteria]       chaperonin GroEL [Mesorhizobium loti MAFF303099] >gi|254528
. . . . . Chelativorans sp. BNC1 .................................................  352   6 hits [a-proteobacteria]       chaperonin GroEL [Mesorhizobium sp. BNC1] >gi|118597097|sp|
. . . . . Ruegeria pomeroyi DSS-3 ................................................  351   2 hits [a-proteobacteria]       chaperonin GroEL [Ruegeria pomeroyi DSS-3] >gi|68566259|sp|
. . . . . Ruegeria pomeroyi ......................................................  351   1 hit  [a-proteobacteria]       chaperonin GroEL [Ruegeria pomeroyi DSS-3] >gi|68566259|sp|
. . . . . Methylobacterium populi BJ001 ..........................................  351   3 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium populi BJ001] >gi|226704
. . . . . Roseovarius sp. HTCC2601 ...............................................  351   2 hits [a-proteobacteria]       chaperonin GroEL [Roseovarius sp. HTCC2601] >gi|114543343|g
. . . . . Rhodobacterales bacterium HTCC2083 .....................................  351   4 hits [a-proteobacteria]       chaperonin GroL [Rhodobacterales bacterium HTCC2083] >gi|20
. . . . . Roseobacter litoralis Och 149 ..........................................  351   2 hits [a-proteobacteria]       chaperonin GroEL [Roseobacter litoralis Och 149] >gi|161394
. . . . . Bradyrhizobium sp. ORS278 ..............................................  351   9 hits [a-proteobacteria]       chaperonin GroEL [Bradyrhizobium sp. ORS278] >gi|187470736|
. . . . . Methylobacterium extorquens PA1 ........................................  351   6 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium extorquens PA1] >gi|2185
. . . . . Methylobacterium chloromethanicum CM4 ..................................  351   4 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium extorquens PA1] >gi|2185
. . . . . Methylobacterium extorquens DM4 ........................................  351   4 hits [a-proteobacteria]       chaperonin GroEL [Methylobacterium extorquens PA1] >gi|2185
. . . . . Citreicella sp. SE45 ...................................................  350   2 hits [a-proteobacteria]       chaperonin GroL [Citreicella sp. SE45] >gi|260423718|gb|EEX
. . . . . Brevundimonas sp. BAL3 .................................................  350   2 hits [a-proteobacteria]       chaperonin GroL [Brevundimonas sp. BAL3] >gi|196183865|gb|E
. . . . . Rhizobium etli CIAT 652 ................................................  350   6 hits [a-proteobacteria]       60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 
. . . . . Rhodospirillum centenum SW .............................................  350   3 hits [a-proteobacteria]       chaperonin GroL, putative [Rhodospirillum centenum SW] >gi|
. . . . . alpha proteobacterium BAL199 ...........................................  350   6 hits [a-proteobacteria]       Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199] >gi|1
. . . . . Roseovarius sp. TM1035 .................................................  350   2 hits [a-proteobacteria]       chaperonin GroEL [Roseovarius sp. TM1035] >gi|149143145|gb|
. . . . . Rhodobacteraceae bacterium KLH11 .......................................  349   2 hits [a-proteobacteria]       chaperonin GroL [Rhodobacteraceae bacterium KLH11] >gi|2215
. . . . . Bradyrhizobium sp. BTAi1 ...............................................  349  12 hits [a-proteobacteria]       chaperonin GroEL [Bradyrhizobium sp. BTAi1] >gi|187470725|s
. . . . . Pseudovibrio sp. JE062 .................................................  349   2 hits [a-proteobacteria]       chaperonin GroL [Pseudovibrio sp. JE062] >gi|211957337|gb|E
. . . . . Rhizobium etli CFN 42 ..................................................  349  12 hits [a-proteobacteria]       chaperonin GroEL [Rhizobium etli CFN 42] >gi|119366207|sp|Q
. . . . . Rhodobacter sphaeroides ATCC 17029 .....................................  348   3 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides ATCC 17029] >gi|1
. . . . . Bartonella quintana str. Toulouse ......................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Bartonella quintana str. Toulouse] >gi|62
. . . . . Bartonella quintana ....................................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Bartonella quintana str. Toulouse] >gi|62
. . . . . Rhodospirillum rubrum ATCC 11170 .......................................  348   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodospirillum rubrum ATCC 11170] >gi|119
. . . . . Loktanella vestfoldensis SKA53 .........................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Loktanella vestfoldensis SKA53] >gi|84509
. . . . . Rhizobium leguminosarum ................................................  348   5 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . . Oceanicaulis alexandrii HTCC2633 .......................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Oceanicaulis alexandrii HTCC2633] >gi|838
. . . . . Oceanicola granulosus HTCC2516 .........................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Oceanicola granulosus HTCC2516] >gi|89045
. . . . . Rhodobacter sphaeroides ATCC 17025 .....................................  348   3 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025] >gi|2
. . . . . Rhodopseudomonas palustris .............................................  348   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025] >gi|2
. . . . . Rhodobacter sphaeroides 2.4.1 ..........................................  348   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides 2.4.1] >gi|221638
. . . . . Rhodobacter sphaeroides KD131 ..........................................  348   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides 2.4.1] >gi|221638
. . . . . Rhodobacter sphaeroides ................................................  348   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sphaeroides 2.4.1] >gi|221638
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...........................  348   8 hits [a-proteobacteria]       chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1
. . . . . Rhizobium sp. NGR234 ...................................................  348  12 hits [a-proteobacteria]       60 kDa chaperonin 2 [Rhizobium sp. NGR234] >gi|75519427|sp|
. . . . . Roseobacter sp. SK209-2-6 ..............................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Roseobacter sp. SK209-2-6] >gi|126719105|
. . . . . Brevundimonas subvibrioides ATCC 15264 .................................  348   2 hits [a-proteobacteria]       chaperonin GroEL [Brevundimonas subvibrioides ATCC 15264] >
. . . . . Paracoccus denitrificans PD1222 ........................................  347   5 hits [a-proteobacteria]       chaperonin GroEL [Paracoccus denitrificans PD1222] >gi|1193
. . . . . Paracoccus denitrificans ...............................................  347   9 hits [a-proteobacteria]       chaperonin GroEL [Paracoccus denitrificans PD1222] >gi|1193
. . . . . Ochrobactrum intermedium LMG 3301 ......................................  347   4 hits [a-proteobacteria]       chaperonin GroEL [Ochrobactrum intermedium LMG 3301] >gi|23
. . . . . Caulobacter crescentus CB15 ............................................  347   3 hits [a-proteobacteria]       chaperonin GroEL [Caulobacter crescentus CB15] >gi|22123365
. . . . . Caulobacter crescentus NA1000 ..........................................  347   3 hits [a-proteobacteria]       chaperonin GroEL [Caulobacter crescentus CB15] >gi|22123365
. . . . . Caulobacter vibrioides .................................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Caulobacter crescentus CB15] >gi|22123365
. . . . . Caulobacter segnis ATCC 21756 ..........................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Caulobacter segnis ATCC 21756] >gi|264672
. . . . . Sagittula stellata E-37 ................................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Sagittula stellata E-37] >gi|126711098|gb
. . . . . Roseobacter sp. MED193 .................................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Roseobacter sp. MED193] >gi|85827358|gb|E
. . . . . Phaeobacter gallaeciensis BS107 ........................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Phaeobacter gallaeciensis BS107] >gi|1637
. . . . . Phaeobacter gallaeciensis 2.10 .........................................  347   2 hits [a-proteobacteria]       chaperonin GroEL [Phaeobacter gallaeciensis BS107] >gi|1637
. . . . . Bartonella grahamii as4aup .............................................  347   2 hits [a-proteobacteria]       chaperonin GroEl [Bartonella grahamii as4aup] >gi|240268303
. . . . . Sinorhizobium meliloti 1021 ............................................  347  10 hits [a-proteobacteria]       chaperonin GroEL [Sinorhizobium meliloti 1021] >gi|17380427
. . . . . Sinorhizobium meliloti .................................................  347  11 hits [a-proteobacteria]       chaperonin GroEL [Sinorhizobium meliloti 1021] >gi|17380427
. . . . . Bartonella tribocorum CIP 105476 .......................................  346   3 hits [a-proteobacteria]       chaperonin GroEL [Bartonella tribocorum CIP 105476] >gi|189
. . . . . Thalassiobium sp. R2A62 ................................................  346   2 hits [a-proteobacteria]       chaperonin GroL [Thalassiobium sp. R2A62] >gi|255106380|gb|
. . . . . Bartonella henselae str. Houston-1 .....................................  346   6 hits [a-proteobacteria]       chaperonin GroEL [Bartonella henselae str. Houston-1] >gi|6
. . . . . Bartonella henselae ....................................................  346   1 hit  [a-proteobacteria]       chaperonin GroEL [Bartonella henselae str. Houston-1] >gi|6
. . . . . Caulobacter sp. K31 ....................................................  346   3 hits [a-proteobacteria]       chaperonin GroEL [Caulobacter sp. K31] >gi|189082203|sp|B0S
. . . . . Roseobacter sp. AzwK-3b ................................................  346   2 hits [a-proteobacteria]       chaperonin GroEL [Roseobacter sp. AzwK-3b] >gi|149812833|gb
. . . . . Sinorhizobium medicae WSM419 ...........................................  345  15 hits [a-proteobacteria]       chaperonin GroEL [Sinorhizobium medicae WSM419] >gi|1874707
. . . . . Beijerinckia indica subsp. indica ATCC 9039 ............................  345   3 hits [a-proteobacteria]       chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 90
. . . . . Gluconobacter oxydans 621H .............................................  345   2 hits [a-proteobacteria]       chaperonin GroEL [Gluconobacter oxydans 621H] >gi|68566253|
. . . . . Gluconobacter oxydans ..................................................  345   2 hits [a-proteobacteria]       chaperonin GroEL [Gluconobacter oxydans 621H] >gi|68566253|
. . . . . Rhizobium etli Kim 5 ...................................................  345   2 hits [a-proteobacteria]       60 kDa chaperonin, heat shock protein [Rhizobium etli Kim 5]
. . . . . Granulibacter bethesdensis CGDNIH1 .....................................  344   3 hits [a-proteobacteria]       chaperonin GroEL [Granulibacter bethesdensis CGDNIH1] >gi|1
. . . . . Rhodobacterales bacterium Y4I ..........................................  344   4 hits [a-proteobacteria]       chaperonin GroL [Rhodobacterales bacterium Y4I] >gi|2066845
. . . . . Rhizobium leguminosarum bv. viciae 3841 ................................  344   9 hits [a-proteobacteria]       chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841] 
. . . . . Bradyrhizobium japonicum USDA 110 ......................................  343  10 hits [a-proteobacteria]       chaperonin GroEL [Bradyrhizobium japonicum USDA 110] >gi|68
. . . . . Bradyrhizobium japonicum ...............................................  343   9 hits [a-proteobacteria]       chaperonin GroEL [Bradyrhizobium japonicum USDA 110] >gi|68
. . . . . Nitrobacter winogradskyi Nb-255 ........................................  343   9 hits [a-proteobacteria]       chaperonin GroEL [Nitrobacter winogradskyi Nb-255] >gi|1193
. . . . . Agrobacterium radiobacter K84 ..........................................  342   6 hits [a-proteobacteria]       Chaperonin GroEL [Agrobacterium radiobacter K84] >gi|221722
. . . . . Azorhizobium caulinodans ORS 571 .......................................  342   6 hits [a-proteobacteria]       chaperonin [Azorhizobium caulinodans ORS 571] >gi|187470684
. . . . . Xanthobacter autotrophicus Py2 .........................................  341   4 hits [a-proteobacteria]       chaperonin GroEL [Xanthobacter autotrophicus Py2] >gi|15416
. . . . . Nitrobacter hamburgensis X14 ...........................................  341   9 hits [a-proteobacteria]       chaperonin GroEL [Nitrobacter hamburgensis X14] >gi|1193662
. . . . . Methylocella silvestris BL2 ............................................  341   3 hits [a-proteobacteria]       chaperonin GroEL [Methylocella silvestris BL2] >gi|25481389
. . . . . Gluconacetobacter diazotrophicus PAl 5 .................................  340  10 hits [a-proteobacteria]       chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5] >
. . . . . Acetobacter pasteurianus IFO 3283-01 ...................................  340   3 hits [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-03 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-07 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-22 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-26 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-32 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-01-42C ...............................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Acetobacter pasteurianus IFO 3283-12 ...................................  340   1 hit  [a-proteobacteria]       heat shock protein GroEL [Acetobacter pasteurianus IFO 3283
. . . . . Methylobacterium extorquens AM1 ........................................  340   4 hits [a-proteobacteria]       60 kDa chaperonin (protein Cpn60, groEL protein) [Methyloba
. . . . . Rhizobium etli CIAT 894 ................................................  340   1 hit  [a-proteobacteria]       chaperonin GroEL [Rhizobium etli CIAT 894]
. . . . . Maricaulis maris MCS10 .................................................  340   3 hits [a-proteobacteria]       chaperonin GroEL [Maricaulis maris MCS10] >gi|122316675|sp|
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  340   3 hits [a-proteobacteria]       chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2
. . . . . Rhodobacter capsulatus .................................................  340   2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Erythrobacter sp. NAP1 .................................................  340   2 hits [a-proteobacteria]       chaperonin GroEL [Erythrobacter sp. NAP1] >gi|85688269|gb|E
. . . . . Oligotropha carboxidovorans OM5 ........................................  340   4 hits [a-proteobacteria]       chaperonin GroL [Oligotropha carboxidovorans OM5] >gi|20987
. . . . . Acidiphilium cryptum JF-5 ..............................................  340   3 hits [a-proteobacteria]       chaperonin GroEL [Acidiphilium cryptum JF-5] >gi|166198428|
. . . . . Rhodopseudomonas palustris DX-1 ........................................  340   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris DX-1] >gi|2835
. . . . . Rhodopseudomonas palustris CGA009 ......................................  339   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris CGA009] >gi|42
. . . . . Rhodopseudomonas palustris TIE-1 .......................................  339   4 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris TIE-1] >gi|192
. . . . . Rhizobium etli IE4771 ..................................................  339   1 hit  [a-proteobacteria]       60 kDa chaperonin, heat shock protein [Rhizobium etli IE477
. . . . . Phenylobacterium zucineum HLK1 .........................................  339   4 hits [a-proteobacteria]       heat shock protein chaperonin, HSP60 [Phenylobacterium zuci
. . . . . Agrobacterium tumefaciens str. C58 .....................................  339   4 hits [a-proteobacteria]       chaperonin GroEL [Agrobacterium tumefaciens str. C58] >gi|2
. . . . . uncultured alpha proteobacterium EBAC2C11 ..............................  338   1 hit  [a-proteobacteria]       predicted chaperonin GroEL [uncultured alpha proteobacteriu
. . . . . Magnetospirillum gryphiswaldense .......................................  338   1 hit  [a-proteobacteria]       unnamed protein product [Magnetospirillum gryphiswaldense] 
. . . . . Magnetospirillum gryphiswaldense MSR-1 .................................  338   1 hit  [a-proteobacteria]       unnamed protein product [Magnetospirillum gryphiswaldense] 
. . . . . Rhizobium leguminosarum bv. viciae .....................................  338   1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Erythrobacter litoralis HTCC2594 .......................................  338   6 hits [a-proteobacteria]       chaperonin GroEL [Erythrobacter litoralis HTCC2594] >gi|123
. . . . . Magnetospirillum magneticum AMB-1 ......................................  337   3 hits [a-proteobacteria]       chaperonin GroEL [Magnetospirillum magneticum AMB-1] >gi|11
. . . . . Magnetospirillum magnetotacticum MS-1 ..................................  337   1 hit  [a-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Magnetospirillum 
. . . . . Rhodobacter sp. SW2 ....................................................  337   2 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacter sp. SW2] >gi|259021355|gb|EEW
. . . . . Sphingomonas wittichii RW1 .............................................  337   3 hits [a-proteobacteria]       chaperonin GroEL [Sphingomonas wittichii RW1] >gi|166201753
. . . . . Acetobacter aceti ......................................................  337   1 hit  [a-proteobacteria]       groEL [Acetobacter aceti]
. . . . . Agrobacterium vitis S4 .................................................  337   3 hits [a-proteobacteria]       chaperonin [Agrobacterium vitis S4] >gi|254813866|sp|B9K1Y8
. . . . . Novosphingobium aromaticivorans DSM 12444 ..............................  337   3 hits [a-proteobacteria]       chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444
. . . . . Erythrobacter sp. SD-21 ................................................  337   2 hits [a-proteobacteria]       chaperonin GroEL [Erythrobacter sp. SD-21] >gi|148830704|gb
. . . . . Bartonella bacilliformis KC583 .........................................  336   3 hits [a-proteobacteria]       chaperonin GroEL [Bartonella bacilliformis KC583] >gi|16619
. . . . . Bartonella bacilliformis ...............................................  336   4 hits [a-proteobacteria]       chaperonin GroEL [Bartonella bacilliformis KC583] >gi|16619
. . . . . Sphingopyxis alaskensis RB2256 .........................................  336   4 hits [a-proteobacteria]       chaperonin GroEL [Sphingopyxis alaskensis RB2256] >gi|11859
. . . . . Sphingopyxis alaskensis ................................................  336   2 hits [a-proteobacteria]       chaperonin GroEL [Sphingopyxis alaskensis RB2256] >gi|11859
. . . . . Rhodopseudomonas palustris HaA2 ........................................  336   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris HaA2] >gi|1193
. . . . . Rhodopseudomonas palustris BisB5 .......................................  335   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris BisB5] >gi|123
. . . . . Roseovarius sp. 217 ....................................................  335   2 hits [a-proteobacteria]       chaperonin GroEL [Roseovarius sp. 217] >gi|85671138|gb|EAQ2
. . . . . Sphingomonas sp. SKA58 .................................................  335   2 hits [a-proteobacteria]       chaperonin GroEL [Sphingomonas sp. SKA58] >gi|94423143|gb|E
. . . . . Nitrobacter sp. Nb-311A ................................................  334   4 hits [a-proteobacteria]       chaperonin GroEL [Nitrobacter sp. Nb-311A] >gi|85697552|gb|
. . . . . Rhizobium etli GR56 ....................................................  333   1 hit  [a-proteobacteria]       chaperonin GroEL [Rhizobium etli GR56]
. . . . . Agrobacterium tumefaciens ..............................................  332   1 hit  [a-proteobacteria]       heat shock protein GroEL - Agrobacterium tumefaciens
. . . . . Labrenzia alexandrii DFL-11 ............................................  332   2 hits [a-proteobacteria]       chaperonin GroL [Labrenzia alexandrii DFL-11] >gi|222441362
. . . . . Zymomonas mobilis subsp. mobilis ZM4 ...................................  332   2 hits [a-proteobacteria]       chaperonin GroEL [Zymomonas mobilis subsp. mobilis ZM4] >gi
. . . . . Zymomonas mobilis ......................................................  332   1 hit  [a-proteobacteria]       chaperonin GroEL [Zymomonas mobilis subsp. mobilis ZM4] >gi
. . . . . Zymomonas mobilis subsp. mobilis ATCC 10988 ............................  332   2 hits [a-proteobacteria]       chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 109
. . . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ...........................  332   2 hits [a-proteobacteria]       chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 109
. . . . . Labrenzia aggregata IAM 12614 ..........................................  331   2 hits [a-proteobacteria]       chaperonin GroEL [Stappia aggregata IAM 12614] >gi|11843665
. . . . . Hyphomicrobium denitrificans ATCC 51888 ................................  330   2 hits [a-proteobacteria]       chaperonin GroEL [Hyphomicrobium denitrificans ATCC 51888] 
. . . . . Parvibaculum lavamentivorans DS-1 ......................................  330   3 hits [a-proteobacteria]       chaperonin GroEL [Parvibaculum lavamentivorans DS-1] >gi|18
. . . . . Rhodopseudomonas palustris BisB18 ......................................  330   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris BisB18] >gi|11
. . . . . Rhodomicrobium vannielii ATCC 17100 ....................................  329   2 hits [a-proteobacteria]       chaperonin GroEL [Rhodomicrobium vannielii ATCC 17100] >gi|
. . . . . Hoeflea phototrophica DFL-43 ...........................................  329   2 hits [a-proteobacteria]       chaperonin GroEL [Hoeflea phototrophica DFL-43] >gi|1622846
. . . . . Rhodopseudomonas palustris BisA53 ......................................  329   6 hits [a-proteobacteria]       chaperonin GroEL [Rhodopseudomonas palustris BisA53] >gi|12
. . . . . Octadecabacter antarcticus 307 .........................................  328   4 hits [a-proteobacteria]       chaperonin GroL [Octadecabacter antarcticus 307] >gi|198250
. . . . . Octadecabacter antarcticus 238 .........................................  327   6 hits [a-proteobacteria]       chaperonin GroL [Octadecabacter antarcticus 238] >gi|198264
. . . . . Hyphomonas neptunium ATCC 15444 ........................................  322   3 hits [a-proteobacteria]       chaperonin GroEL [Hyphomonas neptunium ATCC 15444] >gi|1233
. . . . . Rhodobacterales bacterium HTCC2255 .....................................  322   3 hits [a-proteobacteria]       chaperonin GroEL [alpha proteobacterium HTCC2255] >gi|11455
. . . . . Ochrobactrum anthropi ATCC 49188 .......................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Ochrobactrum anthropi ATCC 49188] >gi|166
. . . . . Brucella ceti str. Cudo ................................................  320   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti str. Cudo] >gi|260166978|re
. . . . . Brucella sp. F5/99 .....................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti str. Cudo] >gi|260166978|re
. . . . . Brucella ceti M490/95/1 ................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti M490/95/1] >gi|265996604|re
. . . . . Brucella suis 1330 .....................................................  320   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella canis ATCC 23365 ..............................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella suis ATCC 23445 ...............................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella suis bv. 5 str. 513 ...........................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella suis bv. 3 str. 686 ...........................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella pinnipedialis B2/94 ...........................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella sp. 83/13 .....................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella microti CCM 4915 ..............................................  320   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella pinnipedialis M292/94/1 .......................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella suis bv. 4 str. 40 ............................................  320   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella suis ..........................................................  320   1 hit  [a-proteobacteria]       chaperonin GroEL [Brucella suis 1330] >gi|161620274|ref|YP_
. . . . . Brucella ceti B1/94 ....................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti B1/94] >gi|261220048|ref|ZP
. . . . . Asticcacaulis excentricus CB 48 ........................................  320   2 hits [a-proteobacteria]       chaperonin GroEL [Asticcacaulis excentricus CB 48] >gi|2412
. . . . . Brucella pinnipedialis M163/99/10 ......................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella pinnipedialis M163/99/10] >gi|26
. . . . . Brucella neotomae 5K33 .................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella neotomae 5K33] >gi|261323538|ref
. . . . . Brucella ceti M644/93/1 ................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti M644/93/1] >gi|254715121|re
. . . . . Brucella ceti M13/05/1 .................................................  320   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ceti M644/93/1] >gi|254715121|re
. . . . . Rhodobacterales bacterium HTCC2150 .....................................  319   2 hits [a-proteobacteria]       chaperonin GroEL [Rhodobacterales bacterium HTCC2150] >gi|1
. . . . . Brucella abortus bv. 1 str. 9-941 ......................................  318   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis biovar Abortus 2308 ................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus S19 ...................................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis ATCC 23457 .........................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus str. 2308 A ...........................................  318   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus bv. 6 str. 870 ........................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus bv. 3 str. Tulya ......................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus bv. 2 str. 86/8/59 ....................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus bv. 4 str. 292 ........................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis bv. 1 str. Rev.1 ...................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis bv. 3 str. Ether ...................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus bv. 9 str. C68 ........................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis bv. 2 str. 63/9 ....................................  318   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus NCTC 8038 .............................................  318   2 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella melitensis bv. 1 str. 16M .....................................  318   4 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella abortus .......................................................  318   4 hits [a-proteobacteria]       chaperonin GroEL [Brucella abortus bv. 1 str. 9-941] >gi|83
. . . . . Brucella ovis ATCC 25840 ...............................................  318   3 hits [a-proteobacteria]       chaperonin GroEL [Brucella ovis ATCC 25840] >gi|166198437|s
. . . . . Brucella melitensis ....................................................  318   1 hit  [a-proteobacteria]       chaperonin GroEL [Brucella melitensis 16M] >gi|25452857|sp|
. . . . . Ochrobactrum pseudogrignonense .........................................  316   1 hit  [a-proteobacteria]       chaperonin GroEL [Ochrobactrum pseudogrignonense]
. . . . . Ochrobactrum sp. CCUG 50899 ............................................  315   1 hit  [a-proteobacteria]       chaperonin GroEL [Ochrobactrum sp. CCUG 50899]
. . . . . Ochrobactrum rhizosphaerae .............................................  315   1 hit  [a-proteobacteria]       chaperonin GroEL [Ochrobactrum rhizosphaerae]
. . . . . Ochrobactrum thiophenivorans ...........................................  314   1 hit  [a-proteobacteria]       chaperonin GroEL [Ochrobactrum thiophenivorans]
. . . . . Ochrobactrum grignonense ...............................................  314   1 hit  [a-proteobacteria]       chaperonin GroEL [Ochrobactrum grignonense]
. . . . . Candidatus Hodgkinia cicadicola Dsem ...................................  302   2 hits [a-proteobacteria]       chaperonin GroEL [Candidatus Hodgkinia cicadicola Dsem] >gi
. . . . . Bartonella doshiae .....................................................  296   1 hit  [a-proteobacteria]       60 kDa heat shock protein [Bartonella doshiae]
. . . . Magnetococcus sp. MC-1 ---------------------------------------------------  335   3 hits [proteobacteria]         chaperonin GroEL [Magnetococcus sp. MC-1] >gi|167008695|sp|
. . . . Acidithiobacillus caldus ATCC 51756 ......................................  328   2 hits [g-proteobacteria]       Heat shock protein 60 family chaperone GroEL [Acidithiobaci
. . . . Desulfomicrobium baculatum DSM 4028 ......................................  327   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfomicrobium baculatum DSM 4028] >gi|
. . . . Bermanella marisrubri ....................................................  326   2 hits [g-proteobacteria]       chaperonin GroEL [Oceanobacter sp. RED65] >gi|94427038|gb|E
. . . . Psychromonas ingrahamii 37 ...............................................  326   6 hits [g-proteobacteria]       chaperonin Cpn60, GroEL, large subunit of GroESL [Psychromo
. . . . Pelobacter propionicus DSM 2379 ..........................................  324   3 hits [d-proteobacteria]       chaperonin GroEL [Pelobacter propionicus DSM 2379] >gi|1662
. . . . Acidithiobacillus ferrooxidans ATCC 53993 ................................  322   3 hits [g-proteobacteria]       chaperonin GroEL [Acidithiobacillus ferrooxidans ATCC 53993
. . . . Acidithiobacillus ferrooxidans ATCC 23270 ................................  322   3 hits [g-proteobacteria]       chaperonin GroEL [Acidithiobacillus ferrooxidans ATCC 53993
. . . . Geobacter sp. FRC-32 .....................................................  321   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter sp. FRC-32] >gi|254813890|sp|B9
. . . . Teredinibacter turnerae T7901 ............................................  321   3 hits [g-proteobacteria]       chaperonin GroL [Teredinibacter turnerae T7901] >gi|2595859
. . . . Saccharophagus degradans 2-40 ............................................  321   3 hits [g-proteobacteria]       chaperonin, 60 kDa [Saccharophagus degradans 2-40] >gi|1193
. . . . Syntrophus aciditrophicus SB .............................................  321   9 hits [d-proteobacteria]       chaperonin GroEL [Syntrophus aciditrophicus SB] >gi|1193662
. . . . Geobacter sulfurreducens PCA .............................................  321   2 hits [d-proteobacteria]       chaperonin GroEL [Geobacter sulfurreducens PCA] >gi|5979782
. . . . Geobacter sulfurreducens .................................................  321   1 hit  [d-proteobacteria]       chaperonin GroEL [Geobacter sulfurreducens PCA] >gi|5979782
. . . . Desulfovibrio salexigens DSM 2638 ........................................  321   4 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio salexigens DSM 2638] >gi|24
. . . . Alteromonas macleodii ATCC 27126 .........................................  320   1 hit  [g-proteobacteria]       chaperonin GroEL [Alteromonas macleodii ATCC 27126]
. . . . Desulfovibrio sp. FW1012B ................................................  320   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio sp. FW1012B] >gi|283570720|
. . . . Geobacter metallireducens GS-15 ..........................................  320   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter metallireducens GS-15] >gi|1193
. . . . Alteromonas macleodii 'Deep ecotype' .....................................  320   3 hits [g-proteobacteria]       Chaperonin GroEL (HSP60 family) protein [Alteromonas macleo
. . . . Bdellovibrio bacteriovorus HD100 .........................................  320   2 hits [d-proteobacteria]       60 kDa chaperonin [Bdellovibrio bacteriovorus HD100] >gi|59
. . . . Bdellovibrio bacteriovorus ...............................................  320   1 hit  [d-proteobacteria]       60 kDa chaperonin [Bdellovibrio bacteriovorus HD100] >gi|59
. . . . Desulfovibrio aespoeensis Aspo-2 .........................................  319   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio aespoeensis Aspo-2] >gi|270
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................  319   3 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio desulfuricans subsp. desulf
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  319   4 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Escherichia coli APEC O1 .................................................  319   6 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Escherichia coli .........................................................  319 337 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Geobacter uraniireducens Rf4 .............................................  318   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter uraniireducens Rf4] >gi|1874707
. . . . Geobacter sp. M18 ........................................................  318   2 hits [d-proteobacteria]       chaperonin GroEL [Geobacter sp. M18] >gi|254985280|gb|EET36
. . . . Mariprofundus ferrooxydans PV-1 ..........................................  318   2 hits [proteobacteria]         chaperonin, 60 kDa subunit [Mariprofundus ferrooxydans PV-1
. . . . Desulfovibrio magneticus RS-1 ............................................  318   3 hits [d-proteobacteria]       60 kDa chaperonin [Desulfovibrio magneticus RS-1] >gi|25958
. . . . Xanthomonas campestris pv. phaseoli ......................................  318   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Desulfohalobium retbaense DSM 5692 .......................................  317   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfohalobium retbaense DSM 5692] >gi|2
. . . . Anaeromyxobacter sp. Fw109-5 .............................................  317   6 hits [d-proteobacteria]       chaperonin GroEL [Anaeromyxobacter sp. Fw109-5] >gi|1874706
. . . . Thiomonas intermedia K12 .................................................  317   2 hits [b-proteobacteria]       chaperonin GroEL [Thiomonas intermedia K12] >gi|256742498|g
. . . . Geobacter bemidjiensis Bem ...............................................  317   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter bemidjiensis Bem] >gi|226704133
. . . . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................  317   2 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas campestris pv. campestris str
. . . . Xanthomonas campestris pv. campestris str. 8004 ..........................  317   3 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas campestris pv. campestris str
. . . . Xanthomonas campestris pv. campestris ....................................  317   2 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas campestris pv. campestris str
. . . . Haliangium ochraceum DSM 14365 ...........................................  317   4 hits [d-proteobacteria]       chaperonin GroEL [Haliangium ochraceum DSM 14365] >gi|26208
. . . . Anaeromyxobacter dehalogenans 2CP-1 ......................................  317   4 hits [d-proteobacteria]       chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1] >gi|
. . . . Myxococcus xanthus DK 1622 ...............................................  317   6 hits [d-proteobacteria]       chaperonin GroEL [Myxococcus xanthus DK 1622] >gi|118597098
. . . . Anaeromyxobacter dehalogenans 2CP-C ......................................  317   6 hits [d-proteobacteria]       chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C] >gi|
. . . . Xanthomonas campestris pv. campestris str. B100 ..........................  316   2 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas campestris pv. campestris str
. . . . Anaeromyxobacter sp. K ...................................................  316   4 hits [d-proteobacteria]       chaperonin GroEL [Anaeromyxobacter sp. K] >gi|196173900|gb|
. . . . Plesiocystis pacifica SIR-1 ..............................................  316   2 hits [d-proteobacteria]       chaperonin Cpn60, GroEL [Plesiocystis pacifica SIR-1] >gi|1
. . . . Geobacter sp. M21 ........................................................  316   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter sp. M21] >gi|259585907|sp|C6DY4
. . . . Lawsonia intracellularis PHE/MN1-00 ......................................  315   3 hits [d-proteobacteria]       chaperonin GroEL [Lawsonia intracellularis PHE/MN1-00] >gi|
. . . . Lawsonia intracellularis .................................................  315   2 hits [d-proteobacteria]       HSP60 [Lawsonia intracellularis]
. . . . Xanthomonas oryzae pv. oryzicola BLS256 ..................................  315   1 hit  [g-proteobacteria]       chaperonin GroEL [Xanthomonas oryzae pv. oryzicola BLS256]
. . . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................  315   3 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas campestris pv. vesicatoria st
. . . . Xanthomonas oryzae pv. oryzae KACC10331 ..................................  315   2 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  315   3 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Xanthomonas oryzae pv. oryzae PXO99A .....................................  315   3 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Xanthomonas oryzae pv. oryzae ............................................  315   1 hit  [g-proteobacteria]       chaperonin GroEL [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Xanthomonas axonopodis pv. citri str. 306 ................................  315   2 hits [g-proteobacteria]       chaperonin GroEL [Xanthomonas axonopodis pv. citri str. 306
. . . . Xanthomonas axonopodis pv. citri .........................................  315   1 hit  [g-proteobacteria]       chaperonin GroEL [Xanthomonas axonopodis pv. citri str. 306
. . . . Desulfovibrio vulgaris str. Hildenborough ................................  315   3 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris st
. . . . Desulfovibrio vulgaris DP4 ...............................................  315   3 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris st
. . . . Desulfovibrio vulgaris RCH1 ..............................................  315   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris st
. . . . gamma proteobacterium HTCC2207 ...........................................  315   2 hits [g-proteobacteria]       chaperonin GroEL [marine gamma proteobacterium HTCC2207] >g
. . . . Azotobacter vinelandii ...................................................  315   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Azotobacter vinelandii DJ ................................................  315   2 hits [g-proteobacteria]       chaperonin GroEL/Hsp60 [Azotobacter vinelandii DJ] >gi|2267
. . . . Idiomarina baltica OS145 .................................................  314   2 hits [g-proteobacteria]       Chaperonin GroEL (HSP60 family protein) [Idiomarina baltica
. . . . Oleispira antarctica RB-8 ................................................  314   4 hits [g-proteobacteria]       Cpn60SR single-ring chaperonin 60 variant [Oleispira antarc
. . . . Coxiella burnetii RSA 331 ................................................  314   3 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 331] >gi|189082349|s
. . . . Coxiella burnetii ........................................................  314   8 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 331] >gi|189082349|s
. . . . Coxiella burnetii RSA 493 ................................................  314   2 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|r
. . . . Coxiella burnetii 'MSU Goat Q177' ........................................  314   2 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|r
. . . . Coxiella burnetii Dugway 5J108-111 .......................................  314   3 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|r
. . . . Coxiella burnetii CbuG_Q212 ..............................................  314   3 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|r
. . . . Coxiella burnetii CbuK_Q154 ..............................................  314   3 hits [g-proteobacteria]       chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|r
. . . . Methylophaga thiooxidans DMS010 ..........................................  314   2 hits [g-proteobacteria]       chaperonin GroL [Methylophaga thiooxidans DMS010] >gi|22446
. . . . Oleispira antarctica .....................................................  314   1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  313   3 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio vulgaris str. 'Miyazaki F']
. . . . secondary endosymbiont of Bemisia tabaci .................................  313   9 hits [enterobacteria]         chaperonin GroEL [secondary endosymbiont of Bemisia tabaci]
. . . . Methylococcus capsulatus str. Bath .......................................  313   4 hits [g-proteobacteria]       chaperonin, 60 kDa subunit [Methylococcus capsulatus str. B
. . . . Methylococcus capsulatus .................................................  313   2 hits [g-proteobacteria]       chaperonin, 60 kDa subunit [Methylococcus capsulatus str. B
. . . . Hahella chejuensis KCTC 2396 .............................................  313   3 hits [g-proteobacteria]       chaperonin GroEL [Hahella chejuensis KCTC 2396] >gi|1193662
. . . . Alcanivorax borkumensis SK2 ..............................................  313   3 hits [g-proteobacteria]       chaperonin, 60 kDa [Alcanivorax borkumensis SK2] >gi|118597
. . . . Desulfonatronospira thiodismutans ASO3-1 .................................  313   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfonatronospira thiodismutans ASO3-1]
. . . . Grimontia hollisae CIP 101886 ............................................  313   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Grimontia hol
. . . . Alcanivorax sp. DG881 ....................................................  313   2 hits [g-proteobacteria]       chaperonin GroL [Alcanivorax sp. DG881] >gi|196193229|gb|ED
. . . . Vibrio vulnificus CMCP6 ..................................................  312   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio vulnificus CMCP6] >gi|37677319|ref
. . . . Vibrio vulnificus YJ016 ..................................................  312   6 hits [g-proteobacteria]       chaperonin GroEL [Vibrio vulnificus CMCP6] >gi|37677319|ref
. . . . Vibrio vulnificus ........................................................  312   3 hits [g-proteobacteria]       chaperonin GroEL [Vibrio vulnificus CMCP6] >gi|37677319|ref
. . . . Aggregatibacter aphrophilus NJ8700 .......................................  312   2 hits [g-proteobacteria]       chaperonin GroL [Aggregatibacter aphrophilus NJ8700] >gi|24
. . . . Neisseria meningitidis ...................................................  312   1 hit  [b-proteobacteria]       heat-shock protein [Neisseria meningitidis]
. . . . Psychromonas sp. CNPT3 ...................................................  312   2 hits [g-proteobacteria]       chaperonin GroEL [Psychromonas sp. CNPT3] >gi|90309794|gb|E
. . . . Limnobacter sp. MED105 ...................................................  311   2 hits [b-proteobacteria]       chaperonin GroEL [Limnobacter sp. MED105] >gi|149823404|gb|
. . . . Francisella tularensis ...................................................  311   1 hit  [g-proteobacteria]       groEL [Francisella tularensis]
. . . . Actinobacillus minor NM305 ...............................................  311   2 hits [g-proteobacteria]       chaperonin GroEL (HSP60 family) protein [Actinobacillus min
. . . . Neisseria meningitidis 053442 ............................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis 053442] >gi|189082
. . . . Francisella tularensis subsp. holarctica FTNF002-00 ......................  311   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica 
. . . . Francisella tularensis subsp. holarctica .................................  311   1 hit  [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica]
. . . . Francisella tularensis subsp. holarctica OSU18 ...........................  311   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica]
. . . . Francisella tularensis subsp. holarctica FSC200 ..........................  311   1 hit  [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica]
. . . . Francisella tularensis subsp. holarctica 257 .............................  311   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica]
. . . . Francisella tularensis subsp. holarctica LVS .............................  311   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. holarctica]
. . . . Neisseria meningitidis alpha14 ...........................................  311   2 hits [b-proteobacteria]       60 kDa chaperonin [Neisseria meningitidis alpha14] >gi|2546
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........  311   3 hits [d-proteobacteria]       chaperonin GroEL [Desulfovibrio desulfuricans subsp. desulf
. . . . Haemophilus parasuis SH0165 ..............................................  311   3 hits [g-proteobacteria]       chaperonin GroEL (HSP60 family) [Haemophilus parasuis SH016
. . . . Cardiobacterium hominis ATCC 15826 .......................................  311   2 hits [g-proteobacteria]       chaperonin GroEL [Cardiobacterium hominis ATCC 15826] >gi|2
. . . . Mannheimia haemolytica PHL213 ............................................  311   2 hits [g-proteobacteria]       chaperone GroEL [Mannheimia haemolytica PHL213] >gi|2614934
. . . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  311   2 hits [g-proteobacteria]       chaperone GroEL [Mannheimia haemolytica PHL213] >gi|2614934
. . . . Mannheimia haemolytica serotype A2 str. OVINE ............................  311   2 hits [g-proteobacteria]       chaperone GroEL [Mannheimia haemolytica PHL213] >gi|2614934
. . . . Desulfobacterium autotrophicum HRM2 ......................................  311   2 hits [d-proteobacteria]       GroEL [Desulfobacterium autotrophicum HRM2] >gi|223692860|g
. . . . Stenotrophomonas maltophilia R551-3 ......................................  311   3 hits [g-proteobacteria]       chaperonin GroEL [Stenotrophomonas maltophilia R551-3] >gi|
. . . . marine gamma proteobacterium HTCC2143 ....................................  311   2 hits [g-proteobacteria]       chaperonin GroEL [marine gamma proteobacterium HTCC2143] >g
. . . . Neisseria gonorrhoeae ....................................................  311   3 hits [b-proteobacteria]       heat-shock protein [Neisseria gonorrhoeae]
. . . . Nitrosospira multiformis ATCC 25196 ......................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Nitrosospira multiformis ATCC 25196] >gi|
. . . . Dichelobacter nodosus VCS1703A ...........................................  311   3 hits [g-proteobacteria]       chaperonin GroEL [Dichelobacter nodosus VCS1703A] >gi|16619
. . . . Neisseria sicca ATCC 29256 ...............................................  311   2 hits [b-proteobacteria]       chaperonin GroL [Neisseria sicca ATCC 29256] >gi|255050169|
. . . . Neisseria gonorrhoeae NCCP11945 ..........................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae NCCP11945] >gi|2267
. . . . Pseudoalteromonas atlantica T6c ..........................................  311   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudoalteromonas atlantica T6c] >gi|1233
. . . . Idiomarina loihiensis L2TR ...............................................  311   2 hits [g-proteobacteria]       chaperonin GroEL [Idiomarina loihiensis L2TR] >gi|68566265|
. . . . Idiomarina loihiensis ....................................................  311   1 hit  [g-proteobacteria]       chaperonin GroEL [Idiomarina loihiensis L2TR] >gi|68566265|
. . . . Polaromonas sp. JS666 ....................................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Polaromonas sp. JS666] >gi|118597119|sp|Q
. . . . Neisseria gonorrhoeae FA19 ...............................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA19] >gi|240116963
. . . . Neisseria gonorrhoeae PID1 ...............................................  311   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA19] >gi|240116963
. . . . Neisseria mucosa ATCC 25996 ..............................................  311   1 hit  [b-proteobacteria]       60 kDa chaperonin [Neisseria mucosa ATCC 25996]
. . . . Sorangium cellulosum 'So ce 56' ..........................................  311   6 hits [d-proteobacteria]       GroEL like chaperone [Sorangium cellulosum 'So ce 56'] >gi|
. . . . Neisseria gonorrhoeae FA 1090 ............................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|240112
. . . . Neisseria gonorrhoeae MS11 ...............................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|240112
. . . . Neisseria gonorrhoeae SK-92-679 ..........................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|240112
. . . . Neisseria gonorrhoeae SK-93-1035 .........................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|240112
. . . . Neisseria gonorrhoeae DGI2 ...............................................  310   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|240112
. . . . Sorangium cellulosum .....................................................  310   1 hit  [d-proteobacteria]       chaperonin GroEL2 [Sorangium cellulosum]
. . . . Actinobacillus minor 202 .................................................  310   2 hits [g-proteobacteria]       60 kDa chaperonin [Actinobacillus minor 202] >gi|207298804|
. . . . Stenotrophomonas maltophilia K279a .......................................  310   3 hits [g-proteobacteria]       putative GroEL protein [Stenotrophomonas maltophilia K279a]
. . . . Neisseria meningitidis FAM18 .............................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis FAM18] >gi|2187674
. . . . Neisseria meningitidis Z2491 .............................................  310   2 hits [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis FAM18] >gi|2187674
. . . . Neisseria meningitidis serogroup A .......................................  310   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis FAM18] >gi|2187674
. . . . Haemophilus parasuis 29755 ...............................................  310   2 hits [g-proteobacteria]       50S ribosomal protein L28 [Haemophilus parasuis 29755] >gi|
. . . . Curvibacter putative symbiont of Hydra magnipapillata ....................  310   2 hits [b-proteobacteria]       60 kDa chaperonin 2 [Curvibacter putative symbiont of Hydra
. . . . Methylibium petroleiphilum PM1 ...........................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Methylibium petroleiphilum PM1] >gi|16620
. . . . Polaromonas naphthalenivorans CJ2 ........................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Polaromonas naphthalenivorans CJ2] >gi|18
. . . . Chromobacterium violaceum ATCC 12472 .....................................  310   4 hits [b-proteobacteria]       chaperonin 60kD subunit [Chromobacterium violaceum ATCC 124
. . . . Chromobacterium violaceum ................................................  310   2 hits [b-proteobacteria]       chaperonin 60kD subunit [Chromobacterium violaceum ATCC 124
. . . . Desulfovibrio piger ATCC 29098 ...........................................  310   2 hits [d-proteobacteria]       hypothetical protein DESPIG_00651 [Desulfovibrio piger ATCC
. . . . Photorhabdus asymbiotica .................................................  310   2 hits [enterobacteria]         60 kda chaperonin (protein cpn60) (groel protein) [Photorha
. . . . delta proteobacterium MLMS-1 .............................................  310   2 hits [d-proteobacteria]       Chaperonin Cpn60/TCP-1 [delta proteobacterium MLMS-1] >gi|9
. . . . Neisseria meningitidis 8013 ..............................................  310   1 hit  [b-proteobacteria]       60 kDa chaperonin (protein Cpn60; GroEL protein; 63 kDa str
. . . . Vibrio parahaemolyticus RIMD 2210633 .....................................  310   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Vibrio parahaemolyticus K5030 ............................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Vibrio parahaemolyticus AN-5034 ..........................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Vibrio parahaemolyticus Peru-466 .........................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Vibrio parahaemolyticus AQ4037 ...........................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Vibrio parahaemolyticus ..................................................  310   3 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Neisseria meningitidis MC58 ..............................................  310   2 hits [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis MC58] >gi|9911060|
. . . . Neisseria meningitidis serogroup B .......................................  310   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria meningitidis MC58] >gi|9911060|
. . . . Acinetobacter lwoffii SH145 ..............................................  310   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter lwoffii SH145] >gi|262308990
. . . . Aromatoleum aromaticum EbN1 ..............................................  310   3 hits [b-proteobacteria]       chaperonin GroEL [Aromatoleum aromaticum EbN1] >gi|68566262
. . . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................  310   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella philomiragia subsp. philomira
. . . . Francisella novicida GA99-3548 ...........................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella novicida GA99-3548] >gi|15157
. . . . Francisella tularensis subsp. tularensis WY96-3418 .......................  310   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. holarctica FSC022 ..........................  310   2 hits [g-proteobacteria]       chaperone protein [Francisella tularensis subsp. holarctica
. . . . Francisella philomiragia subsp. philomiragia ATCC 25015 ..................  310   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella philomiragia subsp. philomira
. . . . Vibrio harveyi HY01 ......................................................  310   2 hits [g-proteobacteria]       chaperonin GroL [Vibrio harveyi HY01] >gi|156972510|ref|YP_
. . . . Vibrio harveyi ATCC BAA-1116 .............................................  310   3 hits [g-proteobacteria]       chaperonin GroL [Vibrio harveyi HY01] >gi|156972510|ref|YP_
. . . . Francisella novicida U112 ................................................  310   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. novicida U1
. . . . Francisella novicida FTE .................................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. novicida U1
. . . . Francisella novicida FTG .................................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. novicida U1
. . . . Francisella novicida GA99-3549 ...........................................  310   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. novicida U1
. . . . Providencia rettgeri DSM 1131 ............................................  310   1 hit  [enterobacteria]         60 kda chaperonin (protein cpn60) (groel protein) [Providen
. . . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................  310   3 hits [enterobacteria]         chaperone Hsp60 (GroEL) [Candidatus Hamiltonella defensa 5A
. . . . Allochromatium vinosum DSM 180 ...........................................  309   5 hits [g-proteobacteria]       chaperonin GroEL [Allochromatium vinosum DSM 180] >gi|24146
. . . . Thioalkalivibrio sp. HL-EbGR7 ............................................  309   3 hits [g-proteobacteria]       chaperonin GroEL [Thioalkalivibrio sp. HL-EbGR7] >gi|254813
. . . . Comamonas testosteroni CNB-2 .............................................  309   2 hits [b-proteobacteria]       chaperonin GroEL [Comamonas testosteroni CNB-2] >gi|2622072
. . . . Aggregatibacter actinomycetemcomitans D11S-1 .............................  309   2 hits [g-proteobacteria]       hypothetical protein D11S_0600 [Aggregatibacter actinomycet
. . . . Aggregatibacter actinomycetemcomitans ....................................  309   2 hits [g-proteobacteria]       hypothetical protein D11S_0600 [Aggregatibacter actinomycet
. . . . Laribacter hongkongensis HLHK9 ...........................................  309   4 hits [b-proteobacteria]       GroEL1 [Laribacter hongkongensis HLHK9] >gi|226714515|gb|AC
. . . . Cellvibrio japonicus Ueda107 .............................................  309   3 hits [g-proteobacteria]       chaperonin GroEL [Cellvibrio japonicus Ueda107] >gi|2267040
. . . . Neisseria gonorrhoeae DGI18 ..............................................  309   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae DGI18] >gi|24012029
. . . . Neisseria gonorrhoeae PID24-1 ............................................  309   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae DGI18] >gi|24012029
. . . . Neisseria gonorrhoeae 1291 ...............................................  309   2 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae DGI18] >gi|24012029
. . . . Neisseria gonorrhoeae FA6140 .............................................  309   1 hit  [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae FA6140]
. . . . Comamonas testosteroni KF-1 ..............................................  309   2 hits [b-proteobacteria]       chaperonin GroEL [Comamonas testosteroni KF-1] >gi|22071411
. . . . Arsenophonus nasoniae ....................................................  309   1 hit  [enterobacteria]         60 Kda chaperonin [Arsenophonus nasoniae]
. . . . Stenotrophomonas sp. SKA14 ...............................................  309   2 hits [g-proteobacteria]       chaperonin GroL [Stenotrophomonas sp. SKA14] >gi|219718536|
. . . . Rhodoferax ferrireducens T118 ............................................  309   3 hits [b-proteobacteria]       chaperonin GroEL [Rhodoferax ferrireducens T118] >gi|119366
. . . . Neisseria meningitidis alpha275 ..........................................  309   1 hit  [b-proteobacteria]       60 kDa chaperonin [Neisseria meningitidis serogroup W135]
. . . . Neisseria gonorrhoeae 35/02 ..............................................  309   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae 35/02] >gi|24011476
. . . . Neisseria gonorrhoeae PID18 ..............................................  309   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae 35/02] >gi|24011476
. . . . Neisseria gonorrhoeae PID332 .............................................  309   3 hits [b-proteobacteria]       chaperonin GroEL [Neisseria gonorrhoeae 35/02] >gi|24011476
. . . . Providencia stuartii ATCC 25827 ..........................................  309   2 hits [enterobacteria]         hypothetical protein PROSTU_01426 [Providencia stuartii ATC
. . . . Enhydrobacter aerosaccus SK60 ............................................  309   2 hits [g-proteobacteria]       chaperonin GroL [Enhydrobacter aerosaccus SK60] >gi|2574491
. . . . Sideroxydans lithotrophicus ES-1 .........................................  309   2 hits [b-proteobacteria]       chaperonin GroEL [Sideroxydans lithotrophicus ES-1] >gi|255
. . . . Chromohalobacter salexigens DSM 3043 .....................................  309   3 hits [g-proteobacteria]       chaperonin GroEL [Chromohalobacter salexigens DSM 3043] >gi
. . . . Neptuniibacter caesariensis ..............................................  309   2 hits [g-proteobacteria]       GroEL protein [Oceanospirillum sp. MED92] >gi|89081662|gb|E
. . . . Proteus mirabilis HI4320 .................................................  309   3 hits [enterobacteria]         60 Kda chaperonin [Proteus mirabilis HI4320] >gi|227357447|
. . . . Proteus mirabilis ATCC 29906 .............................................  309   2 hits [enterobacteria]         60 Kda chaperonin [Proteus mirabilis HI4320] >gi|227357447|
. . . . Verminephrobacter eiseniae EF01-2 ........................................  308   3 hits [b-proteobacteria]       chaperonin GroEL [Verminephrobacter eiseniae EF01-2] >gi|16
. . . . Neisseria flavescens NRL30031/H210 .......................................  308   2 hits [b-proteobacteria]       hypothetical protein NEIFLAOT_01174 [Neisseria flavescens N
. . . . Pantoea sp. At-9b ........................................................  308   2 hits [enterobacteria]         chaperonin GroEL [Pantoea sp. At-9b] >gi|258532469|gb|EEW00
. . . . Burkholderia xenovorans LB400 ............................................  308   8 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia xenovorans LB400] >gi|917832
. . . . Vibrio sp. Ex25 ..........................................................  308   8 hits [g-proteobacteria]       chaperonin GroL [Vibrio sp. Ex25] >gi|262396020|ref|YP_0032
. . . . Delftia acidovorans SPH-1 ................................................  308   3 hits [b-proteobacteria]       chaperonin GroEL [Delftia acidovorans SPH-1] >gi|226704113|
. . . . Vibrio harveyi 1DA3 ......................................................  308   2 hits [g-proteobacteria]       GroEL protein 1 [Vibrio harveyi 1DA3] >gi|269832784|gb|EEZ8
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  308   3 hits [g-proteobacteria]       60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  308   3 hits [g-proteobacteria]       60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 
. . . . Vibrio parahaemolyticus AQ3810 ...........................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio parahaemolyticus RIMD 2210633] >gi
. . . . Glaciecola sp. HTCC2999 ..................................................  308   1 hit  [g-proteobacteria]       Chaperonin GroEL (HSP60 family) protein [alpha proteobacter
. . . . Actinobacillus pleuropneumoniae ..........................................  308   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  308   3 hits [enterobacteria]         chaperonin GroEL [Klebsiella pneumoniae subsp. pneumoniae M
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................  308   2 hits [enterobacteria]         chaperonin GroEL [Klebsiella pneumoniae subsp. pneumoniae M
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  308   2 hits [enterobacteria]         chaperonin GroEL [Klebsiella pneumoniae subsp. pneumoniae M
. . . . Acinetobacter sp. ADP1 ...................................................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter sp. ADP1] >gi|59797745|sp|Q
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  308   1 hit  [enterobacteria]         chaperonin GroEL [Pectobacterium carotovorum subsp. brasili
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  308   1 hit  [enterobacteria]         chaperonin GroEL [Pectobacterium carotovorum subsp. brasili
. . . . Diaphorobacter sp. TPSY ..................................................  308   3 hits [b-proteobacteria]       chaperonin GroEL [Diaphorobacter sp. TPSY] >gi|254813886|sp
. . . . Neisseria subflava NJ9703 ................................................  308   2 hits [b-proteobacteria]       chaperonin GroL [Neisseria subflava NJ9703] >gi|284795791|g
. . . . Neisseria cinerea ATCC 14685 .............................................  308   2 hits [b-proteobacteria]       chaperonin GroL [Neisseria cinerea ATCC 14685] >gi|26914433
. . . . Neisseria lactamica ATCC 23970 ...........................................  308   2 hits [b-proteobacteria]       chaperonin GroL [Neisseria lactamica ATCC 23970] >gi|269208
. . . . Providencia alcalifaciens DSM 30120 ......................................  308   2 hits [enterobacteria]         hypothetical protein PROVALCAL_02048 [Providencia alcalifac
. . . . Enterobacter aerogenes ...................................................  308   5 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rickettsiella grylli .....................................................  308   2 hits [g-proteobacteria]       chaperonin GroL [Rickettsiella grylli] >gi|159121243|gb|EDP
. . . . Neisseria flavescens .....................................................  308   2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Acinetobacter junii SH205 ................................................  308   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter junii SH205] >gi|262312026|g
. . . . Klebsiella pneumoniae ....................................................  308   3 hits [enterobacteria]         similar to GroEL protein [Klebsiella pneumoniae]
. . . . Vibrio alginolyticus 12G01 ...............................................  308   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio alginolyticus 12G01] >gi|91191094|
. . . . Neisseria flavescens SK114 ...............................................  308   2 hits [b-proteobacteria]       chaperonin GroL [Neisseria flavescens SK114] >gi|241320550|
. . . . Francisella tularensis subsp. mediasiatica FSC147 ........................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. mediasiatic
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  308   3 hits [enterobacteria]         chaperonin GroEL [Pectobacterium carotovorum subsp. carotov
. . . . Buchnera aphidicola ......................................................  308  22 hits [enterobacteria]         symbionin [Buchnera aphidicola]
. . . . Acinetobacter sp. RUH2624 ................................................  308   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter sp. RUH2624] >gi|260407643|g
. . . . Klebsiella pneumoniae 342 ................................................  308   3 hits [enterobacteria]         chaperonin GroL [Klebsiella pneumoniae 342] >gi|269917971|r
. . . . Klebsiella variicola At-22 ...............................................  308   2 hits [enterobacteria]         chaperonin GroL [Klebsiella pneumoniae 342] >gi|269917971|r
. . . . Acinetobacter baumannii ACICU ............................................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii ACICU] >gi|226704
. . . . Acinetobacter baumannii SDF ..............................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii SDF] >gi|22670407
. . . . Acinetobacter baumannii ..................................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii SDF] >gi|22670407
. . . . Acinetobacter baumannii AYE ..............................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Acinetobacter baumannii AB0057 ...........................................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Acinetobacter baumannii AB307-0294 .......................................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Acinetobacter baumannii AB900 ............................................  308   1 hit  [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Acinetobacter baumannii ATCC 19606 .......................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Acinetobacter baumannii ATCC 17978 .......................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter baumannii AYE] >gi|21315834
. . . . Vibrio sp. AND4 ..........................................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio sp. AND4] >gi|159173422|gb|EDP5824
. . . . Candidatus Vesicomyosocius okutanii HA ...................................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Candidatus Vesicomyosocius okutanii HA] >
. . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  308   1 hit  [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Actinobacillus pl
. . . . Actinobacillus pleuropneumoniae L20 ......................................  308   3 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Actinobacillus pl
. . . . Edwardsiella ictaluri 93-146 .............................................  308   3 hits [enterobacteria]         chaperonin GroL, putative [Edwardsiella ictaluri 93-146] >g
. . . . Acinetobacter sp. ATCC 27244 .............................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Acinetobacter sp. ATCC 27244] >gi|2268367
. . . . gamma proteobacterium HTCC5015 ...........................................  308   2 hits [g-proteobacteria]       chaperonin GroL [gamma proteobacterium HTCC5015] >gi|198262
. . . . Francisella tularensis subsp. tularensis SCHU S4 .........................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. tularensis FSC198 ..........................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. tularensis MA00-2987 .......................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. tularensis FSC033 ..........................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. tularensis .................................  308   2 hits [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Francisella tularensis subsp. tularensis NE061598 ........................  308   1 hit  [g-proteobacteria]       chaperonin GroEL [Francisella tularensis subsp. tularensis 
. . . . Pantoea agglomerans ......................................................  308   3 hits [enterobacteria]         similar to GroEL protein [Pantoea agglomerans]
. . . . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................  308   3 hits [g-proteobacteria]       chaperonin GroEL [Baumannia cicadellinicola str. Hc (Homalo
. . . . Pectobacterium wasabiae WPP163 ...........................................  308   2 hits [enterobacteria]         chaperonin GroEL [Pectobacterium wasabiae WPP163] >gi|26160
. . . . Enterobacteriaceae bacterium JM965 .......................................  307   1 hit  [enterobacteria]         GroEL-like protein [Enterobacteriaceae sp. JM965]
. . . . Nitrosomonas sp. AL212 ...................................................  307   2 hits [b-proteobacteria]       chaperonin GroEL [Nitrosomonas sp. AL212] >gi|254980817|gb|
. . . . Pectobacterium carotovorum subsp. carotovorum ............................  307   1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Pectobacterium carotovorum ...............................................  307   1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Vibrio alginolyticus 40B .................................................  307   4 hits [g-proteobacteria]       GroEL protein 1 [Vibrio alginolyticus 40B] >gi|269827228|gb
. . . . Xenorhabdus nematophila ..................................................  307   1 hit  [enterobacteria]         GroEL [Xenorhabdus nematophila]
. . . . Haemophilus influenzae PittGG ............................................  307   3 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae PittGG] >gi|166198
. . . . Haemophilus influenzae R3021 .............................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae 22.4-21] >gi|14498
. . . . Pseudoalteromonas haloplanktis TAC125 ....................................  307   4 hits [g-proteobacteria]       GroEL protein [Pseudoalteromonas haloplanktis TAC125]
. . . . Desulfuromonas acetoxidans DSM 684 .......................................  307   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfuromonas acetoxidans DSM 684] >gi|9
. . . . Haemophilus influenzae NT127 .............................................  307   2 hits [g-proteobacteria]       chaperonin GroL [Haemophilus influenzae NT127] >gi|26009420
. . . . Vibrio cholerae O395 .....................................................  307   8 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O395] >gi|262170091|ref|Z
. . . . Vibrio cholerae RC27 .....................................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O395] >gi|262170091|ref|Z
. . . . Kangiella koreensis DSM 16069 ............................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Kangiella koreensis DSM 16069] >gi|256795
. . . . Vibrio cholerae MZO-2 ....................................................  307   4 hits [g-proteobacteria]       chaperonin, 60 Kd subunit [Vibrio cholerae MZO-2] >gi|14974
. . . . Proteus penneri ATCC 35198 ...............................................  307   2 hits [enterobacteria]         hypothetical protein PROPEN_01190 [Proteus penneri ATCC 351
. . . . Leptothrix cholodnii SP-6 ................................................  307   3 hits [b-proteobacteria]       chaperonin GroEL [Leptothrix cholodnii SP-6] >gi|226704147|
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  307   3 hits [enterobacteria]         hypothetical protein ESA_00154 [Enterobacter sakazakii ATCC
. . . . Colwellia maris ..........................................................  307   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Pelobacter carbinolicus DSM 2380 .........................................  307   3 hits [d-proteobacteria]       chaperonin GroEL [Pelobacter carbinolicus DSM 2380] >gi|119
. . . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae 2740-80 ..................................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae V52 ......................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae 1587 .....................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae MAK 757 ..................................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae NCTC 8457 ................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae 623-39 ...................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae MZO-3 ....................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae M66-2 ....................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae BX 330286 ................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae B33 ......................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae TMA 21 ...................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae RC9 ......................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae TM 11079-80 ..............................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae bv. albensis VL426 .......................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae 12129(1) .................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae MJ-1236 ..................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae AM-19226 .................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae MO10 .....................................................  307   4 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholera CIRS 101 ..................................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae INDRE 91/1 ...............................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae CT 5369-93 ...............................................  307   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Vibrio cholerae ..........................................................  307  19 hits [g-proteobacteria]       chaperonin GroEL [Vibrio cholerae O1 biovar El Tor str. N16
. . . . Haemophilus somnus 129PT .................................................  307   3 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus somnus 129PT] >gi|170718937|r
. . . . Haemophilus somnus 2336 ..................................................  307   3 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus somnus 129PT] >gi|170718937|r
. . . . Vibrio cholerae V51 ......................................................  307   2 hits [g-proteobacteria]       chaperonin, 60 Kd subunit [Vibrio cholerae V51] >gi|1256220
. . . . Enterobacter cancerogenus ATCC 35316 .....................................  307   2 hits [enterobacteria]         chaperonin GroL [Enterobacter cancerogenus ATCC 35316] >gi|
. . . . Vibrio cholerae RC385 ....................................................  307   4 hits [g-proteobacteria]       chaperonin, 60 Kd subunit [Vibrio cholerae RC385] >gi|26121
. . . . Vibrio sp. RC341 .........................................................  307   2 hits [g-proteobacteria]       chaperonin, 60 Kd subunit [Vibrio cholerae RC385] >gi|26121
. . . . Actinobacillus succinogenes 130Z .........................................  307   3 hits [g-proteobacteria]       chaperonin GroEL [Actinobacillus succinogenes 130Z] >gi|171
. . . . Methylovorus sp. SIP3-4 ..................................................  307   4 hits [b-proteobacteria]       chaperonin GroEL [Methylovorus sp. SIP3-4] >gi|253986678|gb
. . . . Edwardsiella tarda EIB202 ................................................  307   2 hits [enterobacteria]         chaperonin GroEL (HSP60 family) [Edwardsiella tarda EIB202]
. . . . Enterobacteriaceae bacterium Kuo3-1 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo3-2 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo3-3 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo3-4 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo3-5 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo4-1 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo4-2 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo4-3 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo4-4 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Enterobacteriaceae bacterium Kuo4-5 ......................................  307   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo3-1] >gi|165974036|d
. . . . Variovorax paradoxus S110 ................................................  307   3 hits [b-proteobacteria]       chaperonin GroEL [Variovorax paradoxus S110] >gi|259585918|
. . . . Azoarcus sp. BH72 ........................................................  307   6 hits [b-proteobacteria]       chaperonin GroEL [Azoarcus sp. BH72] >gi|187470734|sp|A1K43
. . . . Vibrio mimicus VM573 .....................................................  307   2 hits [g-proteobacteria]       GroEL protein 1 [Vibrio mimicus VM573] >gi|258587344|gb|EEW
. . . . Marinomonas sp. MWYL1 ....................................................  307   3 hits [g-proteobacteria]       chaperonin GroEL [Marinomonas sp. MWYL1] >gi|189082356|sp|A
. . . . Enterobacteriaceae bacterium Epu-Tsukuba .................................  307   1 hit  [enterobacteria]         GroEL protein [Enterobacteriaceae bacterium Epu-Tsukuba]
. . . . Vibrio coralliilyticus ATCC BAA-450 ......................................  306   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Vibrio corall
. . . . Enterobacter cloacae .....................................................  306   2 hits [enterobacteria]         GroEL [Enterobacter cloacae]
. . . . Mannheimia succiniciproducens MBEL55E ....................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Mannheimia succiniciproducens MBEL55E] >g
. . . . Shewanella loihica PV-4 ..................................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella loihica PV-4] >gi|166201752|sp
. . . . Vibrio mimicus VM603 .....................................................  306   2 hits [g-proteobacteria]       GroEL protein 1 [Vibrio mimicus VM603] >gi|262166676|ref|ZP
. . . . Vibrio mimicus VM223 .....................................................  306   4 hits [g-proteobacteria]       GroEL protein 1 [Vibrio mimicus VM603] >gi|262166676|ref|ZP
. . . . Vibrio mimicus MB-451 ....................................................  306   2 hits [g-proteobacteria]       GroEL protein 1 [Vibrio mimicus VM603] >gi|262166676|ref|ZP
. . . . Xylella fastidiosa Temecula1 .............................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Xylella fastidiosa Temecula1] >gi|1826821
. . . . Xylella fastidiosa M23 ...................................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Xylella fastidiosa Temecula1] >gi|1826821
. . . . Vibrio sp. RC586 .........................................................  306   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Vibrio sp. RC
. . . . Pseudomonas sp. CT07 .....................................................  306   1 hit  [g-proteobacteria]       chaperonin [Pseudomonas sp. CT07]
. . . . Alteromonadales bacterium TW-7 ...........................................  306   2 hits [g-proteobacteria]       60 kDa chaperonin (Protein Cpn60) (groEL protein) [Alteromo
. . . . Pseudoalteromonas sp. PS1M3 ..............................................  306   1 hit  [g-proteobacteria]       60 kDa chaperonin (Protein Cpn60) (groEL protein) [Alteromo
. . . . Serratia rubidaea ........................................................  306   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Xylella fastidiosa 9a5c ..................................................  306   2 hits [g-proteobacteria]       chaperonin GroEL [Xylella fastidiosa 9a5c] >gi|25452892|sp|
. . . . Xylella fastidiosa .......................................................  306   1 hit  [g-proteobacteria]       chaperonin GroEL [Xylella fastidiosa 9a5c] >gi|25452892|sp|
. . . . Lutiella nitroferrum 2002 ................................................  306   2 hits [b-proteobacteria]       chaperonin GroEL [Lutiella nitroferrum 2002] >gi|224604278|
. . . . Cronobacter turicensis ...................................................  306   1 hit  [enterobacteria]         60 kDa chaperonin [Cronobacter turicensis] >gi|260218683|em
. . . . Cronobacter turicensis z3032 .............................................  306   1 hit  [enterobacteria]         60 kDa chaperonin [Cronobacter turicensis] >gi|260218683|em
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  306   2 hits [enterobacteria]         chaperonin GroEL [Photorhabdus luminescens subsp. laumondii
. . . . Photorhabdus luminescens subsp. laumondii ................................  306   1 hit  [enterobacteria]         chaperonin GroEL [Photorhabdus luminescens subsp. laumondii
. . . . Pseudomonas stutzeri A1501 ...............................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas stutzeri A1501] >gi|166201743
. . . . Enterobacteriaceae bacterium Kuo2-1 ......................................  306   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo2-1]
. . . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........  306   3 hits [enterobacteria]         hypothetical protein WGLp258 [Wigglesworthia glossinidia en
. . . . Wigglesworthia glossinidia ...............................................  306   1 hit  [enterobacteria]         hypothetical protein WGLp258 [Wigglesworthia glossinidia en
. . . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  306   3 hits [g-proteobacteria]       chaperonin GroEL [Candidatus Ruthia magnifica str. Cm (Caly
. . . . Haemophilus influenzae 86-028NP ..........................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae 86-028NP] >gi|8133
. . . . Vibrio harveyi ...........................................................  306   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Acinetobacter johnsonii SH046 ............................................  306   2 hits [g-proteobacteria]       predicted protein [Acinetobacter johnsonii SH046] >gi|26231
. . . . Buchnera aphidicola (Thelaxes suberi) ....................................  306   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Raoultella ornithinolytica ...............................................  306   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Haemophilus influenzae 3655 ..............................................  306   2 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae 3655] >gi|14498587
. . . . Klebsiella oxytoca .......................................................  306   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Haemophilus influenzae PittAA ............................................  306   2 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae PittAA] >gi|145267
. . . . Enterobacter asburiae ....................................................  306   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Haemophilus influenzae R2866 .............................................  306   1 hit  [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae 22.1-21 ...........................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae PittII ............................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae 22.4-21 ...........................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae PittEE ............................................  306   3 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae 6P18H1 ............................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae 7P49H1 ............................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae RdAW ..............................................  306   2 hits [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Haemophilus influenzae R2846 .............................................  306   1 hit  [g-proteobacteria]       COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influ
. . . . Xylella fastidiosa Dixon .................................................  306   2 hits [g-proteobacteria]       Chaperonin Cpn60/TCP-1 [Xylella fastidiosa Dixon] >gi|17073
. . . . Xylella fastidiosa M12 ...................................................  306   3 hits [g-proteobacteria]       Chaperonin Cpn60/TCP-1 [Xylella fastidiosa Dixon] >gi|17073
. . . . Yersinia ruckeri ATCC 29473 ..............................................  306   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia ruckeri ATCC 29473] >gi|2387056
. . . . Acinetobacter radioresistens SK82 ........................................  306   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter radioresistens SK82] >gi|262
. . . . Acinetobacter radioresistens SH164 .......................................  306   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter radioresistens SK82] >gi|262
. . . . Burkholderia ubonensis Bu ................................................  306   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia ubonensis Bu]
. . . . Pseudomonas stutzeri .....................................................  306   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Gallionella ferruginea ES-2 ..............................................  306   2 hits [b-proteobacteria]       chaperonin GroEL [Gallionella ferruginea ES-2] >gi|25180692
. . . . Xylella fastidiosa subsp. sandyi Ann-1 ...................................  306   2 hits [g-proteobacteria]       Chaperonin Cpn60/TCP-1 [Xylella fastidiosa Ann-1] >gi|71732
. . . . Serratia marcescens ......................................................  306   9 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Serratia marcescens subsp. marcescens ....................................  306   1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Pseudomonas putida GB-1 ..................................................  306   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas putida GB-1] >gi|189082362|sp
. . . . Vibrio furnissii CIP 102972 ..............................................  306   4 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Vibrio furnis
. . . . Shewanella woodyi ATCC 51908 .............................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella woodyi ATCC 51908] >gi|2267041
. . . . Haemophilus influenzae PittHH ............................................  305   2 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae PittHH] >gi|145269
. . . . Xanthomonas albilineans ..................................................  305   2 hits [g-proteobacteria]       probable 60 kda chaperonin (protein cpn60) (groel protein).
. . . . Candidatus Blochmannia laevigatus ........................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia laevigatus]
. . . . Escherichia albertii TW07627 .............................................  305   2 hits [enterobacteria]         chaperonin GroL [Escherichia albertii TW07627] >gi|17012417
. . . . Candidatus Blochmannia sayi ..............................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia sayi]
. . . . Serratia ficaria .........................................................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Candidatus Blochmannia vicinus ...........................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia vicinus]
. . . . Dickeya dadantii Ech703 ..................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Dickeya dadantii Ech703] >gi|242132863|gb
. . . . Candidatus Blochmannia pennsylvanicus ....................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia pennsylvanicus]
. . . . Acidovorax sp. JS42 ......................................................  305   3 hits [b-proteobacteria]       chaperonin GroEL [Acidovorax sp. JS42] >gi|166198429|sp|A1W
. . . . Candidatus Blochmannia americanus ........................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia americanus]
. . . . Candidatus Riesia pediculicola ...........................................  305   2 hits [enterobacteria]         GroEL [Candidatus Riesia pediculicola]
. . . . Vibrio shilonii AK1 ......................................................  305   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio shilonii AK1] >gi|148833913|gb|EDL
. . . . Shewanella amazonensis SB2B ..............................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella amazonensis SB2B] >gi|16620175
. . . . Candidatus Blochmannia novaeboracensis ...................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia noveboracensis]
. . . . Dickeya dadantii Ech586 ..................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Dickeya dadantii Ech586] >gi|270342665|gb
. . . . Acinetobacter calcoaceticus RUH2202 ......................................  305   2 hits [g-proteobacteria]       chaperonin GroL [Acinetobacter calcoaceticus RUH2202] >gi|2
. . . . Candidatus Blochmannia ulcerosus .........................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia ulcerosus]
. . . . Buchnera aphidicola (Pterocomma populeum) ................................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Yersinia kristensenii ATCC 33638 .........................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia kristensenii ATCC 33638] >gi|23
. . . . Methylophilales bacterium HTCC2181 .......................................  305   2 hits [b-proteobacteria]       chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium 
. . . . Candidatus Blochmannia vafer .............................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia vafer]
. . . . Escherichia coli 536 .....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli 536] >gi|191173388|ref|Z
. . . . Escherichia coli F11 .....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli 536] >gi|191173388|ref|Z
. . . . Yersinia rohdei ATCC 43380 ...............................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia rohdei ATCC 43380] >gi|23871159
. . . . Yersinia enterocolitica ..................................................  305   4 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Candidatus Blochmannia floridanus ........................................  305   4 hits [enterobacteria]         heat shock protein [Candidatus Blochmannia floridanus]
. . . . Candidatus Blochmannia sansabeanus .......................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia sansabeanus]
. . . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  305   3 hits [enterobacteria]         chaperonin GroEL [Candidatus Blochmannia pennsylvanicus str
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia enterocolitica subsp. enterocoli
. . . . Escherichia coli O111:H- str. 11128 ......................................  305   2 hits [enterobacteria]         chaperonin Cpn60 [Escherichia coli O111:H- str. 11128] >gi|
. . . . Stigmatella aurantiaca DW4/3-1 ...........................................  305   2 hits [d-proteobacteria]       chaperonin GroL [Stigmatella aurantiaca DW4/3-1] >gi|115366
. . . . Escherichia coli O157:H7 str. Sakai ......................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli str. K-12 substr. MG1655 ................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella flexneri 2a str. 301 ............................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli CFT073 ..................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella flexneri 2a str. 2457T ..........................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella sonnei Ss046 ....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella boydii Sb227 ....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella dysenteriae Sd197 ...............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli str. K-12 substr. W3110 .................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli UTI89 ...................................................  305  17 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella flexneri 5 str. 8401 ............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli E24377A .................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli HS ......................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4113 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4401 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4501 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4486 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4196 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4076 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC869 ......................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC508 ......................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli ATCC 8739 ...............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli str. K-12 substr. DH10B .................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli SMS-3-5 .................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella boydii CDC 3083-94 ..............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli 53638 ...................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli B7A .....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli E22 .....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli E110019 .................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli B171 ....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella dysenteriae 1012 ................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli 101-1 ...................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4024 .....................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4206 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4045 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4042 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. EC4115 .....................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli SE11 ....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. TW14588 ....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli IAI1 ....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli S88 .....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli ED1a ....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli 55989 ...................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli IAI39 ...................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli UMN026 ..................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli 83972 ...................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia sp. 3_2_53FAA ................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli BW2952 ..................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli BL21(DE3) ...............................................  305   4 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia sp. 1_1_43 ...................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli B str. REL606 ...........................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. TW14359 ....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella sp. D9 ..........................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia sp. 4_1_40B ..................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O103:H2 str. 12009 ......................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O26:H11 str. 11368 ......................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli K-12 ....................................................  305  15 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O6 ......................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O157:H7 .................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella flexneri ........................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli O111:H- .................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli SE15 ....................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Shigella flexneri 2002017 ................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Escherichia coli 042 .....................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 str. Sakai] >gi|
. . . . Enterobacter sp. 638 .....................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Enterobacter sp. 638] >gi|167008693|sp|A4
. . . . Dickeya zeae Ech1591 .....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Dickeya zeae Ech1591] >gi|247539719|gb|AC
. . . . Enterobacteriaceae bacterium Kuo1-1 ......................................  305   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo1-1] >gi|165974016|d
. . . . Enterobacteriaceae bacterium Kuo1-2 ......................................  305   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo1-1] >gi|165974016|d
. . . . Enterobacteriaceae bacterium Kuo1-3 ......................................  305   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo1-1] >gi|165974016|d
. . . . Enterobacteriaceae bacterium Kuo1-4 ......................................  305   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo1-1] >gi|165974016|d
. . . . Enterobacteriaceae bacterium Kuo1-5 ......................................  305   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo1-1] >gi|165974016|d
. . . . Janthinobacterium sp. Marseille ..........................................  305   3 hits [b-proteobacteria]       chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille] 
. . . . Candidatus Blochmannia chromaiodes .......................................  305   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia chromaiodes]
. . . . Buchnera aphidicola (Chaetophorus leucomelas) ............................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Serratia odorifera 4Rx13 .................................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Serratia odorifera 4Rx13] >gi|270040910|
. . . . Yersinia frederiksenii ATCC 33641 ........................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia frederiksenii ATCC 33641] >gi|2
. . . . Serratia proteamaculans 568 ..............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Serratia proteamaculans 568] >gi|16700869
. . . . Buchnera aphidicola (Uroleucon sonchi) ...................................  305   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon sonchi)]
. . . . Yersinia intermedia ATCC 29909 ...........................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia intermedia ATCC 29909] >gi|2387
. . . . Yersinia bercovieri ATCC 43970 ...........................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia bercovieri ATCC 43970] >gi|2387
. . . . Yersinia pestis Antiqua ..................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis Antiqua] >gi|167400677|re
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis Antiqua] >gi|167400677|re
. . . . Yersinia pestis KIM 10 ...................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Microtus str. 91001 ...............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pseudotuberculosis IP 32953 .....................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis Nepal516 .................................................  305   5 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis Pestoides F ..............................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis CA88-4125 ................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pseudotuberculosis IP 31758 .....................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis Angola ...................................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Orientalis str. IP275 .............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Antiqua str. E1979001 .............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Antiqua str. B42003004 ............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pseudotuberculosis YPIII ........................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pseudotuberculosis PB1/+ ........................................  305   3 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis CO92 .....................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis Pestoides A ..............................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis biovar Orientalis str. India 195 .........................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis KIM D27 ..................................................  305   2 hits [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis ..........................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pseudotuberculosis ..............................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis D106004 ..................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Yersinia pestis D182038 ..................................................  305   1 hit  [enterobacteria]         chaperonin GroEL [Yersinia pestis KIM 10] >gi|45440360|ref|
. . . . Methylotenera mobilis JLW8 ...............................................  305   2 hits [b-proteobacteria]       chaperonin GroEL [Methylotenera mobilis JLW8] >gi|253982480
. . . . Escherichia coli O157:H7 EDL933 ..........................................  305   2 hits [enterobacteria]         chaperonin GroEL [Escherichia coli O157:H7 EDL933] >gi|2530
. . . . Pseudomonas aeruginosa ...................................................  305   4 hits [g-proteobacteria]       GroEL [Pseudomonas aeruginosa]
. . . . Buchnera aphidicola (Uroleucon caligatum) ................................  305   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon caligatum)]
. . . . Burkholderia glumae BGR1 .................................................  305   4 hits [b-proteobacteria]       Chaperonin GroEL [Burkholderia glumae BGR1] >gi|237875574|g
. . . . Erwinia pyrifoliae Ep1/96 ................................................  305   2 hits [enterobacteria]         60 kDa chaperonin (Protein Cpn60) [Erwinia pyrifoliae Ep1/9
. . . . Erwinia pyrifoliae DSM 12163 .............................................  305   1 hit  [enterobacteria]         60 kDa chaperonin (Protein Cpn60) [Erwinia pyrifoliae Ep1/9
. . . . Pantoea ananatis .........................................................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Providencia rustigianii DSM 4541 .........................................  305   2 hits [enterobacteria]         chaperonin GroL [Providencia rustigianii DSM 4541] >gi|2825
. . . . Enterobacter amnigenus ...................................................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Marinomonas sp. MED121 ...................................................  305   2 hits [g-proteobacteria]       chaperonin, 60 Kd subunit [Marinomonas sp. MED121] >gi|8616
. . . . Pasteurella dagmatis ATCC 43325 ..........................................  305   2 hits [g-proteobacteria]       chaperone GroEL [Pasteurella dagmatis ATCC 43325] >gi|26063
. . . . Shewanella pealeana ATCC 700345 ..........................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella pealeana ATCC 700345] >gi|1890
. . . . Burkholderia cenocepacia J2315 ...........................................  305   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia J2315] >gi|62251
. . . . Burkholderia cepacia .....................................................  305   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia J2315] >gi|62251
. . . . Buchnera sp. 150 .........................................................  305   1 hit  [enterobacteria]         GroEL protein [Buchnera sp. 150]
. . . . Buchnera aphidicola (Rhopalosiphum padi) .................................  305   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Burkholderia thailandensis E264 ..........................................  305   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia thailandensis E264] >gi|1675
. . . . Burkholderia thailandensis TXDOH .........................................  305   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia thailandensis E264] >gi|1675
. . . . Burkholderia thailandensis Bt4 ...........................................  305   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia thailandensis E264] >gi|1675
. . . . Burkholderia thailandensis ...............................................  305   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia thailandensis E264] >gi|1675
. . . . Haemophilus ducreyi ......................................................  305   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Burkholderia oklahomensis EO147 ..........................................  305   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia oklahomensis EO147]
. . . . Pseudomonas aeruginosa PA7 ...............................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas aeruginosa PA7] >gi|166201740
. . . . Yersinia aldovae ATCC 35236 ..............................................  305   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia aldovae ATCC 35236] >gi|2387042
. . . . Pseudomonas aeruginosa PAO1 ..............................................  305   2 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas aeruginosa PAO1] >gi|11605242
. . . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas aeruginosa PAO1] >gi|11605242
. . . . Pseudomonas aeruginosa LESB58 ............................................  305   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas aeruginosa PAO1] >gi|11605242
. . . . Vibrio parahaemolyticus 16 ...............................................  305   4 hits [g-proteobacteria]       chaperonin GroL [Vibrio parahaemolyticus 16] >gi|219551610|
. . . . Acidovorax delafieldii 2AN ...............................................  305   2 hits [b-proteobacteria]       chaperonin GroEL [Acidovorax delafieldii 2AN] >gi|241362923
. . . . Buchnera aphidicola (Uroleucon ambrosiae) ................................  305  21 hits [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon ambrosiae)]
. . . . Haemophilus ducreyi 35000HP ..............................................  304   2 hits [g-proteobacteria]       60 kDa chaperonin [Haemophilus ducreyi 35000HP] >gi|3314901
. . . . Candidatus Blochmannia nearcticus ........................................  304   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia nearcticus]
. . . . Burkholderia vietnamiensis G4 ............................................  304   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia vietnamiensis G4] >gi|622511
. . . . Burkholderia vietnamiensis ...............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia vietnamiensis G4] >gi|622511
. . . . Buchnera aphidicola (Uroleucon rudbeckiae) ...............................  304   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon rudbeckiae)]
. . . . Burkholderia cenocepacia AU 1054 .........................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia AU 1054] >gi|116
. . . . Burkholderia cenocepacia HI2424 ..........................................  304   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia AU 1054] >gi|116
. . . . Burkholderia cenocepacia PC184 ...........................................  304   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia AU 1054] >gi|116
. . . . Burkholderia cenocepacia MC0-3 ...........................................  304   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia cenocepacia MC0-3] >gi|16981
. . . . Syntrophobacter fumaroxidans MPOB ........................................  304   6 hits [d-proteobacteria]       chaperonin GroEL [Syntrophobacter fumaroxidans MPOB] >gi|18
. . . . Buchnera aphidicola (Uroleucon astronomus) ...............................  304   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon astronomus)]
. . . . Buchnera aphidicola (Uroleucon solidaginis) ..............................  304   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon solidaginis)]
. . . . Pseudomonas aeruginosa 2192 ..............................................  304   2 hits [g-proteobacteria]       GroEL protein [Pseudomonas aeruginosa 2192] >gi|126198182|g
. . . . Burkholderia ambifaria IOP40-10 ..........................................  304   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia ambifaria IOP40-10] >gi|1701
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  304   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Haemophilus influenzae Rd KW20 ...........................................  304   2 hits [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae Rd KW20] >gi|11689
. . . . Haemophilus influenzae ...................................................  304   1 hit  [g-proteobacteria]       chaperonin GroEL [Haemophilus influenzae Rd KW20] >gi|11689
. . . . Thauera sp. MZ1T .........................................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Thauera sp. MZ1T] >gi|217507168|gb|ACK541
. . . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................  304   3 hits [enterobacteria]         60 kDa chaperonin [Buchnera aphidicola str. Tuc7 (Acyrthosi
. . . . Buchnera aphidicola (Uroleucon jaceae) ...................................  304   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon jaceae)]
. . . . Pasteurella multocida ....................................................  304   2 hits [g-proteobacteria]       GroEL [Pasteurella multocida]
. . . . Escherichia coli DH1 .....................................................  304   1 hit  [enterobacteria]         GroEL [Escherichia coli] >gi|260451029|gb|ACX41451.1| chape
. . . . Buchnera aphidicola str. APS (Acyrthosiphon pisum) .......................  304   2 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................  304   3 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . . . Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum) ......................  304   1 hit  [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . . . Buchnera aphidicola (Acyrthosiphon pisum) ................................  304   2 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . . . Buchnera sp. .............................................................  304   1 hit  [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . . . Pasteurella multocida subsp. multocida str. Pm70 .........................  304   2 hits [g-proteobacteria]       chaperonin GroEL [Pasteurella multocida subsp. multocida st
. . . . Plesiomonas shigelloides .................................................  304   1 hit  [enterobacteria]         GroEL [Plesiomonas shigelloides]
. . . . Enterobacteriaceae bacterium Ses-Tsukuba .................................  304   1 hit  [enterobacteria]         GroEL protein [Enterobacteriaceae bacterium Ses-Tsukuba]
. . . . Burkholderia graminis C4D1M ..............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia graminis C4D1M] >gi|17014390
. . . . Kluyvera intermedia ......................................................  304   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Photobacterium angustum S14 ..............................................  304   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio angustum S14] >gi|90437509|gb|EAS6
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ...............................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Acidovorax avenae subsp. avenae ATCC 1986
. . . . Eikenella corrodens ATCC 23834 ...........................................  304   2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_02022 [Eikenella corrodens AT
. . . . Burkholderia pseudomallei K96243 .........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 668 ............................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 305 ............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 91 .............................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 9 ..............................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 576 ............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei Pakistan 9 .....................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei MSHR346 ........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei 406e ...........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Burkholderia pseudomallei ................................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei K96243] >gi|126
. . . . Erwinia tasmaniensis Et1/99 ..............................................  304   2 hits [enterobacteria]         60 kDa chaperonin (Protein Cpn60) [Erwinia tasmaniensis Et1
. . . . Erwinia tasmaniensis .....................................................  304   1 hit  [enterobacteria]         60 kDa chaperonin (Protein Cpn60) [Erwinia tasmaniensis Et1
. . . . Burkholderia multivorans ATCC 17616 ......................................  304   8 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia multivorans ATCC 17616] >gi|
. . . . Burkholderia multivorans CGD2M ...........................................  304   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia multivorans ATCC 17616] >gi|
. . . . Burkholderia multivorans CGD2 ............................................  304   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia multivorans ATCC 17616] >gi|
. . . . Burkholderia multivorans CGD1 ............................................  304   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia multivorans ATCC 17616] >gi|
. . . . Burkholderia dolosa AUO158 ...............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia multivorans ATCC 17616] >gi|
. . . . Buchnera aphidicola str. Sg (Schizaphis graminum) ........................  304   2 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. Sg (Schizaphis g
. . . . Buchnera aphidicola (Schizaphis graminum) ................................  304   2 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. Sg (Schizaphis g
. . . . Candidatus Blochmannia schaefferi ........................................  304   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia schaefferi]
. . . . Burkholderia pseudomallei 1710b ..........................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 1106a ..........................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei DM98 ...........................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 14 .............................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei B7210 ..........................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 7894 ...........................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei NCTC 13177 .....................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei BCC215 .........................................  304   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 1106b ..........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 1655 ...........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei Pasteur 52237 ..................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei S13 ............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia pseudomallei 1710a ..........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 1710b] >gi|1264
. . . . Burkholderia mallei ATCC 23344 ...........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei SAVP1 ................................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei NCTC 10229 ...........................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei NCTC 10247 ...........................................  304   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei PRL-20 ...............................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei GB8 horse 4 ..........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei ATCC 10399 ...........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei FMH ..................................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei JHU ..................................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei 2002721280 ...........................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Burkholderia mallei ......................................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia mallei ATCC 23344] >gi|12160
. . . . Citrobacter rodentium ICC168 .............................................  304   2 hits [enterobacteria]         60 Kda chaperonin [Citrobacter rodentium ICC168] >gi|282950
. . . . Burkholderia sp. CCGE1001 ................................................  304   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia sp. CCGE1001] >gi|281326010|
. . . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............  304   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Raoultella planticola ....................................................  304   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Shewanella sediminis HAW-EB3 .............................................  304   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sediminis HAW-EB3] >gi|1890823
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  304   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. arizonae serov
. . . . Citrobacter sp. 30_2 .....................................................  304   2 hits [enterobacteria]         chaperonin GroEL [Citrobacter sp. 30_2] >gi|226908806|gb|EE
. . . . Buchnera aphidicola (Myzus persicae) .....................................  304   3 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  304   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Sodalis glossinidius .....................................................  304   4 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Citrobacter youngae ATCC 29220 ...........................................  304   1 hit  [enterobacteria]         chaperonin GroEL [Citrobacter youngae ATCC 29220]
. . . . Sodalis glossinidius str. 'morsitans' ....................................  303   3 hits [enterobacteria]         chaperonin GroEL [Sodalis glossinidius str. 'morsitans'] >g
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Enterobacteriaceae bacterium Kuo2-2 ......................................  303   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo2-2] >gi|165974028|d
. . . . Enterobacteriaceae bacterium Kuo2-3 ......................................  303   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo2-2] >gi|165974028|d
. . . . Enterobacteriaceae bacterium Kuo2-4 ......................................  303   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo2-2] >gi|165974028|d
. . . . Enterobacteriaceae bacterium Kuo2-5 ......................................  303   1 hit  [enterobacteria]         GroEL [Enterobacteriaceae bacterium Kuo2-2] >gi|165974028|d
. . . . Geobacter lovleyi SZ .....................................................  303   3 hits [d-proteobacteria]       chaperonin GroEL [Geobacter lovleyi SZ] >gi|226704134|sp|B3
. . . . Shewanella halifaxensis HAW-EB4 ..........................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella halifaxensis HAW-EB4] >gi|1890
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  303   3 hits [enterobacteria]         chaperonin GroL [Salmonella enterica subsp. enterica serova
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  303   1 hit  [enterobacteria]         chaperonin GroL [Salmonella enterica subsp. enterica serova
. . . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  303   3 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  303   2 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhi ........................  303   4 hits [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica ......................................................  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  303   1 hit  [enterobacteria]         chaperonin GroEL [Salmonella enterica subsp. enterica serov
. . . . Vibrio orientalis CIP 102891 .............................................  303   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Vibrio orient
. . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................  303   2 hits [b-proteobacteria]       chaperonin GroEL [Candidatus Accumulibacter phosphatis clad
. . . . Citrobacter koseri ATCC BAA-895 ..........................................  303   3 hits [enterobacteria]         chaperonin GroEL [Citrobacter koseri ATCC BAA-895] >gi|1661
. . . . Candidatus Blochmannia ocreatus ..........................................  303   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia ocreatus]
. . . . Dechloromonas aromatica RCB ..............................................  303   3 hits [b-proteobacteria]       chaperonin GroEL [Dechloromonas aromatica RCB] >gi|11936623
. . . . Pectobacterium atrosepticum SCRI1043 .....................................  303   2 hits [enterobacteria]         chaperonin GroEL [Pectobacterium atrosepticum SCRI1043] >gi
. . . . Pectobacterium atrosepticum ..............................................  303   1 hit  [enterobacteria]         chaperonin GroEL [Pectobacterium atrosepticum SCRI1043] >gi
. . . . Photobacterium sp. SKA34 .................................................  303   2 hits [g-proteobacteria]       60 kDa chaperonin GroEL [Photobacterium sp. SKA34] >gi|8904
. . . . Pseudomonas putida W619 ..................................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas putida W619] >gi|226704161|sp
. . . . Acidovorax citrulli AAC00-1 ..............................................  303   3 hits [b-proteobacteria]       chaperonin GroEL [Acidovorax avenae subsp. citrulli AAC00-1
. . . . Buchnera aphidicola (Tuberolachnus salignus) .............................  303   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Pseudomonas fluorescens Pf-5 .............................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas fluorescens Pf-5] >gi|1193662
. . . . Oxalobacter formigenes HOxBLS ............................................  303   2 hits [b-proteobacteria]       chaperonin [Oxalobacter formigenes HOxBLS] >gi|229378700|gb
. . . . Candidatus Blochmannia festinatus ........................................  303   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia festinatus]
. . . . Burkholderia phytofirmans PsJN ...........................................  303   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia phytofirmans PsJN] >gi|22670
. . . . primary endosymbiont of Sitophilus oryzae ................................  303   1 hit  [enterobacteria]         GroEL [primary endosymbiont of Sitophilus oryzae]
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Alkalilimnicola ehrlichii MLHE-1] >gi|122
. . . . Burkholderia thailandensis MSMB43 ........................................  303   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia thailandensis MSMB43]
. . . . Pseudomonas putida F1 ....................................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas putida F1] >gi|166201742|sp|A
. . . . Pseudomonas mendocina ymp ................................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas mendocina ymp] >gi|166201741|
. . . . Thiobacillus denitrificans ATCC 25259 ....................................  303   3 hits [b-proteobacteria]       chaperonin GroEL (Hsp60, Cpn10) [Thiobacillus denitrificans
. . . . Enterobacteriaceae bacterium Enu-Kitaibaraki .............................  303   1 hit  [enterobacteria]         GroEL protein [Enterobacteriaceae bacterium Enu-Kitaibaraki]
. . . . Buchnera sp. N27 .........................................................  303   1 hit  [enterobacteria]         GroEL protein [Buchnera sp. N27]
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................  303   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Photobacteriu
. . . . Erwinia aphidicola .......................................................  303   1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Erwinia aphidicola DSM 19347 .............................................  303   1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Burkholderia phymatum STM815 .............................................  303   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia phymatum STM815] >gi|2267040
. . . . Pseudomonas putida KT2440 ................................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas putida KT2440] >gi|38257490|s
. . . . Shewanella sp. ANA-3 .....................................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sp. ANA-3] >gi|187470767|sp|A0
. . . . Vibrio metschnikovii CIP 69.14 ...........................................  303   2 hits [g-proteobacteria]       heat shock protein 60 family chaperone GroEL [Vibrio metsch
. . . . Myxococcus xanthus .......................................................  303   1 hit  [d-proteobacteria]       chaperonin GroEL [Myxococcus xanthus DK 1622] >gi|118597089
. . . . Buchnera aphidicola (Uroleucon rapunculoidis) ............................  303   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon rapunculoidis)]
. . . . Enterobacter gergoviae ...................................................  303   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Shewanella oneidensis MR-1 ...............................................  303   2 hits [g-proteobacteria]       chaperonin GroEL [Shewanella oneidensis MR-1] >gi|29839303|
. . . . Shewanella oneidensis ....................................................  303   1 hit  [g-proteobacteria]       chaperonin GroEL [Shewanella oneidensis MR-1] >gi|29839303|
. . . . Burkholderia sp. H160 ....................................................  303   2 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia sp. H160] >gi|209497588|gb|E
. . . . Pseudomonas entomophila L48 ..............................................  303   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas entomophila L48] >gi|12338079
. . . . Herminiimonas arsenicoxydans .............................................  303   3 hits [b-proteobacteria]       chaperone Hsp60 (GroEL), part of GroE chaperone system [Her
. . . . Shewanella sp. MR-4 ......................................................  302   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sp. MR-4] >gi|114046065|ref|YP
. . . . Shewanella sp. MR-7 ......................................................  302   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sp. MR-4] >gi|114046065|ref|YP
. . . . Burkholderia sp. CCGE1002 ................................................  302   4 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia sp. CCGE1002] >gi|270353831|
. . . . Ralstonia solanacearum GMI1000 ...........................................  302   2 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia solanacearum GMI1000] >gi|25452
. . . . Ralstonia solanacearum ...................................................  302   1 hit  [b-proteobacteria]       chaperonin GroEL [Ralstonia solanacearum GMI1000] >gi|25452
. . . . Moritella sp. PE36 .......................................................  302   2 hits [g-proteobacteria]       chaperonin GroEL [Moritella sp. PE36] >gi|149806795|gb|EDM6
. . . . Pseudomonas putida .......................................................  302   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . gamma proteobacterium NOR5-3 .............................................  302   2 hits [g-proteobacteria]       chaperonin GroL [gamma proteobacterium NOR5-3] >gi|21967465
. . . . Pseudomonas fluorescens SBW25 ............................................  302   3 hits [g-proteobacteria]       chaperone Hsp60, peptide-dependent ATPase, heat shock prote
. . . . Colwellia psychrerythraea 34H ............................................  302   3 hits [g-proteobacteria]       chaperone protein GroEL [Colwellia psychrerythraea 34H] >gi
. . . . beta proteobacterium KB13 ................................................  302   2 hits [b-proteobacteria]       chaperonin GroL [beta proteobacterium KB13] >gi|207087884|g
. . . . Methylobacillus flagellatus KT ...........................................  302   3 hits [b-proteobacteria]       chaperonin GroEL [Methylobacillus flagellatus KT] >gi|11859
. . . . Vibrionales bacterium SWAT-3 .............................................  302   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrionales bacterium SWAT-3] >gi|1459637
. . . . Vibrio fischeri ES114 ....................................................  302   3 hits [g-proteobacteria]       chaperonin GroEL [Vibrio fischeri ES114] >gi|197334170|ref|
. . . . Vibrio fischeri MJ11 .....................................................  302   3 hits [g-proteobacteria]       chaperonin GroEL [Vibrio fischeri ES114] >gi|197334170|ref|
. . . . Burkholderia ambifaria MC40-6 ............................................  302   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia ambifaria IOP40-10] >gi|1720
. . . . Burkholderia sp. 383 .....................................................  302   3 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia sp. 383] >gi|119366198|sp|Q3
. . . . Burkholderia ambifaria AMMD ..............................................  302   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia ambifaria AMMD] >gi|17131925
. . . . Burkholderia ambifaria MEX-5 .............................................  302   6 hits [b-proteobacteria]       chaperonin GroEL [Burkholderia ambifaria AMMD] >gi|17131925
. . . . Listonella anguillarum ...................................................  302   1 hit  [g-proteobacteria]       GroEL [Listonella anguillarum]
. . . . Angiococcus disciformis ..................................................  302   1 hit  [d-proteobacteria]       hypothetical protein [Angiococcus disciformis]
. . . . Ralstonia solanacearum MolK2 .............................................  302   2 hits [b-proteobacteria]       60 kda chaperonin [Ralstonia solanacearum MolK2] >gi|206591
. . . . Ralstonia solanacearum UW551 .............................................  302   2 hits [b-proteobacteria]       60 kDa chaperonin GROEL [Ralstonia solanacearum UW551] >gi|
. . . . Ralstonia solanacearum IPO1609 ...........................................  302   2 hits [b-proteobacteria]       60 kDa chaperonin GROEL [Ralstonia solanacearum UW551] >gi|
. . . . Buchnera aphidicola (Rhopalosiphum maidis) ...............................  302   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Pseudoalteromonas tunicata D2 ............................................  302   2 hits [g-proteobacteria]       60 kDa chaperonin (Protein Cpn60) (groEL protein) [Pseudoal
. . . . Shewanella piezotolerans WP3 .............................................  301   3 hits [g-proteobacteria]       Chaperonin GroEL [Shewanella piezotolerans WP3] >gi|2267041
. . . . Ralstonia pickettii 12D ..................................................  301   4 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia pickettii 12D] >gi|240866688|gb
. . . . Reinekea blandensis MED297 ...............................................  301   2 hits [g-proteobacteria]       chaperonin GroEL [Reinekea sp. MED297] >gi|88778298|gb|EAR0
. . . . Psychrobacter frigidicola ................................................  301   1 hit  [g-proteobacteria]       GroEL [Psychrobacter frigidicola]
. . . . Candidatus Portiera aleyrodidarum ........................................  301   1 hit  [g-proteobacteria]       GroEL [Candidatus Portiera aleyrodidarum]
. . . . Candidatus Blochmannia castaneus .........................................  301   1 hit  [enterobacteria]         heat shock protein [Candidatus Blochmannia castaneus]
. . . . Oxalobacter formigenes OXCC13 ............................................  301   2 hits [b-proteobacteria]       TCP-1/cpn60 chaperonin family protein [Oxalobacter formigen
. . . . Shewanella putrefaciens CN-32 ............................................  301   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella putrefaciens CN-32] >gi|187470
. . . . Tolumonas auensis DSM 9187 ...............................................  301   3 hits [g-proteobacteria]       chaperonin GroEL [Tolumonas auensis DSM 9187] >gi|259585917
. . . . Allochromatium vinosum ...................................................  301   1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Vibrio sp. MED222 ........................................................  301   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio sp. MED222] >gi|85834942|gb|EAQ530
. . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  301   2 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. Bp (Baizongia pi
. . . . Buchnera aphidicola (Baizongia pistaciae) ................................  301   1 hit  [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. Bp (Baizongia pi
. . . . Photobacterium profundum 3TCK ............................................  301   2 hits [g-proteobacteria]       chaperonin GroEL [Photobacterium profundum 3TCK] >gi|903255
. . . . Buchnera aphidicola (Uroleucon helianthicola) ............................  301   1 hit  [enterobacteria]         GroEL [Buchnera aphidicola (Uroleucon helianthicola)]
. . . . Shewanella sp. W3-18-1 ...................................................  301   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sp. W3-18-1] >gi|124547880|ref
. . . . Shewanella putrefaciens 200 ..............................................  301   2 hits [g-proteobacteria]       chaperonin GroEL [Shewanella sp. W3-18-1] >gi|124547880|ref
. . . . Psychrobacter sp. PRwf-1 .................................................  301   3 hits [g-proteobacteria]       chaperonin GroEL [Psychrobacter sp. PRwf-1] >gi|172048507|s
. . . . Ralstonia pickettii 12J ..................................................  301   4 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia pickettii 12J] >gi|187727383|gb
. . . . Thioalkalivibrio sp. K90mix ..............................................  301   2 hits [g-proteobacteria]       chaperonin GroEL [Thioalkalivibrio sp. K90mix] >gi|22460909
. . . . Shewanella baltica OS195 .................................................  300   2 hits [g-proteobacteria]       chaperonin GroEL [Shewanella baltica OS195] >gi|160859316|g
. . . . Shewanella baltica OS185 .................................................  300   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella baltica OS185] >gi|187470765|s
. . . . Bordetella avium 197N ....................................................  300   3 hits [b-proteobacteria]       60 kDa chaperonin [Bordetella avium 197N] >gi|119366229|sp|
. . . . Buchnera aphidicola (Tetraneura caerulescens) ............................  300   2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bordetella petrii DSM 12804 ..............................................  300   2 hits [b-proteobacteria]       chaperonin GroEL [Bordetella petrii DSM 12804] >gi|22670409
. . . . Bordetella petrii ........................................................  300   1 hit  [b-proteobacteria]       chaperonin GroEL [Bordetella petrii DSM 12804] >gi|22670409
. . . . Nitrococcus mobilis Nb-231 ...............................................  300   2 hits [g-proteobacteria]       Chaperonin Cpn60/TCP-1 [Nitrococcus mobilis Nb-231] >gi|887
. . . . Shewanella baltica OS155 .................................................  300   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella baltica OS155] >gi|217971860|r
. . . . Shewanella baltica OS223 .................................................  300   2 hits [g-proteobacteria]       chaperonin GroEL [Shewanella baltica OS155] >gi|217971860|r
. . . . Congregibacter litoralis KT71 ............................................  300   2 hits [g-proteobacteria]       60 kDa chaperonin [Congregibacter litoralis KT71] >gi|88698
. . . . Kingella oralis ATCC 51147 ...............................................  300   2 hits [b-proteobacteria]       hypothetical protein GCWU000324_00610 [Kingella oralis ATCC
. . . . Shewanella denitrificans OS217 ...........................................  300   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella denitrificans OS217] >gi|12335
. . . . Bordetella parapertussis 12822 ...........................................  300   1 hit  [b-proteobacteria]       chaperonin GroEL [Bordetella parapertussis 12822] >gi|33599
. . . . Bordetella bronchiseptica RB50 ...........................................  300   2 hits [b-proteobacteria]       chaperonin GroEL [Bordetella parapertussis 12822] >gi|33599
. . . . Bordetella parapertussis .................................................  300   2 hits [b-proteobacteria]       chaperonin GroEL [Bordetella parapertussis 12822] >gi|33599
. . . . Bordetella bronchiseptica ................................................  300   1 hit  [b-proteobacteria]       chaperonin GroEL [Bordetella parapertussis 12822] >gi|33599
. . . . Bordetella pertussis Tohama I ............................................  300   2 hits [b-proteobacteria]       chaperonin GroEL [Bordetella pertussis Tohama I] >gi|134575
. . . . Bordetella pertussis .....................................................  300   2 hits [b-proteobacteria]       chaperonin GroEL [Bordetella pertussis Tohama I] >gi|134575
. . . . Vibrio splendidus 12B01 ..................................................  300   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio splendidus 12B01] >gi|84378239|gb|
. . . . Vibrio splendidus LGP32 ..................................................  300   2 hits [g-proteobacteria]       chaperonin GroEL [Vibrio splendidus LGP32] >gi|218321320|em
. . . . Desulfurivibrio alkaliphilus AHT2 ........................................  300   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfurivibrio alkaliphilus AHT2] >gi|25
. . . . Psychrobacter arcticus 273-4 .............................................  300   3 hits [g-proteobacteria]       chaperonin GroEL [Psychrobacter arcticus 273-4] >gi|1193662
. . . . Enterobacteriaceae bacterium JM983 .......................................  300   1 hit  [enterobacteria]         GroEL-like protein [Enterobacteriaceae sp. JM983]
. . . . Aliivibrio salmonicida LFI1238 ...........................................  300   2 hits [g-proteobacteria]       chaperonin GroEL [Aliivibrio salmonicida LFI1238] >gi|20800
. . . . Piscirickettsia salmonis .................................................  300   2 hits [g-proteobacteria]       immunogenic protein ChaPs [Piscirickettsia salmonis]
. . . . Candidatus Ishikawaella capsulata ........................................  299   1 hit  [enterobacteria]         GroEL protein [Candidatus Ishikawaella capsulata] >gi|12130
. . . . Ishikawaella symbiont of Megacopta cribraria .............................  299   1 hit  [enterobacteria]         GroEL protein [Candidatus Ishikawaella capsulata] >gi|12130
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  299   3 hits [g-proteobacteria]       chaperonin GroEL [Aeromonas hydrophila subsp. hydrophila AT
. . . . Shewanella frigidimarina NCIMB 400 .......................................  299   3 hits [g-proteobacteria]       chaperonin GroEL [Shewanella frigidimarina NCIMB 400] >gi|1
. . . . Buchnera aphidicola str. Cc (Cinara cedri) ...............................  299   3 hits [enterobacteria]         chaperonin GroEL [Buchnera aphidicola str. Cc (Cinara cedri
. . . . Psychrobacter cryohalolentis K5 ..........................................  299   3 hits [g-proteobacteria]       chaperonin GroEL [Psychrobacter cryohalolentis K5] >gi|1193
. . . . Photobacterium profundum SS9 .............................................  298   2 hits [g-proteobacteria]       chaperonin GroEL [Photobacterium profundum SS9] >gi|5979776
. . . . Photobacterium profundum .................................................  298   1 hit  [g-proteobacteria]       chaperonin GroEL [Photobacterium profundum SS9] >gi|5979776
. . . . Nitrosococcus oceani ATCC 19707 ..........................................  298   3 hits [g-proteobacteria]       chaperonin GroEL [Nitrosococcus oceani ATCC 19707] >gi|2544
. . . . Nitrosococcus oceani AFC27 ...............................................  298   2 hits [g-proteobacteria]       chaperonin GroEL [Nitrosococcus oceani ATCC 19707] >gi|2544
. . . . Sitobion avenae endosymbiont .............................................  298   1 hit  [enterobacteria]         GroEL-related molecular chaperonin SymL [Sitobion avenae en
. . . . Desulfotalea psychrophila LSv54 ..........................................  298   2 hits [d-proteobacteria]       chaperonin GroEL [Desulfotalea psychrophila LSv54] >gi|6856
. . . . Desulfotalea psychrophila ................................................  298   1 hit  [d-proteobacteria]       chaperonin GroEL [Desulfotalea psychrophila LSv54] >gi|6856
. . . . Stenotrophomonas maltophilia .............................................  298   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Sulfurospirillum deleyianum DSM 6946 .....................................  297   2 hits [e-proteobacteria]       chaperonin GroEL [Sulfurospirillum deleyianum DSM 6946] >gi
. . . . Pseudomonas fluorescens Pf0-1 ............................................  297   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas fluorescens Pf0-1] >gi|119366
. . . . Ralstonia eutropha H16 ...................................................  297   3 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia eutropha H16] >gi|123134358|sp|
. . . . Burkholderia oklahomensis C6786 ..........................................  297   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia oklahomensis C6786]
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................  297   3 hits [g-proteobacteria]       chaperonin GroL [Aeromonas salmonicida subsp. salmonicida A
. . . . Aeromonas salmonicida ....................................................  297   2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Candidatus Arsenophonus triatominarum ....................................  296   1 hit  [enterobacteria]         GroEL 60S chaperonin [Candidatus Arsenophonus triatominarum]
. . . . Thiomicrospira crunogena XCL-2 ...........................................  296   3 hits [g-proteobacteria]       chaperonin Cpn60/TCP-1 [Thiomicrospira crunogena XCL-2] >gi
. . . . Burkholderia pseudomallei 112 ............................................  296   1 hit  [b-proteobacteria]       chaperonin GroEL [Burkholderia pseudomallei 112]
. . . . Rhopalosiphum padi endosymbiont ..........................................  296   1 hit  [enterobacteria]         GroEL-related molecular chaperonin SymL [Rhopalosiphum padi
. . . . Ralstonia pickettii ......................................................  296   2 hits [b-proteobacteria]       molecular chaperone GroEL [Ralstonia pickettii]
. . . . Sulfurovum sp. NBC37-1 ...................................................  296   3 hits [e-proteobacteria]       chaperonin GroEL [Sulfurovum sp. NBC37-1] >gi|166201757|sp|
. . . . Pseudomonas aeruginosa PACS2 .............................................  296   1 hit  [g-proteobacteria]       hypothetical protein PaerPA_01001051 [Pseudomonas aeruginos
. . . . Yersinia mollaretii ATCC 43969 ...........................................  295   2 hits [enterobacteria]         60 kDa chaperonin [Yersinia mollaretii ATCC 43969] >gi|2387
. . . . Campylobacter lari RM2100 ................................................  295   3 hits [e-proteobacteria]       60 kD chaperonin (cpn60) [Campylobacter lari RM2100] >gi|25
. . . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  295   2 hits [g-proteobacteria]       chaperonin, 60 kDa [Pseudomonas syringae pv. tomato str. DC
. . . . Pseudomonas syringae pv. tomato T1 .......................................  295   2 hits [g-proteobacteria]       chaperonin, 60 kDa [Pseudomonas syringae pv. tomato str. DC
. . . . Pseudomonas syringae pv. tomato ..........................................  295   1 hit  [g-proteobacteria]       chaperonin, 60 kDa [Pseudomonas syringae pv. tomato str. DC
. . . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  295   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas syringae pv. phaseolicola 144
. . . . Pseudomonas syringae pv. syringae B728a ..................................  295   3 hits [g-proteobacteria]       chaperonin GroEL [Pseudomonas syringae pv. syringae B728a] 
. . . . Cupriavidus taiwanensis ..................................................  295   3 hits [b-proteobacteria]       chaperonin GroEL [Cupriavidus taiwanensis] >gi|226704112|sp
. . . . Ralstonia eutropha JMP134 ................................................  295   3 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia eutropha JMP134] >gi|118597120|
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  295   1 hit  [g-proteobacteria]       chaperonin GroEL [Pseudomonas syringae pv. tabaci ATCC 1152
. . . . Halothiobacillus neapolitanus c2 .........................................  295   2 hits [g-proteobacteria]       chaperonin GroEL [Halothiobacillus neapolitanus c2] >gi|261
. . . . Campylobacter coli RM2228 ................................................  295   2 hits [e-proteobacteria]       chaperonin, 60 kDa [Campylobacter coli RM2228] >gi|57020480
. . . . Shewanella benthica KT99 .................................................  294   2 hits [g-proteobacteria]       chaperonin GroEL [Shewanella benthica KT99] >gi|161329817|g
. . . . Nitrosomonas eutropha C91 ................................................  294   3 hits [b-proteobacteria]       chaperonin GroEL [Nitrosomonas eutropha C91] >gi|122314706|
. . . . gamma proteobacterium NOR51-B ............................................  294   2 hits [g-proteobacteria]       chaperonin GroL [gamma proteobacterium NOR51-B] >gi|2196805
. . . . Cupriavidus metallidurans CH34 ...........................................  294   3 hits [b-proteobacteria]       chaperonin GroEL [Ralstonia metallidurans CH34] >gi|1185971
. . . . Arcobacter butzleri RM4018 ...............................................  294   3 hits [e-proteobacteria]       chaperonin GroEL [Arcobacter butzleri RM4018] >gi|167008689
. . . unidentified eubacterium SCB49 ---------------------------------------------  320   2 hits [CFB group bacteria]     chaperonin GroEL [unidentified eubacterium SCB49] >gi|14935
. . . Flavobacteria bacterium BBFL7 ..............................................  316   2 hits [CFB group bacteria]     60 kDa chaperonin GroEL HSP60 heat shock protein [Flavobact
. . . Riemerella anatipestifer ...................................................  315   1 hit  [CFB group bacteria]     chaperonin GroEL [Riemerella anatipestifer]
. . . Brachyspira hyodysenteriae WA1 .............................................  313   2 hits [spirochetes]            chaperonin GroEL [Brachyspira hyodysenteriae WA1] >gi|22521
. . . Robiginitalea biformata HTCC2501 ...........................................  313   2 hits [CFB group bacteria]     chaperonin GroEL [Robiginitalea biformata HTCC2501] >gi|887
. . . Gramella forsetii KT0803 ...................................................  312   3 hits [CFB group bacteria]     protein Cpn60 (GroEL protein) [Gramella forsetii KT0803] >g
. . . Chryseobacterium gleum ATCC 35910 ..........................................  312   2 hits [CFB group bacteria]     chaperone GroEL [Chryseobacterium gleum ATCC 35910] >gi|227
. . . Flavobacteriales bacterium HTCC2170 ........................................  312   2 hits [CFB group bacteria]     chaperonin GroEL [Flavobacteriales bacterium HTCC2170] >gi|
. . . Flavobacteriaceae bacterium 3519-10 ........................................  312   2 hits [CFB group bacteria]     Heat shock protein 60 family chaperone GroEL [Flavobacteria
. . . Brachyspira murdochii DSM 12563 ............................................  311   2 hits [spirochetes]            chaperonin GroL [Brachyspira murdochii DSM 12563] >gi|22797
. . . Flavobacteria bacterium MS024-3C ...........................................  311   2 hits [CFB group bacteria]     chaperonin GroEL [Flavobacteria bacterium MS024-3C] >gi|225
. . . Flavobacterium psychrophilum JIP02/86 ......................................  310   3 hits [CFB group bacteria]     60 kDa chaperonin GroEL [Flavobacterium psychrophilum JIP02
. . . Flavobacterium psychrophilum ...............................................  310   1 hit  [CFB group bacteria]     60 kDa chaperonin GroEL [Flavobacterium psychrophilum JIP02
. . . Kordia algicida OT-1 .......................................................  309   2 hits [CFB group bacteria]     chaperonin GroEL [Kordia algicida OT-1] >gi|161326137|gb|ED
. . . Capnocytophaga ochracea DSM 7271 ...........................................  308   2 hits [CFB group bacteria]     chaperonin GroEL [Capnocytophaga ochracea DSM 7271] >gi|256
. . . Flavobacteria bacterium BAL38 ..............................................  308   2 hits [CFB group bacteria]     60 kDa chaperonin [Flavobacteria bacterium BAL38] >gi|12662
. . . Capnocytophaga gingivalis ATCC 33624 .......................................  308   2 hits [CFB group bacteria]     chaperonin GroL [Capnocytophaga gingivalis ATCC 33624] >gi|
. . . Dyadobacter fermentans DSM 18053 ...........................................  308   2 hits [CFB group bacteria]     chaperonin GroEL [Dyadobacter fermentans DSM 18053] >gi|254
. . . Croceibacter atlanticus HTCC2559 ...........................................  307   2 hits [CFB group bacteria]     chaperonin GroEL [Croceibacter atlanticus HTCC2559] >gi|838
. . . Fibrobacter succinogenes subsp. succinogenes S85 ...........................  307   2 hits [bacteria]               chaperonin GroEL [Fibrobacter succinogenes subsp. succinoge
. . . Chlorobium chlorochromatii CaD3 ............................................  307   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium chlorochromatii CaD3] >gi|1193
. . . Fusobacterium varium ATCC 27725 ............................................  307   2 hits [fusobacteria]           hsp60-like protein [Fusobacterium varium ATCC 27725] >gi|25
. . . Capnocytophaga sputigena ATCC 33612 ........................................  307   2 hits [CFB group bacteria]     chaperonin GroL [Capnocytophaga sputigena Capno] >gi|213953
. . . Fusobacterium ulcerans ATCC 49185 ..........................................  306   1 hit  [fusobacteria]           60 kDa chaperonin GROEL [Fusobacterium ulcerans ATCC 49185]
. . . Sphingobacterium spiritivorum ATCC 33300 ...................................  306   2 hits [CFB group bacteria]     chaperone GroEL [Sphingobacterium spiritivorum ATCC 33300] 
. . . Sphingobacterium spiritivorum ATCC 33861 ...................................  306   2 hits [CFB group bacteria]     chaperone GroEL [Sphingobacterium spiritivorum ATCC 33861] 
. . . Candidatus Sulcia muelleri SMDSEM ..........................................  305   2 hits [CFB group bacteria]     60 kDa chaperonin GroEL [Candidatus Sulcia muelleri SMDSEM]
. . . Flavobacterium johnsoniae UW101 ............................................  305   3 hits [CFB group bacteria]     chaperonin GroEL [Flavobacterium johnsoniae UW101] >gi|1890
. . . Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata) .................  305   2 hits [CFB group bacteria]     60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
. . . Candidatus Sulcia muelleri GWSS ............................................  305   3 hits [CFB group bacteria]     60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
. . . Denitrovibrio acetiphilus DSM 12809 ........................................  304   2 hits [bacteria]               chaperonin GroL [Denitrovibrio acetiphilus DSM 12809] >gi|2
. . . Chloroherpeton thalassium ATCC 35110 .......................................  303   3 hits [green sulfur bacteria]  chaperonin GroEL [Chloroherpeton thalassium ATCC 35110] >gi
. . . Akkermansia muciniphila ATCC BAA-835 .......................................  303   3 hits [verrucomicrobia]        chaperonin GroEL [Akkermansia muciniphila ATCC BAA-835] >gi
. . . Chlorobium luteolum DSM 273 ................................................  303   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium luteolum DSM 273] >gi|11936625
. . . Rhodothermus marinus DSM 4252 ..............................................  303   2 hits [CFB group bacteria]     chaperonin GroEL [Rhodothermus marinus DSM 4252] >gi|254528
. . . Rhodothermus marinus .......................................................  303   2 hits [CFB group bacteria]     chaperonin GroEL [Rhodothermus marinus DSM 4252] >gi|254528
. . . Chlorobaculum parvum NCIB 8327 .............................................  303   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobaculum parvum NCIB 8327] >gi|22670
. . . Dokdonia donghaensis MED134 ................................................  303   2 hits [CFB group bacteria]     60 kDa chaperonin [Dokdonia donghaensis MED134] >gi|8581801
. . . Pelodictyon phaeoclathratiforme BU-1 .......................................  303   3 hits [green sulfur bacteria]  chaperonin GroEL [Pelodictyon phaeoclathratiforme BU-1] >gi
. . . bacterium S5 ...............................................................  303   1 hit  [bacteria]               chaperonin GroEL [bacterium S5]
. . . Chlorobium phaeobacteroides DSM 266 ........................................  302   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium phaeobacteroides DSM 266] >gi|
. . . Leeuwenhoekiella blandensis MED217 .........................................  302   2 hits [CFB group bacteria]     chaperonin, 60 kDa [Leeuwenhoekiella blandensis MED217] >gi
. . . Chlorobium limicola DSM 245 ................................................  301   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium limicola DSM 245] >gi|22670409
. . . Pedobacter sp. BAL39 .......................................................  301   2 hits [CFB group bacteria]     60 kDa chaperonin [Pedobacter sp. BAL39] >gi|149232068|gb|E
. . . Chlorobium phaeobacteroides BS1 ............................................  301   3 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium phaeobacteroides BS1] >gi|2267
. . . Chlorobium tepidum TLS .....................................................  301   2 hits [green sulfur bacteria]  chaperonin GroEL [Chlorobium tepidum TLS] >gi|25452832|sp|Q
. . . Chlorobaculum tepidum ......................................................  301   1 hit  [green sulfur bacteria]  chaperonin GroEL [Chlorobium tepidum TLS] >gi|25452832|sp|Q
. . . Prosthecochloris aestuarii DSM 271 .........................................  301   3 hits [green sulfur bacteria]  chaperonin GroEL [Prosthecochloris aestuarii DSM 271] >gi|2
. . . Pedobacter heparinus DSM 2366 ..............................................  300   2 hits [CFB group bacteria]     chaperonin GroEL [Pedobacter heparinus DSM 2366] >gi|255343
. . . Porphyromonas uenonis 60-3 .................................................  300   2 hits [CFB group bacteria]     chaperonin GroL [Porphyromonas uenonis 60-3] >gi|228309146|
. . . Leptospirillum ferrooxidans ................................................  300   1 hit  [bacteria]               chaperonin GroEL [Leptospirillum ferrooxidans]
. . . Psychroflexus torquis ATCC 700755 ..........................................  300   2 hits [CFB group bacteria]     chaperonin GroEL [Psychroflexus torquis ATCC 700755] >gi|91
. . . Cytophaga hutchinsonii ATCC 33406 ..........................................  300   3 hits [CFB group bacteria]     60 kDa chaperonin [Cytophaga hutchinsonii ATCC 33406] >gi|1
. . . Leptospirillum ferrodiazotrophum ...........................................  299   1 hit  [bacteria]               chaperonin GroEL [Leptospirillum ferrodiazotrophum]
. . . Porphyromonas gingivalis W83 ...............................................  299   2 hits [CFB group bacteria]     chaperonin GroEL [Porphyromonas gingivalis W83] >gi|3753829
. . . Porphyromonas gingivalis ...................................................  299   3 hits [CFB group bacteria]     chaperonin GroEL [Porphyromonas gingivalis W83] >gi|3753829
. . . Porphyromonas gingivalis ATCC 33277 ........................................  299   3 hits [CFB group bacteria]     chaperonin GroEL [Porphyromonas gingivalis ATCC 33277] >gi|
. . . Algoriphagus sp. PR1 .......................................................  298   2 hits [CFB group bacteria]     chaperonin GroEL [Algoriphagus sp. PR1] >gi|126575587|gb|EA
. . . Candidatus Amoebophilus asiaticus 5a2 ......................................  298   3 hits [CFB group bacteria]     hypothetical protein Aasi_0308 [Candidatus Amoebophilus asi
. . . Candidatus Protochlamydia amoebophila UWE25 ................................  298   3 hits [chlamydias]             chaperonin GroEL [Candidatus Protochlamydia amoebophila UWE
. . . Granulicatella elegans ATCC 700633 .........................................  297   2 hits [firmicutes]             chaperonin GroL [Granulicatella elegans ATCC 700633] >gi|26
. . . Enterococcus raffinosus ....................................................  297   1 hit  [firmicutes]             GroEL [Enterococcus raffinosus]
. . . Chlorobium phaeovibrioides DSM 265 .........................................  296   3 hits [green sulfur bacteria]  chaperonin GroEL [Prosthecochloris vibrioformis DSM 265] >g
. . . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ..............  296   3 hits [CFB group bacteria]     chaperonin GroEL [Candidatus Azobacteroides pseudotrichonym
. . . Gemmatimonas aurantiaca T-27 ...............................................  296   3 hits [bacteria]               60 kDa chaperonin [Gemmatimonas aurantiaca T-27] >gi|259585
. . . Granulicatella adiacens ATCC 49175 .........................................  296   2 hits [firmicutes]             chaperonin GroEL [Granulicatella adiacens ATCC 49175] >gi|2
. . . Enterococcus avium .........................................................  296   1 hit  [firmicutes]             GroEL [Enterococcus avium]
. . . endosymbiont of Pedicinus obtusus ..........................................  296   2 hits [bacteria]               GroEL [endosymbiont of Pedicinus obtusus] >gi|238773814|dbj
. . . Fusobacterium gonidiaformans ATCC 25563 ....................................  296   1 hit  [fusobacteria]           60 kDa chaperonin GROEL [Fusobacterium gonidiaformans ATCC 
. . . Fusobacterium sp. 3_1_5R ...................................................  296   1 hit  [fusobacteria]           60 kDa chaperonin GROEL [Fusobacterium sp. 3_1_5R]
. . . Blattabacterium sp. (Blattella germanica) str. Bge .........................  295   2 hits [CFB group bacteria]     chaperone GroEL [Blattabacterium sp. (Blattella germanica) 
. . . Parachlamydia acanthamoebae str. Hall's coccus .............................  295   2 hits [chlamydias]             Chaperonin GroEL [Parachlamydia acanthamoebae str. Hall's c
. . . Blattabacterium sp. (Periplaneta americana) str. BPLAN .....................  295   2 hits [CFB group bacteria]     60 kDa chaperonin GroEL [Blattabacterium sp. (Periplaneta a
. . . Geobacillus sp. Y412MC10 ...................................................  295   2 hits [firmicutes]             chaperonin GroEL [Geobacillus sp. Y412MC10] >gi|261285534|g
. . . Dictyoglomus turgidum DSM 6724 .............................................  295   3 hits [bacteria]               chaperonin GroEL [Dictyoglomus turgidum DSM 6724] >gi|22670
. . . Chthoniobacter flavus Ellin428 .............................................  295   2 hits [verrucomicrobia]        chaperonin GroEL [Chthoniobacter flavus Ellin428] >gi|19622
. . . Streptococcus lutetiensis ..................................................  295   1 hit  [firmicutes]             GroEL [Streptococcus lutetiensis]
. . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ..................  295   3 hits [firmicutes]             GroEL [Streptococcus infantarius subsp. infantarius ATCC BA
. . . Parabacteroides merdae ATCC 43184 ..........................................  295   2 hits [CFB group bacteria]     hypothetical protein PARMER_01119 [Parabacteroides merdae A
. . . Dictyoglomus thermophilum H-6-12 ...........................................  295   3 hits [bacteria]               chaperonin GroL [Dictyoglomus thermophilum H-6-12] >gi|2267
. . . Streptococcus equinus ......................................................  295   1 hit  [firmicutes]             GroEL [Streptococcus equinus]
. . . Porphyromonas endodontalis ATCC 35406 ......................................  294   2 hits [CFB group bacteria]     chaperonin GroL [Porphyromonas endodontalis ATCC 35406] >gi
. . . Propionibacterium sp. oral taxon 191 str. F0233 ............................  294   2 hits [high GC Gram+]          chaperonin GroL [Porphyromonas endodontalis ATCC 35406] >gi
. . . Bacillus sp. NRRL B-14911 ..................................................  294   2 hits [firmicutes]             chaperonin GroEL [Bacillus sp. NRRL B-14911] >gi|89085055|g
. . . Fusobacterium mortiferum ATCC 9817 .........................................  294   2 hits [fusobacteria]           hsp60-like protein [Fusobacterium mortiferum ATCC 9817] >gi
. . Populus trichocarpa (black cottonwood) ---------------------------------------  308   1 hit  [eudicots]               predicted protein [Populus trichocarpa]
. . Hydra magnipapillata .........................................................  308   1 hit  [hydrozoans]             PREDICTED: similar to chaperonin groEL-like, partial [Hydra
. . Acyrthosiphon pisum ..........................................................  304   1 hit  [aphids]                 chaperonin GroEL [Buchnera aphidicola str. APS (Acyrthosiph
. . Sitophilus oryzae ............................................................  303   1 hit  [beetles]                chaperonin groEL-like protein - Weevil
. . Methanococcus vannielii SB ...................................................  296   3 hits [euryarchaeotes]         chaperonin GroEL [Methanococcus vannielii SB] >gi|187470761
. . Micromonas pusilla CCMP1545 ..................................................  296   1 hit  [green algae]            predicted protein [Micromonas pusilla CCMP1545]
. . Chlamydomonas reinhardtii ....................................................  294   2 hits [green algae]            chaperonin 60C [Chlamydomonas reinhardtii] >gi|158279325|gb
. synthetic construct ------------------------------------------------------------  307   1 hit  [other sequences]        hypothetical protein FTT1696 [synthetic construct]
. uncultured marine microorganism HF4000_ANIW137I15 ..............................  300   1 hit  [unclassified]           putative TCP-1/cpn60 chaperonin family protein [uncultured 

DATABASE: SWISSPROT

Lineage Report

Lineage Report

cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Alphaproteobacteria [a-proteobacteria]
. . . . Rickettsiales       [a-proteobacteria]
. . . . . Candidatus Pelagibacter ubique ---------------------------------------  422 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia canadensis str. McKiel ....................................  300 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia felis .....................................................  296 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia prowazekii ................................................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia typhi .....................................................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia rickettsii ................................................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia rickettsii str. 'Sheila Smith' ............................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia rickettsii str. Iowa ......................................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia peacockii str. Rustic .....................................  295 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia conorii ...................................................  294 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia africae ESF-5 .............................................  294 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia akari str. Hartford .......................................  294 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia massiliae MTU5 ............................................  293 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia bellii RML369-C ...........................................  293 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Rickettsia bellii OSU 85-389 .........................................  293 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Holospora obtusa .....................................................  264 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Orientia tsutsugamushi str. Boryong ..................................  236 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Orientia tsutsugamushi str. Ikeda ....................................  235 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Orientia tsutsugamushi ...............................................  235 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia chaffeensis ................................................  202 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia chaffeensis str. Arkansas ..................................  202 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia canis str. Jake ............................................  198 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia canis ......................................................  198 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Neorickettsia sennetsu ...............................................  197 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Neorickettsia sennetsu str. Miyayama .................................  197 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Neorickettsia risticii (equine monocytic ehrli...) ...................  196 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia ruminantium str. Welgevonden ...............................  195 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Ehrlichia ruminantium str. Gardel ....................................  195 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Anaplasma marginale str. St. Maries ..................................  195 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Anaplasma marginale str. Florida .....................................  195 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Anaplasma phagocytophilum HZ .........................................  191 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Anaplasma phagocytophilum (agent of human granulo...) ................  191 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Wolbachia endosymbiont of Drosophila melanogaster ....................  189 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Wolbachia sp. wRi ....................................................  189 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel .................  185 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . . Wolbachia endosymbiont strain TRS of Brugia malayi ...................  180 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Methylobacterium radiotolerans JCM 2831 --------------------------------  357 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Dinoroseobacter shibae DFL 12 ..........................................  357 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Roseobacter denitrificans OCh 114 ......................................  353 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Ruegeria sp. TM1040 ....................................................  353 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Jannaschia sp. CCS1 ....................................................  353 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Mesorhizobium loti .....................................................  352 5 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Chelativorans sp. BNC1 .................................................  352 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Ruegeria pomeroyi ......................................................  351 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Methylobacterium populi BJ001 ..........................................  351 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bradyrhizobium sp. ORS278 ..............................................  351 3 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Rhodospirillum centenum SW .............................................  350 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bradyrhizobium sp. BTAi1 ...............................................  349 4 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 3; AltName: Full=Protein Cp
. . . . Rhizobium etli CFN 42 ..................................................  349 4 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Rhodobacter sphaeroides ATCC 17029 .....................................  348 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bartonella quintana ....................................................  348 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhodospirillum rubrum ATCC 11170 .......................................  348 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Rhizobium leguminosarum ................................................  348 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Rhodopseudomonas palustris .............................................  348 3 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhodobacter sphaeroides ATCC 17025 .....................................  348 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhodobacter sphaeroides ................................................  348 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Rhodobacter sphaeroides 2.4.1 ..........................................  348 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Rhizobium sp. NGR234 ...................................................  348 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Paracoccus denitrificans ...............................................  347 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Paracoccus denitrificans PD1222 ........................................  347 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Caulobacter crescentus NA1000 ..........................................  347 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Caulobacter vibrioides .................................................  347 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Sinorhizobium meliloti .................................................  347 5 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 5; AltName: Full=Protein Cp
. . . . Bartonella tribocorum CIP 105476 .......................................  346 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bartonella henselae ....................................................  346 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Caulobacter sp. K31 ....................................................  346 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Sinorhizobium medicae WSM419 ...........................................  345 5 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 3; AltName: Full=Protein Cp
. . . . Beijerinckia indica subsp. indica ATCC 9039 ............................  345 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Gluconobacter oxydans ..................................................  345 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Granulibacter bethesdensis CGDNIH1 .....................................  344 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhizobium leguminosarum bv. viciae 3841 ................................  344 3 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 3; AltName: Full=Protein Cp
. . . . Bradyrhizobium japonicum ...............................................  343 7 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 6; AltName: Full=Protein Cp
. . . . Nitrobacter winogradskyi Nb-255 ........................................  343 3 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Azorhizobium caulinodans ORS 571 .......................................  342 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Nitrobacter hamburgensis X14 ...........................................  341 3 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Methylocella silvestris BL2 ............................................  341 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Gluconacetobacter diazotrophicus PAl 5 .................................  340 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Acetobacter pasteurianus IFO 3283-01 ...................................  340 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Maricaulis maris MCS10 .................................................  340 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  340 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhodobacter capsulatus .................................................  340 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Acidiphilium cryptum JF-5 ..............................................  340 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Agrobacterium tumefaciens str. C58 .....................................  339 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhizobium leguminosarum bv. viciae .....................................  338 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Erythrobacter litoralis HTCC2594 .......................................  338 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Magnetospirillum magneticum AMB-1 ......................................  337 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Sphingomonas wittichii RW1 .............................................  337 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Agrobacterium vitis S4 .................................................  337 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Novosphingobium aromaticivorans DSM 12444 ..............................  337 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bartonella bacilliformis KC583 .........................................  336 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Bartonella bacilliformis ...............................................  336 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Sphingopyxis alaskensis ................................................  336 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Rhodopseudomonas palustris HaA2 ........................................  336 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Rhodopseudomonas palustris BisB5 .......................................  335 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Zymomonas mobilis ......................................................  332 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Parvibaculum lavamentivorans DS-1 ......................................  330 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Rhodopseudomonas palustris BisB18 ......................................  330 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . . Rhodopseudomonas palustris BisA53 ......................................  329 2 hits [a-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . . Hyphomonas neptunium ATCC 15444 ........................................  322 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Ochrobactrum anthropi ATCC 49188 .......................................  320 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella suis ..........................................................  320 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella canis ATCC 23365 ..............................................  320 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella suis ATCC 23445 ...............................................  320 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella melitensis biovar Abortus 2308 ................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella abortus S19 ...................................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella melitensis ATCC 23457 .........................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella abortus .......................................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella ovis ATCC 25840 ...............................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . . Brucella melitensis ....................................................  318 1 hit  [a-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Magnetococcus sp. MC-1 ---------------------------------------------------  335 1 hit  [proteobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Psychromonas ingrahamii 37 ...............................................  326 3 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Pelobacter propionicus DSM 2379 ..........................................  324 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acidithiobacillus ferrooxidans ATCC 23270 ................................  322 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acidithiobacillus ferrooxidans ATCC 53993 ................................  322 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Geobacter sp. FRC-32 .....................................................  321 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Teredinibacter turnerae T7901 ............................................  321 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Saccharophagus degradans 2-40 ............................................  321 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Syntrophus aciditrophicus SB .............................................  321 3 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Geobacter sulfurreducens .................................................  321 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Geobacter metallireducens GS-15 ..........................................  320 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Alteromonas macleodii 'Deep ecotype' .....................................  320 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bdellovibrio bacteriovorus ...............................................  320 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................  319 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli APEC O1 .................................................  319 2 hits [enterobacteria]         RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Geobacter uraniireducens Rf4 .............................................  318 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio magneticus RS-1 ............................................  318 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas campestris pv. phaseoli ......................................  318 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Anaeromyxobacter sp. Fw109-5 .............................................  317 2 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Geobacter bemidjiensis Bem ...............................................  317 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas campestris pv. campestris ....................................  317 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas campestris pv. campestris str. 8004 ..........................  317 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Myxococcus xanthus DK 1622 ...............................................  317 2 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Anaeromyxobacter dehalogenans 2CP-C ......................................  317 2 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Xanthomonas campestris pv. campestris str. B100 ..........................  316 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Geobacter sp. M21 ........................................................  316 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Lawsonia intracellularis PHE/MN1-00 ......................................  315 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas oryzae pv. oryzae ............................................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas oryzae pv. oryzae PXO99A .....................................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xanthomonas axonopodis pv. citri .........................................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio vulgaris str. Hildenborough ................................  315 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio vulgaris DP4 ...............................................  315 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Azotobacter vinelandii ...................................................  315 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Coxiella burnetii RSA 331 ................................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Coxiella burnetii ........................................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Coxiella burnetii Dugway 5J108-111 .......................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Coxiella burnetii CbuK_Q154 ..............................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Coxiella burnetii CbuG_Q212 ..............................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Oleispira antarctica .....................................................  314 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  313 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Methylococcus capsulatus .................................................  313 3 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Hahella chejuensis KCTC 2396 .............................................  313 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Alcanivorax borkumensis SK2 ..............................................  313 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio vulnificus ........................................................  312 2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Vibrio vulnificus YJ016 ..................................................  312 2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Neisseria meningitidis 053442 ............................................  311 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. holarctica LVS .............................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. holarctica OSU18 ...........................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. holarctica FTNF002-00 ......................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........  311 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus parasuis SH0165 ..............................................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Stenotrophomonas maltophilia R551-3 ......................................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nitrosospira multiformis ATCC 25196 ......................................  311 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Dichelobacter nodosus VCS1703A ...........................................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Neisseria gonorrhoeae NCCP11945 ..........................................  311 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudoalteromonas atlantica T6c ..........................................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Idiomarina loihiensis ....................................................  311 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Polaromonas sp. JS666 ....................................................  311 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Sorangium cellulosum 'So ce 56' ..........................................  311 2 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Neisseria gonorrhoeae FA 1090 ............................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Stenotrophomonas maltophilia K279a .......................................  310 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Neisseria meningitidis serogroup A .......................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Neisseria meningitidis FAM18 .............................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Methylibium petroleiphilum PM1 ...........................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Polaromonas naphthalenivorans CJ2 ........................................  310 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Chromobacterium violaceum ................................................  310 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Vibrio parahaemolyticus ..................................................  310 2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Neisseria meningitidis serogroup B .......................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Aromatoleum aromaticum EbN1 ..............................................  310 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................  310 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. tularensis WY96-3418 .......................  310 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio harveyi ATCC BAA-1116 .............................................  310 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella novicida U112 ................................................  310 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................  310 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Thioalkalivibrio sp. HL-EbGR7 ............................................  309 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Aggregatibacter actinomycetemcomitans ....................................  309 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Cellvibrio japonicus Ueda107 .............................................  309 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Rhodoferax ferrireducens T118 ............................................  309 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Chromohalobacter salexigens DSM 3043 .....................................  309 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Proteus mirabilis HI4320 .................................................  309 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Verminephrobacter eiseniae EF01-2 ........................................  308 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia xenovorans LB400 ............................................  308 4 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Delftia acidovorans SPH-1 ................................................  308 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Actinobacillus pleuropneumoniae ..........................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  308 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter sp. ADP1 ...................................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Diaphorobacter sp. TPSY ..................................................  308 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Enterobacter aerogenes ...................................................  308 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Neisseria flavescens .....................................................  308 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. mediasiatica FSC147 ........................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  308 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Klebsiella pneumoniae 342 ................................................  308 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii ACICU ............................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii SDF ..............................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii AB307-0294 .......................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii AB0057 ...........................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii AYE ..............................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acinetobacter baumannii ATCC 17978 .......................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Vesicomyosocius okutanii HA ...................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Actinobacillus pleuropneumoniae L20 ......................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Edwardsiella ictaluri 93-146 .............................................  308 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. tularensis .................................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Francisella tularensis subsp. tularensis FSC198 ..........................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................  308 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pectobacterium carotovorum subsp. carotovorum ............................  307 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus influenzae PittGG ............................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Neisseria gonorrhoeae ....................................................  307 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio cholerae O395 .....................................................  307 2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Pseudoalteromonas haloplanktis TAC125 ....................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Leptothrix cholodnii SP-6 ................................................  307 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Cronobacter sakazakii ATCC BAA-894 .......................................  307 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Colwellia maris ..........................................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pelobacter carbinolicus DSM 2380 .........................................  307 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio cholerae ..........................................................  307 2 hits [g-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Haemophilus somnus 129PT .................................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus somnus 2336 ..................................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Actinobacillus succinogenes 130Z .........................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Variovorax paradoxus S110 ................................................  307 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Azoarcus sp. BH72 ........................................................  307 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Marinomonas sp. MWYL1 ....................................................  307 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Mannheimia succiniciproducens MBEL55E ....................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella loihica PV-4 ..................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xylella fastidiosa Temecula1 .............................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xylella fastidiosa M23 ...................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Serratia rubidaea ........................................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xylella fastidiosa .......................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pantoea agglomerans ......................................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Photorhabdus luminescens subsp. laumondii ................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas stutzeri A1501 ...............................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus influenzae 86-028NP ..........................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio harveyi ...........................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Buchnera aphidicola (Thelaxes suberi) ....................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Raoultella ornithinolytica ...............................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Klebsiella oxytoca .......................................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Enterobacter asburiae ....................................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus influenzae PittEE ............................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Xylella fastidiosa M12 ...................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas stutzeri .....................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Serratia marcescens ......................................................  306 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas putida GB-1 ..................................................  306 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella woodyi ATCC 51908 .............................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Serratia ficaria .........................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acidovorax sp. JS42 ......................................................  305 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella amazonensis SB2B ..............................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Pterocomma populeum) ................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli 536 .....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia enterocolitica ..................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli K-12 ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli O6 ......................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli O157:H7 .................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella flexneri ........................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli UTI89 ...................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella boydii Sb227 ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella dysenteriae Sd197 ...............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella sonnei Ss046 ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella flexneri 5 str. 8401 ............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli E24377A .................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli HS ......................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli ATCC 8739 ...............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli S88 .....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli O157:H7 str. EC4115 .....................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli IAI39 ...................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli IAI1 ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli str. K-12 substr. DH10B .................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli UMN026 ..................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli SE11 ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli SMS-3-5 .................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shigella boydii CDC 3083-94 ..............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli O127:H6 str. E2348/69 ...................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli 55989 ...................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli ED1a ....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia coli BW2952 ..................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Enterobacter sp. 638 .....................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Blochmannia floridanus ........................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Janthinobacterium sp. Marseille ..........................................  305 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Chaetophorus leucomelas) ............................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Serratia proteamaculans 568 ..............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pestis Antiqua ..................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pestis ..........................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pseudotuberculosis ..............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pestis Nepal516 .................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pestis Pestoides F ..............................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pseudotuberculosis IP 31758 .....................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pseudotuberculosis PB1/+ ........................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pestis Angola ...................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Yersinia pseudotuberculosis YPIII ........................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pantoea ananatis .........................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Enterobacter amnigenus ...................................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella pealeana ATCC 700345 ..........................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia cepacia .....................................................  305 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Rhopalosiphum padi) .................................  305 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia thailandensis ...............................................  305 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia thailandensis E264 ..........................................  305 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Haemophilus ducreyi ......................................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas aeruginosa PA7 ...............................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas aeruginosa ...................................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas aeruginosa LESB58 ............................................  305 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia vietnamiensis ...............................................  304 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia vietnamiensis G4 ............................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia cenocepacia AU 1054 .........................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Burkholderia cenocepacia HI2424 ..........................................  304 3 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Syntrophobacter fumaroxidans MPOB ........................................  304 2 hits [d-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Haemophilus influenzae ...................................................  304 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Acyrthosiphon pisum) ................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pasteurella multocida ....................................................  304 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Kluyvera intermedia ......................................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia pseudomallei ................................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Burkholderia pseudomallei 668 ............................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Erwinia tasmaniensis .....................................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Schizaphis graminum) ................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia pseudomallei 1710b ..........................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Burkholderia pseudomallei 1106a ..........................................  304 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Burkholderia mallei ......................................................  304 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia mallei NCTC 10247 ...........................................  304 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia mallei NCTC 10229 ...........................................  304 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia mallei SAVP1 ................................................  304 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Raoultella planticola ....................................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella sediminis HAW-EB3 .............................................  304 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Myzus persicae) .....................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Sodalis glossinidius .....................................................  304 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Sodalis glossinidius str. 'morsitans' ....................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Geobacter lovleyi SZ .....................................................  303 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella halifaxensis HAW-EB4 ..........................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Typhi ........................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica ......................................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Citrobacter koseri ATCC BAA-895 ..........................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Dechloromonas aromatica RCB ..............................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pectobacterium atrosepticum ..............................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas putida W619 ..................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Acidovorax citrulli AAC00-1 ..............................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Tuberolachnus salignus) .............................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas fluorescens Pf-5 .............................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia phytofirmans PsJN ...........................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas putida F1 ....................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas mendocina ymp ................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Thiobacillus denitrificans ATCC 25259 ....................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Erwinia aphidicola .......................................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia phymatum STM815 .............................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas putida KT2440 ................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella sp. ANA-3 .....................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Enterobacter gergoviae ...................................................  303 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella oneidensis ....................................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas entomophila L48 ..............................................  303 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Herminiimonas arsenicoxydans .............................................  303 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella sp. MR-4 ......................................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella sp. MR-7 ......................................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Ralstonia solanacearum ...................................................  302 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas putida .......................................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas fluorescens SBW25 ............................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Colwellia psychrerythraea 34H ............................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Methylobacillus flagellatus KT ...........................................  302 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio fischeri ES114 ....................................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Vibrio fischeri MJ11 .....................................................  302 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Burkholderia sp. 383 .....................................................  302 2 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . . Burkholderia ambifaria AMMD ..............................................  302 3 hits [b-proteobacteria]       RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . . Buchnera aphidicola (Rhopalosiphum maidis) ...............................  302 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella piezotolerans WP3 .............................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella putrefaciens CN-32 ............................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Tolumonas auensis DSM 9187 ...............................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Allochromatium vinosum ...................................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Baizongia pistaciae) ................................  301 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella sp. W3-18-1 ...................................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Psychrobacter sp. PRwf-1 .................................................  301 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella baltica OS185 .................................................  300 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bordetella avium 197N ....................................................  300 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola (Tetraneura caerulescens) ............................  300 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bordetella petrii DSM 12804 ..............................................  300 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella baltica OS155 .................................................  300 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Klebsiella pneumoniae ....................................................  300 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella denitrificans OS217 ...........................................  300 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bordetella parapertussis .................................................  300 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bordetella bronchiseptica ................................................  300 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Bordetella pertussis .....................................................  300 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Psychrobacter arcticus 273-4 .............................................  300 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  299 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Shewanella frigidimarina NCIMB 400 .......................................  299 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Buchnera aphidicola str. Cc (Cinara cedri) ...............................  299 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Psychrobacter cryohalolentis K5 ..........................................  299 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Photobacterium profundum .................................................  298 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nitrosococcus oceani ATCC 19707 ..........................................  298 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfotalea psychrophila ................................................  298 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Stenotrophomonas maltophilia .............................................  298 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas fluorescens Pf0-1 ............................................  297 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Ralstonia eutropha H16 ...................................................  297 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................  297 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Aeromonas salmonicida ....................................................  297 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Thiomicrospira crunogena XCL-2 ...........................................  296 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Sulfurovum sp. NBC37-1 ...................................................  296 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter lari RM2100 ................................................  295 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas syringae pv. tomato ..........................................  295 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  295 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Pseudomonas syringae pv. syringae B728a ..................................  295 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Cupriavidus taiwanensis ..................................................  295 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Ralstonia eutropha JMP134 ................................................  295 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nitrosomonas eutropha C91 ................................................  294 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Cupriavidus metallidurans CH34 ...........................................  294 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Arcobacter butzleri RM4018 ...............................................  294 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter jejuni subsp. doylei 269.97 ................................  293 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter jejuni subsp. jejuni 81116 .................................  293 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter jejuni RM1221 ..............................................  292 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter jejuni .....................................................  292 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter jejuni subsp. jejuni 81-176 ................................  292 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter fetus subsp. fetus 82-40 ...................................  292 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................  292 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Sulfurimonas denitrificans DSM 1251 ......................................  291 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............  291 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Methylovorus sp. SS1 .....................................................  290 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter curvus 525.92 ..............................................  290 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nitrosomonas europaea ....................................................  290 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Wolinella succinogenes ...................................................  289 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Marinobacter aquaeolei VT8 ...............................................  287 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Halorhodospira halophila SL1 .............................................  286 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter concisus 13826 .............................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori J99 ..................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter rectus .....................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori Shi470 ...............................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori HPAG1 ................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori ......................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori G27 ..................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter pylori P12 ..................................................  286 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfatibacillum alkenivorans AK-01 .....................................  285 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Campylobacter hominis ATCC BAA-381 .......................................  283 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Tremblaya princeps ............................................  282 1 hit  [b-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Escherichia fergusonii ATCC 35469 ........................................  281 1 hit  [enterobacteria]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nautilia profundicola AmH ................................................  281 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Carsonella ruddii PV ..........................................  281 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter acinonychis str. Sheeba .....................................  281 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Desulfococcus oleovorans Hxd3 ............................................  280 1 hit  [d-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Nitratiruptor sp. SB155-2 ................................................  277 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Legionella pneumophila str. Corby ........................................  276 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Legionella pneumophila str. Paris ........................................  276 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  276 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Legionella pneumophila str. Lens .........................................  276 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Legionella pneumophila ...................................................  275 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Helicobacter hepaticus ...................................................  274 1 hit  [e-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Tatlockia micdadei .......................................................  274 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . . Candidatus Legionella jeonii .............................................  273 1 hit  [g-proteobacteria]       RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Gramella forsetii KT0803 ---------------------------------------------------  312 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Flavobacterium psychrophilum JIP02/86 ......................................  310 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobium chlorochromatii CaD3 ............................................  307 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Flavobacterium johnsoniae UW101 ............................................  305 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Sulcia muelleri GWSS ............................................  305 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chloroherpeton thalassium ATCC 35110 .......................................  303 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Akkermansia muciniphila ATCC BAA-835 .......................................  303 1 hit  [verrucomicrobia]        RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobium luteolum DSM 273 ................................................  303 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Rhodothermus marinus .......................................................  303 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobaculum parvum NCIB 8327 .............................................  303 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Pelodictyon phaeoclathratiforme BU-1 .......................................  303 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobium phaeobacteroides DSM 266 ........................................  302 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobium limicola DSM 245 ................................................  301 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobium phaeobacteroides BS1 ............................................  301 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlorobaculum tepidum ......................................................  301 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Prosthecochloris aestuarii DSM 271 .........................................  301 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Cytophaga hutchinsonii ATCC 33406 ..........................................  300 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Porphyromonas gingivalis ...................................................  299 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Porphyromonas gingivalis ATCC 33277 ........................................  299 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Amoebophilus asiaticus 5a2 ......................................  298 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Protochlamydia amoebophila UWE25 ................................  298 3 hits [chlamydias]             RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Chlorobium phaeovibrioides DSM 265 .........................................  296 1 hit  [green sulfur bacteria]  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ..............  296 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Gemmatimonas aurantiaca T-27 ...............................................  296 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Dictyoglomus turgidum DSM 6724 .............................................  295 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Dictyoglomus thermophilum H-6-12 ...........................................  295 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Parabacteroides distasonis ATCC 8503 .......................................  293 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactococcus lactis subsp. cremoris MG1363 ..................................  292 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactococcus lactis subsp. lactis ...........................................  292 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactococcus lactis subsp. cremoris SK11 ....................................  292 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermodesulfovibrio yellowstonii DSM 11347 .................................  292 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus gordonii str. Challis ........................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira interrogans .....................................................  291 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus gordonii .....................................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Salinibacter ruber DSM 13855 ...............................................  291 2 hits [CFB group bacteria]     RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Tannerella forsythia .......................................................  291 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus anginosus ....................................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Exiguobacterium sp. AT1b ...................................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus constellatus .................................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Enterococcus faecalis ......................................................  291 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira borgpetersenii serovar Hardjo-bovis JB197 .......................  291 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira borgpetersenii serovar Hardjo-bovis L550 ........................  291 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Anoxybacillus flavithermus WK1 .............................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Geobacillus kaustophilus ...................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria welshimeri serovar 6b str. SLCC5334 ...............................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria monocytogenes HCC23 ...............................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria monocytogenes .....................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria monocytogenes str. 4b F2365 .......................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria monocytogenes Clip80459 ...........................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus agalactiae serogroup V .......................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus agalactiae serogroup Ia ......................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Geobacillus thermodenitrificans NG80-2 .....................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Listeria innocua ...........................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus sakei subsp. sakei 23K .......................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cytotoxicus NVH 391-98 ............................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira interrogans serovar Copenhageni .................................  290 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Geobacillus sp. WCH70 ......................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus G9842 ......................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus ATCC 14579 .................................................  290 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus B4264 ......................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus ............................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus anthracis (anthrax) ...............................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus anthracis str. A0248 ..............................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus anthracis str. CDC 684 ............................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus E33L .......................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus thuringiensis serovar konkukian ...................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus ATCC 10987 .................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus thuringiensis str. Al Hakam .......................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus AH820 ......................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus AH187 ......................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus 03BB102 ....................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus cereus Q1 .........................................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Geobacillus stearothermophilus .............................................  289 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydophila pneumoniae ...................................................  289 2 hits [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Solibacter usitatus Ellin6076 ...................................  288 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus agalactiae serogroup III .....................................  288 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus weihenstephanensis KBAB4 ..........................................  288 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' ...................  288 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ..................  288 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus pumilus SAFR-032 ..................................................  288 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Fusobacterium nucleatum subsp. nucleatum ...................................  288 1 hit  [fusobacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Geobacillus thermoglucosidasius ............................................  288 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus mutans .......................................................  288 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus sanguinis ....................................................  287 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus sanguinis SK36 ...............................................  287 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus agalactiae ...................................................  287 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus equi subsp. equi 4047 ........................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus equi subsp. zooepidemicus MGCS10565 ..........................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus licheniformis ATCC 14580 ..........................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus zeae .........................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus casei ATCC 334 ...............................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus casei BL23 ...................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus sp. PS3 ...........................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium novyi NT .......................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Steptococcus equi subsp. zooepidemicus H70 .................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Oceanobacillus iheyensis ...................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Methylacidiphilum infernorum V4 ............................................  286 1 hit  [verrucomicrobia]        RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus uberis 0140J .................................................  286 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus gasseri ATCC 33323 ...........................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacteroides fragilis .......................................................  285 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacteroides fragilis NCTC 9343 .............................................  285 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydia muridarum (agent of mouse pneumon...) ............................  285 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydophila felis Fe/C-56 ................................................  285 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydia trachomatis A/HAR-13 .............................................  285 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Exiguobacterium sibiricum 255-15 ...........................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus COL ....................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus USA300 .................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus str. Newman ............................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus USA300_TCH1516 .........................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus MW2 ....................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus N315 ...................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus Mu50 ...................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus MSSA476 ................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus Mu3 ....................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus JH1 ....................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus JH9 ....................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus RF122 ................................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus MRSA252 ................................  285 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydia trachomatis ......................................................  285 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydophila caviae .......................................................  285 2 hits [chlamydias]             RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Fusobacterium nucleatum subsp. polymorphum .................................  285 1 hit  [fusobacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus amyloliquefaciens FZB42 ...........................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus subtilis ..........................................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum ......................................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus salivarius UCC118 ............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacteroides thetaiotaomicron ...............................................  284 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus johnsonii ....................................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Macrococcus caseolyticus JCSC5402 ..........................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae Hungary19A-6 ......................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae CGSP14 ............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Gloeobacter violaceus ......................................................  284 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Streptococcus pneumoniae ...................................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae R6 ................................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae D39 ...............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae G54 ...............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae 70585 .............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae ATCC 700669 .......................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae JJA ...............................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae Taiwan19F-14 ......................................  284 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Desulfitobacterium hafniense DCB-2 .........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pneumoniae P1031 .............................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes serotype M6 .........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes str. Manfredo .......................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes serotype M1 .........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus subsp. aureus NCTC 8325 ..............................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes serotype M18 ........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes MGAS2096 ............................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes MGAS9429 ............................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes MGAS10750 ...........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes serotype M28 ........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes NZ131 ...............................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes MGAS10270 ...........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus pyogenes serotype M3 .........................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus haemolyticus JCSC1435 .......................................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus carnosus subsp. carnosus TM300 ..............................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 .....................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ...................  283 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Pediococcus pentosaceus ATCC 25745 .........................................  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycoplasma penetrans .......................................................  282 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus epidermidis RP62A ...........................................  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus epidermidis ATCC 12228 ......................................  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...............  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermosipho melanesiensis BI429 ............................................  282 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Desulfitobacterium hafniense Y51 ...........................................  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Desulfotomaculum reducens MI-1 .............................................  282 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lysinibacillus sphaericus C3-41 ............................................  281 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermotoga maritima ........................................................  281 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermotoga petrophila RKU-1 ................................................  281 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermotoga sp. RQ2 .........................................................  281 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Koribacter versatilis Ellin345 ..................................  281 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus clausii KSM-K16 ...................................................  281 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus fermentum IFO 3956 ...........................................  281 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus plantarum ....................................................  281 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus brevis ATCC 367 ..............................................  280 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium acetobutylicum .................................................  280 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus epidermidis .................................................  280 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Aquifex aeolicus ...........................................................  280 1 hit  [aquificales]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacillus halodurans ........................................................  280 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Halothermothrix orenii H 168 ...............................................  280 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Hydrogenobaculum sp. Y04AAS1 ...............................................  279 1 hit  [aquificales]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Rhodopirellula baltica .....................................................  279 3 hits [planctomycetes]         RecName: Full=60 kDa chaperonin 3; AltName: Full=Protein Cp
. . Natranaerobius thermophilus JW/NM-WN-LF ....................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium tetani .........................................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydia trachomatis 434/Bu ...............................................  279 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Chlamydia trachomatis L2b/UCH-1/proctitis ..................................  279 1 hit  [chlamydias]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Eubacterium rectale ATCC 33656 .............................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus thermophilus CNRZ1066 ........................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus thermophilus LMG 18311 .......................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptococcus thermophilus LMD-9 ...........................................  279 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermotoga neapolitana .....................................................  279 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Tetragenococcus halophilus .................................................  278 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermus thermophilus HB27 ..................................................  278 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermus thermophilus HB8 ...................................................  278 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Syntrophomonas wolfei subsp. wolfei str. Goettingen ........................  278 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium beijerinckii NCIMB 8052 ........................................  278 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Heliobacterium modesticaldum Ice1 ..........................................  277 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium perfringens ....................................................  277 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium perfringens ATCC 13124 .........................................  277 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Treponema denticola ........................................................  277 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum E3 str. Alaska E43 ...................................  277 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ...................  277 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bacteroides vulgatus ATCC 8482 .............................................  277 1 hit  [CFB group bacteria]     RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia garinii ...........................................................  276 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia afzelii PKo .......................................................  276 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermosipho africanus TCF52B ...............................................  276 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermotoga lettingae TMO ...................................................  276 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia burgdorferi ZS7 ...................................................  276 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia burgdorferi .......................................................  276 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Roseiflexus castenholzii DSM 13941 .........................................  275 2 hits [GNS bacteria]           RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Alkaliphilus oremlandii OhILAs .............................................  275 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia duttonii Ly .......................................................  274 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia recurrentis A1 ....................................................  274 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum B str. Eklund 17B ....................................  274 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus reuteri DSM 20016 ............................................  274 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus reuteri JCM 1112 .............................................  274 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Symbiobacterium thermophilum ...............................................  274 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Roseiflexus sp. RS-1 .......................................................  273 2 hits [GNS bacteria]           RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Clostridium thermocellum ATCC 27405 ........................................  273 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptomyces avermitilis ...................................................  273 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Moorella thermoacetica ATCC 39073 ..........................................  273 2 hits [firmicutes]             RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Deinococcus geothermalis DSM 11300 .........................................  273 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Sulfurihydrogenibium sp. YO3AOP1 ...........................................  272 1 hit  [aquificales]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . uncultured Termite group 1 bacterium phylotype Rs-D17 ......................  272 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Anabaena sp. L-31 ..........................................................  272 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=61 kDa cha
. . Clostridium kluyveri DSM 555 ...............................................  271 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium kluyveri NBRC 12016 ............................................  271 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Deinococcus radiodurans ....................................................  271 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium cellulolyticum H10 .............................................  271 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Oenococcus oeni PSU-1 ......................................................  271 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus helveticus DPC 4571 ..........................................  271 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Fervidobacterium nodosum Rt17-B1 ...........................................  271 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Parascardovia denticolens ..................................................  271 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Treponema pallidum .........................................................  270 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Treponema pallidum subsp. pallidum SS14 ....................................  270 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Pelotomaculum thermopropionicum SI .........................................  270 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Anabaena variabilis ATCC 29413 .............................................  270 3 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Nocardioides sp. JS614 .....................................................  270 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Lactobacillus helveticus ...................................................  270 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermoanaerobacter pseudethanolicus ATCC 33223 .............................  270 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermoanaerobacter sp. X514 ................................................  270 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Candidatus Desulforudis audaxviator MP104C .................................  270 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermobifida fusca YX ......................................................  270 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Eubacterium eligens ATCC 27750 .............................................  269 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Finegoldia magna ATCC 29328 ................................................  269 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermosynechococcus elongatus BP-1 .........................................  269 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Thermosynechococcus vulcanus ...............................................  269 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Corynebacterium glutamicum .................................................  269 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Scardovia inopinata ........................................................  269 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptomyces coelicolor ....................................................  269 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Corynebacterium glutamicum R ...............................................  269 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus sp. JA-2-3B'a(2-13) ..........................................  268 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Deinococcus deserti VCD115 .................................................  268 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Coprothermobacter proteolyticus DSM 5265 ...................................  268 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Nostoc sp. PCC 7120 ........................................................  268 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Caldicellulosiruptor saccharolyticus DSM 8903 ..............................  268 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium difficile 630 ..................................................  268 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium phytofermentans ISDg ...........................................  268 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Anaerocellum thermophilum DSM 6725 .........................................  267 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Borrelia turicatae 91E135 ..................................................  267 1 hit  [spirochetes]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptomyces albus G .......................................................  266 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Clostridium difficile ......................................................  266 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Lactobacillus acidophilus ..................................................  266 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Petrotoga mobilis SJ95 .....................................................  266 1 hit  [thermotogales]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Alkaliphilus metalliredigens QYMF ..........................................  266 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Carboxydothermus hydrogenoformans Z-2901 ...................................  266 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Trichodesmium erythraeum IMS101 ............................................  266 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Acaryochloris marina MBIC11017 .............................................  266 3 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Corynebacterium efficiens ..................................................  266 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Kineococcus radiotolerans SRS30216 .........................................  266 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Thermoanaerobacter tengcongensis ...........................................  265 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Thermoanaerobacter brockii .................................................  265 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Staphylococcus aureus ......................................................  265 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Acholeplasma laidlawii PG-8A ...............................................  264 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Corynebacterium diphtheriae ................................................  264 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechocystis sp. PCC 6803 .................................................  263 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus sp. CC9902 ...................................................  263 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. NATL2A ........................................  263 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Bifidobacterium animalis subsp. lactis AD011 ...............................  263 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bifidobacterium animalis subsp. lactis DSM 10140 ...........................  263 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Prochlorococcus marinus str. NATL1A ........................................  263 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus sp. WH 8102 ..................................................  262 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Propionibacterium acnes ....................................................  262 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Saccharopolyspora erythraea NRRL 2338 ......................................  262 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus elongatus PCC 6301 ...........................................  262 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Corynebacterium jeikeium K411 ..............................................  262 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Herpetosiphon aurantiacus ATCC 23779 .......................................  262 1 hit  [GNS bacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium vanbaalenii PYR-1 ............................................  262 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus sp. JA-3-3Ab .................................................  262 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Mycobacterium avium subsp. paratuberculosis ................................  261 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium avium 104 ....................................................  261 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Arthrobacter aurescens TC1 .................................................  261 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Salinispora tropica CNB-440 ................................................  261 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Arthrobacter sp. FB24 ......................................................  260 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Mycobacterium ulcerans Agy99 ...............................................  259 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Acidothermus cellulolyticus 11B ............................................  259 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Elusimicrobium minutum Pei191 ..............................................  259 1 hit  [bacteria]               RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Synechococcus sp. RCC307 ...................................................  259 1 hit  [cyanobacteria]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Prochlorococcus marinus ....................................................  259 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Synechococcus sp. WH 7803 ..................................................  259 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. MIT 9313 ......................................  259 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus elongatus PCC 7942 ...........................................  259 1 hit  [cyanobacteria]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Synechococcus sp. CC9311 ...................................................  258 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. MIT 9303 ......................................  258 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium sp. JLS ......................................................  258 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Mycobacterium sp. KMS ......................................................  258 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Mycobacterium sp. MCS ......................................................  258 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Brevibacillus choshinensis .................................................  258 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Nocardia farcinica .........................................................  258 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Mycobacterium smegmatis str. MC2 155 .......................................  258 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Chloroflexus aurantiacus J-10-fl ...........................................  258 2 hits [GNS bacteria]           RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Clostridium botulinum Ba4 str. 657 .........................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Synechococcus sp. CC9605 ...................................................  257 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Clostridium botulinum A3 str. Loch Maree ...................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum A str. ATCC 19397 ....................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum A str. Hall ..........................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum F str. Langeland .....................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum B1 str. Okra .........................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clostridium botulinum A2 str. Kyoto ........................................  257 1 hit  [firmicutes]             RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Frankia alni ACN14a ........................................................  256 4 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 4; AltName: Full=Protein Cp
. . Frankia sp. CcI3 ...........................................................  256 4 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 4; AltName: Full=Protein Cp
. . Mycobacterium tuberculosis .................................................  256 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium bovis ........................................................  256 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium bovis BCG str. Pasteur 1173P2 ................................  256 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium tuberculosis H37Ra ...........................................  256 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Salinispora arenicola CNS-205 ..............................................  256 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. AS9601 ........................................  255 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. MIT 9215 ......................................  255 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. MIT 9301 ......................................  255 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium gilvum PYR-GCK ...............................................  255 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Prochlorococcus marinus str. MIT 9312 ......................................  254 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Mycobacterium leprae .......................................................  254 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Rubrobacter xylanophilus DSM 9941 ..........................................  254 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Prochlorococcus marinus str. MIT 9515 ......................................  254 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ......................  254 2 hits [cyanobacteria]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Rhodococcus equi ...........................................................  254 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Beutenbergia cavernae DSM 12333 ............................................  253 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bifidobacterium longum .....................................................  253 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bifidobacterium longum DJO10A ..............................................  253 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bifidobacterium longum subsp. infantis ATCC 15697 ..........................  252 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Tropheryma whipplei TW08/27 ................................................  251 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Rhodococcus jostii RHA1 ....................................................  251 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Tropheryma whipplei ........................................................  251 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Tropheryma whipplei str. Twist .............................................  251 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Gardnerella vaginalis ......................................................  251 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Tsukamurella tyrosinosolvens ...............................................  249 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Streptomyces lividans ......................................................  248 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cp
. . Aster yellows witches'-broom phytoplasma AYWB ..............................  248 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clavibacter michiganensis subsp. michiganensis NCPPB 382 ...................  247 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Clavibacter michiganensis subsp. sepedonicus ...............................  247 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Nocardia asteroides ........................................................  247 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Bifidobacterium adolescentis ATCC 15703 ....................................  246 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Onion yellows phytoplasma ..................................................  246 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Tsukamurella paurometabola .................................................  244 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Renibacterium salmoninarum ATCC 33209 ......................................  244 2 hits [high GC Gram+]          RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cp
. . Leifsonia xyli subsp. xyli .................................................  244 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Dehalococcoides sp. CBDB1 ..................................................  235 1 hit  [GNS bacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Dehalococcoides sp. BAV1 ...................................................  234 1 hit  [GNS bacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Dehalococcoides ethenogenes 195 ............................................  234 1 hit  [GNS bacteria]           RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycoplasma gallisepticum ...................................................  222 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycoplasma genitalium ......................................................  200 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycoplasma pneumoniae ......................................................  197 1 hit  [mycoplasmas]            RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium avium ........................................................  179 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium marinum ......................................................  178 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium chelonae .....................................................  177 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium fortuitum ....................................................  176 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium scrofulaceum .................................................  140 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium malmoense ....................................................  139 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium intracellulare ...............................................  139 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium pulveris .....................................................  138 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium ulcerans .....................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium asiaticum ....................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium rhodesiae ....................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium gordonae .....................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium phlei ........................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium xenopi .......................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium genavense ....................................................  137 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium gastri .......................................................  136 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium kansasii .....................................................  136 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium fallax .......................................................  135 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium nonchromogenicum .............................................  135 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium agri .........................................................  135 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium shimoidei ....................................................  135 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium chitae .......................................................  135 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. . Mycobacterium vaccae .......................................................  134 1 hit  [high GC Gram+]          RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Methanococcus vannielii SB ---------------------------------------------------  296 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Cucurbita maxima (great pumpkin) .............................................  289 2 hits [eudicots]               RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: F
. Arabidopsis thaliana (thale-cress) ...........................................  286 7 hits [eudicots]               RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Ful
. Zea mays (maize) .............................................................  282 2 hits [monocots]               RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: F
. Candida albicans .............................................................  281 1 hit  [ascomycetes]            RecName: Full=Heat shock protein 60, mitochondrial; AltName
. Ajellomyces capsulatus .......................................................  281 1 hit  [ascomycetes]            RecName: Full=Heat shock protein 60, mitochondrial; AltName
. Paracoccidioides brasiliensis Pb01 ...........................................  278 1 hit  [ascomycetes]            RecName: Full=Heat shock protein 60, mitochondrial; AltName
. Methanosarcina barkeri str. Fusaro ...........................................  274 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Schizosaccharomyces pombe ....................................................  274 5 hits [ascomycetes]            RecName: Full=Heat shock protein 60, mitochondrial; Short=H
. Emericella nidulans ..........................................................  274 1 hit  [ascomycetes]            RecName: Full=Heat shock protein 60; AltName: Full=60 kDa c
. Saccharomyces cerevisiae (yeast) .............................................  270 4 hits [ascomycetes]            RecName: Full=Heat shock protein 60, mitochondrial; AltName
. Methanosarcina mazei .........................................................  270 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Drosophila melanogaster ......................................................  269 3 hits [flies]                  RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Methanosarcina acetivorans ...................................................  268 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Bos taurus (cow) .............................................................  263 5 hits [even-toed ungulates]    RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Pongo abelii (Orang-utan) ....................................................  262 5 hits [primates]               RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Homo sapiens (man) ...........................................................  261 7 hits [primates]               RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Rattus norvegicus (brown rat) ................................................  260 4 hits [rodents]                RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Mus musculus (mouse) .........................................................  260 6 hits [rodents]                RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Gallus gallus (bantam) .......................................................  260 3 hits [birds]                  RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Cricetulus griseus (Chinese hamsters) ........................................  260 1 hit  [rodents]                RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Dictyostelium discoideum .....................................................  259 6 hits [cellular slime molds]   RecName: Full=60 kDa heat shock protein, mitochondrial; Alt
. Cyanidium caldarium ..........................................................  259 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Brassica napus (rapeseeds) ...................................................  258 4 hits [eudicots]               RecName: Full=Chaperonin CPN60, mitochondrial; Flags: Precu
. Caenorhabditis elegans (nematode) ............................................  256 3 hits [nematodes]              RecName: Full=Chaperonin homolog Hsp-60, mitochondrial; Alt
. Trypanosoma brucei brucei ....................................................  256 1 hit  [kinetoplastids]         RecName: Full=Chaperonin HSP60, mitochondrial; Short=Protei
. Candidatus Methanoregula boonei 6A8 ..........................................  255 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Euglena gracilis .............................................................  254 1 hit  [euglenoids]             RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Ful
. Cyanophora paradoxa ..........................................................  254 1 hit  [eukaryotes]             RecName: Full=60 kDa chaperonin, cyanelle; AltName: Full=Pr
. Galdieria sulphuraria ........................................................  251 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Porphyra purpurea ............................................................  250 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Trypanosoma cruzi ............................................................  250 1 hit  [kinetoplastids]         RecName: Full=Chaperonin HSP60, mitochondrial; Short=Protei
. Leishmania major .............................................................  249 1 hit  [kinetoplastids]         RecName: Full=Chaperonin HSP60, mitochondrial; Short=Protei
. Heliothis virescens ..........................................................  249 1 hit  [moths]                  RecName: Full=63 kDa chaperonin, mitochondrial; AltName: Fu
. Porphyra yezoensis ...........................................................  246 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Odontella sinensis ...........................................................  245 1 hit  [diatoms]                RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Guillardia theta .............................................................  244 1 hit  [cryptomonads]           RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Emiliania huxleyi ............................................................  244 1 hit  [haptophytes]            RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Phaeodactylum tricornutum ....................................................  239 1 hit  [diatoms]                RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Thalassiosira pseudonana .....................................................  238 1 hit  [diatoms]                RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Gracilaria tenuistipitata var. liui ..........................................  236 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Pisum sativum (peas) .........................................................  234 2 hits [eudicots]               RecName: Full=RuBisCO large subunit-binding protein subunit
. Methanospirillum hungatei JF-1 ...............................................  233 1 hit  [euryarchaeotes]         RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn6
. Cyanidioschyzon merolae ......................................................  231 1 hit  [red algae]              RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Trichomonas vaginalis ........................................................  228 1 hit  [trichomonads]           RecName: Full=Hydrogenosomal chaperonin HSP60; Short=Protei
. Triticum aestivum (common wheat) .............................................  222 1 hit  [monocots]               RecName: Full=RuBisCO large subunit-binding protein subunit
. Ricinus communis .............................................................  219 1 hit  [eudicots]               RecName: Full=RuBisCO large subunit-binding protein subunit
. Chlamydomonas reinhardtii ....................................................  218 2 hits [green algae]            RecName: Full=RuBisCO large subunit-binding protein subunit
. Pyrenomonas salina ...........................................................  215 1 hit  [cryptomonads]           RecName: Full=60 kDa chaperonin, chloroplastic; AltName: Fu
. Secale cereale ...............................................................  196 1 hit  [monocots]               RecName: Full=RuBisCO large subunit-binding protein subunit
. Plasmodium falciparum FCR-3/Gambia ...........................................  166 1 hit  [apicomplexans]          RecName: Full=Chaperonin CPN60, mitochondrial; Flags: Precu
. Methanothermobacter thermautotrophicus str. Delta H ..........................   80 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit beta; AltName: Full=Thermo
. Pyrococcus abyssi ............................................................   78 1 hit  [euryarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Chaperonin 
. Haloferax volcanii ...........................................................   76 3 hits [euryarchaeotes]         RecName: Full=Thermosome subunit 2; AltName: Full=Heat shoc
. Pyrococcus horikoshii ........................................................   76 1 hit  [euryarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Chaperonin 
. Halobacterium salinarum ......................................................   75 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit beta; AltName: Full=Thermo
. Methanothermococcus thermolithotrophicus .....................................   75 1 hit  [euryarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Chaperonin 
. Archaeoglobus fulgidus .......................................................   74 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit beta; AltName: Full=Thermo
. Methanocaldococcus jannaschii ................................................   73 1 hit  [euryarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Chaperonin 
. Thermococcus sp. KS-8 ........................................................   72 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Thermococcus kodakarensis ....................................................   71 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Thermococcus sp. KS-1 ........................................................   71 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Desulfurococcus sp. SY .......................................................   71 1 hit  [crenarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Hyperthermo
. Methanopyrus kandleri ........................................................   71 1 hit  [euryarchaeotes]         RecName: Full=Thermosome subunit; AltName: Full=Chaperonin-
. Macaca fascicularis (cynomolgus monkey) ......................................   64 2 hits [primates]               RecName: Full=T-complex protein 1 subunit epsilon; Short=TC
. Thermoplasma acidophilum .....................................................   63 2 hits [euryarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Aeropyrum pernix .............................................................   63 2 hits [crenarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Eremothecium gossypii ........................................................   61 1 hit  [ascomycetes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Kluyveromyces lactis .........................................................   60 1 hit  [ascomycetes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Tetrahymena pyriformis .......................................................   60 2 hits [ciliates]               RecName: Full=T-complex protein 1 subunit eta; Short=TCP-1-
. Candida glabrata .............................................................   58 1 hit  [ascomycetes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Sulfolobus tokodaii ..........................................................   57 1 hit  [crenarchaeotes]         RecName: Full=Thermosome subunit beta; AltName: Full=Thermo
. Takifugu rubripes (tiger puffer) .............................................   57 1 hit  [bony fishes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Ochlerotatus triseriatus .....................................................   57 1 hit  [flies]                  RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Encephalitozoon cuniculi .....................................................   56 3 hits [microsporidians]        RecName: Full=T-complex protein 1 subunit alpha; Short=TCP-
. Schistosoma mansoni ..........................................................   56 1 hit  [flatworms]              RecName: Full=T-complex protein 1 subunit alpha; Short=TCP-
. Oryctolagus cuniculus (domestic rabbit) ......................................   56 1 hit  [rabbits & hares]        RecName: Full=T-complex protein 1 subunit zeta; Short=TCP-1
. Sulfolobus solfataricus ......................................................   56 1 hit  [crenarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Sulfolobus shibatae ..........................................................   55 1 hit  [crenarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Avena sativa (cultivated oat) ................................................   54 2 hits [monocots]               RecName: Full=T-complex protein 1 subunit epsilon; Short=TC
. Sulfolobus acidocaldarius ....................................................   54 1 hit  [crenarchaeotes]         RecName: Full=Thermosome subunit alpha; AltName: Full=Therm
. Plasmodium falciparum 3D7 ....................................................   53 1 hit  [apicomplexans]          RecName: Full=T-complex protein 1 subunit eta; Short=TCP-1-
. Debaryomyces hansenii ........................................................   53 1 hit  [ascomycetes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP-
. Yarrowia lipolytica ..........................................................   53 1 hit  [ascomycetes]            RecName: Full=T-complex protein 1 subunit delta; Short=TCP

in-group
a-proteobacteria
>gi|149688742|gb|ABR27782.1| HSP60 [Candidatus Pelagibacter ubique]
LGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIV
KEGVKYVTAGMNPMDVKRGIDSAVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVG
NEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAV
VQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQVISEDIGVKLE
NVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDYDREKLQERLAKLAGGVAVIK
VGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALLYASQSLDTLKVKGDDQKAGVALVAKALQAP
IRQITLNAGVDGSVVVGKLLEQNKKNMGYDAQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEA
MIADKPHNKDSGAGGMPGGM

>gi|84701593|ref|ZP_01016168.1| putative heat shock protein groEL [Parvularcula bermudensis HTCC2503]
MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELEDKFENMG
AQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGIDLAVTKVIEQIRSNATPVSG
SAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEESKTAETELDVVEGMQFDRGYLSPYFITNAEK
MTTELEDPYILLHEKKLSNLQSMLPLLESAVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDIAVLTGGQVVSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKDDIEGRTAQLR
KQIEDTSSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
YAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENAGQEGSIVVGKLLEQDDTKFGFNAQTEEYGNLL
DMGIVDPAKVVRHALQDAASVAGLLITTEAMIAEAPKKDSGGAGGGMPDMGGMGGMM

>gi|83950579|ref|ZP_00959312.1| chaperonin GroEL [Roseovarius nubinhibens ISM]
MAAKDVKFDTDARNKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELEDKFENMG
AQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGIDMATSKVVEAIKAAARDVTD
SDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEENKGLETETDVVEGMQFDRGYLSPYFVTNADK
MTAELEDCMILLHEKKLSSLQPMVPLLEQVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLQDIAILTGGQVISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIR
NQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV
QAGKSLDGLEGANADQNAGIAIVRRAIEAPLRQIAENAGVDGAVVAGKVRESSDLSFGFNAQTEEYGDMF
KFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPAKEGAGAGGGMPDMGGMGGMM

>gi|220920707|ref|YP_002496008.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
MAAKDVRFASDARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMG
AQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGIDLAVTAVVKDIQGRSKKVSA
SEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEK
MIAELEDPYILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIK
AQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGTALL
RARDAIKDLKSDNADVQAGIKIIVKALEAPIRQIAANAGVEGSIVVGKVSENGSATFGFDAQTETYVDLI
QAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKEAPPAMPGGGGMGGMDF

>gi|254293331|ref|YP_003059354.1| chaperonin GroEL [Hirschia baltica ATCC 49814]
MAAKLVHFGSEARNEMLEGVDILANAVKVTLGPKGRNVVIDKSFGAPRTTKDGVTVAKEIELENKFQNMG
AQMVREVASKANDVAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGIDKAVAEVVATLESNSKKVKT
NEEIAQVGAISANGEREIGDMIAKAMEKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITDAEK
MTVALDDPYILLHESKLTSLQPMLPILEAVVQSGKPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDISVLTGGTVISEDLGIKLENVSLEMLGTAKRVSITKDETVIVDGAGDKADIEGRVAQIR
AQIENTTSEYDKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL
RASSALKVKGSNVDEQAGIDIVTKALQAPLRQIVQNAGVEGSVVVNAILADKSISYGFDAQKEEYCDLVA
AGIIDPTKVVRSSLQNAASIASLIITTEAAICDAPVKDAPAGGGMPDMGGMGGMGGMGGMGF

>gi|114705804|ref|ZP_01438707.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMG
AQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGIDAAIAKVVEALGEAARSIDT
SDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNGEK
MVAELEDAYILLHEKKLSNLQAMLPVLESVVQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDIAILTGGTVVSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIK
AQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL
RASNAVDLKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESLSFGYNAQTGEYGDMIQ
MGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPKKDNGGGGMPAGGMGGMGGMGGMDF

>gi|84499753|ref|ZP_00998041.1| chaperonin GroEL [Oceanicola batsensis HTCC2597]
MSAKDVKFNTDARNKMLKGVNVLADAVKVTLGPKGRNVVLEKSFGSPRITKDGVSVAKEIELEDKFENMG
AQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGIDLATSKVVEAIKSAARDVTD
SDEVAQVGTISANGEASIGRMIADAMQKVGNEGVITVEENKGMETEVDVVEGMQFDRGYLSPYFVTNPDK
MLTELEDCMILLHEKKLSSLQPLVPLLESVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLQDIAILTGGQVISEDLGMKLENVTMDMLGTAKKVSITKDETTIVDGNGDKAEIEARVSQIN
TQIQETTSDYDREKLQERVAKLAGGVAVIRVGGMTETEVKERKDRVDDALNATRAAVQEGVIVGGGVALV
QGGKALEGLTGANPDQEAGIAIVRRALEAPLRQIAENAGVDGAVVAGKVRESDDVKYGFNAQTEEYGDMF
KFGVIDPAKVVRTALEDAASISGLLITTEAMVADKPQKEGAGAAAGGMPDMGGMGGMM

>gi|13472184|ref|NP_103751.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMG
AQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVQELKTNARKVTR
NDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDK
MRVELEEPYVLIHEKKLSNLQALLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIK
SQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL
RAAKALDSVQAENEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWNAQTNAFGDLY
NEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKKEPAVPAMPAGGMDF

>gi|260425778|ref|ZP_05779758.1| chaperonin GroL [Citreicella sp. SE45]
MAAKDVKFDTDARTRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELEDKFENMG
AQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGIDLATAKVVEAIKAAARPVND
TNEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEENKGLETETDVVEGMQFDRGYLSPYFVTNADK
MIAELDDCMILLHEKKLSSLQPMVPLLESVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLQDIAILTGGQVISEDLGMKLENVTVDMLGSAKKVSITKDETTIVDGAGEKAEIEARVSQIR
TQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV
QGAKSLDGLEGANSDQNAGITIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYNAQTDEYGDMF
KFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQKDAPAGGGMPDMGGMGGMM

>gi|254421167|ref|ZP_05034888.1| chaperonin GroL [Brevundimonas sp. BAL3]
MAAKIVQFNTDARDKMLRGVNVLANAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEIELEDAFENMG
AQMIREVASKTNDKAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGIDKAVTAVLADIKASAKKVEN
NSEIAQVGTISANGDAEVGEMIAKAMAKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNADK
MEVQLEEPLILLFEKKLSSLQAMLPILEAVVQSGRPLVIIAEDIEGEALATLVVNKLRGGLRVAAVKAPG
FGDRRKAMLEDIAILTGGQVISEDLGIKLENVTIDMLGKAKKVTITKDDTTIVDGVGGKEEIEARIGQIK
RQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL
KATKALDGLTGDNADQTAGIAIIRRAIQAPIRQIVENAGVEGSIVVGKVLENSSATYGFNAQTEEYGDLV
AMGVIDPAKVVRTALTDAASVASILITTEAAVADAPKKGGSSAPDMGGMGGMGGMDF

>gi|49474597|ref|YP_032639.1| chaperonin GroEL [Bartonella quintana str. Toulouse]
MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMG
AQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGIDAAVEEVVGNLFKKAKKIQT
SAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADK
MVADLDDPYILIHEKKLSNLQSLLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDIAILTSGQVISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGKKAEINARVNQIK
VQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL
RAANALAIKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYNTATGQFGDLIA
LGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDTPMPPMPGGGMGGMGGMDF

>gi|83591926|ref|YP_425678.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170]
MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEIELKDKFENMG
AQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGIDLAVLAVVEDVKKRSKKIKT
SAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEAKGLDTELDVVEGMQFDRGYLSPYFVTNAEK
MVADLENPYILLHEKKLSGLQALLPVLEAVVQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLEDIAILTGGQVISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIR
ANIEDTSSDYDREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL
HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYNAQTGIYENLV
TAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAMPSPDMGGMGGMGGMGF

>gi|239834971|ref|ZP_04683299.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
MAAKEVKFHTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMG
AQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDLAVDAVVKELKTNARKITS
NSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNQDK
MRVELEDPYILIHEKKLSNLQAMLPVLEAVVQSGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDIAILTGGTVISEDLGIKLENVTLNMLGRAKRVAIEKENTTIIDGVGSKAEIDGRVAQIR
AQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL
RAVKALEGLPIANDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTDFSYGWNAQTGEYGDLY
AQGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKEATPALPASAGMDF

>gi|182678711|ref|YP_001832857.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039]
MAAKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELADKFENLG
AQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGIDHAVEAIVADLKANSKKVTS
NDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITNAEK
MIAELEDPYILVHEKKLSSLQAMLPVLEAVVQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLEDIAILTGGTLISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIK
AQIAETTSDYDREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL
RAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYNAQTGEYGDMV
KLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAPLPPMGGGGMGGMGGMDF

>gi|58040332|ref|YP_192296.1| chaperonin GroEL [Gluconobacter oxydans 621H]
MAAKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMG
AQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGIDKAVGVVVDQLKSNTKKITS
PEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFVTNPEK
MTADLDSPYILIHEKKLSSLQPMLPLLESVVQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDIAILTGGQVISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIR
AQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA
RASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFDAQKGEYKDLV
AAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPEKKAPAAAPGGMGDMDF

>gi|154248184|ref|YP_001419142.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
MAAKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELEDKFENLG
AQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVDAIVKDLASNSRKVTS
NDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNADK
MRVEFEEPYILINEKKLSGLQELLPVLEAVVQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLQDIAILTGGTVISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIR
AQIETTTSDYDREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL
RSIKALEGLKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYNAQTGEYVDMV
KAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNAPAAPAMPGGGMDF

>gi|217976980|ref|YP_002361127.1| chaperonin GroEL [Methylocella silvestris BL2]
MAAKDVRFSSDARDRMLRGIDILNNAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELSDKFENLG
AQLIREVASKQNDAAGDGTTTATILAASIVREGTKAVAAGLNPMDLKRGIDIAVAAVVADLKANSKKVTS
NEEIAQVGTISANGDKSVGEMISTAMQKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITNAEK
MIAELEDPFILVHEKKLSSLQALLPVLEAVVQSGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLEDIAILTSGTLISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIK
SQIAETTSDYDREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALL
RAIKALEGLTVENADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYNAQTDEYGDLV
KLGIIDPTKVVRTALQDAASVGGLLITTEAIIAEQPKKDSPAMPGGGGMGGMGGMDF

>gi|114569155|ref|YP_755835.1| chaperonin GroEL [Maricaulis maris MCS10]
MAAKDVLFGSDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELADKFENMG
AQMLREVASKTNDVAGDGTTTATVLAQSIVREGMKSVAAGMNPMDLKRGIDKAVAIVMDDIKASSTPVKD
SSEVAQVGTISANGASDIGEMIAKAMDKVGKEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITDADK
MQVEMEEPYILLFEKKLTSLQPMLPILEAVVQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLEDLAILTGGQVISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIR
RQSEETTSDYDREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
KASAKLAGLEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPSATFGFNAQTEEYGDML
AFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKEEGAGGGMPDMGGMGGMGGMGGMM

>gi|85709559|ref|ZP_01040624.1| chaperonin GroEL [Erythrobacter sp. NAP1]
MAAKDVKFSREAREGILKGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELKDKFENMG
AQMLKEVASKTNDLAGDGTTTATVLGQAIAREGMTAVAAGMNPMDLKRGIDLATTKVVENLKARSKDVSG
SEEIAQVGVISANGDREVGEKIAEAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPDK
MQVELDNPYILIHEKKLSNLQAMLPVLEAAVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPG
FGDRRKAMLQDIAILTKGEMISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVGEIR
TQIDNTTSDYDREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
YATKVLEGLKGDNDDQTRGIDIVRRAIMAPVRQIAQNAGHDGAVVSGNLLREDNESQGFNAATDTYEDLV
KAGVIDPTKVVRTALQDAASVAGLLITTEAAITDAPEDDKAAPAMPDMGGMGGMGGMGGF

>gi|197106643|ref|YP_002132020.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum HLK1]
MAAKDVYFSSDARDRMLRGVNTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEIELSDKFENLG
AQLIREVASKTNDKAGDGTTTATVLAQAIVVEGLKSVAAGMNPMDLKRGVDKAVAKVIEEIKATSKKVSA
NSEIAQVGTISANGDVEVGEMIARAMEKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEK
MEADLEEPLILLFEKKLSSLQPLLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPG
FGDRRKAMLEDIAILTGGQLISEDLGIKLENVSLDMLGRAKKVTITKEDTTIVDGSGDKSGIEGRIAQIK
KQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL
KASKVLDGFKGDNDDQEAGIAIVRRALQAPIRQISENAGVEGSIVVGKVLENASPTFGFNAQTEEYVDLV
QAGVIDPAKVVRTALQDAASVAGLLITTEAAIVEAPKKGGAGGAPGGMPGGMGDMDF

>gi|87198061|ref|YP_495318.1| chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444]
MAAKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELKDKFENMG
AQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGIDIAVGKVVENLKARSTPVAG
SSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEK
MTVELENPYILIHEKKLSSLQAMLPILEAVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPG
FGDRRKAMLGDIATLTAGEMISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAEEIKARVEQIR
AQIEVTTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL
YATKALEGLKGANDDQTKGIDIVRRAIQAPIRQIAANAGHDGAVVSGNLLRENDENQGFNAATDTYENLK
AAGVIDPTKVVRTALQDAASVSGLLITTEAAISEKPDDKPAMPPMGGGMGGMGGMDF

out-group
b-proteobacteria
>gi|256758655|ref|ZP_05499324.1| chaperonin GroEL [Thiomonas intermedia K12]
MAAKDVIFGADARARMVEGVNILANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMG
AQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVTTLVEQLKKASKPCST
SKEIAQVGSISANSDANVGQIIAEAMDKVGKEGVITVEDGKSLENELDIVEGMQFDRGYLSPYFINNQDK
QVAVLENPYVLLHDKKISNIRDLLPALEQVAKASRPLLIIAEDVEGEALATLVVNSIRGILKTVAVKAPG
FGDRRKAMLEDIAILTGGKVIAEEVGLTLEKVTLADLGQAKRIEVGKENTIIIDGAGVAADIEARVKQIR
IQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL
RARQAVGEIKGDNHDQEAGIKIVLRAIEQPLREIVANSGGEPSVVINKVLEGKGNFGFNAANDTYGDMLE
MGIIDPTKVTRTALQNAASVAGLMLTTECMVAEAPKDESAPAMPGGGMGGMGDMGM

>gi|438206|emb|CAA80532.1| heat-shock protein [Neisseria meningitidis]
MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMG
AQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDT
SKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEK
QIAGLDNPFVLLFEKKISNIRDLLPVLEKVAKASRPLLIIAENVEGEALATLVVNNIRGILKTVAVKAPG
FGDRRKAMLQDIAILTGGTVISEEVGLFLEKATLDNLGQAKRIEIGKENTTIIDGFGDAAQIEARFAEIR
QQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRLEDALHATRAAVEEGVVAGGGVALL
RARAALENLHTGNADKDAGVQIVLRAVESSLRQIVANAGGEPSVVVNKVLEGKGNYGYNAGSGEYGDMIE
MGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPENKPAMPDMGGMGGMGGMM

>gi|82703461|ref|YP_413027.1| chaperonin GroEL [Nitrosospira multiformis ATCC 25196]
MAAKEVKFSDSARHKMVNGVNILADAVKVTLGPKGRNVVLERSYGSPTITKDGVSVAKEIELKDKFENMG
AQMVKEVASKTSDVAGDGTTTATVLAQSIVKEGMKYVAAGMNPMDLKRGIDKAVVATVEELKKLSKPCTT
GKEIAQVGSISANSDPEIGKIIADAMEKVGKEGVITVEDGSGLQNELEVVEGMQFDRGYLSPYFINNADR
QIALLESPFILLHDKKISNIRDLLPVLEQVAKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPG
FGDRRKAMLEDIAILTGGTVIAEEVGLSLEKATLAELGQAKRVEVGKEETTIIDGAGDTQNIEGRVKQIR
AQIEEATSDYDKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
RTRSAVSNLKGDNHDQDAGIKIVLRALEEPLRQIVANCGDEPSVVINKVLEGTENFGYNAASSEYGDMVQ
MGVLDPTKVTRYALQHAASIAGLMLTTDALVAEVPKEEGAGGGMGGGMGGMGGMGGMGGMDM

>gi|56476061|ref|YP_157650.1| chaperonin GroEL [Aromatoleum aromaticum EbN1]
MAAKEVKFGDSARDRMVAGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENMG
AQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVIAVTEELKKLSKPCST
NKEIAQVGSISANSDADIGEIIAKSMDKVGKEGVITVEDGKSLQNELDVVEGMQFDRGYLSPYFINNPDK
QVAILENPFILLFDKKISNIRDLLPVLEQVAKAGRPLLIVAEDVEGEALATLVVNNIRGILKTCSVKAPG
FGDRRKAMLEDIAVLTGGQVIAEEVGLTLEKATLAELGQAARIEIGKENTIIIDGAGEGSRIEGRVKQIR
AQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
RARANLGTLKGDNHDQDAGIKIVLRALEQPLREIVANAGDEPSVVVNRVVEGTGNFGYNAATGEYGDLVD
MGVLDPTKVERIALQNAASVAGLMLTTDCMVGELAEEKPSMGGMGGMGGMGGMGGMDMGM

>gi|255259323|ref|ZP_05338681.1| chaperonin GroEL [Sideroxydans lithotrophicus ES-1]
MAAKDVKFHDAARAKMVVGVNILADAVKVTLGPKGRNVVLDRSYGSPTITKDGVSVAKEIELKDKFENMG
AQMVKEVASKTSDVAGDGTTTATVLAQSIVQEGMKFVAAGMNPMDLKRGIDQAVIAAVAELKKISKPCTT
TKEIAQVGSISANSDTVIGEKIAAAMEKVGKEGVITIEDGQGLEDELDIVEGMQFDRGYLSPYFINNADK
QIAAMENPFILLHDKKISNIRDLLPLLEQVAKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPG
FGDRRKAMLEDIAVLTGGTVIAEEVGLSLEKATLAEMGQAKRIEVGKENTTIIDGAGKHEAILGRVGEIK
KLAEESTSDYDKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
RAKAAVAGLKGANHDQDAGITIVLRAMESPIRAITMNAGDEPSVVVNKVLEGKGSFGYNASSSEYGDMLV
MGVVDPTKVTRVALQNAASIAGLMLTTACMVAELPEDKPAGGMGGGDMGGMGGMGGMM

g-proteobacteria
>gi|94500716|ref|ZP_01307245.1| chaperonin GroEL [Oceanobacter sp. RED65]
MAKDVKFGDSARSKMLKGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGA
QMVKEVASQANDKAGDGTTTATVLAQAIINEGLKSVAAGMNPMDLKRGIDKATAAVVEELAKLSRPCTDS
KNIAQVGTISANSDKTVGDLIAQAMEKVGKEGVITVEEGQGLADELEVVEGMQFDRGYLSPYFINNQEKM
NVELENPLILLADKKIDNLQEIIPLLENVAKSGRPLLIVAEDVEGQALATLVVNTMRGTFKVAAVKAPGF
GDRRKAMLQDIATLTGGKVISEEVGMSLETTSLEDLGTAKKVVIDKENTVMVGGAGSDADVTARCEQIRS
EIETTTSDYDKEKLQERLAKLAGGVAVIKVGAGSEIEMKEKKDRVEDALQATRAAVEEGVVAGGGVALIR
AISNVTVTGDNEDQNVGIALALRAMEAPIRQIAYNAGDEASVVVDKVKSGEGSFGYNASTGEYGDMIELG
IIDPTKVTRSSLQAAASVGGLMITTEAMVADIPEENGGAPDMGGMGGMGGMPGMM

>gi|134047129|ref|YP_001102020.1| chaperonin GroEL [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MAAKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKFENMG
AQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGIDKAVTSAVEELKKISKPCST
SKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNPQS
MQAELEDPFILLHDKKISNVRDLLPILEGVAKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPG
FGDRRKAMLEDMAILTGGTVISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTADIEARIKQIK
AQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI
RAKAAIAELKGANEDQNHGIAIALRAMEAPLREIVTNAGDEPSVVLNRVAEGTGAFGYNAANGEFGDMIE
FGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKEEPAAPGGGMGGMGGMDF

>gi|21241313|ref|NP_640895.1| chaperonin GroEL [Xanthomonas axonopodis pv. citri str. 306]
MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKFENMG
AQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGIDQAVKAAVVELKNISKPTTD
DKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQQS
QSADLDDPFILLHDKKISNVRDLLPVLEGVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPG
FGDRRKAMLEDMAVLTGGTVISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIK
TQIEDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
RALVAVGDLKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEGTGNYGYNAANGEFGDMVE
FGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKDEPALPAGGGMGGMGGMDF

>gi|226943476|ref|YP_002798549.1| chaperonin GroEL/Hsp60 [Azotobacter vinelandii DJ]
MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELKDKFENMG
AQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKSLAKPCSD
SKAIAQVGTISANSDESIGNIIAEAMNKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDT
MVAELDNPLLLLVDKKISNIRELLPVLEAVAKSGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPG
FGDRRKAMLQDIAILTGATVISEEVGLSLESATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIR
KQIEETSSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKVKQGSGNFGFNAASGVYGDMIE
MGILDPAKVTRSALQAASSIGGLMITTEAMVADIVEDKAAPAMPDMGGMGGMGGMM

>gi|85711845|ref|ZP_01042900.1| Chaperonin GroEL (HSP60 family protein) [Idiomarina baltica OS145]
MAAKEVKFGNNARQRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMG
AQMVKEVASKANDEAGDGTTTATVLAQAIVNEGVKAVAAGMNPMDLKRGIDKAVTAAVEELKKISQPCAD
SKAIAQVGTISANSDSTIGEIIAKAMDKVGQEGVITVEEGQALQDELDVVEGMQFDRGYLSPYFINNQES
GSVELDNPFILLVDKKVSNIRELLPVLEGVSKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPG
FGDRRKAMLQDIAVLTGGTVVSEEIGMELEKTQLEDLGTAKRVVITKDNTTVVDGNGDDAAIEGRVTQIK
QQMEETSSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
RAASKLAELTGDNEEQNVGIRMMLRAMEAPLRQIAYNAGAEASVVANRVREGEGNFGYNAGNDTYGDMLE
MGILDPTKVTRSALQFAASVGSLMITTEAMVAEIPKDDESAGGMGDMGGMGGMGGMM

BLAST

PROTOCOLE:


Both BLASTs ran on the amino acid traslation of the analysed sequence.


a) analyse BLASTp of Translation of ORF number 2 in reading frame 1 on the direct strand - database: nr

> set `max target sequences` _ 5000

> with expect threshold _ 10, word size of 3

> by matrix BLOSUM62

Query Length

226

Description

All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Program

BLASTP 2.2.22+


b) analyse BLASTp of Translation of ORF number 2 in reading frame 1 on the direct strand - database: swissprot

> set `max target sequences` _ 5000

> with expect threshold _ 10, word size of 3

> by matrix BLOSUM62

Query Length

226

Description

Non-redundant SwissProt sequences

Program

BLASTP 2.2.22+


c) analyse BLASTx on the ORF and the rest of the sequence


> database: nr

> set `max target sequences` _ 1000



ANALYSE DES RÉSULTATS:


In the NR databank the search on 5000 sequences did not reach the e-value 10, the worst score yielded by this test is 2e-38 at a score of 162. (In databan SwissProt the e-value 9.9 was reached at the 5000th result)

This score with this e-value is stilla very high resemblance so on 5000 sequences I could not define a homology-thershold. When trying to run the BLAST on 10000 sequences, the system froze.\


The two top results yield a score of 422 and 420 with e-values 9e-117 and 6e-116 and 100% query coverage with the proteins of the same function: 60 kDa chaperonin.

However the following scores with also 100% coverage and scores not drastically inferior to these show an other proteic function for the same domain: chaperonin GroL and GroEl, which are a little more specific groups of the 60kDa chaperonins and are also referred to sometimes as heat shock proteins.

These results correspond to the functions of the domains found by InterPro.


At the most indentic results we see a disturbing fact:

Though the alignement of the query and subject sequences start around the beginning of both (1-1 for the best results, q2-s3 as most common), our protein is only 225 amino acids long while the subject sequences of the highest similarity go above 500 (mostly around 540). In the translation given by ORFinder our sequence clearly ends with a STOP codon. This raises the possibility of a mistake made in the original sequency (that I find most likely) or other phenomena yielding a codon STOP in the 226th position.

This problem is also shown in having my translated protein`s weight found to be 24.25kDa while it`s aligned in every result with 60kDa proteins.


To investigate a little more this possibility, I've ran a BLASTx on the entire ORF and the remaining few nucleotide to see if it gives better scores and better aligned homologues than the original ORF. Unfortunately I have found almost the same results showing the sequence after the codon stop aligned with a really low score (under 40). This though still kepps the possibility of a sequencing mistake being made, but not only punctually, rather on a bigger part if the sequence. An other possibility is that the genome from which we got the gene - unlike most other organisms with a gene coding from the same protein - at this point has an internal noncoding or filling sequence or a characteristic part in its genome which can not be fully determined without knowing the origin of the sequence for sure.


RÉSULTATS BRUTS:

a) analyse BLAST of Translation of ORF number 2 in reading frame 1 on the direct strand - database: nr
          
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_265587.1|  60 kDa chaperonin [Candidatus Pelagibacter u...   422    1e-116 Gene info
ref|ZP_01264674.1|  60 kDa chaperonin [Candidatus Pelagibacter...   420    6e-116
ref|ZP_05069866.1|  chaperonin GroL [Candidatus Pelagibacter s...   411    3e-113
ref|ZP_06054579.1|  chaperonin GroL [alpha proteobacterium HIM...   375    2e-102
gb|ABR27784.1|  HSP60 [Candidatus Pelagibacter ubique]              374    4e-102
gb|ABR27777.1|  HSP60 [Candidatus Pelagibacter ubique]              372    2e-101
gb|ABR27782.1|  HSP60 [Candidatus Pelagibacter ubique]              371    4e-101
gb|ABR27776.1|  HSP60 [Candidatus Pelagibacter ubique HTCC1002...   370    4e-101
ref|ZP_02153075.1|  chaperonin GroEL [Oceanibulbus indolifex H...   360    6e-98 
ref|ZP_01749368.1|  60 kDa chaperonin 1, putative [Roseobacter...   360    6e-98 
ref|YP_001753228.1|  chaperonin GroEL [Methylobacterium radiot...   357    4e-97  Gene info
ref|ZP_01016168.1|  putative heat shock protein groEL [Parvula...   357    5e-97 
ref|YP_001772213.1|  chaperonin GroEL [Methylobacterium sp. 4-...   357    7e-97  Gene info
ref|YP_001534253.1|  60 kDa chaperonin [Dinoroseobacter shibae...   357    7e-97  Gene info
ref|ZP_05786825.1|  chaperonin GroL [Silicibacter lacuscaerule...   357    7e-97 
ref|YP_001768695.1|  chaperonin GroEL [Methylobacterium sp. 4-...   356    8e-97  Gene info
ref|ZP_00959312.1|  chaperonin GroEL [Roseovarius nubinhibens ...   356    8e-97 
ref|YP_002497060.1|  chaperonin GroEL [Methylobacterium nodula...   356    9e-97  Gene info
ref|YP_002496008.1|  chaperonin GroEL [Methylobacterium nodula...   356    1e-96  Gene info
ref|ZP_01438707.1|  chaperonin GroEL [Fulvimarina pelagi HTCC2...   355    1e-96 
ref|YP_003059354.1|  chaperonin GroEL [Hirschia baltica ATCC 4...   355    1e-96  Gene info
ref|ZP_00948346.1|  chaperonin GroEL [Sulfitobacter sp. NAS-14...   355    1e-96 
ref|YP_002490026.1|  chaperonin GroEL [Methylobacterium nodula...   355    2e-96  Gene info
ref|ZP_05100668.1|  chaperonin GroL [Roseobacter sp. GAI101] >...   355    3e-96 
ref|YP_681139.1|  chaperonin GroEL [Roseobacter denitrificans ...   353    5e-96  Gene info
ref|ZP_01014048.1|  chaperonin GroEL [Rhodobacterales bacteriu...   353    6e-96 
ref|YP_683684.1|  chaperonin GroEL [Roseobacter denitrificans ...   353    8e-96  Gene info
ref|YP_612592.1|  chaperonin GroEL [Ruegeria sp. TM1040] >sp|Q...   353    9e-96  Gene info
ref|ZP_05742950.1|  chaperonin GroL [Silicibacter sp. TrichCH4...   353    9e-96 
ref|ZP_05091178.1|  chaperonin GroL [Ruegeria sp. R11] >gb|EEB...   353    9e-96 
ref|YP_511300.1|  chaperonin GroEL [Jannaschia sp. CCS1] >sp|Q...   353    1e-95  Gene info
ref|ZP_01227877.1|  chaperonin groEL [Aurantimonas manganoxyda...   353    1e-95 
ref|ZP_00998041.1|  chaperonin GroEL [Oceanicola batsensis HTC...   352    1e-95 
ref|ZP_05813116.1|  chaperonin GroEL [Mesorhizobium opportunis...   352    2e-95 
ref|NP_103751.1|  chaperonin GroEL [Mesorhizobium loti MAFF303...   352    2e-95  Gene info
ref|YP_675632.1|  chaperonin GroEL [Mesorhizobium sp. BNC1] >s...   352    2e-95  Gene info
ref|YP_166140.1|  chaperonin GroEL [Ruegeria pomeroyi DSS-3] >...   351    3e-95  Gene info
ref|YP_001927953.1|  chaperonin GroEL [Methylobacterium populi...   351    3e-95  Gene info
ref|ZP_01443429.1|  chaperonin GroEL [Roseovarius sp. HTCC2601...   351    3e-95 
ref|ZP_05075406.1|  chaperonin GroL [Rhodobacterales bacterium...   351    3e-95 
ref|ZP_02139724.1|  chaperonin GroEL [Roseobacter litoralis Oc...   351    3e-95 
ref|YP_001204748.1|  chaperonin GroEL [Bradyrhizobium sp. ORS2...   351    3e-95  Gene info
ref|YP_001642221.1|  chaperonin GroEL [Methylobacterium extorq...   351    4e-95  Gene info
ref|ZP_05779758.1|  chaperonin GroL [Citreicella sp. SE45] >gb...   350    4e-95 
ref|ZP_05034888.1|  chaperonin GroL [Brevundimonas sp. BAL3] >...   350    5e-95 
ref|YP_672926.1|  chaperonin GroEL [Mesorhizobium sp. BNC1] >s...   350    6e-95  Gene info
ref|YP_001977485.1|  60 kDa chaperonin, heat shock protein [Rh...   350    7e-95  Gene info
ref|YP_002298788.1|  chaperonin GroL, putative [Rhodospirillum...   350    7e-95  Gene info
ref|ZP_02189452.1|  Chaperonin Cpn60/TCP-1 [alpha proteobacter...   350    7e-95 
ref|ZP_05809576.1|  chaperonin GroEL [Mesorhizobium opportunis...   350    8e-95 
ref|ZP_01880282.1|  chaperonin GroEL [Roseovarius sp. TM1035] ...   350    8e-95 
ref|ZP_05121926.1|  chaperonin GroL [Rhodobacteraceae bacteriu...   349    1e-94 
ref|YP_001239060.1|  chaperonin GroEL [Bradyrhizobium sp. BTAi...   349    1e-94  Gene info
ref|ZP_05087021.1|  chaperonin GroL [Pseudovibrio sp. JE062] >...   349    1e-94 
ref|YP_468771.1|  chaperonin GroEL [Rhizobium etli CFN 42] >sp...   349    1e-94  Gene info
ref|YP_472947.1|  chaperonin GroEL [Rhizobium etli CFN 42] >sp...   349    2e-94  Gene info
ref|ZP_02187726.1|  feruloyl-CoA synthase [alpha proteobacteri...   348    2e-94 
ref|YP_001042868.1|  chaperonin GroEL [Rhodobacter sphaeroides...   348    2e-94  Gene info
ref|YP_032639.1|  chaperonin GroEL [Bartonella quintana str. T...   348    2e-94  Gene info
ref|ZP_05811505.1|  chaperonin GroEL [Mesorhizobium opportunis...   348    2e-94 
ref|YP_425678.1|  chaperonin GroEL [Rhodospirillum rubrum ATCC...   348    2e-94  Gene info
ref|ZP_01004030.1|  chaperonin GroEL [Loktanella vestfoldensis...   348    2e-94 
sp|Q9L691.1|CH602_RHILE  RecName: Full=60 kDa chaperonin 2; Al...   348    2e-94 
ref|ZP_00958106.1|  chaperonin GroEL [Oceanicaulis alexandrii ...   348    2e-94 
ref|ZP_01156415.1|  chaperonin GroEL [Oceanicola granulosus HT...   348    3e-94 
ref|YP_001168384.1|  chaperonin GroEL [Rhodobacter sphaeroides...   348    3e-94  Gene info
ref|YP_352366.1|  chaperonin GroEL [Rhodobacter sphaeroides 2....   348    3e-94  Gene info
ref|YP_002979179.1|  chaperonin GroEL [Rhizobium leguminosarum...   348    3e-94  Gene info
ref|YP_002822725.1|  60 kDa chaperonin 2 [Rhizobium sp. NGR234...   348    3e-94  Gene info
ref|NP_108345.1|  chaperonin GroEL [Mesorhizobium loti MAFF303...   348    3e-94  Gene info
ref|ZP_01755564.1|  chaperonin GroEL [Roseobacter sp. SK209-2-...   348    3e-94 
ref|ZP_06171378.1|  chaperonin GroEL [Brevundimonas subvibrioi...   348    4e-94 
ref|YP_917417.1|  chaperonin GroEL [Paracoccus denitrificans P...   347    4e-94  Gene info
ref|ZP_04683299.1|  chaperonin GroEL [Ochrobactrum intermedium...   347    4e-94 
ref|NP_419502.1|  chaperonin GroEL [Caulobacter crescentus CB1...   347    4e-94  Gene info
ref|ZP_06122584.1|  chaperonin GroEL [Caulobacter segnis ATCC ...   347    5e-94 
ref|ZP_01743949.1|  chaperonin GroEL [Sagittula stellata E-37]...   347    5e-94 
ref|ZP_01055063.1|  chaperonin GroEL [Roseobacter sp. MED193] ...   347    5e-94 
ref|ZP_02145205.1|  chaperonin GroEL [Phaeobacter gallaeciensi...   347    5e-94 
ref|NP_085869.1|  chaperonin GroEL [Mesorhizobium loti MAFF303...   347    7e-94  Gene info
ref|YP_002972583.1|  chaperonin GroEl [Bartonella grahamii as4...   347    8e-94  Gene info
ref|NP_437546.1|  chaperonin GroEL [Sinorhizobium meliloti 102...   347    8e-94  Gene info
ref|YP_001610271.1|  chaperonin GroEL [Bartonella tribocorum C...   346    8e-94  Gene info
ref|NP_435641.1|  chaperonin GroEL [Sinorhizobium meliloti 102...   346    8e-94  Gene info
ref|ZP_05343387.1|  chaperonin GroL [Thalassiobium sp. R2A62] ...   346    9e-94 
gb|AAA26287.1|  groEL [Sinorhizobium meliloti]                      346    9e-94 
ref|YP_034075.1|  chaperonin GroEL [Bartonella henselae str. H...   346    9e-94  Gene info
gb|AAB65637.1|  GroEL [Bartonella henselae str. Houston-1]          346    9e-94 
ref|YP_001685772.1|  chaperonin GroEL [Caulobacter sp. K31] >s...   346    1e-93  Gene info
ref|ZP_01902246.1|  chaperonin GroEL [Roseobacter sp. AzwK-3b]...   346    1e-93 
ref|YP_001772319.1|  chaperonin GroEL [Methylobacterium sp. 4-...   345    1e-93  Gene info
ref|NP_384898.1|  chaperonin GroEL [Sinorhizobium meliloti 102...   345    2e-93  Gene info
ref|YP_001326966.1|  chaperonin GroEL [Sinorhizobium medicae W...   345    2e-93  Gene info
emb|CAD31231.1|  PROBABLE CHAPERONIN GROEL DF PROTEIN [Mesorhi...   345    2e-93 
ref|YP_001832857.1|  chaperonin GroEL [Beijerinckia indica sub...   345    2e-93  Gene info
ref|YP_002824957.1|  60 kDa chaperonin 2 [Rhizobium sp. NGR234...   345    2e-93  Gene info
ref|YP_001326100.1|  chaperonin GroEL [Sinorhizobium medicae W...   345    3e-93  Gene info
ref|YP_192296.1|  chaperonin GroEL [Gluconobacter oxydans 621H...   345    3e-93  Gene info
ref|ZP_03501595.1|  60 kDa chaperonin, heat shock protein [Rhi...   345    3e-93 
ref|YP_002973213.1|  chaperonin GroEL [Rhizobium leguminosarum...   344    3e-93  Gene info
ref|YP_746001.1|  chaperonin GroEL [Granulibacter bethesdensis...   344    3e-93  Gene info
ref|NP_106407.1|  chaperonin GroEL [Mesorhizobium loti MAFF303...   344    3e-93  Gene info
ref|ZP_05077095.1|  chaperonin GroL [Rhodobacterales bacterium...   344    3e-93 
ref|YP_001985158.1|  60 kDa chaperonin, heat shock protein [Rh...   344    3e-93  Gene info
ref|YP_765148.1|  chaperonin GroEL [Rhizobium leguminosarum bv...   344    4e-93  Gene info
ref|NP_772266.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   343    6e-93  Gene info
ref|YP_001241176.1|  chaperonin GroEL [Bradyrhizobium sp. BTAi...   343    6e-93  Gene info
ref|YP_318720.1|  chaperonin GroEL [Nitrobacter winogradskyi N...   343    7e-93  Gene info
gb|AAA26285.1|  groEL [Sinorhizobium meliloti]                      343    7e-93 
ref|YP_001204938.1|  chaperonin GroEL [Bradyrhizobium sp. ORS2...   343    7e-93  Gene info
gb|AAB18635.1|  heat shock protein [Caulobacter crescentus CB15]    343    7e-93 
ref|NP_774173.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   342    1e-92  Gene info
ref|YP_425254.1|  chaperonin GroEL [Rhodospirillum rubrum ATCC...   342    1e-92  Gene info
ref|YP_002543532.1|  Chaperonin GroEL [Agrobacterium radiobact...   342    1e-92  Gene info
ref|YP_001638224.1|  chaperonin GroEL [Methylobacterium extorq...   342    1e-92  Gene info
ref|YP_001525228.1|  chaperonin [Azorhizobium caulinodans ORS ...   342    2e-92  Gene info
ref|YP_001314661.1|  chaperonin GroEL [Sinorhizobium medicae W...   342    2e-92  Gene info
ref|YP_002822793.1|  60 kDa chaperonin 2 [Rhizobium sp. NGR234...   342    2e-92  Gene info
ref|YP_001419142.1|  chaperonin GroEL [Xanthobacter autotrophi...   341    3e-92  Gene info
ref|YP_577836.1|  chaperonin GroEL [Nitrobacter hamburgensis X...   341    3e-92  Gene info
ref|YP_002361127.1|  chaperonin GroEL [Methylocella silvestris...   341    4e-92  Gene info
ref|YP_001602294.1|  chaperonin GroEL [Gluconacetobacter diazo...   340    4e-92  Gene info
ref|YP_003188292.1|  heat shock protein GroEL [Acetobacter pas...   340    5e-92  Gene info
ref|YP_002966118.1|  60 kDa chaperonin (protein Cpn60, groEL p...   340    5e-92  Gene info
ref|ZP_03530120.1|  chaperonin GroEL [Rhizobium etli CIAT 894]      340    6e-92 
ref|YP_755835.1|  chaperonin GroEL [Maricaulis maris MCS10] >s...   340    6e-92  Gene info
ref|YP_001523340.1|  chaperonin [Azorhizobium caulinodans ORS ...   340    6e-92  Gene info
ref|YP_766495.1|  chaperonin GroEL [Rhizobium leguminosarum bv...   340    6e-92  Gene info
ref|YP_002279994.1|  chaperonin GroEL [Rhizobium leguminosarum...   340    7e-92  Gene info
ref|YP_002974359.1|  chaperonin GroEL [Rhizobium leguminosarum...   340    7e-92  Gene info
sp|P95678.1|CH60_RHOCA  RecName: Full=60 kDa chaperonin; AltNa...   340    8e-92 
ref|ZP_01040624.1|  chaperonin GroEL [Erythrobacter sp. NAP1] ...   340    8e-92 
ref|YP_002288499.1|  chaperonin GroL [Oligotropha carboxidovor...   340    8e-92  Gene info
ref|YP_001235613.1|  chaperonin GroEL [Acidiphilium cryptum JF...   340    9e-92  Gene info
ref|ZP_06357569.1|  chaperonin GroEL [Rhodopseudomonas palustr...   340    9e-92 
ref|ZP_06358256.1|  chaperonin GroEL [Rhodopseudomonas palustr...   340    9e-92 
ref|YP_001207982.1|  chaperonin GroEL [Bradyrhizobium sp. ORS2...   340    9e-92  Gene info
ref|NP_947509.1|  chaperonin GroEL [Rhodopseudomonas palustris...   339    1e-91  Gene info
ref|YP_001991446.1|  chaperonin GroEL [Rhodopseudomonas palust...   339    1e-91  Gene info
ref|NP_946491.1|  chaperonin GroEL [Rhodopseudomonas palustris...   339    1e-91  Gene info
ref|YP_001237787.1|  chaperonin GroEL [Bradyrhizobium sp. BTAi...   339    1e-91  Gene info
ref|ZP_03515869.1|  60 kDa chaperonin, heat shock protein [Rhi...   339    1e-91 
ref|YP_002132020.1|  heat shock protein chaperonin, HSP60 [Phe...   339    1e-91  Gene info
ref|NP_353706.1|  chaperonin GroEL [Agrobacterium tumefaciens ...   339    2e-91  Gene info
ref|YP_001990346.1|  chaperonin GroEL [Rhodopseudomonas palust...   338    2e-91  Gene info
gb|AAV31663.1|  predicted chaperonin GroEL [uncultured alpha p...   338    2e-91 
emb|CAE45331.1|  unnamed protein product [Magnetospirillum gry...   338    2e-91 
sp|P34939.1|CH60_RHILV  RecName: Full=60 kDa chaperonin; AltNa...   338    2e-91 
ref|YP_001977077.1|  60 kDa chaperonin, heat shock protein [Rh...   338    3e-91  Gene info
ref|YP_002128613.1|  heat shock protein chaperonin, HSP60 [Phe...   338    3e-91  Gene info
ref|YP_468366.1|  chaperonin GroEL [Rhizobium etli CFN 42] >sp...   338    3e-91  Gene info
ref|YP_459769.1|  chaperonin GroEL [Erythrobacter litoralis HT...   338    3e-91  Gene info
ref|YP_419566.1|  chaperonin GroEL [Magnetospirillum magneticu...   337    4e-91  Gene info
ref|ZP_00055267.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   337    4e-91 
ref|ZP_05844462.1|  chaperonin GroEL [Rhodobacter sp. SW2] >gb...   337    4e-91 
ref|NP_771867.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   337    4e-91  Gene info
ref|YP_001263860.1|  chaperonin GroEL [Sphingomonas wittichii ...   337    6e-91  Gene info
dbj|BAC16232.1|  groEL [Acetobacter aceti]                          337    7e-91 
ref|YP_002547602.1|  chaperonin [Agrobacterium vitis S4] >sp|B...   337    7e-91  Gene info
ref|YP_495318.1|  chaperonin GroEL [Novosphingobium aromaticiv...   337    7e-91  Gene info
ref|ZP_01863800.1|  chaperonin GroEL [Erythrobacter sp. SD-21]...   337    7e-91 
pir||S70667  chaperonin groEL - Caulobacter crescentus              336    9e-91 
ref|YP_001326495.1|  chaperonin GroEL [Sinorhizobium medicae W...   336    9e-91  Gene info
ref|YP_989430.1|  chaperonin GroEL [Bartonella bacilliformis K...   336    9e-91  Gene info
sp|P35635.2|CH60_BARBA  RecName: Full=60 kDa chaperonin; AltNa...   336    1e-90 
ref|YP_617121.1|  chaperonin GroEL [Sphingopyxis alaskensis RB...   336    1e-90  Gene info
ref|YP_485455.1|  chaperonin GroEL [Rhodopseudomonas palustris...   336    1e-90  Gene info
ref|YP_864228.1|  chaperonin GroEL [Magnetococcus sp. MC-1] >s...   335    1e-90  Gene info
ref|YP_571247.1|  chaperonin GroEL [Rhodopseudomonas palustris...   335    2e-90  Gene info
ref|ZP_01034921.1|  chaperonin GroEL [Roseovarius sp. 217] >gb...   335    2e-90 
ref|YP_002541540.1|  chaperonin GroL [Agrobacterium radiobacte...   335    2e-90  Gene info
ref|ZP_01304082.1|  chaperonin GroEL [Sphingomonas sp. SKA58] ...   335    2e-90 
ref|YP_569363.1|  chaperonin GroEL [Rhodopseudomonas palustris...   335    2e-90  Gene info
ref|YP_318798.1|  chaperonin GroEL [Nitrobacter winogradskyi N...   335    3e-90  Gene info
gb|AAA26283.1|  groEL [Sinorhizobium meliloti]                      335    3e-90 
ref|ZP_01046593.1|  chaperonin GroEL [Nitrobacter sp. Nb-311A]...   334    4e-90 
ref|NP_385302.1|  chaperonin GroEL [Sinorhizobium meliloti 102...   334    4e-90  Gene info
ref|YP_468803.1|  chaperonin GroEL [Rhizobium etli CFN 42] >sp...   334    5e-90  Gene info
ref|YP_003329340.1|  GroEL3 chaperonin [Sinorhizobium meliloti...   333    7e-90 
ref|YP_457720.1|  chaperonin GroEL [Erythrobacter litoralis HT...   333    9e-90  Gene info
ref|ZP_03520311.1|  chaperonin GroEL [Rhizobium etli GR56]          333    1e-89 
ref|ZP_02191922.1|  putative dimethyl sulfoniopropionate demet...   333    1e-89 
ref|YP_319179.1|  chaperonin GroEL [Nitrobacter winogradskyi N...   333    1e-89  Gene info
sp|Q9L690.1|CH603_RHILE  RecName: Full=60 kDa chaperonin 3; Al...   332    1e-89 
ref|YP_767017.1|  chaperonin GroEL [Rhizobium leguminosarum bv...   332    1e-89  Gene info
ref|YP_002974878.1|  chaperonin GroEL [Rhizobium leguminosarum...   332    2e-89  Gene info
pir||B36917  heat shock protein GroEL - Agrobacterium tumefaciens   332    2e-89 
emb|CAA48331.1|  groEL [Agrobacterium tumefaciens]                  332    2e-89 
ref|ZP_01045214.1|  chaperonin [Nitrobacter sp. Nb-311A] >gb|E...   332    2e-89 
ref|ZP_05117442.1|  chaperonin GroL [Labrenzia alexandrii DFL-...   332    2e-89 
ref|YP_163664.1|  chaperonin GroEL [Zymomonas mobilis subsp. m...   332    2e-89  Gene info
ref|ZP_04760631.1|  chaperonin GroEL [Zymomonas mobilis subsp....   332    2e-89 
ref|ZP_01548078.1|  chaperonin GroEL [Stappia aggregata IAM 12...   331    3e-89 
ref|YP_001416072.1|  chaperonin GroEL [Xanthobacter autotrophi...   330    6e-89  Gene info
ref|ZP_05374561.1|  chaperonin GroEL [Hyphomicrobium denitrifi...   330    8e-89 
ref|YP_002825488.1|  60 kDa chaperonin 2 [Rhizobium sp. NGR234...   330    9e-89  Gene info
ref|YP_615506.1|  chaperonin GroEL [Sphingopyxis alaskensis RB...   330    9e-89  Gene info
ref|YP_001411890.1|  chaperonin GroEL [Parvibaculum lavamentiv...   330    9e-89  Gene info
ref|YP_534567.1|  chaperonin GroEL [Rhodopseudomonas palustris...   330    9e-89  Gene info
ref|ZP_06349418.1|  chaperonin GroEL [Rhodomicrobium vannielii...   329    1e-88 
ref|ZP_02165491.1|  chaperonin GroEL [Hoeflea phototrophica DF...   329    1e-88 
ref|YP_779797.1|  chaperonin GroEL [Rhodopseudomonas palustris...   329    2e-88  Gene info
ref|ZP_03498083.1|  chaperonin GroEL [Rhizobium etli Kim 5]         329    2e-88 
ref|YP_002546751.1|  chaperonin GroL [Agrobacterium radiobacte...   328    2e-88  Gene info
ref|ZP_05291681.1|  Heat shock protein 60 family chaperone Gro...   328    2e-88 
ref|ZP_05054316.1|  chaperonin GroL [Octadecabacter antarcticu...   328    2e-88 
ref|YP_001312869.1|  chaperonin GroEL [Sinorhizobium medicae W...   328    4e-88  Gene info
ref|NP_103625.1|  chaperonin GroEL [Mesorhizobium loti MAFF303...   328    4e-88  Gene info
ref|NP_435310.1|  chaperonin GroEL [Sinorhizobium meliloti 102...   327    6e-88  Gene info
ref|ZP_05811190.1|  chaperonin GroEL [Mesorhizobium opportunis...   327    6e-88 
ref|ZP_05063668.1|  chaperonin GroL [Octadecabacter antarcticu...   327    6e-88 
ref|YP_003159117.1|  chaperonin GroEL [Desulfomicrobium bacula...   327    8e-88  Gene info
ref|ZP_01307245.1|  chaperonin GroEL [Oceanobacter sp. RED65] ...   326    1e-87 
ref|YP_943818.1|  chaperonin Cpn60, GroEL, large subunit of Gr...   326    1e-87  Gene info
ref|YP_002964563.1|  60 kDa chaperonin (protein Cpn60, groEL p...   326    1e-87  Gene info
ref|YP_001640792.1|  chaperonin GroEL [Methylobacterium extorq...   326    1e-87  Gene info
ref|YP_002422406.1|  chaperonin GroEL [Methylobacterium chloro...   325    1e-87  Gene info
ref|YP_003069606.1|  60 kDa chaperonin (protein Cpn60, groEL p...   325    2e-87  Gene info
ref|YP_942286.1|  chaperonin Cpn60, GroEL, large subunit of Gr...   325    2e-87  Gene info
ref|YP_902459.1|  chaperonin GroEL [Pelobacter propionicus DSM...   324    4e-87  Gene info
ref|ZP_05073784.1|  chaperonin GroL [Rhodobacterales bacterium...   323    6e-87 
ref|ZP_05079680.1|  chaperonin GroL [Rhodobacterales bacterium...   323    7e-87 
ref|YP_001238586.1|  60 kDa chaperonin (protein Cpn60) [Bradyr...   323    8e-87  Gene info
ref|YP_760663.1|  chaperonin GroEL [Hyphomonas neptunium ATCC ...   322    2e-86  Gene info
ref|YP_002219156.1|  chaperonin GroEL [Acidithiobacillus ferro...   322    2e-86  Gene info
ref|ZP_01447032.1|  chaperonin GroEL [alpha proteobacterium HT...   322    2e-86 
ref|ZP_04681866.1|  chaperonin GroEL [Ochrobactrum intermedium...   321    3e-86 
ref|YP_002535868.1|  chaperonin GroEL [Geobacter sp. FRC-32] >...   321    3e-86  Gene info
ref|YP_003074399.1|  chaperonin GroL [Teredinibacter turnerae ...   321    3e-86  Gene info
ref|YP_526358.1|  chaperonin, 60 kDa [Saccharophagus degradans...   321    3e-86  Gene info
ref|YP_461542.1|  chaperonin GroEL [Syntrophus aciditrophicus ...   321    4e-86  Gene info
ref|YP_486841.1|  chaperonin GroEL [Rhodopseudomonas palustris...   321    4e-86  Gene info
ref|NP_954380.1|  chaperonin GroEL [Geobacter sulfurreducens P...   321    4e-86  Gene info
ref|YP_002990374.1|  chaperonin GroEL [Desulfovibrio salexigen...   321    4e-86  Gene info
ref|YP_001371563.1|  chaperonin GroEL [Ochrobactrum anthropi A...   320    5e-86  Gene info
ref|ZP_04714833.1|  chaperonin GroEL [Alteromonas macleodii AT...   320    5e-86 
ref|ZP_06371110.1|  chaperonin GroEL [Desulfovibrio sp. FW1012...   320    6e-86 
ref|ZP_03786692.1|  chaperonin GroEL [Brucella ceti str. Cudo]...   320    6e-86 
ref|ZP_05456007.1|  chaperonin GroEL [Brucella ceti M490/95/1]...   320    7e-86 
ref|NP_699396.1|  chaperonin GroEL [Brucella suis 1330] >ref|Y...   320    7e-86  Gene info
ref|ZP_05458492.1|  chaperonin GroEL [Brucella ceti B1/94] >re...   320    7e-86 
ref|ZP_04771251.1|  chaperonin GroEL [Asticcacaulis excentricu...   320    7e-86 
ref|ZP_05168084.1|  chaperonin GroEL [Brucella pinnipedialis M...   320    7e-86 
ref|YP_383004.1|  chaperonin GroEL [Geobacter metallireducens ...   320    8e-86  Gene info
ref|YP_002290241.1|  chaperonin GroL [Oligotropha carboxidovor...   320    8e-86  Gene info
ref|ZP_05449769.1|  chaperonin GroEL [Brucella neotomae 5K33] ...   320    9e-86 
ref|ZP_01889793.1|  chaperonin GroEL [unidentified eubacterium...   320    9e-86 
ref|ZP_05173863.1|  chaperonin GroEL [Brucella ceti M644/93/1]...   320    9e-86 
ref|YP_002128202.1|  Chaperonin GroEL (HSP60 family) protein [...   320    1e-85  Gene info
ref|NP_967123.1|  60 kDa chaperonin [Bdellovibrio bacteriovoru...   320    1e-85  Gene info
ref|YP_001602889.1|  60 kDa chaperonin [Gluconacetobacter diaz...   319    1e-85  Gene info
ref|ZP_06231980.1|  chaperonin GroEL [Desulfovibrio aespoeensi...   319    2e-85 
ref|YP_388965.1|  chaperonin GroEL [Desulfovibrio desulfurican...   319    2e-85  Gene info
ref|ZP_01741689.1|  chaperonin GroEL [Rhodobacterales bacteriu...   319    2e-85 
ref|YP_001102020.1|  chaperonin GroEL [Salmonella enterica sub...   319    2e-85  Gene info
ref|YP_461768.1|  chaperonin GroEL [Syntrophus aciditrophicus ...   318    2e-85  Gene info
ref|YP_222995.1|  chaperonin GroEL [Brucella abortus bv. 1 str...   318    2e-85  Gene info
ref|YP_001257246.1|  chaperonin GroEL [Brucella ovis ATCC 2584...   318    2e-85  Gene info
ref|YP_001233023.1|  chaperonin GroEL [Geobacter uraniireducen...   318    2e-85  Gene info
ref|NP_542026.1|  chaperonin GroEL [Brucella melitensis 16M] >...   318    2e-85  Gene info
ref|ZP_05311015.1|  chaperonin GroEL [Geobacter sp. M18] >gb|E...   318    2e-85 
ref|ZP_01452747.1|  chaperonin, 60 kDa subunit [Mariprofundus ...   318    3e-85 
ref|YP_533033.1|  chaperonin GroEL [Rhodopseudomonas palustris...   318    3e-85  Gene info
ref|YP_002951648.1|  60 kDa chaperonin [Desulfovibrio magnetic...   318    4e-85  Gene info
sp|Q8RIT7.1|CH60_XANCH  RecName: Full=60 kDa chaperonin; AltNa...   318    4e-85 
ref|YP_003199038.1|  chaperonin GroEL [Desulfohalobium retbaen...   317    4e-85  Gene info
ref|YP_001380878.1|  chaperonin GroEL [Anaeromyxobacter sp. Fw...   317    4e-85  Gene info
ref|ZP_05499324.1|  chaperonin GroEL [Thiomonas intermedia K12...   317    5e-85 
ref|YP_781205.1|  chaperonin GroEL [Rhodopseudomonas palustris...   317    5e-85  Gene info
ref|YP_002137076.1|  chaperonin GroEL [Geobacter bemidjiensis ...   317    6e-85  Gene info
ref|NP_635915.1|  chaperonin GroEL [Xanthomonas campestris pv....   317    6e-85  Gene info
ref|YP_003270948.1|  chaperonin GroEL [Haliangium ochraceum DS...   317    7e-85  Gene info
ref|YP_002494127.1|  chaperonin GroEL [Anaeromyxobacter dehalo...   317    8e-85  Gene info
ref|YP_633052.1|  chaperonin GroEL [Myxococcus xanthus DK 1622...   317    9e-85  Gene info
ref|YP_466797.1|  chaperonin GroEL [Anaeromyxobacter dehalogen...   317    9e-85  Gene info
gb|AAA22997.1|  GroEL [Brucella abortus]                            316    9e-85 
ref|YP_001901959.1|  chaperonin GroEL [Xanthomonas campestris ...   316    1e-84  Gene info
ref|YP_002136002.1|  chaperonin GroEL [Anaeromyxobacter sp. K]...   316    1e-84  Gene info
ref|ZP_01905725.1|  chaperonin Cpn60, GroEL [Plesiocystis paci...   316    1e-84 
ref|YP_003020076.1|  chaperonin GroEL [Geobacter sp. M21] >sp|...   316    1e-84  Gene info
ref|YP_576475.1|  chaperonin GroEL [Nitrobacter hamburgensis X...   316    1e-84  Gene info
emb|CAR94879.1|  chaperonin GroEL [Ochrobactrum pseudogrignone...   316    1e-84 
ref|ZP_05063295.1|  chaperonin GroL [Octadecabacter antarcticu...   316    1e-84 
ref|ZP_01203326.1|  60 kDa chaperonin GroEL HSP60 heat shock p...   316    1e-84 
ref|YP_595000.1|  chaperonin GroEL [Lawsonia intracellularis P...   315    2e-84  Gene info
ref|YP_002992615.1|  chaperonin GroEL [Desulfovibrio salexigen...   315    2e-84  Gene info
dbj|BAE54309.1|  HSP60 [Lawsonia intracellularis]                   315    2e-84 
gb|ACY64468.1|  chaperonin GroEL [Riemerella anatipestifer]         315    2e-84 
emb|CAR94877.1|  chaperonin GroEL [Ochrobactrum sp. CCUG 50899]     315    2e-84 
ref|NP_773619.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   315    2e-84  Gene info
ref|ZP_02241664.1|  chaperonin GroEL [Xanthomonas oryzae pv. o...   315    2e-84 
ref|YP_362302.1|  chaperonin GroEL [Xanthomonas campestris pv....   315    2e-84  Gene info
ref|YP_202927.1|  chaperonin GroEL [Xanthomonas oryzae pv. ory...   315    2e-84  Gene info
ref|NP_640895.1|  chaperonin GroEL [Xanthomonas axonopodis pv....   315    2e-84  Gene info
emb|CAR94876.1|  chaperonin GroEL [Ochrobactrum rhizosphaerae]      315    2e-84 
ref|YP_011193.1|  chaperonin GroEL [Desulfovibrio vulgaris sub...   315    2e-84  Gene info
ref|ZP_01224293.1|  chaperonin GroEL [marine gamma proteobacte...   315    2e-84 
sp|Q8GBB4.1|CH60_AZOVI  RecName: Full=60 kDa chaperonin; AltNa...   315    3e-84 
ref|YP_002798549.1|  chaperonin GroEL/Hsp60 [Azotobacter vinel...   315    3e-84  Gene info
ref|ZP_01042900.1|  Chaperonin GroEL (HSP60 family protein) [I...   314    4e-84 
emb|CAR94880.1|  chaperonin GroEL [Ochrobactrum thiophenivorans]    314    4e-84 
emb|CAE54386.1|  Cpn60SR single-ring chaperonin 60 variant [Ol...   314    5e-84 
ref|YP_001597541.1|  chaperonin GroL [Coxiella burnetii RSA 33...   314    5e-84  Gene info
ref|NP_820699.1|  chaperonin GroL [Coxiella burnetii RSA 493] ...   314    5e-84  Gene info
emb|CAR94878.1|  chaperonin GroEL [Ochrobactrum grignonense]        314    6e-84 
emb|CAE54389.1|  Cpn60DR double-ring chaperonin 60 variant [Ol...   314    6e-84 
ref|ZP_05103330.1|  chaperonin GroL [Methylophaga thiooxidans ...   314    6e-84 
sp|Q8KM30.1|CH60_OLEAN  RecName: Full=60 kDa chaperonin; AltNa...   314    6e-84 
gb|AAP13856.1|  heat shock protein B [Coxiella burnetii]            313    6e-84 
ref|YP_002720339.1|  chaperonin GroEL [Brachyspira hyodysenter...   313    6e-84  Gene info
ref|YP_002437469.1|  chaperonin GroEL [Desulfovibrio vulgaris ...   313    7e-84  Gene info
gb|AAD26368.1|AF130421_1  chaperonin GroEL [secondary endosymb...   313    7e-84 
gb|AAR23104.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    313    7e-84 
ref|YP_114145.1|  chaperonin, 60 kDa subunit [Methylococcus ca...   313    7e-84  Gene info
gb|ACH54109.1|  heat shock protein B [Coxiella burnetii] >gb|A...   313    7e-84 
gb|AAR18235.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    313    7e-84 
gb|ACH54111.1|  heat shock protein B [Coxiella burnetii]            313    8e-84 
ref|YP_435739.1|  chaperonin GroEL [Hahella chejuensis KCTC 23...   313    8e-84  Gene info
ref|YP_692354.1|  chaperonin, 60 kDa [Alcanivorax borkumensis ...   313    9e-84  Gene info
ref|ZP_03738369.1|  chaperonin GroEL [Desulfonatronospira thio...   313    9e-84 
ref|ZP_06051061.1|  heat shock protein 60 family chaperone Gro...   313    9e-84 
ref|ZP_05040767.1|  chaperonin GroL [Alcanivorax sp. DG881] >g...   313    9e-84 
ref|YP_003194798.1|  chaperonin GroEL [Robiginitalea biformata...   313    1e-83  Gene info
ref|NP_763045.1|  chaperonin GroEL [Vibrio vulnificus CMCP6] >...   312    1e-83  Gene info
ref|YP_863601.1|  protein Cpn60 (GroEL protein) [Gramella fors...   312    1e-83  Gene info
ref|ZP_03851365.1|  chaperone GroEL [Chryseobacterium gleum AT...   312    2e-83 
ref|YP_003008108.1|  chaperonin GroL [Aggregatibacter aphrophi...   312    2e-83  Gene info
emb|CAA80532.1|  heat-shock protein [Neisseria meningitidis]        312    2e-83 
ref|ZP_01217217.1|  chaperonin GroEL [Psychromonas sp. CNPT3] ...   312    2e-83 
ref|ZP_01107485.1|  chaperonin GroEL [Flavobacteriales bacteri...   312    2e-83 
ref|YP_003094795.1|  Heat shock protein 60 family chaperone Gr...   312    2e-83  Gene info
ref|ZP_01916215.1|  chaperonin GroEL [Limnobacter sp. MED105] ...   311    2e-83 
emb|CAA67358.1|  groEL [Francisella tularensis]                     311    2e-83 
ref|ZP_04754632.1|  chaperonin GroEL (HSP60 family) protein [A...   311    3e-83 
ref|YP_001598403.1|  chaperonin GroEL [Neisseria meningitidis ...   311    3e-83  Gene info
gb|AAR18233.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    311    3e-83 
ref|YP_001429247.2|  chaperonin GroEL [Francisella tularensis ...   311    3e-83  Gene info
ref|YP_514345.1|  chaperonin GroEL [Francisella tularensis sub...   311    3e-83  Gene info
gb|ACH54112.1|  heat shock protein B [Coxiella burnetii]            311    3e-83 
ref|YP_003082421.1|  60 kDa chaperonin [Neisseria meningitidis...   311    3e-83  Gene info
ref|ZP_04047101.1|  chaperonin GroL [Brachyspira murdochii DSM...   311    3e-83 
ref|YP_002480128.1|  chaperonin GroEL [Desulfovibrio desulfuri...   311    3e-83  Gene info
ref|YP_002476465.1|  chaperonin GroEL (HSP60 family) [Haemophi...   311    3e-83  Gene info
ref|ZP_05705690.1|  chaperonin GroEL [Cardiobacterium hominis ...   311    3e-83 
ref|ZP_04978143.1|  chaperone GroEL [Mannheimia haemolytica PH...   311    3e-83 
gb|ACI01430.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    311    3e-83 
ref|YP_002604307.1|  GroEL [Desulfobacterium autotrophicum HRM...   311    3e-83  Gene info
ref|YP_002030008.1|  chaperonin GroEL [Stenotrophomonas maltop...   311    4e-83  Gene info
ref|ZP_01617245.1|  chaperonin GroEL [marine gamma proteobacte...   311    4e-83 
emb|CAA80551.1|  heat-shock protein [Neisseria gonorrhoeae]         311    4e-83 
ref|NP_768699.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   311    4e-83  Gene info
ref|YP_113217.1|  chaperonin GroEL [Methylococcus capsulatus s...   311    4e-83  Gene info
ref|ZP_03700528.1|  chaperonin GroEL [Flavobacteria bacterium ...   311    4e-83 
ref|YP_413027.1|  chaperonin GroEL [Nitrosospira multiformis A...   311    4e-83  Gene info
ref|YP_001210205.1|  chaperonin GroEL [Dichelobacter nodosus V...   311    4e-83  Gene info
ref|ZP_05317199.1|  chaperonin GroL [Neisseria sicca ATCC 2925...   311    4e-83 
ref|YP_002003184.1|  chaperonin GroEL [Neisseria gonorrhoeae N...   311    4e-83  Gene info
ref|YP_663309.1|  chaperonin GroEL [Pseudoalteromonas atlantic...   311    5e-83  Gene info
ref|YP_156661.1|  chaperonin GroEL [Idiomarina loihiensis L2TR...   311    5e-83  Gene info
ref|YP_547613.1|  chaperonin GroEL [Polaromonas sp. JS666] >sp...   311    5e-83  Gene info
ref|ZP_04724351.1|  chaperonin GroEL [Neisseria gonorrhoeae FA...   311    5e-83 
gb|AAC36500.1|  GroEL/HSP60 homolog [Lawsonia intracellularis]      311    5e-83 
ref|ZP_05978603.1|  60 kDa chaperonin [Neisseria mucosa ATCC 2...   311    5e-83 
ref|YP_001613420.1|  GroEL like chaperone [Sorangium cellulosu...   311    5e-83  Gene info
gb|AAR23103.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    311    5e-83 
ref|YP_578391.1|  chaperonin GroEL [Nitrobacter hamburgensis X...   310    5e-83  Gene info
ref|YP_209108.1|  chaperonin GroEL [Neisseria gonorrhoeae FA 1...   310    5e-83  Gene info
gb|ABY86696.1|  chaperonin GroEL2 [Sorangium cellulosum]            310    5e-83 
ref|ZP_03612137.1|  60 kDa chaperonin [Actinobacillus minor 20...   310    5e-83 
ref|YP_001973887.1|  putative GroEL protein [Stenotrophomonas ...   310    5e-83  Gene info
ref|YP_975876.1|  chaperonin GroEL [Neisseria meningitidis FAM...   310    5e-83  Gene info
ref|ZP_02478658.1|  50S ribosomal protein L28 [Haemophilus par...   310    5e-83 
emb|CBA32107.1|  60 kDa chaperonin 2 [Curvibacter putative sym...   310    5e-83 
ref|YP_001019625.1|  chaperonin GroEL [Methylibium petroleiphi...   310    5e-83  Gene info
ref|YP_980897.1|  chaperonin GroEL [Polaromonas naphthalenivor...   310    6e-83  Gene info
ref|NP_903684.1|  chaperonin 60kD subunit [Chromobacterium vio...   310    6e-83  Gene info
gb|AAR18234.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    310    6e-83 
ref|ZP_03310751.1|  hypothetical protein DESPIG_00651 [Desulfo...   310    6e-83 
ref|YP_001296851.1|  60 kDa chaperonin GroEL [Flavobacterium p...   310    6e-83  Gene info
ref|YP_003042586.1|  60 kda chaperonin (protein cpn60) (groel ...   310    6e-83  Gene info
gb|AAR23102.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    310    7e-83 
ref|ZP_01288768.1|  Chaperonin Cpn60/TCP-1 [delta proteobacter...   310    7e-83 
ref|YP_465601.1|  chaperonin GroEL [Anaeromyxobacter dehalogen...   310    8e-83  Gene info
emb|CAX50934.1|  60 kDa chaperonin (protein Cpn60; GroEL prote...   310    8e-83 
ref|NP_799230.1|  chaperonin GroEL [Vibrio parahaemolyticus RI...   310    8e-83  Gene info
ref|NP_274966.1|  chaperonin GroEL [Neisseria meningitidis MC5...   310    8e-83  Gene info
ref|ZP_06069127.1|  chaperonin GroL [Acinetobacter lwoffii SH1...   310    8e-83 
ref|YP_157650.1|  chaperonin GroEL [Aromatoleum aromaticum EbN...   310    8e-83  Gene info
ref|YP_001677824.1|  chaperonin GroEL [Francisella philomiragi...   310    8e-83  Gene info
ref|ZP_04990400.1|  chaperonin GroEL [Francisella novicida GA9...   310    9e-83 
ref|YP_001121346.1|  chaperonin GroEL [Francisella tularensis ...   310    9e-83  Gene info
ref|ZP_04985847.1|  chaperone protein [Francisella tularensis ...   310    9e-83 
ref|ZP_04755460.1|  chaperonin GroEL [Francisella philomiragia...   310    9e-83 
ref|ZP_01987608.1|  chaperonin GroL [Vibrio harveyi HY01] >ref...   310    1e-82 
ref|YP_899157.1|  chaperonin GroEL [Francisella tularensis sub...   310    1e-82  Gene info
ref|ZP_06125057.1|  60 kda chaperonin (protein cpn60) (groel p...   310    1e-82 
ref|YP_002923518.1|  chaperone Hsp60 (GroEL) [Candidatus Hamil...   310    1e-82  Gene info
ref|ZP_02161046.1|  chaperonin GroEL [Kordia algicida OT-1] >g...   309    1e-82 
ref|ZP_04775504.1|  chaperonin GroEL [Allochromatium vinosum D...   309    1e-82 
ref|YP_002512524.1|  chaperonin GroEL [Thioalkalivibrio sp. HL...   309    1e-82  Gene info
gb|AAF27528.1|AF221845_1  GroEL [Vibrio parahaemolyticus]           309    1e-82 
ref|YP_003276685.1|  chaperonin GroEL [Comamonas testosteroni ...   309    1e-82  Gene info
ref|YP_002491975.1|  chaperonin GroEL [Anaeromyxobacter dehalo...   309    1e-82  Gene info
ref|YP_003255225.1|  hypothetical protein D11S_0600 [Aggregati...   309    1e-82  Gene info
ref|YP_002794662.1|  GroEL1 [Laribacter hongkongensis HLHK9] >...   309    1e-82  Gene info
gb|AAR23105.1|  GroEL [secondary endosymbiont of Bemisia tabaci]    309    1e-82 
ref|YP_001983106.1|  chaperonin GroEL [Cellvibrio japonicus Ue...   309    1e-82  Gene info
ref|ZP_04720139.1|  chaperonin GroEL [Neisseria gonorrhoeae DG...   309    1e-82 
ref|ZP_04722212.1|  chaperonin GroEL [Neisseria gonorrhoeae FA...   309    1e-82 
ref|ZP_03545192.1|  chaperonin GroEL [Comamonas testosteroni K...   309    1e-82 
emb|CBA74436.1|  60 Kda chaperonin [Arsenophonus nasoniae]          309    1e-82 
ref|ZP_05133000.1|  chaperonin GroL [Stenotrophomonas sp. SKA1...   309    1e-82 
ref|YP_522403.1|  chaperonin GroEL [Rhodoferax ferrireducens T...   309    1e-82  Gene info
emb|CBA07420.1|  60 kDa chaperonin [Neisseria meningitidis ser...   309    1e-82 
ref|ZP_04717968.1|  chaperonin GroEL [Neisseria gonorrhoeae 35...   309    2e-82 
ref|YP_355125.1|  chaperonin Cpn60 [Rhodobacter sphaeroides 2....   309    2e-82  Gene info
ref|ZP_02959560.1|  hypothetical protein PROSTU_01426 [Provide...   309    2e-82 
ref|ZP_05618695.1|  chaperonin GroL [Enhydrobacter aerosaccus ...   309    2e-82 
ref|ZP_05338681.1|  chaperonin GroEL [Sideroxydans lithotrophi...   309    2e-82 
ref|YP_574210.1|  chaperonin GroEL [Chromohalobacter salexigen...   309    2e-82  Gene info
ref|ZP_01166932.1|  GroEL protein [Oceanospirillum sp. MED92] ...   309    2e-82 
ref|YP_002152262.1|  60 Kda chaperonin [Proteus mirabilis HI43...   309    2e-82  Gene info
ref|YP_997330.1|  chaperonin GroEL [Verminephrobacter eiseniae...   308    2e-82  Gene info
ref|ZP_03719341.1|  hypothetical protein NEIFLAOT_01174 [Neiss...   308    2e-82 
ref|YP_003140441.1|  chaperonin GroEL [Capnocytophaga ochracea...   308    2e-82  Gene info
ref|ZP_01734267.1|  60 kDa chaperonin [Flavobacteria bacterium...   308    2e-82 
ref|ZP_05730841.1|  chaperonin GroEL [Pantoea sp. At-9b] >gb|E...   308    2e-82 
ref|YP_558394.1|  chaperonin GroEL [Burkholderia xenovorans LB...   308    2e-82  Gene info
ref|ZP_04056376.1|  chaperonin GroL [Capnocytophaga gingivalis...   308    2e-82 
ref|ZP_04921429.1|  chaperonin GroL [Vibrio sp. Ex25] >ref|YP_...   308    2e-82  Gene info
ref|YP_001566674.1|  chaperonin GroEL [Delftia acidovorans SPH...   308    2e-82  Gene info
ref|ZP_06176837.1|  GroEL protein 1 [Vibrio harveyi 1DA3] >gb|...   308    2e-82 
ref|YP_001652030.1|  60 kDa chaperonin [Actinobacillus pleurop...   308    3e-82  Gene info
ref|NP_799797.1|  chaperonin GroEL [Vibrio parahaemolyticus RI...   308    3e-82  Gene info
ref|ZP_01448234.1|  Chaperonin GroEL (HSP60 family) protein [a...   308    3e-82 
sp|P94166.3|CH60_ACTPL  RecName: Full=60 kDa chaperonin; AltNa...   308    3e-82 
ref|YP_001338154.1|  chaperonin GroEL [Klebsiella pneumoniae s...   308    3e-82  Gene info
ref|YP_047391.1|  chaperonin GroEL [Acinetobacter sp. ADP1] >s...   308    3e-82  Gene info
ref|ZP_03827360.1|  chaperonin GroEL [Pectobacterium carotovor...   308    3e-82 
gb|EEF09621.1|  predicted protein [Populus trichocarpa]             308    3e-82 
ref|YP_002552157.1|  chaperonin GroEL [Diaphorobacter sp. TPSY...   308    3e-82  Gene info
ref|ZP_05985878.1|  chaperonin GroL [Neisseria subflava NJ9703...   308    3e-82 
ref|XP_002169692.1|  PREDICTED: similar to chaperonin groEL-li...   308    3e-82  UniGene infoGene info
ref|ZP_05983753.1|  chaperonin GroL [Neisseria cinerea ATCC 14...   308    3e-82 
ref|ZP_05987623.1|  chaperonin GroL [Neisseria lactamica ATCC ...   308    3e-82 
ref|ZP_03319107.1|  hypothetical protein PROVALCAL_02048 [Prov...   308    3e-82 
sp|O66198.1|CH60_ENTAE  RecName: Full=60 kDa chaperonin; AltNa...   308    3e-82 
ref|ZP_02062576.1|  chaperonin GroL [Rickettsiella grylli] >gb...   308    3e-82 
sp|P48215.1|CH60_NEIFL  RecName: Full=60 kDa chaperonin; AltNa...   308    3e-82 
ref|YP_003087114.1|  chaperonin GroEL [Dyadobacter fermentans ...   308    3e-82  Gene info
ref|ZP_06065280.1|  chaperonin GroL [Acinetobacter junii SH205...   308    3e-82 
dbj|BAA25225.1|  similar to GroEL protein [Klebsiella pneumoniae]   308    3e-82 
ref|ZP_01259446.1|  chaperonin GroEL [Vibrio alginolyticus 12G...   308    3e-82 
ref|ZP_04757239.1|  chaperonin GroL [Neisseria flavescens SK11...   308    3e-82 
ref|YP_001891089.1|  chaperonin GroEL [Francisella tularensis ...   308    3e-82  Gene info
ref|YP_003016100.1|  chaperonin GroEL [Pectobacterium carotovo...   308    3e-82  Gene info
gb|ABH85370.1|  symbionin [Buchnera aphidicola]                     308    3e-82 
ref|ZP_05823457.1|  chaperonin GroL [Acinetobacter sp. RUH2624...   308    3e-82 
ref|YP_002240909.1|  chaperonin GroL [Klebsiella pneumoniae 34...   308    3e-82  Gene info
ref|YP_001847567.1|  chaperonin GroEL [Acinetobacter baumannii...   308    3e-82  Gene info
ref|YP_001706389.1|  chaperonin GroEL [Acinetobacter baumannii...   308    3e-82  Gene info
ref|YP_001712779.1|  chaperonin GroEL [Acinetobacter baumannii...   308    3e-82  Gene info
ref|ZP_02196605.1|  chaperonin GroEL [Vibrio sp. AND4] >gb|EDP...   308    3e-82 
ref|YP_001219359.1|  chaperonin GroEL [Candidatus Vesicomyosoc...   308    4e-82  Gene info
ref|ZP_00134228.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   308    4e-82 
ref|YP_002931856.1|  chaperonin GroL, putative [Edwardsiella i...   308    4e-82  Gene info
ref|ZP_03822920.1|  chaperonin GroEL [Acinetobacter sp. ATCC 2...   308    4e-82 
ref|ZP_05061889.1|  chaperonin GroL [gamma proteobacterium HTC...   308    4e-82 
ref|YP_170601.1|  chaperonin GroEL [Francisella tularensis sub...   308    4e-82  Gene info
dbj|BAA25233.1|  similar to GroEL protein [Pantoea agglomerans]     308    4e-82 
ref|YP_589019.1|  chaperonin GroEL [Baumannia cicadellinicola ...   308    4e-82  Gene info
ref|YP_003258155.1|  chaperonin GroEL [Pectobacterium wasabiae...   308    4e-82  Gene info
emb|CAC19389.1|  GroEL-like protein [Enterobacteriaceae sp. JM...   307    4e-82 
ref|ZP_05315400.1|  chaperonin GroEL [Nitrosomonas sp. AL212] ...   307    4e-82 
sp|O66220.1|CH60_PECCC  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-82 
ref|ZP_06182193.1|  GroEL protein 1 [Vibrio alginolyticus 40B]...   307    4e-82 
gb|AAN84781.2|  GroEL [Xenorhabdus nematophila]                     307    4e-82 
ref|YP_001292487.1|  chaperonin GroEL [Haemophilus influenzae ...   307    4e-82  Gene info
ref|ZP_01786057.1|  chaperonin GroEL [Haemophilus influenzae 2...   307    4e-82 
sp|P29842.3|CH60_NEIGO  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-82 
ref|ZP_00949084.1|  chaperonin GroEL [Croceibacter atlanticus ...   307    5e-82 
emb|CAB50775.1|  GroEL protein [Pseudoalteromonas haloplanktis...   307    5e-82 
ref|ZP_01313307.1|  chaperonin GroEL [Desulfuromonas acetoxida...   307    5e-82 
ref|ZP_05850540.1|  chaperonin GroL [Haemophilus influenzae NT...   307    5e-82 
gb|AAW49855.1|  hypothetical protein FTT1696 [synthetic constr...   307    5e-82 
ref|YP_001218153.1|  chaperonin GroEL [Vibrio cholerae O395] >...   307    5e-82  Gene info
ref|YP_338801.1|  chaperonin GroEL [Pseudoalteromonas haloplan...   307    5e-82  Gene info
ref|YP_003145457.1|  chaperonin GroEL [Kangiella koreensis DSM...   307    5e-82  Gene info
ref|ZP_01977749.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   307    5e-82 
ref|ZP_03802841.1|  hypothetical protein PROPEN_01190 [Proteus...   307    5e-82 
ref|YP_001789523.1|  chaperonin GroEL [Leptothrix cholodnii SP...   307    6e-82  Gene info
ref|YP_001436294.1|  hypothetical protein ESA_00154 [Enterobac...   307    6e-82  Gene info
sp|Q93GT8.2|CH60_COLMA  RecName: Full=60 kDa chaperonin; AltNa...   307    6e-82 
ref|YP_358175.1|  chaperonin GroEL [Pelobacter carbinolicus DS...   307    6e-82  Gene info
ref|ZP_01262337.1|  chaperonin GroEL [Vibrio alginolyticus 12G...   307    6e-82 
ref|NP_232292.1|  chaperonin GroEL [Vibrio cholerae O1 biovar ...   307    6e-82  Gene info
ref|YP_718679.1|  chaperonin GroEL [Haemophilus somnus 129PT] ...   307    6e-82  Gene info
ref|ZP_04919012.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   307    6e-82 
ref|ZP_05970662.1|  chaperonin GroL [Enterobacter cancerogenus...   307    6e-82 
ref|ZP_04916166.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   307    6e-82 
ref|YP_001343970.1|  chaperonin GroEL [Actinobacillus succinog...   307    6e-82  Gene info
ref|YP_003052062.1|  chaperonin GroEL [Methylovorus sp. SIP3-4...   307    6e-82  Gene info
ref|YP_003248158.1|  chaperonin GroEL [Fibrobacter succinogene...   307    6e-82  Gene info
ref|YP_003294372.1|  chaperonin GroEL (HSP60 family) [Edwardsi...   307    6e-82  Gene info
ref|YP_379609.1|  chaperonin GroEL [Chlorobium chlorochromatii...   307    6e-82  Gene info
ref|ZP_04858665.1|  hsp60-like protein [Fusobacterium varium A...   307    6e-82 
dbj|BAF99046.1|  GroEL [Enterobacteriaceae bacterium Kuo3-1] >...   307    6e-82 
ref|YP_002943035.1|  chaperonin GroEL [Variovorax paradoxus S1...   307    7e-82  Gene info
ref|YP_932478.1|  chaperonin GroEL [Azoarcus sp. BH72] >sp|A1K...   307    7e-82  Gene info
ref|ZP_05715503.1|  GroEL protein 1 [Vibrio mimicus VM573] >gb...   307    7e-82 
ref|ZP_03391793.1|  chaperonin GroL [Capnocytophaga sputigena ...   307    7e-82 
ref|YP_001340894.1|  chaperonin GroEL [Marinomonas sp. MWYL1] ...   307    7e-82  Gene info
dbj|BAG68455.1|  GroEL protein [Enterobacteriaceae bacterium E...   307    7e-82 
ref|ZP_05888496.1|  heat shock protein 60 family chaperone Gro...   306    7e-82 
dbj|BAF99059.1|  GroEL [Enterobacter cloacae]                       306    7e-82 
ref|YP_087651.1|  chaperonin GroEL [Mannheimia succiniciproduc...   306    7e-82  Gene info
ref|YP_001092603.1|  chaperonin GroEL [Shewanella loihica PV-4...   306    7e-82  Gene info
ref|ZP_05720557.1|  GroEL protein 1 [Vibrio mimicus VM603] >re...   306    7e-82 
ref|NP_779731.1|  chaperonin GroEL [Xylella fastidiosa Temecul...   306    7e-82  Gene info
ref|ZP_06078516.1|  heat shock protein 60 family chaperone Gro...   306    7e-82 
gb|ACC91624.1|  chaperonin [Pseudomonas sp. CT07]                   306    7e-82 
ref|ZP_01611292.1|  60 kDa chaperonin (Protein Cpn60) (groEL p...   306    7e-82 
emb|CBA26967.1|  60 kDa chaperonin [Curvibacter putative symbi...   306    8e-82 
ref|ZP_04772672.1|  chaperonin GroEL [Allochromatium vinosum D...   306    8e-82 
dbj|BAF99058.1|  GroEL [Enterobacter cloacae]                       306    8e-82 
sp|O66202.1|CH60_SERRU  RecName: Full=60 kDa chaperonin; AltNa...   306    8e-82 
ref|NP_297905.1|  chaperonin GroEL [Xylella fastidiosa 9a5c] >...   306    8e-82  Gene info
sp|O66200.1|CH60_ENTAG  RecName: Full=60 kDa chaperonin; AltNa...   306    8e-82 
ref|ZP_03696932.1|  chaperonin GroEL [Lutiella nitroferrum 200...   306    8e-82 
ref|YP_003212077.1|  60 kDa chaperonin [Cronobacter turicensis...   306    9e-82  Gene info
ref|ZP_05632548.1|  60 kDa chaperonin GROEL [Fusobacterium ulc...   306    9e-82 
ref|NP_931324.1|  chaperonin GroEL [Photorhabdus luminescens s...   306    9e-82  Gene info
dbj|BAF99056.1|  GroEL [Enterobacter aerogenes] >dbj|BAF99057....   306    9e-82 
ref|YP_001173625.1|  chaperonin GroEL [Pseudomonas stutzeri A1...   306    9e-82  Gene info
dbj|BAF99041.1|  GroEL [Enterobacteriaceae bacterium Kuo2-1]        306    9e-82 
ref|NP_871261.1|  hypothetical protein WGLp258 [Wigglesworthia...   306    1e-81  Gene info
ref|YP_001616555.1|  heat shock protein groEL [Sorangium cellu...   306    1e-81  Gene info
ref|YP_903785.1|  chaperonin GroEL [Candidatus Ruthia magnific...   306    1e-81  Gene info
ref|YP_248252.1|  chaperonin GroEL [Haemophilus influenzae 86-...   306    1e-81  Gene info
sp|Q83WI8.1|CH601_VIBHA  RecName: Full=60 kDa chaperonin 1; Al...   306    1e-81 
ref|ZP_06062084.1|  predicted protein [Acinetobacter johnsonii...   306    1e-81 
gb|ABH85369.1|  symbionin [Buchnera aphidicola]                     306    1e-81 
sp|Q8KIX2.1|CH60_BUCTS  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
sp|O66214.1|CH60_KLEOR  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
ref|ZP_01789234.1|  chaperonin GroEL [Haemophilus influenzae 3...   306    1e-81 
sp|O66210.1|CH60_KLEOX  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
ref|ZP_01791078.1|  chaperonin GroEL [Haemophilus influenzae P...   306    1e-81 
ref|YP_460096.1|  chaperonin GroEL [Syntrophus aciditrophicus ...   306    1e-81  Gene info
sp|O66190.1|CH60_ENTAS  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
ref|ZP_00156363.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   306    1e-81 
ref|ZP_00155536.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   306    1e-81 
ref|ZP_00650827.1|  Chaperonin Cpn60/TCP-1 [Xylella fastidiosa...   306    1e-81 
ref|YP_003050177.1|  chaperonin GroEL [Methylovorus sp. SIP3-4...   306    1e-81  Gene info
ref|ZP_04617466.1|  60 kDa chaperonin [Yersinia ruckeri ATCC 2...   306    1e-81 
ref|ZP_05360132.1|  chaperonin GroL [Acinetobacter radioresist...   306    1e-81 
ref|ZP_02382575.1|  chaperonin GroEL [Burkholderia ubonensis Bu]    306    1e-81 
sp|O33500.1|CH60_PSEST  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
ref|ZP_05066025.1|  chaperonin GroL [Octadecabacter antarcticu...   306    1e-81 
ref|ZP_04832320.1|  chaperonin GroEL [Gallionella ferruginea E...   306    1e-81 
ref|ZP_00680264.1|  Chaperonin Cpn60/TCP-1 [Xylella fastidiosa...   306    1e-81 
ref|ZP_03968898.1|  chaperone GroEL [Sphingobacterium spiritiv...   306    1e-81 
ref|ZP_04778493.1|  chaperone GroEL [Sphingobacterium spiritiv...   306    1e-81 
sp|O66206.1|CH60_SERMA  RecName: Full=60 kDa chaperonin; AltNa...   306    1e-81 
ref|YP_001670710.1|  chaperonin GroEL [Pseudomonas putida GB-1...   306    1e-81  Gene info
ref|ZP_05878344.1|  heat shock protein 60 family chaperone Gro...   306    1e-81 
emb|CAC18574.1|  GroEL-like protein [Serratia marcescens] >emb...   305    2e-81 
ref|YP_001762657.1|  chaperonin GroEL [Shewanella woodyi ATCC ...   305    2e-81  Gene info
ref|ZP_01793075.1|  chaperonin GroEL [Haemophilus influenzae P...   305    2e-81 
ref|YP_003374848.1|  probable 60 kda chaperonin (protein cpn60...   305    2e-81 
ref|YP_003108572.1|  60 kDa chaperonin GroEL [Candidatus Sulci...   305    2e-81  Gene info
gb|AAR99286.1|  heat shock protein [Candidatus Blochmannia lae...   305    2e-81 
ref|ZP_02901194.1|  chaperonin GroL [Escherichia albertii TW07...   305    2e-81 
gb|AAR99287.1|  heat shock protein [Candidatus Blochmannia sayi]    305    2e-81 
sp|O66204.1|CH60_SERFI  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-81 
gb|AAR99291.1|  heat shock protein [Candidatus Blochmannia vic...   305    2e-81 
ref|YP_002988987.1|  chaperonin GroEL [Dickeya dadantii Ech703...   305    2e-81  Gene info
gb|AAR99293.1|  heat shock protein [Candidatus Blochmannia pen...   305    2e-81 
ref|YP_985019.1|  chaperonin GroEL [Acidovorax sp. JS42] >sp|A...   305    2e-81  Gene info
ref|YP_001194193.1|  chaperonin GroEL [Flavobacterium johnsoni...   305    2e-81  Gene info
gb|AAR99297.1|  heat shock protein [Candidatus Blochmannia ame...   305    2e-81 
dbj|BAH66384.1|  GroEL [Candidatus Riesia pediculicola]             305    2e-81 
ref|ZP_01870454.1|  chaperonin GroEL [Vibrio shilonii AK1] >gb...   305    2e-81 
ref|YP_928996.1|  chaperonin GroEL [Shewanella amazonensis SB2...   305    2e-81  Gene info
dbj|BAH66383.1|  GroEL [Candidatus Riesia pediculicola]             305    2e-81 
gb|AAR99296.1|  heat shock protein [Candidatus Blochmannia nov...   305    2e-81 
ref|YP_003332135.1|  chaperonin GroEL [Dickeya dadantii Ech586...   305    2e-81  Gene info
ref|ZP_06055863.1|  chaperonin GroL [Acinetobacter calcoacetic...   305    2e-81 
gb|AAR99292.1|  heat shock protein [Candidatus Blochmannia ulc...   305    2e-81 
sp|Q8KIX4.1|CH60_BUCPP  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-81 
ref|ZP_04625044.1|  60 kDa chaperonin [Yersinia kristensenii A...   305    2e-81 
ref|ZP_01552630.1|  chaperonin GroEL (Hsp60, Cpn10) [Methyloph...   305    2e-81 
gb|AAR99285.1|  heat shock protein [Candidatus Blochmannia vafer]   305    2e-81 
ref|YP_672232.1|  chaperonin GroEL [Escherichia coli 536] >ref...   305    2e-81  Gene info
ref|ZP_04611550.1|  60 kDa chaperonin [Yersinia rohdei ATCC 43...   305    2e-81 
ref|ZP_01308779.1|  60 kDa chaperonin GroEL [Candidatus Sulcia...   305    2e-81 
gb|AAR21890.1|  GroEL [Escherichia coli]                            305    2e-81 
sp|P48219.1|CH60_YEREN  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-81 
gb|AAR99299.1|  heat shock protein [Candidatus Blochmannia flo...   305    2e-81 
gb|AAR99284.1|  heat shock protein [Candidatus Blochmannia san...   305    2e-81 
ref|YP_277589.1|  chaperonin GroEL [Candidatus Blochmannia pen...   305    2e-81  Gene info
ref|YP_001004730.1|  chaperonin GroEL [Yersinia enterocolitica...   305    2e-81  Gene info
gb|AAR21891.1|  GroEL [Escherichia coli]                            305    2e-81 
ref|YP_003237350.1|  chaperonin Cpn60 [Escherichia coli O111:H...   305    2e-81  Gene info
ref|ZP_01463777.1|  chaperonin GroL [Stigmatella aurantiaca DW...   305    2e-81 
ref|NP_313151.1|  chaperonin GroEL [Escherichia coli O157:H7 s...   305    2e-81  Gene info
ref|YP_001175069.1|  chaperonin GroEL [Enterobacter sp. 638] >...   305    2e-81  Gene info
pdb|2EU1|A  Chain A, Crystal Structure Of The Chaperonin Groel...   305    2e-81  Related structures
ref|YP_003005819.1|  chaperonin GroEL [Dickeya zeae Ech1591] >...   305    2e-81  Gene info
dbj|BAF99036.1|  GroEL [Enterobacteriaceae bacterium Kuo1-1] >...   305    2e-81 
gb|AAL55999.1|AF325450_1  GroEL [Escherichia coli] >emb|CAA306...   305    2e-81 
gb|AAR21886.1|  GroEL [Escherichia coli]                            305    2e-81 
gb|AAL09389.1|AF306521_1  GroEL-like protein [Enterobacter aer...   305    2e-81 
ref|NP_878382.1|  chaperonin GroEL [Candidatus Blochmannia flo...   305    2e-81  Gene info
ref|YP_001354342.1|  chaperonin GroEL (Hsp60) [Janthinobacteri...   305    2e-81  Gene info
gb|AAR99294.1|  heat shock protein [Candidatus Blochmannia chr...   305    2e-81 
sp|Q8KIX0.1|CH60_BUCCM  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-81 
ref|ZP_06193239.1|  60 kDa chaperonin [Serratia odorifera 4Rx1...   305    3e-81 
ref|ZP_04631314.1|  60 kDa chaperonin [Yersinia frederiksenii ...   305    3e-81 
ref|YP_001476645.1|  chaperonin GroEL [Serratia proteamaculans...   305    3e-81  Gene info
pdb|3FBH|A  Chain A, Crystal Structure Of The Allosteric-Defec...   305    3e-81  Related structures
pdb|1PCQ|A  Chain A, Crystal Structure Of Groel-Groes >pdb|1PC...   305    3e-81  Related structures
gb|AAR23322.1|  GroEL [Buchnera aphidicola (Uroleucon sonchi)]      305    3e-81 
ref|ZP_04637011.1|  60 kDa chaperonin [Yersinia intermedia ATC...   305    3e-81 
ref|ZP_04628798.1|  60 kDa chaperonin [Yersinia bercovieri ATC...   305    3e-81 
gb|AAR21888.1|  GroEL [Escherichia coli]                            305    3e-81 
ref|YP_653837.1|  chaperonin GroEL [Yersinia pestis Antiqua] >...   305    3e-81  Gene info
ref|NP_667946.1|  chaperonin GroEL [Yersinia pestis KIM 10] >r...   305    3e-81  Gene info
ref|YP_003047865.1|  chaperonin GroEL [Methylotenera mobilis J...   305    3e-81  Gene info
ref|NP_290776.1|  chaperonin GroEL [Escherichia coli O157:H7 E...   305    3e-81  Gene info
gb|AAA53369.1|  GroEL [Pseudomonas aeruginosa]                      305    3e-81 
gb|AAR23315.1|  GroEL [Buchnera aphidicola (Uroleucon caligatum)]   305    3e-81 
ref|YP_002910611.1|  Chaperonin GroEL [Burkholderia glumae BGR...   305    3e-81  Gene info
ref|YP_002647515.1|  60 kDa chaperonin (Protein Cpn60) [Erwini...   305    3e-81  Gene info
sp|O66218.1|CH60_PANAN  RecName: Full=60 kDa chaperonin; AltNa...   305    3e-81 
ref|ZP_05972647.1|  chaperonin GroL [Providencia rustigianii D...   305    3e-81 
sp|O66196.1|CH60_ENTAM  RecName: Full=60 kDa chaperonin; AltNa...   305    3e-81 
ref|ZP_01077765.1|  chaperonin, 60 Kd subunit [Marinomonas sp....   305    3e-81 
ref|ZP_05919686.1|  chaperone GroEL [Pasteurella dagmatis ATCC...   305    3e-81 
ref|YP_001503535.1|  chaperonin GroEL [Shewanella pealeana ATC...   305    3e-81  Gene info
pdb|1J4Z|A  Chain A, Structural And Mechanistic Basis For Allo...   305    3e-81  Related structures
ref|YP_002232255.1|  chaperonin GroEL [Burkholderia cenocepaci...   305    3e-81  Gene info
gb|ABH85381.1|  symbionin [Buchnera aphidicola]                     305    3e-81 
emb|CAC86959.1|  GroEL protein [Buchnera sp. 150]                   305    3e-81 
sp|Q93N34.1|CH60_BUCRP  RecName: Full=60 kDa chaperonin; AltNa...   305    3e-81 
ref|YP_442004.1|  chaperonin GroEL [Burkholderia thailandensis...   305    3e-81  Gene info
pdb|1AON|A  Chain A, Crystal Structure Of The Asymmetric Chape...   305    3e-81  Related structures
sp|P31294.2|CH60_HAEDU  RecName: Full=60 kDa chaperonin; AltNa...   305    3e-81 
ref|ZP_02356758.1|  chaperonin GroEL [Burkholderia oklahomensi...   305    3e-81 
ref|YP_001350292.1|  chaperonin GroEL [Pseudomonas aeruginosa ...   305    3e-81  Gene info
ref|ZP_04618681.1|  60 kDa chaperonin [Yersinia aldovae ATCC 3...   305    3e-81 
ref|NP_253075.1|  chaperonin GroEL [Pseudomonas aeruginosa PAO...   305    3e-81  Gene info
pdb|3C9V|A  Chain A, C7 Symmetrized Structure Of Unliganded Gr...   305    3e-81  Related structures
ref|ZP_05117640.1|  chaperonin GroL [Vibrio parahaemolyticus 1...   305    3e-81 
gb|ABW81767.1|  GroEL [Buchnera aphidicola]                         305    3e-81 
ref|ZP_04764557.1|  chaperonin GroEL [Acidovorax delafieldii 2...   305    3e-81 
gb|AAR21864.1|  GroEL [Buchnera aphidicola (Uroleucon ambrosiae)]   305    3e-81 
gb|AAR21862.1|  GroEL [Buchnera aphidicola (Uroleucon ambrosiae)]   304    3e-81 
ref|NP_874147.1|  60 kDa chaperonin [Haemophilus ducreyi 35000...   304    3e-81  Gene info
gb|AAR99298.1|  heat shock protein [Candidatus Blochmannia nea...   304    4e-81 
ref|YP_001118641.1|  chaperonin GroEL [Burkholderia vietnamien...   304    4e-81  Gene info
gb|AAR23320.1|  GroEL [Buchnera aphidicola (Uroleucon rudbecki...   304    4e-81 
ref|YP_620263.1|  chaperonin GroEL [Burkholderia cenocepacia A...   304    4e-81  Gene info
ref|YP_001764131.1|  chaperonin GroEL [Burkholderia cenocepaci...   304    4e-81  Gene info
ref|YP_844259.1|  chaperonin GroEL [Syntrophobacter fumaroxida...   304    4e-81  Gene info
gb|AAR23314.1|  GroEL [Buchnera aphidicola (Uroleucon astronom...   304    4e-81 
gb|AAR23321.1|  GroEL [Buchnera aphidicola (Uroleucon solidagi...   304    4e-81 
emb|CAC18576.1|  GroEL-like protein [Serratia marcescens]           304    4e-81 
gb|ABW81765.1|  GroEL [Buchnera aphidicola]                         304    4e-81 
ref|ZP_04938126.1|  GroEL protein [Pseudomonas aeruginosa 2192...   304    4e-81 
ref|ZP_02889882.1|  chaperonin GroEL [Burkholderia ambifaria I...   304    4e-81 
emb|CAC18572.1|  GroEL-like protein [Serratia marcescens]           304    4e-81 
gb|AAR21865.1|  GroEL [Buchnera aphidicola (Uroleucon ambrosia...   304    4e-81 
ref|ZP_03364091.1|  chaperonin GroEL [Salmonella enterica subs...   304    4e-81 
ref|NP_438701.1|  chaperonin GroEL [Haemophilus influenzae Rd ...   304    4e-81  GeoGene info
ref|YP_002355075.1|  chaperonin GroEL [Thauera sp. MZ1T] >gb|A...   304    4e-81  Gene info
ref|YP_002468346.1|  60 kDa chaperonin [Buchnera aphidicola st...   304    4e-81  Gene info
gb|AAR23317.1|  GroEL [Buchnera aphidicola (Uroleucon jaceae)]      304    4e-81 
gb|AAA84916.1|  GroEL [Pasteurella multocida]                       304    4e-81 
gb|AAS75782.1|  GroEL [Escherichia coli] >gb|ACX41451.1| chape...   304    4e-81 
ref|NP_239860.1|  chaperonin GroEL [Buchnera aphidicola str. A...   304    4e-81  Gene info
ref|NP_246044.1|  chaperonin GroEL [Pasteurella multocida subs...   304    4e-81  Gene info
gb|ABW81769.1|  GroEL [Buchnera aphidicola]                         304    4e-81 
dbj|BAE95977.1|  GroEL [Plesiomonas shigelloides]                   304    4e-81 
dbj|BAG68456.1|  GroEL protein [Enterobacteriaceae bacterium S...   304    4e-81 
ref|ZP_02881818.1|  chaperonin GroEL [Burkholderia graminis C4...   304    4e-81 
gb|ABW81768.1|  GroEL [Buchnera aphidicola]                         304    4e-81 
ref|NP_760189.1|  chaperonin GroEL [Vibrio vulnificus CMCP6] >...   304    4e-81  Gene info
emb|CAA57694.1|  60 kDa Heat Shock Protein [Yersinia enterocol...   304    4e-81 
sp|O66192.1|CH60_ENTIT  RecName: Full=60 kDa chaperonin; AltNa...   304    4e-81 
ref|ZP_03907682.1|  chaperonin GroL [Denitrovibrio acetiphilus...   304    4e-81 
ref|ZP_01237067.1|  chaperonin GroEL [Vibrio angustum S14] >gb...   304    4e-81 
ref|YP_557235.1|  chaperonin GroEL [Burkholderia xenovorans LB...   304    5e-81  Gene info
ref|ZP_06209478.1|  chaperonin GroEL [Acidovorax avenae subsp....   304    5e-81 
ref|ZP_03714322.1|  hypothetical protein EIKCOROL_02022 [Eiken...   304    5e-81 
ref|YP_109293.1|  chaperonin GroEL [Burkholderia pseudomallei ...   304    5e-81  Gene info
gb|AAO46033.1|  GroEL [Burkholderia pseudomallei]                   304    5e-81 
ref|YP_001908898.1|  60 kDa chaperonin (Protein Cpn60) [Erwini...   304    5e-81  Gene info
ref|YP_001580709.1|  chaperonin GroEL [Burkholderia multivoran...   304    5e-81  Gene info
ref|NP_660380.1|  chaperonin GroEL [Buchnera aphidicola str. S...   304    5e-81  Gene info
gb|AAR99290.1|  heat shock protein [Candidatus Blochmannia sch...   304    5e-81 
ref|YP_334547.1|  chaperonin GroEL [Burkholderia pseudomallei ...   304    5e-81  Gene info
ref|YP_103588.1|  chaperonin GroEL [Burkholderia mallei ATCC 2...   304    5e-81  Gene info
ref|YP_003366690.1|  60 Kda chaperonin [Citrobacter rodentium ...   304    5e-81  Gene info
ref|ZP_06296964.1|  chaperonin GroEL [Burkholderia sp. CCGE100...   304    5e-81 
ref|ZP_03337305.1|  chaperonin GroEL [Salmonella enterica subs...   304    5e-81 
gb|ABW81766.1|  GroEL [Buchnera aphidicola]                         304    5e-81 
sp|O66212.1|CH60_KLEPL  RecName: Full=60 kDa chaperonin; AltNa...   304    5e-81 
ref|YP_001472382.1|  chaperonin GroEL [Shewanella sediminis HA...   304    5e-81  Gene info
ref|YP_001572277.1|  chaperonin GroEL [Salmonella enterica sub...   304    5e-81  Gene info
dbj|BAA12847.1|  60 kd chaperonin [Buchnera aphidicola] >gb|AA...   304    5e-81 
ref|ZP_04559558.1|  chaperonin GroEL [Citrobacter sp. 30_2] >g...   304    5e-81 
sp|O51832.1|CH60_BUCMP  RecName: Full=60 kDa chaperonin; AltNa...   304    5e-81 
ref|ZP_03378670.1|  chaperonin GroEL [Salmonella enterica subs...   304    5e-81 
sp|P0C193.1|CH60_SODGL  RecName: Full=60 kDa chaperonin; AltNa...   304    5e-81 
ref|ZP_05118623.1|  chaperonin GroL [Vibrio parahaemolyticus 1...   304    5e-81 
ref|ZP_06354500.1|  chaperonin GroEL [Citrobacter youngae ATCC...   304    6e-81 
gb|AAK92204.1|AF404511_1  groEL [Sodalis glossinidius]              304    6e-81 
ref|YP_453986.1|  chaperonin GroEL [Sodalis glossinidius str. ...   303    6e-81  Gene info
gb|AAG49527.1|AF321517_1  groEL [Sodalis glossinidius]              303    6e-81 
ref|YP_002228894.1|  chaperonin GroEL [Salmonella enterica sub...   303    6e-81  Gene info
dbj|BAF99042.1|  GroEL [Enterobacteriaceae bacterium Kuo2-2] >...   303    6e-81 
ref|YP_001953156.1|  chaperonin GroEL [Geobacter lovleyi SZ] >...   303    6e-81  Gene info
ref|YP_001675975.1|  chaperonin GroEL [Shewanella halifaxensis...   303    6e-81  Gene info
ref|ZP_05879781.1|  heat shock protein 60 family chaperone Gro...   303    6e-81 
ref|YP_002149249.1|  chaperonin GroL [Salmonella enterica subs...   303    6e-81  Gene info
emb|CAC16675.1|  GroEL-like protein [Serratia marcescens]           303    6e-81 
ref|NP_458769.1|  chaperonin GroEL [Salmonella enterica subsp....   303    6e-81  Gene info
ref|ZP_05943057.1|  heat shock protein 60 family chaperone Gro...   303    6e-81 
ref|YP_003167494.1|  chaperonin GroEL [Candidatus Accumulibact...   303    6e-81  Gene info
ref|YP_001455205.1|  chaperonin GroEL [Citrobacter koseri ATCC...   303    6e-81  Gene info
emb|CAA48539.1|  heat shock protein 60 [Yersinia enterocolitica]    303    7e-81 
ref|YP_001996523.1|  chaperonin GroEL [Chloroherpeton thalassi...   303    7e-81  Gene info
gb|AAR99289.1|  heat shock protein [Candidatus Blochmannia ocr...   303    7e-81 
ref|YP_283653.1|  chaperonin GroEL [Dechloromonas aromatica RC...   303    7e-81  Gene info
ref|YP_048741.1|  chaperonin GroEL [Pectobacterium atrosepticu...   303    7e-81  Gene info
ref|ZP_01161755.1|  60 kDa chaperonin GroEL [Photobacterium sp...   303    7e-81 
pir||JC5771  chaperonin groEL-like protein - Weevil                 303    7e-81 
ref|YP_001747842.1|  chaperonin GroEL [Pseudomonas putida W619...   303    7e-81  Gene info
ref|YP_969317.1|  chaperonin GroEL [Acidovorax avenae subsp. c...   303    7e-81  Gene info
ref|YP_001878012.1|  chaperonin GroEL [Akkermansia muciniphila...   303    7e-81  Gene info
sp|Q8KIX1.1|CH60_BUCTT  RecName: Full=60 kDa chaperonin; AltNa...   303    7e-81 
ref|YP_374469.1|  chaperonin GroEL [Chlorobium luteolum DSM 27...   303    7e-81  Gene info
ref|YP_261919.1|  chaperonin GroEL [Pseudomonas fluorescens Pf...   303    8e-81  Gene info
ref|ZP_04577829.1|  chaperonin [Oxalobacter formigenes HOxBLS]...   303    8e-81 
gb|AAR99288.1|  heat shock protein [Candidatus Blochmannia fes...   303    8e-81 
ref|YP_001894509.1|  chaperonin GroEL [Burkholderia phytofirma...   303    8e-81  Gene info
ref|YP_003291189.1|  chaperonin GroEL [Rhodothermus marinus DS...   303    8e-81  Gene info
gb|AAB97670.1|  GroEL [primary endosymbiont of Sitophilus oryzae]   303    8e-81 
sp|P95647.1|CH602_RHOSH  RecName: Full=60 kDa chaperonin 2; Al...   303    8e-81 
ref|YP_933870.1|  chaperonin GroEL [Azoarcus sp. BH72] >sp|A1K...   303    8e-81  Gene info
ref|YP_740868.1|  chaperonin GroEL [Alkalilimnicola ehrlichii ...   303    9e-81  Gene info
ref|ZP_02464506.1|  chaperonin GroEL [Burkholderia thailandens...   303    9e-81 
ref|YP_001998968.1|  chaperonin GroEL [Chlorobaculum parvum NC...   303    9e-81  Gene info
ref|YP_002133830.1|  chaperonin GroEL [Anaeromyxobacter sp. K]...   303    1e-80  Gene info
ref|YP_001269670.1|  chaperonin GroEL [Pseudomonas putida F1] ...   303    1e-80  Gene info
ref|YP_001378663.1|  chaperonin GroEL [Anaeromyxobacter sp. Fw...   303    1e-80  Gene info
gb|ABH85371.1|  symbionin [Buchnera aphidicola]                     303    1e-80 
ref|YP_001189168.1|  chaperonin GroEL [Pseudomonas mendocina y...   303    1e-80  Gene info
ref|YP_313849.1|  chaperonin GroEL (Hsp60, Cpn10) [Thiobacillu...   303    1e-80  Gene info
dbj|BAG68454.1|  GroEL protein [Enterobacteriaceae bacterium E...   303    1e-80 
emb|CAC86957.1|  GroEL protein [Buchnera sp. N27]                   303    1e-80 
ref|ZP_06156329.1|  heat shock protein 60 family chaperone Gro...   303    1e-80 
sp|O66222.1|CH60_ERWAP  RecName: Full=60 kDa chaperonin; AltNa...   303    1e-80 
ref|YP_001858554.1|  chaperonin GroEL [Burkholderia phymatum S...   303    1e-80  Gene info
gb|AAG48876.1|  groEL [Vibrio vulnificus]                           303    1e-80 
ref|NP_743520.1|  chaperonin GroEL [Pseudomonas putida KT2440]...   303    1e-80  Gene info
gb|AAA22995.1|  heat shock protein [Brucella abortus]               303    1e-80 
ref|YP_871195.1|  chaperonin GroEL [Shewanella sp. ANA-3] >sp|...   303    1e-80  Gene info
ref|ZP_01050165.1|  60 kDa chaperonin [Dokdonia donghaensis ME...   303    1e-80 
ref|YP_002017740.1|  chaperonin GroEL [Pelodictyon phaeoclathr...   303    1e-80  Gene info
ref|ZP_05880959.1|  heat shock protein 60 family chaperone Gro...   303    1e-80 
ref|YP_632638.1|  chaperonin GroEL [Myxococcus xanthus DK 1622...   303    1e-80  Gene info
gb|AAR23319.1|  GroEL [Buchnera aphidicola (Uroleucon rapuncul...   303    1e-80 
sp|O66194.1|CH60_ENTGE  RecName: Full=60 kDa chaperonin; AltNa...   303    1e-80 
ref|NP_716337.1|  chaperonin GroEL [Shewanella oneidensis MR-1...   303    1e-80  Gene info
gb|EFC65747.1|  chaperonin GroEL [bacterium S5]                     303    1e-80 
ref|ZP_03270638.1|  chaperonin GroEL [Burkholderia sp. H160] >...   303    1e-80 
ref|YP_609927.1|  chaperonin GroEL [Pseudomonas entomophila L4...   303    1e-80  Gene info
ref|YP_001100795.1|  chaperone Hsp60 (GroEL), part of GroE cha...   303    1e-80  Gene info
ref|YP_735520.1|  chaperonin GroEL [Shewanella sp. MR-4] >ref|...   302    1e-80  Gene info
ref|ZP_06223653.1|  chaperonin GroEL [Burkholderia sp. CCGE100...   302    1e-80 
ref|YP_003038778.1|  chaperonin GroEL [Candidatus Hodgkinia ci...   302    1e-80  Gene info
ref|NP_518763.1|  chaperonin GroEL [Ralstonia solanacearum GMI...   302    1e-80  Gene info
ref|ZP_01898855.1|  chaperonin GroEL [Moritella sp. PE36] >gb|...   302    1e-80 
sp|P48216.3|CH60_PSEPU  RecName: Full=60 kDa chaperonin; AltNa...   302    1e-80 
ref|ZP_05129212.1|  chaperonin GroL [gamma proteobacterium NOR...   302    1e-80 
ref|YP_002874493.1|  chaperone Hsp60, peptide-dependent ATPase...   302    1e-80  Gene info
emb|CAC18570.1|  GroEL-like protein [Serratia marcescens]           302    1e-80 
ref|YP_267706.1|  chaperone protein GroEL [Colwellia psychrery...   302    1e-80  Gene info
ref|YP_912376.1|  chaperonin GroEL [Chlorobium phaeobacteroide...   302    2e-80  Gene info
ref|ZP_05082480.1|  chaperonin GroL [beta proteobacterium KB13...   302    2e-80 
ref|YP_544476.1|  chaperonin GroEL [Methylobacillus flagellatu...   302    2e-80  Gene info
ref|ZP_01813536.1|  chaperonin GroEL [Vibrionales bacterium SW...   302    2e-80 
ref|YP_203588.1|  chaperonin GroEL [Vibrio fischeri ES114] >re...   302    2e-80  Gene info
ref|ZP_01957270.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   302    2e-80 
ref|ZP_02892700.1|  chaperonin GroEL [Burkholderia ambifaria I...   302    2e-80 
ref|YP_368198.1|  chaperonin GroEL [Burkholderia sp. 383] >sp|...   302    2e-80  Gene info
ref|YP_772626.1|  chaperonin GroEL [Burkholderia ambifaria AMM...   302    2e-80  Gene info
ref|ZP_01062250.1|  chaperonin, 60 kDa [Leeuwenhoekiella bland...   302    2e-80 
gb|ACA58291.1|  GroEL [Listonella anguillarum]                      302    2e-80 
gb|AAR21884.1|  GroEL [Escherichia coli]                            302    2e-80 
dbj|BAA03164.1|  heat-shock protein 60 [Yersinia enterocolitica]    302    2e-80 
gb|ABH85380.1|  symbionin [Buchnera aphidicola]                     302    2e-80 
gb|AAA24961.1|  heat shock protein [Haemophilus ducreyi]            302    2e-80 
emb|CAF05633.1|  hypothetical protein [Angiococcus disciformis]     302    2e-80 
ref|YP_002256484.1|  60 kda chaperonin [Ralstonia solanacearum...   302    2e-80  Gene info
gb|ABH85374.1|  symbionin [Buchnera aphidicola] >gb|ABH85378.1...   302    2e-80 
ref|ZP_00944593.1|  60 kDa chaperonin GROEL [Ralstonia solanac...   302    2e-80 
gb|ABH85372.1|  symbionin [Buchnera aphidicola]                     302    2e-80 
sp|Q93N35.1|CH60_BUCRM  RecName: Full=60 kDa chaperonin; AltNa...   302    2e-80 
ref|ZP_01135609.1|  60 kDa chaperonin (Protein Cpn60) (groEL p...   302    2e-80 
ref|ZP_01979949.1|  chaperonin GroL [Vibrio cholerae MZO-2] >r...   302    2e-80 
ref|YP_002309996.1|  Chaperonin GroEL [Shewanella piezotoleran...   301    3e-80  Gene info
ref|YP_001942570.1|  chaperonin GroEL [Chlorobium limicola DSM...   301    3e-80  Gene info
emb|CAC16677.1|  GroEL-like protein [Serratia marcescens]           301    3e-80 
ref|ZP_01883333.1|  60 kDa chaperonin [Pedobacter sp. BAL39] >...   301    3e-80 
ref|YP_002983021.1|  chaperonin GroEL [Ralstonia pickettii 12D...   301    3e-80  Gene info
ref|ZP_01114652.1|  chaperonin GroEL [Reinekea sp. MED297] >gb...   301    3e-80 
ref|YP_778270.1|  chaperonin GroEL [Burkholderia ambifaria AMM...   301    3e-80  Gene info
ref|YP_001959215.1|  chaperonin GroEL [Chlorobium phaeobactero...   301    3e-80  Gene info
ref|ZP_01973128.1|  chaperonin GroL [Vibrio cholerae NCTC 8457...   301    3e-80 
gb|ACD68572.1|  GroEL [Psychrobacter frigidicola]                   301    3e-80 
ref|NP_661430.1|  chaperonin GroEL [Chlorobium tepidum TLS] >s...   301    3e-80  Gene info
gb|AAK52957.1|  GroEL-related molecular chaperonin SymL [Buchn...   301    3e-80 
gb|ACC54436.1|  GroEL [Candidatus Portiera aleyrodidarum]           301    3e-80 
gb|AAR99295.1|  heat shock protein [Candidatus Blochmannia cas...   301    3e-80 
ref|YP_002795870.1|  GroEL1 [Laribacter hongkongensis HLHK9] >...   301    3e-80  Gene info
ref|ZP_04579978.1|  TCP-1/cpn60 chaperonin family protein [Oxa...   301    3e-80 
ref|NP_233206.1|  chaperonin GroEL [Vibrio cholerae O1 biovar ...   301    3e-80  Gene info
gb|AAB34346.1|  GroEL [Pseudomonas aeruginosa]                      301    3e-80 
ref|YP_001182230.1|  chaperonin GroEL [Shewanella putrefaciens...   301    3e-80  Gene info
ref|YP_002893992.1|  chaperonin GroEL [Tolumonas auensis DSM 9...   301    3e-80  Gene info
sp|P31293.1|CH60_CHRVI  RecName: Full=60 kDa chaperonin; AltNa...   301    3e-80 
ref|ZP_01065542.1|  chaperonin GroEL [Vibrio sp. MED222] >gb|E...   301    4e-80 
ref|ZP_04917549.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   301    4e-80 
ref|ZP_01950208.1|  chaperonin, 60 Kd subunit [Vibrio cholerae...   301    4e-80 
ref|NP_777659.1|  chaperonin GroEL [Buchnera aphidicola str. B...   301    4e-80  Gene info
ref|YP_002015374.1|  chaperonin GroEL [Prosthecochloris aestua...   301    4e-80  Gene info
gb|AAR21863.1|  GroEL [Buchnera aphidicola (Uroleucon ambrosiae)]   301    4e-80 
ref|ZP_04417711.1|  heat shock protein 60 family chaperone Gro...   301    4e-80 
ref|ZP_01221350.1|  chaperonin GroEL [Photobacterium profundum...   301    4e-80 
gb|AAR23316.1|  GroEL [Buchnera aphidicola (Uroleucon helianth...   301    4e-80 
ref|YP_964835.1|  chaperonin GroEL [Shewanella sp. W3-18-1] >r...   301    4e-80  Gene info
ref|YP_001279543.1|  chaperonin GroEL [Psychrobacter sp. PRwf-...   301    4e-80  Gene info
ref|YP_001900980.1|  chaperonin GroEL [Ralstonia pickettii 12J...   301    4e-80  Gene info
pdb|1GRL|A  Chain A, The Crystal Structure Of The Bacterial Ch...   301    5e-80  Related structures
ref|ZP_03691894.1|  chaperonin GroEL [Thioalkalivibrio sp. K90...   301    5e-80 
pdb|1SS8|A  Chain A, Groel >pdb|1SS8|B Chain B, Groel >pdb|1SS...   300    5e-80  Related structures
ref|YP_001553110.1|  chaperonin GroEL [Shewanella baltica OS19...   300    5e-80  Gene info
pdb|1SX3|A  Chain A, Groel14-(Atpgammas)14 >pdb|1SX3|B Chain B...   300    5e-80  Related structures
pdb|1KP8|A  Chain A, Structural Basis For Groel-Assisted Prote...   300    5e-80  Related structures
ref|YP_001364869.1|  chaperonin GroEL [Shewanella baltica OS18...   300    5e-80  Gene info
ref|YP_785112.1|  60 kDa chaperonin [Bordetella avium 197N] >s...   300    5e-80  Gene info
ref|YP_003090531.1|  chaperonin GroEL [Pedobacter heparinus DS...   300    5e-80  Gene info
ref|YP_002980512.1|  chaperonin GroEL [Ralstonia pickettii 12D...   300    5e-80  Gene info
sp|Q8KIX3.1|CH60_BUCTC  RecName: Full=60 kDa chaperonin; AltNa...   300    5e-80 
ref|YP_001898162.1|  chaperonin GroEL [Ralstonia pickettii 12J...   300    6e-80  Gene info
ref|YP_001632546.1|  chaperonin GroEL [Bordetella petrii DSM 1...   300    6e-80  Gene info
pdb|3CAU|A  Chain A, D7 Symmetrized Structure Of Unliganded Gr...   300    6e-80  Related structures
ref|ZP_01126571.1|  Chaperonin Cpn60/TCP-1 [Nitrococcus mobili...   300    6e-80 
ref|YP_001052051.1|  chaperonin GroEL [Shewanella baltica OS15...   300    6e-80  Gene info
gb|AAR21883.1|  GroEL [Escherichia coli]                            300    6e-80 
sp|O66026.1|CH60_KLEPN  RecName: Full=60 kDa chaperonin; AltNa...   300    6e-80 
ref|ZP_04054367.1|  chaperonin GroL [Porphyromonas uenonis 60-...   300    6e-80 
gb|AAA25830.1|  heat shock protein [Pseudomonas aeruginosa]         300    6e-80 
ref|ZP_05054116.1|  TCP-1/cpn60 chaperonin family [Octadecabac...   300    6e-80 
ref|ZP_01104859.1|  60 kDa chaperonin [Congregibacter litorali...   300    6e-80 
ref|YP_002909493.1|  Chaperonin GroEL2 [Burkholderia glumae BG...   300    6e-80  Gene info
ref|YP_001816085.1|  chaperonin GroEL [Burkholderia ambifaria ...   300    6e-80  Gene info
gb|ABZ07518.1|  putative TCP-1/cpn60 chaperonin family protein...   300    6e-80 
pdb|1OEL|A  Chain A, Conformational Variability In The Refined...   300    6e-80  Related structures
pdb|1GR5|A  Chain A, Solution Structure Of Apo Groel By Cryo-E...   300    7e-80  Related structures
gb|ACY78971.1|  GroEL [Vibrio cholerae] >gb|ACY78972.1| GroEL ...   300    7e-80 
gb|AAX59906.1|  chaperonin GroEL [Leptospirillum ferrooxidans]      300    7e-80 
ref|ZP_04601146.1|  hypothetical protein GCWU000324_00610 [Kin...   300    7e-80 
gb|ABH85376.1|  symbionin [Buchnera aphidicola] >gb|ABH85377.1...   300    7e-80 
gb|ABH85373.1|  symbionin [Buchnera aphidicola] >gb|ABH85375.1...   300    7e-80 
ref|YP_561438.1|  chaperonin GroEL [Shewanella denitrificans O...   300    7e-80  Gene info
ref|NP_883195.1|  chaperonin GroEL [Bordetella parapertussis 1...   300    8e-80  Gene info
ref|NP_882014.1|  chaperonin GroEL [Bordetella pertussis Toham...   300    8e-80  Gene info
ref|ZP_06226323.1|  chaperonin GroEL [Burkholderia sp. CCGE100...   300    9e-80 
ref|ZP_00989973.1|  chaperonin GroEL [Vibrio splendidus 12B01]...   300    9e-80 
ref|YP_002415922.1|  chaperonin GroEL [Vibrio splendidus LGP32...   300    9e-80  Gene info
ref|YP_001492054.1|  chaperonin GroEL [Rickettsia canadensis s...   300    9e-80  Gene info
ref|ZP_02379898.1|  chaperonin GroEL [Burkholderia ubonensis Bu]    300    9e-80 
ref|ZP_06032117.1|  heat shock protein 60 family chaperone Gro...   300    9e-80 
ref|ZP_05711341.1|  chaperonin GroEL [Desulfurivibrio alkaliph...   300    9e-80 
ref|ZP_01253840.1|  chaperonin GroEL [Psychroflexus torquis AT...   300    9e-80 
ref|YP_263848.1|  chaperonin GroEL [Psychrobacter arcticus 273...   300    1e-79  Gene info
emb|CAC19391.1|  GroEL-like protein [Enterobacteriaceae sp. JM...   300    1e-79 
ref|YP_002261578.1|  chaperonin GroEL [Aliivibrio salmonicida ...   300    1e-79  Gene info
gb|AAP32277.1|  immunogenic protein ChaPs [Piscirickettsia sal...   300    1e-79 
ref|YP_678437.1|  60 kDa chaperonin [Cytophaga hutchinsonii AT...   300    1e-79  Gene info
dbj|BAE79471.1|  GroEL protein [Candidatus Ishikawaella capsul...   299    1e-79 
gb|EES53980.1|  chaperonin GroEL [Leptospirillum ferrodiazotro...   299    1e-79 
ref|YP_855402.1|  chaperonin GroEL [Aeromonas hydrophila subsp...   299    1e-79  Gene info
ref|YP_752326.1|  chaperonin GroEL [Shewanella frigidimarina N...   299    1e-79  Gene info
gb|ACY78970.1|  GroEL [Vibrio cholerae]                             299    1e-79 
ref|YP_802589.1|  chaperonin GroEL [Buchnera aphidicola str. C...   299    1e-79  Gene info
ref|NP_904815.1|  chaperonin GroEL [Porphyromonas gingivalis W...   299    1e-79  Gene info
ref|YP_579808.1|  chaperonin GroEL [Psychrobacter cryohalolent...   299    2e-79  Gene info
ref|YP_001929568.1|  chaperonin GroEL [Porphyromonas gingivali...   299    2e-79  Gene info
ref|YP_846461.1|  chaperonin GroEL [Syntrophobacter fumaroxida...   299    2e-79  Gene info
ref|YP_131474.1|  chaperonin GroEL [Photobacterium profundum S...   298    2e-79  Gene info
ref|YP_001117599.1|  chaperonin GroEL [Burkholderia vietnamien...   298    2e-79  Gene info
ref|YP_344897.1|  chaperonin GroEL [Nitrosococcus oceani ATCC ...   298    2e-79  Gene info
gb|AAB47483.1|  GroEL-related molecular chaperonin SymL [Sitob...   298    2e-79 
ref|ZP_01720488.1|  chaperonin GroEL [Algoriphagus sp. PR1] >g...   298    3e-79 
ref|YP_002520731.1|  60 kDa chaperonin 2 [Rhodobacter sphaeroi...   298    3e-79  Gene info
ref|YP_063926.1|  chaperonin GroEL [Desulfotalea psychrophila ...   298    3e-79  Gene info
sp|P95800.1|CH60_STEMA  RecName: Full=60 kDa chaperonin; AltNa...   298    3e-79 
gb|ACY78978.1|  GroEL [Vibrio cholerae]                             298    3e-79 
ref|YP_001957473.1|  hypothetical protein Aasi_0308 [Candidatu...   298    3e-79  Gene info
gb|AAO33048.1|  GroEL [Buchnera aphidicola]                         298    4e-79 
ref|YP_008179.1|  chaperonin GroEL [Candidatus Protochlamydia ...   298    4e-79  Gene info
ref|YP_003269744.1|  chaperonin GroEL [Haliangium ochraceum DS...   297    4e-79  Gene info
ref|ZP_05852382.1|  chaperonin GroL [Granulicatella elegans AT...   297    5e-79 
gb|AAL30419.1|  SymL [Buchnera aphidicola (Schizaphis graminum)]    297    5e-79 
ref|YP_003303823.1|  chaperonin GroEL [Sulfurospirillum deleyi...   297    5e-79  Gene info
ref|YP_350229.1|  chaperonin GroEL [Pseudomonas fluorescens Pf...   297    6e-79  Gene info
ref|YP_725222.1|  chaperonin GroEL [Ralstonia eutropha H16] >s...   297    6e-79  Gene info
ref|ZP_03570534.1|  chaperonin GroL [Burkholderia multivorans ...   297    6e-79 
ref|YP_001585215.1|  chaperonin GroEL [Burkholderia multivoran...   297    6e-79  Gene info
gb|AAN32681.1|AF417588_2  GroEL [Enterococcus raffinosus]           297    6e-79 
ref|ZP_02363854.1|  chaperonin GroEL [Burkholderia oklahomensi...   297    6e-79 
ref|YP_001143150.1|  chaperonin GroL [Aeromonas salmonicida su...   297    7e-79  Gene info
sp|O68309.1|CH60_AERSA  RecName: Full=60 kDa chaperonin; AltNa...   297    7e-79 
ref|YP_001322746.1|  chaperonin GroEL [Methanococcus vannielii...   296    8e-79  Gene info
gb|ABF51688.1|  GroEL 60S chaperonin [Candidatus Arsenophonus ...   296    8e-79 
ref|YP_001130110.1|  chaperonin GroEL [Prosthecochloris vibrio...   296    8e-79  Gene info
ref|NP_902903.1|  chaperonin GroEL [Chromobacterium violaceum ...   296    8e-79  Gene info
ref|YP_390616.1|  chaperonin Cpn60/TCP-1 [Thiomicrospira cruno...   296    9e-79  Gene info
ref|YP_002308963.1|  chaperonin GroEL [Candidatus Azobacteroid...   296    9e-79  Gene info
ref|ZP_02499310.1|  chaperonin GroEL [Burkholderia pseudomalle...   296    9e-79 
ref|ZP_02908296.1|  chaperonin GroEL [Burkholderia ambifaria M...   296    9e-79 
gb|AAB47482.1|  GroEL-related molecular chaperonin SymL [Rhopa...   296    9e-79 
dbj|BAD06928.1|  molecular chaperone GroEL [Ralstonia pickettii]    296    1e-78 
gb|AAD04241.1|  60 kDa heat shock protein [Bartonella doshiae]      296    1e-78 
ref|YP_246425.1|  chaperonin GroEL [Rickettsia felis URRWXCal2...   296    1e-78  Gene info
ref|YP_002761048.1|  60 kDa chaperonin [Gemmatimonas aurantiac...   296    1e-78  Gene info
ref|YP_001359264.1|  chaperonin GroEL [Sulfurovum sp. NBC37-1]...   296    1e-78  Gene info
gb|EEH51094.1|  predicted protein [Micromonas pusilla CCMP1545]     296    1e-78 
ref|ZP_05737840.1|  chaperonin GroEL [Granulicatella adiacens ...   296    1e-78 
dbj|BAD06926.1|  molecular chaperone GroEL [Ralstonia pickettii]    296    1e-78 
gb|AAN32671.1|AF417583_2  GroEL [Enterococcus avium]                296    1e-78 
dbj|BAH66381.1|  GroEL [endosymbiont of Pedicinus obtusus] >db...   296    1e-78 
ref|ZP_05630424.1|  60 kDa chaperonin GROEL [Fusobacterium gon...   296    1e-78 
ref|YP_837154.1|  chaperonin GroEL [Burkholderia cenocepacia H...   296    1e-78  Gene info
ref|YP_001777638.1|  chaperonin GroEL [Burkholderia cenocepaci...   296    1e-78  Gene info
ref|YP_001810134.1|  chaperonin GroEL [Burkholderia ambifaria ...   296    2e-78  Gene info
gb|AAV80377.1|  GroEL [Piscirickettsia salmonis]                    296    2e-78 
ref|ZP_05617387.1|  60 kDa chaperonin GROEL [Fusobacterium sp....   296    2e-78 
ref|ZP_01363948.1|  hypothetical protein PaerPA_01001051 [Pseu...   296    2e-78 
ref|ZP_04942418.1|  Chaperonin GroEL (HSP60 family) [Burkholde...   296    2e-78 
gb|ACY78975.1|  GroEL [Vibrio cholerae]                             295    2e-78 
ref|YP_003283834.1|  chaperone GroEL [Blattabacterium sp. (Bla...   295    2e-78  Gene info
gb|AAO33049.1|  GroEL [Buchnera aphidicola]                         295    2e-78 
ref|ZP_06299088.1|  Chaperonin GroEL [Parachlamydia acanthamoe...   295    2e-78 
ref|YP_003257191.1|  60 kDa chaperonin GroEL [Blattabacterium ...   295    2e-78  Gene info
ref|ZP_04639567.1|  60 kDa chaperonin [Yersinia mollaretii ATC...   295    2e-78 
ref|YP_002575607.1|  60 kD chaperonin (cpn60) [Campylobacter l...   295    2e-78  Gene info
ref|NP_220991.1|  chaperonin GroEL [Rickettsia prowazekii str....   295    2e-78  Gene info
ref|ZP_02888350.1|  chaperonin GroEL [Burkholderia ambifaria I...   295    2e-78 
ref|YP_067563.1|  chaperonin GroEL [Rickettsia typhi str. Wilm...   295    2e-78  Gene info
ref|ZP_02382547.1|  chaperonin GroEL [Burkholderia ubonensis Bu]    295    2e-78 
ref|NP_794131.1|  chaperonin, 60 kDa [Pseudomonas syringae pv....   295    2e-78  Gene info
ref|YP_276203.1|  chaperonin GroEL [Pseudomonas syringae pv. p...   295    2e-78  Gene info
sp|O34198.1|CH60_RICRI  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-78 
ref|YP_237140.1|  chaperonin GroEL [Pseudomonas syringae pv. s...   295    2e-78  Gene info
ref|ZP_02908908.1|  chaperonin GroEL [Burkholderia ambifaria M...   295    2e-78 
ref|YP_003245312.1|  chaperonin GroEL [Geobacillus sp. Y412MC1...   295    3e-78  Gene info
ref|YP_002004733.1|  chaperonin GroEL [Cupriavidus taiwanensis...   295    3e-78  Gene info
ref|YP_296861.1|  chaperonin GroEL [Ralstonia eutropha JMP134]...   295    3e-78  Gene info
ref|YP_002352851.1|  chaperonin GroEL [Dictyoglomus turgidum D...   295    3e-78  Gene info
gb|AAD04238.1|  60 kDa heat shock protein [Bartonella henselae...   295    3e-78 
ref|ZP_03132024.1|  chaperonin GroEL [Chthoniobacter flavus El...   295    3e-78 
ref|ZP_05640427.1|  chaperonin GroEL [Pseudomonas syringae pv....   295    3e-78 
gb|ABC26736.1|  GroEL [Streptococcus lutetiensis]                   295    3e-78 
ref|YP_003262520.1|  chaperonin GroEL [Halothiobacillus neapol...   295    3e-78  Gene info
gb|AAC26224.1|  GroEL [Rickettsia typhi]                            295    3e-78 
ref|ZP_00367245.1|  chaperonin, 60 kDa [Campylobacter coli RM2...   295    3e-78 
gb|ABC26734.1|  GroEL [Streptococcus infantarius subsp. infant...   295    3e-78 
ref|ZP_02031134.1|  hypothetical protein PARMER_01119 [Parabac...   295    3e-78 
ref|YP_002250677.1|  chaperonin GroL [Dictyoglomus thermophilu...   295    3e-78  Gene info
gb|ABX57775.1|  GroEL [Streptococcus equinus]                       295    3e-78 
ref|YP_001495063.1|  chaperonin GroEL [Rickettsia rickettsii s...   295    3e-78  Gene info
ref|NP_360605.1|  chaperonin GroEL [Rickettsia conorii str. Ma...   294    4e-78  Gene info
ref|YP_002845475.1|  60 kD chaperonin [Rickettsia africae ESF-...   294    4e-78  Gene info
ref|ZP_02157735.1|  chaperonin GroEL [Shewanella benthica KT99...   294    4e-78 
ref|ZP_04389028.1|  chaperonin GroL [Porphyromonas endodontali...   294    4e-78 
ref|ZP_01173072.1|  chaperonin GroEL [Bacillus sp. NRRL B-1491...   294    4e-78 
ref|YP_746457.1|  chaperonin GroEL [Nitrosomonas eutropha C91]...   294    4e-78  Gene info
ref|ZP_02919964.1|  hypothetical protein STRINF_00825 [Strepto...   294    4e-78 
ref|ZP_04566947.1|  hsp60-like protein [Fusobacterium mortifer...   294    5e-78 
ref|ZP_04959328.1|  chaperonin GroL [gamma proteobacterium NOR...   294    5e-78 
ref|YP_582771.1|  chaperonin GroEL [Ralstonia metallidurans CH...   294    6e-78  Gene info
ref|XP_001691353.1|  chaperonin 60C [Chlamydomonas reinhardtii...   294    6e-78  UniGene infoGene info
ref|YP_001489376.1|  chaperonin GroEL [Arcobacter butzleri RM4...   294    6e-78  Gene info
ref|YP_002233172.1|  chaperonin GroEL [Burkholderia cenocepaci...   294    6e-78  Gene info
ref|YP_001493749.1|  chaperonin GroEL [Rickettsia akari str. H...   294    6e-78  Gene info
gb|AAR23318.1|  GroEL [Buchnera aphidicola (Uroleucon obscurum)]    293    6e-78 
ref|ZP_01766781.1|  chaperonin GroL [Burkholderia pseudomallei...   293    6e-78 
ref|ZP_06229643.1|  chaperonin GroEL [Burkholderia sp. CCGE100...   293    6e-78 
ref|YP_003385834.1|  chaperonin GroEL [Spirosoma linguale DSM ...   293    7e-78  Gene info
ref|ZP_04948254.1|  Chaperonin GroEL [Burkholderia dolosa AUO1...   293    7e-78 
ref|ZP_04588050.1|  chaperonin GroEL [Pseudomonas syringae pv....   293    7e-78 
ref|ZP_04570956.1|  hsp60-like protein [Fusobacterium sp. 2_1_...   293    7e-78 
sp|A8F2B5.2|CH60_RICM5  RecName: Full=60 kDa chaperonin; AltNa...   293    8e-78 
ref|ZP_00142887.1|  60 kD chaperonin [Rickettsia sibirica 246]...   293    8e-78 
ref|ZP_04449309.1|  hypothetical protein GCWU000282_00538 [Cat...   293    8e-78 
emb|CAB40143.1|  chaperonin hsp60, GroEL [Rickettsia prowazekii]    293    8e-78 
ref|YP_001305096.1|  chaperonin GroEL [Parabacteroides distaso...   293    9e-78  Gene info
gb|AAY19525.1|  heat shock protein 60 [Parabacteroides distaso...   293    9e-78 
emb|CAC86962.1|  GroEL protein [Buchnera sp. 389]                   293    9e-78 
gb|ABX57785.1|  GroEL [Streptococcus lutetiensis]                   293    1e-77 
ref|YP_001499598.1|  chaperonin GroEL [Rickettsia massiliae MT...   293    1e-77  Gene info
gb|ABX57781.1|  GroEL [Streptococcus lutetiensis] >gb|ABX57783...   293    1e-77 
ref|ZP_01871945.1|  chaperonin GroEL [Caminibacter mediatlanti...   293    1e-77 
gb|ABW80159.1|  GroEL [Streptococcus sinensis]                      293    1e-77 
ref|YP_001397688.1|  chaperonin GroEL [Campylobacter jejuni su...   293    1e-77  Gene info
ref|YP_621458.1|  chaperonin GroEL [Burkholderia cenocepacia A...   293    1e-77  Gene info
gb|AAO33050.1|  GroEL [Buchnera aphidicola]                         293    1e-77 
ref|YP_001774336.1|  chaperonin GroEL [Burkholderia cenocepaci...   293    1e-77  Gene info
gb|ACC54437.1|  GroEL [Rickettsia endosymbiont of Bemisia tabaci]   293    1e-77 
ref|ZP_01809906.1|  60 kD chaperonin (cpn60) [Campylobacter je...   293    1e-77 
ref|ZP_05627439.1|  60 kDa chaperonin GROEL [Fusobacterium sp....   293    1e-77 
gb|ABW80158.1|  GroEL [Streptococcus sinensis]                      293    1e-77 
ref|YP_537760.1|  chaperonin GroEL [Rickettsia bellii RML369-C...   293    1e-77  Gene info
gb|AAL67840.1|AF461533_1  60 kDa chaperonin Cpn60 [Campylobact...   293    1e-77 
ref|YP_179343.1|  chaperonin GroEL [Campylobacter jejuni RM122...   292    1e-77  Gene info
ref|YP_003125852.1|  chaperonin GroEL [Chitinophaga pinensis D...   292    1e-77  Gene info
ref|ZP_01099471.1|  co-chaperonin GroEL [Campylobacter jejuni ...   292    1e-77 
ref|ZP_04700103.1|  chaperonin GroL [Rickettsia endosymbiont o...   292    2e-77 
gb|AAL67843.1|AF461536_1  60 kDa chaperonin Cpn60 [Campylobact...   292    2e-77 
ref|ZP_04427822.1|  chaperonin GroL [Planctomyces limnophilus ...   292    2e-77 
ref|ZP_05070701.1|  chaperonin GroL [Campylobacterales bacteri...   292    2e-77 
ref|ZP_03477630.1|  hypothetical protein PRABACTJOHN_03318 [Pa...   292    2e-77 
emb|CAC86960.1|  GroEL protein [Buchnera sp. 168]                   292    2e-77 
ref|YP_001031761.1|  chaperonin GroEL [Lactococcus lactis subs...   292    2e-77  Gene info
ref|ZP_06008791.1|  chaperonin GroEL [Campylobacter fetus subs...   292    2e-77 
ref|YP_003352916.1|  60 kDa chaperonin GroEL [Lactococcus lact...   292    2e-77  Gene info
ref|XP_002176830.1|  mitochondria-targeted chaperonin [Phaeoda...   292    2e-77  UniGene infoGene info
ref|YP_373371.1|  chaperonin GroEL [Burkholderia sp. 383] >sp|...   292    2e-77  Gene info
ref|YP_891876.1|  chaperonin GroEL [Campylobacter fetus subsp....   292    2e-77  Gene info
ref|NP_266550.1|  chaperonin GroEL [Lactococcus lactis subsp. ...   292    2e-77  Gene info
ref|YP_808466.1|  chaperonin GroEL [Lactococcus lactis subsp. ...   292    2e-77  Gene info
gb|AAN32675.1|AF417585_2  GroEL [Enterococcus durans]               292    2e-77 
gb|ABJ52823.1|  GroEL [Francisella noatunensis subsp. noatunen...   292    2e-77 
ref|YP_002248448.1|  chaperonin GroL [Thermodesulfovibrio yell...   292    2e-77  Gene info
ref|YP_001798220.1|  chaperonin GroEL [Polynucleobacter necess...   292    2e-77  Gene info
ref|YP_002154019.1|  chaperonin GroEL [Burkholderia cenocepaci...   292    2e-77  Gene info
ref|YP_001451151.1|  chaperonin GroEL [Streptococcus gordonii ...   291    2e-77  Gene info
ref|ZP_03982588.1|  chaperone GroEL protein [Enterococcus faec...   291    3e-77 
ref|NP_712836.1|  chaperonin GroEL [Leptospira interrogans ser...   291    3e-77  Gene info
ref|ZP_03267615.1|  chaperonin GroEL [Burkholderia sp. H160] >...   291    3e-77 
ref|ZP_06061470.1|  chaperonin [Streptococcus sp. 2_1_36FAA] >...   291    3e-77 
gb|AAD04242.1|  60 kDa heat shock protein [Bartonella grahamii]     291    3e-77 
ref|ZP_05673941.1|  TCP-1/cpn60 family chaperonin [Enterococcu...   291    3e-77 
gb|ABJ52822.1|  GroEL [Francisella philomiragia subsp. philomi...   291    3e-77 
emb|CAC86961.1|  GroEL protein [Buchnera sp.]                       291    3e-77 
ref|ZP_01068929.1|  co-chaperonin GroEL [Campylobacter jejuni ...   291    3e-77 
ref|ZP_02186011.1|  chaperonin, 60 kDa [Carnobacterium sp. AT7...   291    3e-77 
ref|XP_002295556.1|  mitochondrial chaperonin [Thalassiosira p...   291    3e-77  Gene info
emb|CAM32690.2|  chaperonin GroEL (HSP60 family) protein [Herb...   291    3e-77 
ref|ZP_01116966.1|  chaperonin GroEL [Polaribacter irgensii 23...   291    3e-77 
gb|AAN32669.1|AF417582_2  GroEL [Enterococcus faecium]              291    3e-77 
ref|ZP_01896004.1|  Chaperonin GroEL (HSP60 family) protein [M...   291    3e-77 
sp|Q8VT58.1|CH60_STRGN  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-77 
ref|ZP_00604407.1|  Chaperonin Cpn60/TCP-1 [Enterococcus faeci...   291    3e-77 
gb|AAQ84338.1|  GroEL [Enterococcus faecium]                        291    4e-77 
ref|YP_393145.1|  chaperonin GroEL [Sulfurimonas denitrificans...   291    4e-77  Gene info
ref|YP_446228.1|  chaperonin GroEL [Salinibacter ruber DSM 138...   291    4e-77  Gene info
sp|P81284.3|CH60_BACFO  RecName: Full=60 kDa chaperonin; AltNa...   291    4e-77 
sp|Q8KJ20.1|CH60_STRAP  RecName: Full=60 kDa chaperonin; AltNa...   291    4e-77 
ref|ZP_05108023.1|  TCP-1/cpn60 chaperonin family protein [Pol...   291    4e-77 
ref|ZP_05503846.1|  chaperonin [Enterococcus faecalis T3] >gb|...   291    4e-77 
ref|YP_001156582.1|  chaperonin GroEL [Polynucleobacter necess...   291    4e-77  Gene info
ref|YP_002886489.1|  chaperonin GroEL [Exiguobacterium sp. AT1...   291    4e-77  Gene info
sp|Q8KJ18.1|CH60_STRCV  RecName: Full=60 kDa chaperonin; AltNa...   291    4e-77 
ref|NP_816272.1|  chaperonin, 60 kDa [Enterococcus faecalis V5...   291    5e-77  Gene info
ref|YP_797549.1|  chaperonin GroEL [Leptospira borgpetersenii ...   291    5e-77  Gene info
ref|ZP_06027144.1|  60 kDa chaperonin GROEL [Fusobacterium per...   291    5e-77 
emb|CAC86955.1|  GroEL protein [Buchnera sp.]                       291    5e-77 
gb|EEY58953.1|  chaperonin CPN60-1, mitochondrial precursor [P...   291    5e-77 
ref|ZP_05712441.1|  chaperonin, 60 kDa [Enterococcus faecium DO]    290    5e-77 
ref|YP_002314581.1|  chaperonin GroEL [Anoxybacillus flavither...   290    5e-77  Gene info
gb|ABE86688.1|  GroEL-like chaperone, ATPase [Medicago truncat...   290    5e-77 
ref|YP_553745.1|  chaperonin GroEL [Burkholderia xenovorans LB...   290    5e-77  Gene info
ref|YP_146102.1|  chaperonin GroEL [Geobacillus kaustophilus H...   290    5e-77  Gene info
ref|ZP_06288337.1|  chaperonin GroL [Prevotella timonensis CRI...   290    5e-77 
sp|Q9WWL4.1|CH60_METSS  RecName: Full=60 kDa chaperonin; AltNa...   290    6e-77 
ref|ZP_04443207.1|  chaperonin GroEL [Listeria grayi DSM 20601...   290    6e-77 
ref|ZP_04394322.1|  chaperonin GroEL [Geobacillus sp. Y412MC52...   290    6e-77 
ref|XP_002299295.1|  predicted protein [Populus trichocarpa] >...   290    6e-77  UniGene infoGene info
emb|CAA73778.1|  heat shock protein [Campylobacter jejuni]          290    6e-77 
gb|ABX57777.1|  GroEL [Streptococcus gallolyticus subsp. gallo...   290    6e-77 
gb|AAM73642.1|AF389514_2  GroEL [Streptococcus equinus]             290    6e-77 
ref|ZP_05244447.1|  chaperonin GroEL [Listeria monocytogenes F...   290    6e-77 
gb|ABC26732.1|  GroEL [Streptococcus pasteurianus]                  290    6e-77 
gb|ABX57779.1|  GroEL [Streptococcus gallolyticus subsp. gallo...   290    6e-77 
ref|YP_850286.1|  chaperonin GroEL [Listeria welshimeri serova...   290    6e-77  Gene info
ref|ZP_02371578.1|  chaperonin GroEL [Burkholderia thailandens...   290    7e-77 
gb|ABX57787.1|  GroEL [Streptococcus pasteurianus] >gb|ABX5778...   290    7e-77 
ref|YP_001408485.1|  chaperonin GroEL [Campylobacter curvus 52...   290    7e-77  Gene info
ref|ZP_06372295.1|  co-chaperonin GroEL [Campylobacter jejuni ...   290    7e-77 
ref|YP_002349461.1|  chaperonin GroL [Listeria monocytogenes H...   290    7e-77  Gene info
ref|NP_465592.1|  chaperonin GroEL [Listeria monocytogenes EGD...   290    7e-77  Gene info
ref|NP_689060.1|  chaperonin GroEL [Streptococcus agalactiae 2...   290    7e-77  Gene info
gb|ABX76300.1|  heat shock protein 60 [Ageratina adenophora]        290    7e-77 
ref|YP_001124352.1|  chaperonin GroEL [Geobacillus thermodenit...   290    7e-77  Gene info
ref|NP_840129.1|  chaperonin GroEL [Nitrosomonas europaea ATCC...   290    7e-77  Gene info
ref|ZP_00781018.1|  60 kDa chaperonin (Protein Cpn60) (groEL p...   290    7e-77 
ref|ZP_03212460.1|  chaperonin GroEL [Lactobacillus rhamnosus ...   290    7e-77 
ref|NP_471507.1|  chaperonin GroEL [Listeria innocua Clip11262...   290    7e-77  Gene info
ref|ZP_02182099.1|  hypothetical protein FBALC1_03897 [Flavoba...   290    7e-77 
gb|AAN32677.1|AF417586_2  GroEL [Enterococcus hirae]                290    8e-77 
ref|ZP_04581432.1|  chaperonin GroEL [Helicobacter bilis ATCC ...   290    8e-77 
ref|YP_003009817.1|  chaperonin GroEL [Paenibacillus sp. JDR-2...   290    8e-77  Gene info
ref|YP_394972.1|  chaperonin GroEL [Lactobacillus sakei subsp....   290    8e-77  Gene info
dbj|BAA88110.1|  Cpn60 [Bacillus sp. MS]                            290    8e-77 
ref|YP_001373613.1|  chaperonin GroEL [Bacillus cereus subsp. ...   290    8e-77  Gene info
ref|YP_001299.1|  chaperonin GroEL [Leptospira interrogans ser...   290    9e-77  Gene info
gb|ABW80157.1|  GroEL [Streptococcus sinensis]                      290    9e-77 
ref|YP_002948428.1|  chaperonin GroEL [Geobacillus sp. WCH70] ...   290    9e-77  Gene info
dbj|BAA04222.1|  heat shock protein 60 (GroEL) like protein [P...   290    9e-77 
gb|AAM73644.1|AF389515_2  GroEL [Streptococcus intermedius]         290    1e-76 
gb|AAM73648.1|AF389517_2  GroEL [Streptococcus salivarius]          290    1e-76 
ref|ZP_02358074.1|  chaperonin GroEL [Burkholderia oklahomensi...   290    1e-76 
ref|ZP_02378734.1|  chaperonin GroEL [Burkholderia ubonensis Bu]    290    1e-76 
ref|YP_001818937.1|  chaperonin GroEL [Opitutus terrae PB90-1]...   290    1e-76  Gene info
ref|ZP_04207347.1|  60 kDa chaperonin 2 [Bacillus cereus Rock4...   290    1e-76 
gb|AAR00653.1|  GroEL [Vagococcus fluvialis]                        290    1e-76 
ref|YP_002443789.1|  chaperonin GroL [Bacillus cereus G9842] >...   290    1e-76  Gene info
ref|NP_830146.1|  chaperonin GroEL [Bacillus cereus ATCC 14579...   290    1e-76  Gene info
ref|ZP_03233630.1|  chaperonin GroL [Bacillus cereus AH1134] >...   289    1e-76 
ref|ZP_06287146.1|  chaperonin GroL [Prevotella buccalis ATCC ...   289    1e-76 
ref|ZP_04582952.1|  heat shock protein [Helicobacter winghamen...   289    1e-76 
ref|ZP_03108403.1|  chaperonin GroL [Bacillus cereus NVH0597-9...   289    1e-76 
ref|NP_906559.1|  chaperonin GroEL [Wolinella succinogenes DSM...   289    1e-76  Gene info
ref|ZP_00784141.1|  chaperonin, 60 kDa [Streptococcus agalacti...   289    1e-76 
ref|ZP_00238220.1|  chaperonin, 60 kDa [Bacillus cereus G9241]...   289    1e-76 
ref|ZP_04172647.1|  60 kDa chaperonin 2 [Bacillus cereus AH127...   289    1e-76 
ref|ZP_04287441.1|  60 kDa chaperonin 2 [Bacillus cereus R3098...   289    1e-76 
gb|AAR00651.1|  GroEL [Enterococcus cecorum]                        289    1e-76 
gb|AAY83367.1|  HSP60 [Streptococcus criceti]                       289    1e-76 
ref|NP_842820.1|  chaperonin GroEL [Bacillus anthracis str. Am...   289    1e-76  Gene info
ref|ZP_00741141.1|  60 kDa chaperonin GROEL [Bacillus thuringi...   289    1e-76 
ref|ZP_05186513.1|  chaperonin GroEL [Bacillus anthracis str. ...   289    1e-76 
ref|YP_034593.1|  chaperonin GroEL [Bacillus thuringiensis ser...   289    1e-76  Gene info
gb|ACZ33115.1|  chaperonin GroL [Chlamydophila pneumoniae LPCoLN]   289    2e-76 
sp|Q07201.1|CH60_BACST  RecName: Full=60 kDa chaperonin; AltNa...   289    2e-76 
ref|ZP_03724331.1|  chaperonin GroEL [Opitutaceae bacterium TA...   289    2e-76 
ref|ZP_04143722.1|  60 kDa chaperonin 2 [Bacillus thuringiensi...   289    2e-76 
ref|NP_224342.1|  chaperonin GroEL [Chlamydophila pneumoniae C...   289    2e-76  Gene info
gb|EER17512.1|  heat shock protein 60, putative [Perkinsus mar...   289    2e-76 
sp|Q05046.1|CH62_CUCMA  RecName: Full=Chaperonin CPN60-2, mito...   289    2e-76 
ref|ZP_04195528.1|  60 kDa chaperonin 2 [Bacillus cereus AH603...   289    2e-76 
gb|EEQ98399.1|  heat shock protein 60, putative [Perkinsus mar...   289    2e-76 
ref|ZP_01625201.1|  chaperonin, 60 kDa [marine gamma proteobac...   289    2e-76 
gb|AAA23126.1|  putative GroEL protein [Chlamydophila pneumoniae]   289    2e-76 
ref|YP_555410.1|  chaperonin GroEL [Burkholderia xenovorans LB...   289    2e-76  Gene info
ref|ZP_00370618.1|  chaperonin, 60 kDa [Campylobacter upsalien...   289    2e-76 
ref|ZP_06233052.1|  chaperonin GroEL [Desulfovibrio aespoeensi...   288    2e-76 
ref|XP_002303091.1|  predicted protein [Populus trichocarpa] >...   288    2e-76  UniGene infoGene info
ref|ZP_00789170.1|  chaperonin, 60 kDa [Streptococcus agalacti...   288    2e-76 
ref|YP_827953.1|  chaperonin GroEL [Solibacter usitatus Ellin6...   288    2e-76  Gene info
ref|NP_976617.1|  chaperonin family protein [Bacillus cereus A...   288    2e-76  Gene info
ref|NP_736462.1|  chaperonin GroEL [Streptococcus agalactiae N...   288    2e-76  Gene info
ref|ZP_04834845.1|  chaperonin GroL [Prevotella melaninogenica...   288    2e-76 
gb|EER09914.1|  heat shock protein 60, putative [Perkinsus mar...   288    2e-76 
ref|YP_001643142.1|  chaperonin GroEL [Bacillus weihenstephane...   288    2e-76  Gene info
gb|EFC72282.1|  chaperonin GroL [Prevotella melaninogenica D18]     288    3e-76 
ref|YP_001839711.1|  Hsp60 family GroEL protein [Leptospira bi...   288    3e-76  Gene info
gb|AAL04033.1|AF335185_2  GroEL [Enterococcus faecalis]             288    3e-76 
gb|AAZ08337.1|  GroEL [Streptococcus mutans]                        288    3e-76 
gb|ABY81909.1|  mitochondrial cpn60 [Sawyeria marylandensis]        288    3e-76 
ref|ZP_05918235.1|  chaperone GroEL [Prevotella sp. oral taxon...   288    3e-76 
ref|ZP_03054480.1|  chaperonin GroL [Bacillus pumilus ATCC 706...   288    3e-76 
ref|YP_001485790.1|  chaperonin GroEL [Bacillus pumilus SAFR-0...   288    3e-76  Gene info
ref|YP_440132.1|  chaperonin GroEL [Burkholderia thailandensis...   288    3e-76  Gene info
ref|ZP_00390655.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   288    3e-76 
ref|NP_603572.1|  60 kDa chaperonin GROEL [Fusobacterium nucle...   288    3e-76  Gene info
ref|ZP_02328908.1|  chaperonin GroEL [Paenibacillus larvae sub...   288    3e-76 
sp|Q8VV84.1|CH60_BACTR  RecName: Full=60 kDa chaperonin; AltNa...   288    3e-76 
gb|EER15265.1|  heat shock protein 60, putative [Perkinsus mar...   288    3e-76 
ref|ZP_02887259.1|  chaperonin GroEL [Burkholderia graminis C4...   288    3e-76 
ref|ZP_06007251.1|  chaperone GroEL [Prevotella bergensis DSM ...   288    3e-76 
gb|AAZ08339.1|  GroEL [Streptococcus mutans]                        288    3e-76 
ref|XP_002285608.1|  PREDICTED: similar to GroEL-like chaperon...   288    3e-76  UniGene infoGene info
gb|ABR28463.1|  chaperonin GroEL [Bacillus megaterium]              288    3e-76 
gb|AAM73646.1|AF389516_2  GroEL [Streptococcus mutans]              288    4e-76 
ref|XP_002518171.1|  chaperonin-60kD, ch60, putative [Ricinus ...   288    4e-76  Gene info
gb|AAZ08343.1|  GroEL [Streptococcus downei]                        288    4e-76 
ref|ZP_04155294.1|  60 kDa chaperonin 2 [Bacillus mycoides Roc...   288    4e-76 
gb|AAZ08335.1|  GroEL [Streptococcus sobrinus]                      288    4e-76 
gb|AAZ08341.1|  GroEL [Streptococcus sobrinus]                      288    4e-76 
ref|ZP_04215879.1|  60 kDa chaperonin 2 [Bacillus cereus Rock3...   288    4e-76 
ref|YP_444383.1|  chaperonin GroEL [Salinibacter ruber DSM 138...   288    4e-76  Gene info
ref|ZP_04061166.1|  chaperonin GroL [Streptococcus salivarius ...   288    4e-76 
ref|NP_722255.1|  chaperonin GroEL [Streptococcus mutans UA159...   288    4e-76  Gene info
ref|ZP_02385468.1|  chaperonin GroEL [Burkholderia thailandens...   288    4e-76 
ref|ZP_06244150.1|  chaperonin GroEL [Victivallis vadensis ATC...   288    4e-76 
gb|ABD93984.1|  60 kDa heat shock protein [Rickettsia helvetica]    288    4e-76 
ref|YP_959298.1|  chaperonin GroEL [Marinobacter aquaeolei VT8...   287    4e-76  Gene info
ref|YP_003372246.1|  chaperonin GroEL [Pirellula staleyi DSM 6...   287    4e-76  Gene info
ref|ZP_03951551.1|  chaperonin GroEL [Lactobacillus gasseri JV...   287    4e-76 
gb|AAN63805.1|  heat shock protein 60 [Prunus dulcis]               287    5e-76 
gb|AAZ08333.1|  GroEL [Streptococcus ratti]                         287    5e-76 
gb|ABE86687.1|  GroEL-like chaperone, ATPase [Medicago truncat...   287    5e-76 
ref|ZP_02465716.1|  chaperonin GroEL [Burkholderia thailandens...   287    5e-76 
ref|YP_001034236.1|  chaperonin GroEL [Streptococcus sanguinis...   287    5e-76  Gene info
ref|YP_777152.1|  chaperonin GroEL [Burkholderia ambifaria AMM...   287    5e-76  Gene info
sp|Q9AME7.1|CH60_STRAG  RecName: Full=60 kDa chaperonin; AltNa...   287    5e-76 
gb|AAG44815.1|AF274871_2  GroEL [Geobacillus stearothermophilus]    287    6e-76 
ref|ZP_06010892.1|  chaperonin GroL [Leptotrichia goodfellowii...   287    6e-76 
gb|ABE01070.1|  60 kDa chaperonin [Lactobacillus salivarius]        287    7e-76 
gb|ABE01071.1|  60 kDa chaperonin [Lactobacillus salivarius]        287    7e-76 
gb|ABE01063.1|  60 kDa chaperonin [Lactobacillus salivarius]        287    7e-76 
ref|ZP_03656153.1|  chaperonin GroEL [Helicobacter canadensis ...   287    7e-76 
emb|CAA50446.1|  groEL [Lactococcus lactis]                         287    7e-76 
gb|ABY86689.1|  chaperonin GroEL2 [Sorangium cellulosum]            287    7e-76 
ref|ZP_02435287.1|  hypothetical protein BACSTE_01530 [Bactero...   287    7e-76 
ref|ZP_05362709.1|  chaperonin GroL [Campylobacter showae RM32...   287    7e-76 
ref|YP_002745626.1|  60 kDa chaperonin [Streptococcus equi sub...   286    8e-76  Gene info
gb|ABE01076.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    8e-76 
ref|YP_001003906.1|  chaperonin GroEL [Halorhodospira halophil...   286    8e-76  Gene info
gb|ABE01057.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   286    8e-76 
gb|ABE01073.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    8e-76 
ref|YP_002122537.1|  chaperonin GroEL [Streptococcus equi subs...   286    8e-76  Gene info
gb|ABE01064.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    8e-76 
gb|EFC69121.1|  chaperonin GroL [Prevotella sp. oral taxon 317...   286    8e-76 
ref|YP_077851.1|  chaperonin GroEL [Bacillus licheniformis ATC...   286    8e-76  Gene info
ref|ZP_01736024.1|  chaperonin GroEL [Marinobacter sp. ELB17] ...   286    8e-76 
gb|ABE01074.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    8e-76 
gb|ABE01072.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   286    8e-76 
gb|ABE01056.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    8e-76 
gb|ABE01052.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   286    8e-76 
emb|CAA77646.1|  chaperonin hsp60 [Arabidopsis thaliana]            286    8e-76 
ref|NP_189041.1|  HSP60 (HEAT SHOCK PROTEIN 60); ATP binding [...   286    8e-76  UniGene infoGene info
ref|XP_001762115.1|  predicted protein [Physcomitrella patens ...   286    9e-76  UniGene infoGene info
gb|ABE01068.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    9e-76 
ref|ZP_04184254.1|  60 kDa chaperonin 2 [Bacillus cereus AH127...   286    9e-76 
ref|ZP_04808179.1|  chaperonin [Helicobacter pullorum MIT 98-5...   286    9e-76 
ref|YP_807425.1|  chaperonin GroEL [Lactobacillus casei ATCC 3...   286    9e-76  Gene info
ref|ZP_02926970.1|  chaperonin GroEL [Verrucomicrobium spinosu...   286    9e-76 
ref|ZP_01962179.1|  hypothetical protein BACCAC_03829 [Bactero...   286    1e-75 
ref|XP_001772410.1|  predicted protein [Physcomitrella patens ...   286    1e-75  UniGene infoGene info
ref|ZP_05550433.1|  chaperonin GroL [Fusobacterium sp. 3_1_36A...   286    1e-75 
ref|NP_850203.1|  HSP60-2 (HEAT SHOCK PROTEIN 60-2); ATP bindi...   286    1e-75  UniGene infoGene info
sp|P26209.1|CH60_BACP3  RecName: Full=60 kDa chaperonin; AltNa...   286    1e-75 
gb|AAT76679.1|  GroEL [Lactobacillus paracasei subsp. paracasei]    286    1e-75 
ref|YP_878933.1|  chaperonin GroEL [Clostridium novyi NT] >sp|...   286    1e-75  Gene info
ref|YP_001466610.1|  chaperonin GroEL [Campylobacter concisus ...   286    1e-75  Gene info
ref|XP_001760735.1|  predicted protein [Physcomitrella patens ...   286    1e-75  UniGene infoGene info
ref|ZP_04678303.1|  chaperonin GroL [Staphylococcus warneri L3...   286    1e-75 
ref|NP_222730.1|  chaperonin GroEL [Helicobacter pylori J99] >...   286    1e-75  Gene info
sp|Q93GW2.1|CH60_WOLRE  RecName: Full=60 kDa chaperonin; AltNa...   286    1e-75 
ref|ZP_04575202.1|  hsp60-like protein [Fusobacterium sp. 7_1]...   286    1e-75 
ref|ZP_05373801.1|  chaperonin GroEL [Geobacillus sp. Y4.1MC1]...   286    1e-75 
ref|ZP_04572130.1|  hsp60-like protein [Fusobacterium sp. 4_1_...   286    1e-75 
ref|ZP_04149421.1|  60 kDa chaperonin 2 [Bacillus pseudomycoid...   286    1e-75 
ref|YP_002753839.1|  chaperonin GroEL [Acidobacterium capsulat...   286    1e-75  Gene info
ref|YP_001909507.1|  chaperonin GroEL [Helicobacter pylori Shi...   286    1e-75  Gene info
ref|YP_626751.1|  chaperonin GroEL [Helicobacter pylori HPAG1]...   286    1e-75  Gene info
ref|NP_206812.1|  chaperonin GroEL [Helicobacter pylori 26695]...   286    1e-75  Gene info
ref|YP_002743690.1|  60 kDa chaperonin [Streptococcus equi sub...   286    1e-75  Gene info
ref|ZP_03610423.1|  chaperonin GroL [Campylobacter rectus RM32...   286    1e-75 
ref|ZP_03492536.1|  chaperonin GroEL [Alicyclobacillus acidoca...   286    1e-75 
ref|YP_003309277.1|  chaperonin GroEL [Sebaldella termitidis A...   286    1e-75  Gene info
ref|ZP_03437257.1|  hypothetical protein HPB128_155g66 [Helico...   286    1e-75 
ref|YP_002265651.1|  chaperone and heatshock protein [Helicoba...   286    1e-75  Gene info
gb|ABE01055.1|  60 kDa chaperonin [Lactobacillus salivarius]        286    1e-75 
ref|NP_691577.1|  chaperonin GroEL [Oceanobacillus iheyensis H...   286    1e-75  Gene info
gb|ABE01059.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   286    1e-75 
gb|ACX97231.1|  chaperone and heat shock protein [Helicobacter...   286    1e-75 
ref|YP_001940827.1|  Chaperonin GroEL (HSP60 family) [Methylac...   286    1e-75  Gene info
ref|ZP_04008996.1|  chaperonin GroEL [Lactobacillus salivarius...   286    1e-75 
gb|ABE01058.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   286    1e-75 
ref|YP_003183828.1|  chaperonin GroEL [Alicyclobacillus acidoc...   286    1e-75  Gene info
gb|ACX98646.1|  chaperonin GroEL [Helicobacter pylori 52]           286    1e-75 
emb|CAA52062.1|  heat shock protein 60 [Helicobacter pylori]        286    1e-75 
ref|YP_220012.1|  chaperonin GroEL [Chlamydophila abortus S26/...   286    1e-75  Gene info
ref|ZP_05695961.1|  chaperonin GroEL [Staphylococcus aureus A6...   286    1e-75 
ref|YP_002300648.1|  chaperone and heat shock protein [Helicob...   286    2e-75  Gene info
gb|AAL56001.1|AF325451_2  GroEL [Staphylococcus aureus]             286    2e-75 
gb|AAL56002.1|AF325452_1  GroEL [Staphylococcus aureus RN4220]      286    2e-75 
ref|ZP_05056201.1|  chaperonin GroL [Verrucomicrobiae bacteriu...   286    2e-75 
ref|YP_002563013.1|  60 kDa chaperonin [Streptococcus uberis 0...   286    2e-75  Gene info
gb|ADC38181.1|  Heat shock protein 60 family chaperone GroEL [...   286    2e-75 
gb|AAY17356.1|  GroEL [Bacteroides fragilis]                        286    2e-75 
ref|XP_001419890.1|  chaperonin 60, mitochondrial [Ostreococcu...   286    2e-75  Gene info
ref|XP_002521151.1|  chaperonin-60kD, ch60, putative [Ricinus ...   285    2e-75  Gene info
ref|ZP_03240834.1|  chaperonin GroEL [Helicobacter pylori HPKX...   285    2e-75 
ref|YP_814252.1|  chaperonin GroEL [Lactobacillus gasseri ATCC...   285    2e-75  Gene info
ref|ZP_05353481.1|  chaperonin GroEL [Chlamydia trachomatis 62...   285    2e-75 
ref|ZP_04842640.1|  chaperonin GroEL [Bacteroides sp. 3_2_5] >...   285    2e-75 
ref|ZP_05857674.1|  chaperonin GroL [Prevotella veroralis F031...   285    2e-75 
ref|ZP_04645898.1|  chaperonin GroL [Lactobacillus jensenii 26...   285    2e-75 
ref|YP_100673.1|  chaperonin GroEL [Bacteroides fragilis YCH46...   285    2e-75  Gene info
ref|NP_296764.1|  chaperonin GroEL [Chlamydia muridarum Nigg] ...   285    2e-75  Gene info
ref|ZP_03955567.1|  chaperonin GroEL [Lactobacillus jensenii J...   285    2e-75 
ref|YP_515282.1|  chaperonin GroEL [Chlamydophila felis Fe/C-5...   285    2e-75  Gene info
ref|YP_327911.1|  chaperonin GroEL [Chlamydia trachomatis A/HA...   285    2e-75  Gene info
emb|CAQ50454.1|  chaperonin GroL [Staphylococcus aureus subsp....   285    2e-75 
ref|ZP_05700389.1|  chaperonin GroL [Staphylococcus aureus A59...   285    2e-75 
ref|ZP_04854153.1|  chaperonin GroL [Paenibacillus sp. oral ta...   285    2e-75 
ref|YP_002997735.1|  chaperonin [Streptococcus dysgalactiae su...   285    2e-75  Gene info
ref|ZP_04838232.1|  chaperonin GroEL [Staphylococcus aureus su...   285    2e-75 
ref|ZP_03225174.1|  chaperonin GroEL [Bacillus coahuilensis m4-4]   285    2e-75 
ref|YP_003292626.1|  60 kDa chaperonin [Lactobacillus johnsoni...   285    2e-75  Gene info
ref|YP_002433392.1|  chaperonin GroEL [Desulfatibacillum alken...   285    2e-75  Gene info
gb|ABY86694.1|  chaperonin GroEL2 [Sorangium cellulosum]            285    2e-75 
ref|YP_003282932.1|  chaperonin GroEL [Staphylococcus aureus s...   285    2e-75  Gene info
ref|ZP_03562187.1|  chaperonin GroEL [Staphylococcus aureus su...   285    2e-75 
ref|YP_001815231.1|  chaperonin GroEL [Exiguobacterium sibiric...   285    2e-75  Gene info
ref|ZP_06344084.1|  60 kDa chaperonin [Staphylococcus aureus s...   285    2e-75 
gb|AAA19871.1|  heat shock protein [Chlamydia muridarum]            285    2e-75 
ref|ZP_02620680.1|  chaperonin GroL [Clostridium botulinum C s...   285    2e-75 
ref|ZP_05283008.1|  chaperonin GroEL [Bacteroides fragilis 3_1...   285    2e-75 
ref|YP_186835.1|  chaperonin GroEL [Staphylococcus aureus subs...   285    2e-75  Gene info
ref|NP_372553.1|  chaperonin GroEL [Staphylococcus aureus subs...   285    2e-75  Gene info
ref|ZP_06298809.1|  Chaperonin GroEL [Parachlamydia acanthamoe...   285    2e-75 
ref|ZP_05736290.1|  chaperonin GroL [Prevotella tannerae ATCC ...   285    2e-75 
ref|ZP_06325129.1|  chaperonin GroL [Staphylococcus aureus sub...   285    3e-75 
ref|YP_417372.1|  chaperonin GroEL [Staphylococcus aureus RF12...   285    3e-75  Gene info
ref|YP_041479.1|  chaperonin GroEL [Staphylococcus aureus subs...   285    3e-75  Gene info
ref|NP_219613.1|  chaperonin GroEL [Chlamydia trachomatis D/UW...   285    3e-75  Gene info
gb|EFC75504.1|  chaperonin GroL [Prevotella buccae D17]             285    3e-75 
emb|CAH04305.1|  HSP60-1 protein [Chlamydia trachomatis]            285    3e-75 
ref|NP_829507.1|  chaperonin GroEL [Chlamydophila caviae GPIC]...   285    3e-75  Gene info
prf||1906220B  groEL gene                                           285    3e-75 
ref|XP_001783814.1|  predicted protein [Physcomitrella patens ...   285    3e-75  UniGene infoGene info
ref|ZP_04971028.1|  chaperonin GroEL [Fusobacterium nucleatum ...   285    3e-75 
ref|XP_001840101.1|  hypothetical protein CC1G_02564 [Coprinop...   285    3e-75  Gene info
ref|YP_003163748.1|  chaperonin GroEL [Leptotrichia buccalis D...   285    3e-75  Gene info
ref|ZP_03459060.1|  hypothetical protein BACEGG_01844 [Bactero...   285    3e-75 
gb|AAR00649.1|  GroEL [Enterococcus mundtii]                        285    3e-75 
ref|ZP_03681157.1|  hypothetical protein BACCELL_05532 [Bacter...   285    4e-75 
ref|YP_001420264.1|  chaperonin GroEL [Bacillus amyloliquefaci...   284    4e-75  Gene info
ref|NP_388484.1|  chaperonin GroEL [Bacillus subtilis subsp. s...   284    4e-75  Gene info
ref|ZP_02950682.1|  chaperonin GroL [Clostridium butyricum 552...   284    4e-75 
sp|Q8KJ24.1|CH60_CLOBO  RecName: Full=60 kDa chaperonin; AltNa...   284    4e-75 
gb|ABE01049.1|  60 kDa chaperonin [Lactobacillus salivarius] >...   284    4e-75 
ref|ZP_05413910.1|  chaperonin GroL [Bacteroides finegoldii DS...   284    4e-75 
ref|XP_001242382.1|  heat shock protein 60, mitochondrial prec...   284    4e-75  Gene info
gb|ABE01048.1|  60 kDa chaperonin [Lactobacillus salivarius]        284    4e-75 
ref|ZP_03015621.1|  hypothetical protein BACINT_03212 [Bactero...   284    4e-75 
gb|ABO16621.1|  GroEL [Methanohalophilus portucalensis FDF-1]       284    4e-75 
ref|YP_536102.1|  chaperonin GroEL [Lactobacillus salivarius U...   284    5e-75  Gene info
ref|NP_810742.1|  chaperonin GroEL [Bacteroides thetaiotaomicr...   284    5e-75  Gene info
ref|YP_003192725.1|  chaperonin GroEL [Desulfotomaculum acetox...   284    5e-75  Gene info
gb|AAK71886.1|  GroEL [Streptococcus oralis ATCC 35037]             284    5e-75 
ref|NP_964487.1|  chaperonin GroEL [Lactobacillus johnsonii NC...   284    5e-75  Gene info
ref|YP_001074682.1|  chaperonin GroEL [Burkholderia pseudomall...   284    6e-75  Gene info
ref|ZP_04061026.1|  chaperonin GroL [Staphylococcus hominis SK...   284    6e-75 
ref|YP_002561113.1|  chaperonin GroEL protein [Macrococcus cas...   284    6e-75  Gene info
gb|AAN32683.1|AF417589_2  GroEL [Streptococcus mitis]               284    6e-75 
ref|YP_001061737.1|  chaperonin GroEL [Burkholderia pseudomall...   284    6e-75  Gene info
ref|YP_001695268.1|  chaperonin GroL [Streptococcus pneumoniae...   284    6e-75  Gene info
ref|NP_925843.1|  chaperonin GroEL [Gloeobacter violaceus PCC ...   284    6e-75  Gene info
ref|ZP_02458585.1|  chaperonin GroEL [Burkholderia pseudomalle...   284    6e-75 
ref|ZP_02405804.1|  chaperonin GroEL [Burkholderia pseudomalle...   284    6e-75 
ref|NP_346336.1|  chaperonin GroEL [Streptococcus pneumoniae T...   284    6e-75  Gene info
gb|ABY86690.1|  chaperonin GroEL2 [Sorangium cellulosum]            283    6e-75 
ref|ZP_01829178.1|  chaperonin GroEL [Streptococcus pneumoniae...   283    6e-75 
ref|ZP_06198429.1|  chaperonin, 60 kDa [Streptococcus sp. M143...   283    6e-75 
ref|ZP_02716261.1|  chaperonin GroL [Streptococcus pneumoniae ...   283    7e-75 
emb|CAM35538.1|  GroEL protein [Pseudomonas fluorescens]            283    7e-75 
ref|ZP_04006524.1|  chaperonin GroEL protein [Lactobacillus jo...   283    7e-75 
ref|ZP_04891992.1|  chaperonin GroL [Burkholderia pseudomallei...   283    7e-75 
ref|YP_002457898.1|  chaperonin GroEL [Desulfitobacterium hafn...   283    7e-75  Gene info
ref|ZP_01833538.1|  chaperonin GroEL [Streptococcus pneumoniae...   283    8e-75 
ref|ZP_05899226.1|  chaperonin GroL [Selenomonas sputigena ATC...   283    8e-75 
ref|ZP_02067564.1|  hypothetical protein BACOVA_04572 [Bactero...   283    8e-75 
ref|YP_001129237.1|  chaperonin GroEL [Streptococcus pyogenes ...   283    8e-75  Gene info
ref|NP_270006.1|  chaperonin GroEL [Streptococcus pyogenes M1 ...   283    8e-75  Gene info
ref|YP_599438.2|  chaperonin GroEL [Streptococcus pyogenes MGA...   283    8e-75  Gene info
ref|YP_500736.1|  chaperonin GroEL [Staphylococcus aureus subs...   283    8e-75  Gene info
ref|NP_608082.1|  chaperonin GroEL [Streptococcus pyogenes MGA...   283    8e-75  Gene info
ref|ZP_02492764.1|  chaperonin GroEL [Burkholderia pseudomalle...   283    8e-75 
ref|ZP_02414319.1|  chaperonin GroEL [Burkholderia pseudomalle...   283    8e-75 
ref|YP_110499.1|  chaperonin GroEL [Burkholderia pseudomallei ...   283    8e-75  Gene info
sp|Q1J9G4.1|CH60_STRPB  RecName: Full=60 kDa chaperonin; AltNa...   283    8e-75 
ref|XP_001731319.1|  hypothetical protein MGL_1502 [Malassezia...   283    8e-75  Gene info
ref|ZP_00365789.1|  COG0459: Chaperonin GroEL (HSP60 family) [...   283    8e-75 
sp|Q1JEL5.1|CH60_STRPD  RecName: Full=60 kDa chaperonin; AltNa...   283    9e-75 
ref|XP_001880247.1|  predicted protein [Laccaria bicolor S238N...   283    9e-75  Gene info
ref|NP_665569.1|  chaperonin GroEL [Streptococcus pyogenes MGA...   283    9e-75  Gene info
ref|ZP_04544279.1|  chaperonin GroEL [Bacteroides sp. D1] >ref...   283    9e-75 
ref|YP_001406156.1|  chaperonin GroEL [Campylobacter hominis A...   283    9e-75  Gene info
ref|XP_001539356.1|  heat shock protein 60, mitochondrial prec...   283    9e-75  Gene info
gb|ABQ28587.1|  GroEL [Francisella philomiragia]                    283    1e-74 
ref|XP_001017291.2|  TCP-1/cpn60 chaperonin family protein [Te...   283    1e-74  UniGene infoGene info
ref|ZP_04431622.1|  chaperonin GroEL [Bacillus coagulans 36D1]...   283    1e-74 
ref|ZP_03752956.1|  hypothetical protein ROSEINA2194_01367 [Ro...   283    1e-74 
ref|YP_252917.1|  chaperonin GroEL [Staphylococcus haemolyticu...   283    1e-74  Gene info
ref|YP_003024200.1|  60 kDa chaperonin [Streptococcus suis SC8...   283    1e-74  Gene info
emb|CAJ72961.1|  stronlgy similar to 60 kDa chaperonin (GroEL ...   283    1e-74 
ref|ZP_01723652.1|  chaperonin GroEL [Bacillus sp. B14905] >gb...   283    1e-74 
gb|ABQ28584.1|  GroEL [Francisella philomiragia] >gb|ABQ28586....   283    1e-74 
gb|ABQ28585.1|  GroEL [Francisella philomiragia]                    283    1e-74 
ref|ZP_06196947.1|  chaperonin GroL [Pediococcus acidilactici ...   283    1e-74 
gb|ABS19996.1|  GroEL [Francisella noatunensis subsp. noatunen...   283    1e-74 
ref|YP_002634630.1|  GroEL protein [Staphylococcus carnosus su...   283    1e-74  Gene info
ref|YP_619403.1|  chaperonin GroEL [Lactobacillus delbrueckii ...   283    1e-74  Gene info
ref|XP_002171843.1|  heat shock protein [Schizosaccharomyces j...   282    1e-74  Gene info
gb|ACL52466.1|  unknown [Zea mays]                                  282    1e-74 
ref|YP_001197518.1|  putative chaperonin GroEL [Streptococcus ...   282    2e-74  Gene info
ref|XP_002544588.1|  chaperonin GroL [Uncinocarpus reesii 1704...   282    2e-74  Gene info
ref|YP_803959.1|  chaperonin GroEL [Pediococcus pentosaceus AT...   282    2e-74  Gene info
ref|ZP_02426228.1|  hypothetical protein ALIPUT_02392 [Alistip...   282    2e-74 
gb|EER40487.1|  hsp60-like protein [Ajellomyces capsulatus H143]    282    2e-74 
gb|ABY86692.1|  chaperonin GroEL2 [Sorangium cellulosum]            282    2e-74 
ref|NP_757486.1|  chaperonin GroEL [Mycoplasma penetrans HF-2]...   282    2e-74  Gene info
gb|EEH02929.1|  hsp60-like protein [Ajellomyces capsulatus G18...   282    2e-74 
ref|ZP_05744216.1|  chaperone GroEL [Lactobacillus iners DSM 1...   282    2e-74 
ref|ZP_01769661.1|  chaperonin GroL [Burkholderia pseudomallei...   282    2e-74 
sp|P29185.2|CH61_MAIZE  RecName: Full=Chaperonin CPN60-1, mito...   282    2e-74  Gene info
ref|XP_001385888.1|  hypothetical protein PICST_90190 [Pichia ...   282    2e-74  Gene info
ref|NP_001105690.1|  mitochondrial chaperonin 60 precursor [Ze...   282    2e-74  UniGene infoGene info
ref|ZP_04796242.1|  chaperonin GroEL [Staphylococcus epidermid...   282    2e-74 
ref|XP_001931555.1|  heat shock protein 60, mitochondrial prec...   282    2e-74  Gene info
ref|NP_765184.1|  chaperonin GroEL [Staphylococcus epidermidis...   282    2e-74  Gene info
ref|YP_300938.1|  chaperonin GroEL [Staphylococcus saprophytic...   282    2e-74  Gene info
gb|AAA33450.1|  chaperonin 60 [Zea mays]                            282    2e-74 
ref|ZP_04806479.1|  chaperonin GroEL [Clostridium cellulovoran...   282    2e-74 
ref|YP_001305316.1|  chaperonin GroEL [Thermosipho melanesiens...   282    2e-74  Gene info
sp|Q8KTS0.1|CH60_TREPR  RecName: Full=60 kDa chaperonin; AltNa...   282    2e-74 
sp|Q24QE3.2|CH60_DESHY  RecName: Full=60 kDa chaperonin; AltNa...   282    2e-74 
gb|AAC41441.1|  heat shock protein [Helicobacter pylori]            282    2e-74 
ref|YP_001114202.1|  chaperonin GroEL [Desulfotomaculum reduce...   282    2e-74  Gene info
gb|ABY86695.1|  chaperonin GroEL2 [Sorangium cellulosum]            281    2e-74 
gb|AAF75593.1|AF214488_3  GroEL [Lactobacillus johnsonii]           281    3e-74 
ref|YP_003426819.1|  chaperonin GroEL [Bacillus pseudofirmus O...   281    3e-74 
ref|ZP_04525187.1|  chaperonin GroEL [Streptococcus pneumoniae...   281    3e-74 
ref|YP_002385205.1|  chaperonin GroEL [Escherichia fergusonii ...   281    3e-74  Gene info
ref|ZP_06250699.1|  chaperonin GroL [Prevotella copri DSM 1820...   281    3e-74 
dbj|BAA22519.1|  GroEL protein [Bacillus subtilis]                  281    3e-74 
ref|ZP_03614109.1|  chaperonin GroL [Staphylococcus capitis SK...   281    3e-74 
ref|YP_001695899.1|  60 kDa chaperonin (protein Cpn60) (groEL ...   281    3e-74  Gene info
ref|NP_001105716.1|  mitochondrial chaperonin-60 precursor [Ze...   281    3e-74  UniGene infoGene info
ref|XP_002422164.1|  heat shock protein 60, mitochondrial prec...   281    3e-74  Gene info
ref|NP_228316.1|  groEL protein [Thermotoga maritima MSB8] >sp...   281    3e-74  Gene info
ref|XP_713100.1|  heat shock protein 60 [Candida albicans SC53...   281    3e-74  Gene info
gb|EEQ43706.1|  heat shock protein 60, mitochondrial precursor...   281    3e-74 
ref|ZP_05900796.1|  chaperonin GroL [Leptotrichia hofstadii F0...   281    3e-74 
ref|YP_001244015.1|  chaperonin GroEL [Thermotoga petrophila R...   281    3e-74  Gene info
gb|AAA23128.1|  groE [Chlamydia trachomatis]                        281    3e-74 
ref|ZP_04817307.1|  chaperonin GroEL [Staphylococcus epidermid...   281    3e-74 
ref|YP_002607886.1|  chaperonin GroL [Nautilia profundicola Am...   281    4e-74  Gene info
ref|XP_002467123.1|  hypothetical protein SORBIDRAFT_01g020010...   281    4e-74  UniGene infoGene info
ref|YP_590174.1|  chaperonin GroEL [Candidatus Koribacter vers...   281    4e-74  Gene info
gb|EDK41467.2|  heat shock protein 60, mitochondrial precursor...   281    4e-74 
sp|P50142.2|HSP60_AJECA  RecName: Full=Heat shock protein 60, ...   281    4e-74 
ref|ZP_04861631.1|  chaperonin GroL [Clostridium botulinum D s...   281    4e-74 
ref|ZP_02179983.1|  GroEL [Hydrogenivirga sp. 128-5-R1-1] >gb|...   281    4e-74 
gb|AAY22593.1|  60 kDa chaperonin [Bacteroides caccae]              281    4e-74 
ref|ZP_05864062.1|  chaperonin GroL [Lactobacillus fermentum 2...   281    4e-74 
ref|YP_174382.1|  chaperonin GroEL [Bacillus clausii KSM-K16] ...   281    4e-74  Gene info
gb|EFC71666.1|  chaperonin GroL [Prevotella sp. oral taxon 299...   281    4e-74 
ref|YP_001843142.1|  chaperonin GroEL [Lactobacillus fermentum...   281    4e-74  Gene info
ref|YP_002522505.1|  chaperonin GroEL [Thermomicrobium roseum ...   281    5e-74  Gene info
ref|YP_802448.1|  chaperonin GroEL [Candidatus Carsonella rudd...   281    5e-74  Gene info
ref|NP_784483.1|  chaperonin GroEL [Lactobacillus plantarum WC...   281    5e-74  Gene info
ref|YP_665399.1|  chaperonin GroEL [Helicobacter acinonychis s...   281    5e-74  Gene info
ref|ZP_04659158.1|  chaperone GroEL [Selenomonas flueggei ATCC...   281    5e-74 
ref|XP_002545832.1|  heat shock protein 60, mitochondrial prec...   280    5e-74  Gene info
gb|EEU45854.1|  predicted protein [Nectria haematococca mpVI 7...   280    6e-74 
ref|XP_002619459.1|  heat shock protein 60, mitochondrial prec...   280    6e-74  Gene info
ref|XP_459575.1|  hypothetical protein DEHA0E06589g [Debaryomy...   280    6e-74  Gene info
ref|XP_001482545.1|  heat shock protein 60, mitochondrial prec...   280    6e-74  Gene info
ref|ZP_03730000.1|  chaperonin GroEL [Dethiobacter alkaliphilu...   280    6e-74 
ref|ZP_02170092.1|  ABC transporter, transmembrane region, typ...   280    6e-74 
ref|YP_794794.1|  chaperonin GroEL [Lactobacillus brevis ATCC ...   280    6e-74  Gene info
sp|Q05045.1|CH61_CUCMA  RecName: Full=Chaperonin CPN60-1, mito...   280    6e-74 
ref|NP_349309.1|  chaperonin GroEL [Clostridium acetobutylicum...   280    7e-74  Gene info
gb|AAY22597.1|  60 kDa chaperonin [Bacteroides uniformis]           280    7e-74 
sp|P0C0N6.2|CH60_STAEP  RecName: Full=60 kDa chaperonin; AltNa...   280    7e-74 
ref|ZP_05625494.1|  chaperonin GroL [Campylobacter gracilis RM...   280    7e-74 
gb|ABC25372.1|  chaperonin (groEL) [uncultured marine bacteriu...   280    7e-74 
ref|YP_001528437.1|  chaperonin GroEL [Desulfococcus oleovoran...   280    8e-74  Gene info
gb|AAT11556.1|  chaperonin 60 [Cytophaga sp. FIRDI-133-V546]        280    8e-74 
ref|NP_214512.1|  GroEL [Aquifex aeolicus VF5] >sp|O67943.1|CH...   280    8e-74  Gene info
ref|ZP_06003726.1|  chaperonin GroEL [Selenomonas noxia ATCC 4...   280    8e-74 
gb|ABY86693.1|  chaperonin GroEL2 [Sorangium cellulosum]            280    9e-74 
ref|NP_241428.1|  chaperonin GroEL [Bacillus halodurans C-125]...   280    9e-74  Gene info
ref|YP_002507958.1|  chaperonin GroEL [Halothermothrix orenii ...   280    9e-74  Gene info
ref|XP_002561413.1|  Pc16g11070 [Penicillium chrysogenum Wisco...   280    1e-73  Gene info
ref|YP_520193.1|  hypothetical protein DSY3960 [Desulfitobacte...   280    1e-73  Gene info
ref|XP_504920.1|  YALI0F02805p [Yarrowia lipolytica] >emb|CAG7...   280    1e-73  Gene info
ref|ZP_06255139.1|  chaperonin GroL [Prevotella oris F0302] >g...   280    1e-73 
ref|ZP_06199704.1|  chaperonin GroL [Bacteroides sp. D20] >gb|...   280    1e-73 
ref|ZP_02069721.1|  hypothetical protein BACUNI_01136 [Bactero...   280    1e-73 
dbj|BAA09494.1|  GroEL [Bacillus sp.]                               280    1e-73 
gb|EEQ90477.1|  chaperonin GroL [Ajellomyces dermatitidis ER-3]     280    1e-73 
gb|AAP54159.2|  Chaperonin CPN60-1, mitochondrial precursor, p...   280    1e-73 
ref|NP_782944.2|  chaperonin GroEL [Clostridium tetani E88]         279    1e-73  Gene info
ref|XP_002623693.1|  chaperonin GroL [Ajellomyces dermatitidis...   279    1e-73  Gene info
ref|YP_002121525.1|  chaperonin GroEL [Hydrogenobaculum sp. Y0...   279    1e-73  Gene info
ref|NP_869524.1|  heat shock protein GroEL [Rhodopirellula bal...   279    1e-73  Gene info
ref|YP_001916634.1|  chaperonin GroEL [Natranaerobius thermoph...   279    1e-73  Gene info
sp|Q891G4.1|CH60_CLOTE  RecName: Full=60 kDa chaperonin; AltNa...   279    1e-73 
ref|ZP_06309333.1|  Chaperonin Cpn60/TCP-1 [Cylindrospermopsis...   279    2e-73 
ref|YP_001654449.1|  chaperonin GroEL [Chlamydia trachomatis 4...   279    2e-73  Gene info
ref|NP_001064784.1|  Os10g0462900 [Oryza sativa (japonica cult...   279    2e-73  UniGene infoGene info
ref|ZP_06268910.1|  chaperonin GroL [Prevotella bivia JCVIHMP0...   279    2e-73 
ref|YP_002938143.1|  chaperonin GroEL [Eubacterium rectale ATC...   279    2e-73  Gene info
ref|XP_001806589.1|  hypothetical protein SNOG_16475 [Phaeosph...   279    2e-73  Gene info
ref|ZP_03958224.1|  chaperonin GroEL [Lactobacillus ruminis AT...   279    2e-73 
ref|ZP_03658024.1|  chaperonin GroEL [Helicobacter cinaedi CCU...   279    2e-73 
ref|YP_138744.1|  chaperonin GroEL [Streptococcus thermophilus...   279    2e-73  Gene info
ref|ZP_04782259.1|  chaperone GroEL protein [Weissella parames...   279    2e-73 
ref|ZP_03959586.1|  chaperone GroEL [Lactobacillus vaginalis A...   279    2e-73 
sp|Q9EZV1.1|CH60_THENE  RecName: Full=60 kDa chaperonin; AltNa...   279    2e-73 
emb|CAA78101.1|  mitochondrial chaperonin-60 [Zea mays]             279    2e-73 
gb|AAD23455.1|  chaperonin GroEL [Streptococcus pneumoniae]         279    2e-73 
ref|ZP_05392650.1|  chaperonin GroEL [Clostridium carboxidivor...   279    2e-73 
gb|EEH43444.1|  heat shock protein [Paracoccidioides brasilien...   278    2e-73 
ref|ZP_01667262.1|  chaperonin GroEL [Thermosinus carboxydivor...   278    2e-73 
ref|XP_002552673.1|  KLTH0C10428p [Lachancea thermotolerans] >...   278    2e-73  Gene info
ref|ZP_03764814.1|  chaperonin GroEL ['Nostoc azollae' 0708] >...   278    2e-73 
sp|Q93GT6.2|CH60_TETHA  RecName: Full=60 kDa chaperonin; AltNa...   278    2e-73 
emb|CAB91379.2|  probable heat-shock protein hsp60 [Neurospora...   278    2e-73 
ref|ZP_04599573.1|  hypothetical protein VEIDISOL_01010 [Veill...   278    3e-73 
ref|YP_003311995.1|  chaperonin GroEL [Veillonella parvula DSM...   278    3e-73  Gene info
ref|ZP_06259701.1|  chaperonin GroL [Veillonella parvula ATCC ...   278    3e-73 
ref|ZP_06291955.1|  chaperonin GroL [Peptoniphilus lacrimalis ...   278    3e-73 
gb|AAA83441.1|  GroEL-like chaperonin [Thermus aquaticus]           278    3e-73 
ref|YP_005683.1|  chaperonin GroEL [Thermus thermophilus HB27]...   278    3e-73  Gene info
ref|ZP_03644022.1|  hypothetical protein BACCOPRO_02396 [Bacte...   278    3e-73 
sp|O60008.1|HSP60_PARBA  RecName: Full=Heat shock protein 60, ...   278    3e-73 
ref|ZP_01855575.1|  heat shock protein GroEL [Planctomyces mar...   278    3e-73 
ref|YP_754524.1|  hypothetical protein Swol_1855 [Syntrophomon...   278    4e-73  Gene info
ref|ZP_02953282.1|  chaperonin, 60 kDa [Clostridium perfringen...   278    4e-73 
ref|YP_001307473.1|  chaperonin GroEL [Clostridium beijerincki...   278    4e-73  Gene info
gb|EEH17213.1|  heat shock protein [Paracoccidioides brasilien...   277    5e-73 
gb|ACI47199.1|  heat shock protein 60 [Legionella pneumophila]      277    5e-73 
ref|ZP_05129689.1|  chaperonin GroEL [Clostridium sp. 7_2_43FA...   277    5e-73 
ref|ZP_03723959.1|  chaperonin GroEL [Opitutaceae bacterium TA...   277    5e-73 
ref|ZP_06363228.1|  chaperonin GroEL [Bacillus cellulosilyticu...   277    5e-73 
ref|YP_001680010.1|  chaperonin groel [Heliobacterium modestic...   277    5e-73  Gene info
ref|YP_001355980.1|  chaperonin GroEL [Nitratiruptor sp. SB155...   277    5e-73  Gene info
gb|ABE02805.1|  heat shock protein 60 [Glomus intraradices]         277    6e-73 
ref|NP_563205.1|  chaperonin GroEL [Clostridium perfringens st...   277    6e-73  Gene info
ref|XP_761978.1|  hypothetical protein UM05831.1 [Ustilago may...   277    6e-73  Gene info
ref|YP_696963.1|  chaperonin GroEL [Clostridium perfringens AT...   277    6e-73  Gene info
ref|NP_971783.1|  chaperonin GroEL [Treponema denticola ATCC 3...   277    6e-73  Gene info
ref|YP_003319104.1|  chaperonin GroEL [Sphaerobacter thermophi...   277    6e-73  Gene info
ref|XP_001645297.1|  hypothetical protein Kpol_1037p35 [Vander...   277    6e-73  Gene info
ref|YP_003204966.1|  chaperonin, GroL [Clostridium perfringens...   277    6e-73 
ref|YP_001728706.1|  60 kDa chaperonin [Leuconostoc citreum KM...   277    7e-73  Gene info
gb|AAY22595.1|  60 kDa chaperonin [Bacteroides vulgatus]            277    7e-73 
ref|YP_001919807.1|  chaperonin GroEL [Clostridium botulinum E...   277    7e-73  Gene info
emb|CAB65482.1|  chaperonin-60 [Thermus thermophilus HB27]          277    7e-73 
ref|YP_094724.1|  chaperonin GroEL [Legionella pneumophila sub...   277    7e-73  Gene info
ref|ZP_03913179.1|  chaperone GroEL [Leuconostoc mesenteroides...   277    7e-73 
ref|YP_002941321.1|  chaperonin GroEL [Kosmotoga olearia TBF 1...   277    7e-73  Gene info
ref|YP_819222.1|  chaperonin GroEL [Leuconostoc mesenteroides ...   277    7e-73  Gene info
ref|XP_001347438.1|  heat shock protein 60 [Plasmodium falcipa...   277    7e-73  UniGene infoGene info
ref|ZP_05110732.1|  chaperonin GroEL [Legionella drancourtii L...   277    7e-73 
ref|YP_001297686.1|  chaperonin GroEL [Bacteroides vulgatus AT...   277    7e-73  Gene info
ref|NP_001048938.1|  Os03g0143400 [Oryza sativa (japonica cult...   277    7e-73  UniGene infoGene info
ref|ZP_02637265.1|  chaperonin, 60 kDa [Clostridium perfringen...   276    8e-73 
ref|ZP_03675052.1|  chaperonin GroL [Borrelia spielmanii A14S]...   276    8e-73 
ref|ZP_03539272.1|  chaperonin GroL [Borrelia garinii PBr] >gb...   276    8e-73 
ref|ZP_04821701.1|  chaperonin GroL [Clostridium botulinum E1 ...   276    8e-73 
ref|YP_073092.1|  chaperonin GroEL [Borrelia garinii PBi] >sp|...   276    8e-73  Gene info
ref|YP_710100.1|  chaperonin GroEL [Borrelia afzelii PKo] >ref...   276    8e-73  Gene info
ref|ZP_03462070.1|  hypothetical protein BACPEC_01131 [Bactero...   276    9e-73 
ref|ZP_03672186.1|  chaperonin GroL [Borrelia valaisiana VS116...   276    9e-73 
ref|XP_386422.1|  HS60_AJECA Heat shock protein 60, mitochondr...   276    9e-73  Gene info
dbj|BAC02899.1|  chaperonin [Thermus sp. TB1]                       276    9e-73 
dbj|BAB33386.1|  hsp60 [Paramecium caudatum]                        276    9e-73 
ref|YP_002334111.1|  chaperonin GroL [Thermosipho africanus TC...   276    1e-72  Gene info
ref|YP_001251867.1|  chaperonin GroEL [Legionella pneumophila ...   276    1e-72  Gene info
gb|ACI47215.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|ACI47183.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
ref|YP_001469949.1|  chaperonin GroEL [Thermotoga lettingae TM...   276    1e-72  Gene info
ref|ZP_01094293.1|  60 kDa chaperonin 5 [Blastopirellula marin...   276    1e-72 
gb|ACI47198.1|  heat shock protein 60 [Legionella pneumophila]...   276    1e-72 
ref|NP_212783.1|  chaperonin GroEL [Borrelia burgdorferi B31] ...   276    1e-72  Gene info
ref|XP_002493562.1|  Tetradecameric mitochondrial chaperonin [...   276    1e-72  Gene info
gb|ACI47226.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|ACI47192.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|ACZ26340.1|  heat shock protein 60 kDa [Trichophyton mentag...   276    1e-72 
ref|ZP_03777736.1|  hypothetical protein CLOHYLEM_04790 [Clost...   276    1e-72 
ref|YP_123081.1|  chaperonin GroEL [Legionella pneumophila str...   276    1e-72  Gene info
ref|XP_002258797.1|  hsp60 [Plasmodium knowlesi strain H] >emb...   276    1e-72  Gene info
ref|ZP_02429847.1|  hypothetical protein CLOSCI_00050 [Clostri...   276    1e-72 
ref|ZP_05425603.1|  chaperonin [Enterococcus faecalis T2] >gb|...   276    1e-72 
ref|YP_007029.1|  60 kDa chaperonin (GroEL) [Candidatus Protoc...   276    1e-72  Gene info
ref|ZP_05422546.1|  chaperonin Cpn60/TCP-1 [Enterococcus faeca...   276    1e-72 
ref|ZP_05591817.1|  chaperone protein GroEL [Roseburia intesti...   276    1e-72 
ref|XP_001614468.1|  heat shock protein 60 [Plasmodium vivax S...   276    1e-72  Gene info
gb|ACB06709.1|  heat shock protein 60 [Botryotinia squamosa]        276    1e-72 
gb|ACI47201.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|ACI47206.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|ACI47214.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
ref|YP_126086.1|  chaperonin GroEL [Legionella pneumophila str...   276    1e-72  Gene info
gb|ACI47188.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
ref|ZP_02091248.1|  hypothetical protein FAEPRAM212_01519 [Fae...   276    1e-72 
gb|ACI47219.1|  heat shock protein 60 [Legionella pneumophila]      276    1e-72 
gb|EEY19099.1|  heat shock protein [Verticillium albo-atrum Va...   276    1e-72 
ref|XP_001910071.1|  unnamed protein product [Podospora anseri...   276    1e-72  Gene info
ref|XP_002495959.1|  ZYRO0C07106p [Zygosaccharomyces rouxii] >...   276    1e-72  Gene info
gb|EEQ34001.1|  heat shock protein 60 [Microsporum canis CBS 1...   276    1e-72 
ref|ZP_03011662.1|  hypothetical protein BACCOP_03577 [Bactero...   276    2e-72 
gb|ABQ85794.1|  chaperonin 60 [Mastigamoeba balamuthi]              276    2e-72 
ref|ZP_03931247.1|  chaperone GroEL [Anaerococcus tetradius AT...   276    2e-72 
ref|ZP_03943736.1|  chaperonin GroEL [Lactobacillus buchneri A...   276    2e-72 
ref|ZP_03940720.1|  chaperonin GroEL [Lactobacillus brevis sub...   275    2e-72 
ref|XP_448482.1|  unnamed protein product [Candida glabrata] >...   275    2e-72  Gene info
dbj|BAI42679.1|  chaperonin GroEL [Lactobacillus rhamnosus GG]      275    2e-72 
ref|YP_001431326.1|  chaperonin GroEL [Roseiflexus castenholzi...   275    2e-72  Gene info
gb|AAG60328.1|  heat shock protein 60 [Toxoplasma gondii]           275    2e-72 
ref|XP_455510.1|  unnamed protein product [Kluyveromyces lacti...   275    2e-72  UniGene infoGene info
sp|P69050.1|CH60_LEGPN  RecName: Full=60 kDa chaperonin; AltNa...   275    3e-72 
ref|ZP_02176593.1|  GroEL [Hydrogenivirga sp. 128-5-R1-1] >gb|...   275    3e-72 
gb|AAD38419.1|  heat shock protein 60 [Toxoplasma gondii]           275    3e-72 
ref|XP_001395564.1|  hypothetical protein An12g04940 [Aspergil...   275    3e-72  Gene info
emb|CAA37994.1|  common antigen [Borrelia burgdorferi]              275    3e-72 
emb|CAA77645.1|  chaperonin hsp60 [Zea mays]                        275    3e-72 
ref|ZP_05614692.1|  chaperonin GroL [Faecalibacterium prausnit...   275    3e-72 
ref|XP_002367122.1|  heat shock protein 60 [Toxoplasma gondii ...   275    3e-72  UniGene infoGene info
ref|XP_001260425.1|  antigenic mitochondrial protein HSP60, pu...   275    3e-72  Gene info
ref|XP_001218472.1|  heat shock protein 60, mitochondrial prec...   275    4e-72  Gene info
dbj|BAA09171.1|  heat-shock protein [Schizosaccharomyces pombe]     275    4e-72 
ref|ZP_03208807.1|  hypothetical protein BACPLE_02468 [Bactero...   275    4e-72 
ref|YP_001513975.1|  chaperonin GroEL [Alkaliphilus oremlandii...   275    4e-72  Gene info
ref|XP_360622.2|  heat shock protein 60, mitochondrial precurs...   274    4e-72  UniGene infoGene info
ref|YP_305071.1|  chaperonin GroEL [Methanosarcina barkeri str...   274    4e-72  Gene info
ref|ZP_05403471.1|  chaperonin GroL [Mitsuokella multacida DSM...   274    4e-72 
ref|NP_592894.1|  mitochondrial heat shock protein Hsp60 [Schi...   274    4e-72  UniGene infoGene info
ref|YP_003111777.1|  chaperonin GroEL [Catenulispora acidiphil...   274    4e-72  Gene info
ref|YP_002222287.1|  heat shock protein [Borrelia duttonii Ly]...   274    4e-72  Gene info
ref|NP_860732.1|  chaperonin GroEL [Helicobacter hepaticus ATC...   274    4e-72  Gene info
ref|XP_663693.1|  HS60_PARBR Heat shock protein 60, mitochondr...   274    4e-72  Gene info
ref|YP_002731778.1|  chaperonin GroL [Persephonella marina EX-...   274    4e-72  Gene info
gb|ABY86691.1|  chaperonin GroEL2 [Sorangium cellulosum]            274    5e-72 
ref|ZP_02094496.1|  hypothetical protein PEPMIC_01263 [Parvimo...   274    5e-72 
ref|YP_001884621.1|  chaperonin GroEL [Clostridium botulinum B...   274    5e-72  Gene info
gb|AAQ55584.1|  chaperonin GroEL [Streptococcus anginosus]          274    5e-72 
ref|YP_003301822.1|  chaperonin GroEL [Thermomonospora curvata...   274    5e-72  Gene info
sp|P26194.1|CH60_LEGMI  RecName: Full=60 kDa chaperonin; AltNa...   274    5e-72 
ref|ZP_03074123.1|  chaperonin GroEL [Lactobacillus reuteri 10...   274    5e-72 
ref|ZP_03975183.1|  chaperone GroEL protein [Lactobacillus reu...   274    5e-72 
ref|ZP_06305364.1|  Chaperonin Cpn60/TCP-1 [Raphidiopsis brook...   274    5e-72 
ref|ZP_03952573.1|  chaperonin GroEL [Lactobacillus hilgardii ...   274    5e-72 
gb|AAD26145.1|AF109791_1  60 kD heat shock protein GroEL [Chla...   274    5e-72 
ref|XP_755263.1|  antigenic mitochondrial protein HSP60 [Asper...   274    5e-72  Gene info
ref|XP_001826345.1|  hypothetical protein [Aspergillus oryzae ...   274    6e-72  Gene info
ref|ZP_01995668.1|  hypothetical protein DORLON_01663 [Dorea l...   274    6e-72 
ref|YP_001270960.1|  chaperonin GroEL [Lactobacillus reuteri D...   274    6e-72  Gene info
ref|YP_076724.1|  chaperonin GroEL [Symbiobacterium thermophil...   274    6e-72  Gene info
ref|ZP_03989276.1|  chaperonin groEL [Acidaminococcus sp. D21]...   274    6e-72 
ref|ZP_06186425.1|  chaperonin GroL [Legionella longbeachae D-...   273    7e-72 
ref|YP_001278425.1|  chaperonin GroEL [Roseiflexus sp. RS-1] >...   273    7e-72  Gene info
ref|YP_001039283.1|  chaperonin GroEL [Clostridium thermocellu...   273    7e-72  Gene info
ref|XP_677968.1|  hsp60 [Plasmodium berghei strain ANKA] >emb|...   273    7e-72  Gene info
ref|ZP_01875439.1|  chaperonin GroEL [Lentisphaera araneosa HT...   273    7e-72 
ref|YP_003065262.1|  chaperonin GroEL [Candidatus Liberibacter...   273    8e-72  Gene info
ref|NP_826169.1|  chaperonin GroEL [Streptomyces avermitilis M...   273    8e-72  Gene info
sp|P26004.1|CH60_AMOPS  RecName: Full=60 kDa chaperonin; AltNa...   273    9e-72 
ref|XP_724940.1|  heat shock protein 60 [Plasmodium yoelii yoe...   273    9e-72  Gene info
gb|AAC78150.1|  heat shock protein 60 [Plasmodium yoelii] >gb|...   273    1e-71 
ref|ZP_05344623.1|  chaperonin GroL [Bryantella formatexigens ...   273    1e-71 
ref|YP_429419.1|  chaperonin GroEL [Moorella thermoacetica ATC...   273    1e-71  Gene info
ref|YP_605694.1|  chaperonin GroEL [Deinococcus geothermalis D...   273    1e-71  Gene info
ref|ZP_01070792.1|  chaperonin GroEL [Campylobacter jejuni sub...   273    1e-71 
ref|YP_430964.1|  chaperonin GroEL [Moorella thermoacetica ATC...   273    1e-71  Gene info
ref|YP_001884068.1|  60 kDa chaperonin GroEL [Borrelia hermsii...   273    1e-71  Gene info
ref|NP_985702.1|  AFR155Wp [Ashbya gossypii ATCC 10895] >gb|AA...   273    1e-71  UniGene infoGene info
ref|ZP_05497881.1|  chaperonin GroEL [Clostridium papyrosolven...   273    1e-71 
ref|YP_003306185.1|  chaperonin GroEL [Streptobacillus monilif...   273    1e-71  Gene info
ref|YP_003153242.1|  chaperonin GroEL [Anaerococcus prevotii D...   273    1e-71  Gene info
gb|AAK13020.1|  heat shock protein 60 [Fibrobacter succinogene...   272    1e-71 
ref|ZP_02421457.1|  hypothetical protein EUBSIR_00282 [Eubacte...   272    2e-71 
gb|AAD26144.1|AF109790_1  60 kD heat shock protein GroEL [Chla...   272    2e-71 
ref|ZP_05471769.1|  chaperonin GroEL [Anaerococcus vaginalis A...   272    2e-71 
ref|ZP_03304865.1|  hypothetical protein ANHYDRO_01279 [Anaero...   272    2e-71 
ref|YP_002729657.1|  chaperonin GroL [Sulfurihydrogenibium azo...   272    2e-71  Gene info
gb|AAS54979.1|  chaperonin GroEL [Streptococcus sinensis]           272    2e-71 
gb|ABE02806.1|  heat shock protein 60 [Glomus intraradices]         272    2e-71 
gb|AAS54978.1|  chaperonin GroEL [Streptococcus sinensis]           272    2e-71 
ref|YP_001930778.1|  chaperonin GroEL [Sulfurihydrogenibium sp...   272    2e-71  Gene info
ref|NP_923973.1|  chaperonin GroEL [Gloeobacter violaceus PCC ...   272    2e-71  Gene info
ref|ZP_05644951.1|  TCP-1/cpn60 family chaperonin [Enterococcu...   272    2e-71 
gb|AAN32673.1|AF417584_2  GroEL [Enterococcus casseliflavus]        272    2e-71 
ref|ZP_05654552.1|  TCP-1/cpn60 family chaperonin [Enterococcu...   272    2e-71 
ref|YP_001956621.1|  chaperonin Cpn60 [uncultured Termite grou...   272    2e-71  Gene info
sp|Q7WVY0.1|CH602_ANASL  RecName: Full=60 kDa chaperonin 2; Al...   272    2e-71 
ref|ZP_05014481.1|  conserved hypothetical protein [Streptomyc...   272    2e-71 
gb|AAN32679.1|AF417587_2  GroEL [Enterococcus gallinarum]           272    2e-71 
ref|ZP_04584576.1|  chaperonin GroL [Sulfurihydrogenibium yell...   272    2e-71 
dbj|BAH22152.1|  GroEL [Stanieria cyanosphaera PCC 7437]            272    2e-71 
gb|AAD26143.1|AF109789_1  60 kD heat shock protein GroEL [Chla...   271    2e-71 
gb|ABG75547.1|  GroEL [Klebsiella pneumoniae]                       271    3e-71 
ref|ZP_04455097.1|  hypothetical protein GCWU000342_01113 [Shu...   271    3e-71 
ref|ZP_02692393.1|  chaperonin GroEL [Epulopiscium sp. 'N.t. m...   271    3e-71 
ref|YP_001393866.1|  chaperonin GroEL [Clostridium kluyveri DS...   271    3e-71  Gene info
ref|ZP_05745616.1|  chaperonin GroEL [Lactobacillus antri DSM ...   271    3e-71 
ref|ZP_03497706.1|  chaperonin GroEL [Thermus aquaticus Y51MC2...   271    3e-71 
ref|YP_003399105.1|  chaperonin GroEL [Acidaminococcus ferment...   271    3e-71  Gene info
gb|AAV48830.1|  60 kDa chaperonin 1 [Corynebacterium pseudotub...   271    4e-71 
ref|ZP_04018940.1|  chaperone GroEL [Finegoldia magna ATCC 535...   271    4e-71 
ref|NP_294330.1|  chaperonin GroEL [Deinococcus radiodurans R1...   271    4e-71  Gene info
gb|AAN87514.1|  60 kDa chaperonin GroEL [Heliobacillus mobilis]     271    4e-71 
ref|ZP_03924691.1|  chaperone GroEL [Actinomyces coleocanis DS...   271    4e-71 
ref|XP_002100912.1|  GE15908 [Drosophila yakuba] >gb|EDX02020....   271    4e-71  Gene info
ref|YP_002504757.1|  chaperonin GroEL [Clostridium cellulolyti...   271    4e-71  Gene info
ref|YP_003383831.1|  chaperonin GroEL [Kribbella flavida DSM 1...   271    4e-71  Gene info
ref|YP_810923.1|  chaperonin GroEL [Oenococcus oeni PSU-1] >sp...   271    4e-71  Gene info
ref|YP_001576925.1|  chaperonin GroEL [Lactobacillus helveticu...   271    4e-71  Gene info
ref|YP_001411043.1|  chaperonin GroEL [Fervidobacterium nodosu...   271    4e-71  Gene info
ref|ZP_05649738.1|  TCP-1/cpn60 family chaperonin [Enterococcu...   271    5e-71 
emb|CBG70718.1|  60 kD chaperonin cpn60 [Streptomyces scabiei ...   271    5e-71 
sp|Q9KI71.2|CH60_PARDN  RecName: Full=60 kDa chaperonin; AltNa...   271    5e-71 
ref|ZP_03288228.1|  hypothetical protein CLONEX_00414 [Clostri...   271    5e-71 
ref|ZP_02737557.1|  heat shock protein GroEL [Gemmata obscurig...   271    5e-71 
ref|YP_002377090.1|  chaperonin GroEL [Cyanothece sp. PCC 7424...   271    5e-71  Gene info
ref|XP_002133668.1|  GA22684 [Drosophila pseudoobscura pseudoo...   271    6e-71  Gene info
gb|AAY86934.1|  lr0140 [Lactobacillus reuteri]                      270    6e-71 
ref|XP_001977170.1|  GG18391 [Drosophila erecta] >gb|EDV46097....   270    6e-71  Gene info
gb|AAQ55583.1|  chaperonin GroEL [Streptococcus mutans]             270    6e-71 
ref|ZP_03995664.1|  chaperonin GroEL [Lactobacillus crispatus ...   270    6e-71 
ref|ZP_06020501.1|  chaperonin GroL [Lactobacillus crispatus M...   270    6e-71 
ref|NP_218470.1|  chaperonin GroEL [Treponema pallidum subsp. ...   270    6e-71  Gene info
ref|YP_001213155.1|  chaperonin GroEL [Pelotomaculum thermopro...   270    7e-71  Gene info
ref|ZP_04335169.1|  chaperonin GroL [Nocardiopsis dassonvillei...   270    7e-71 
ref|ZP_05533684.1|  chaperonin GroEL [Streptomyces viridochrom...   270    7e-71 
gb|EFA83887.1|  chaperonin 60 [Polysphondylium pallidum PN500]      270    7e-71 
ref|YP_002770007.1|  60 kDa chaperonin [Brevibacillus brevis N...   270    8e-71  Gene info
ref|YP_324266.2|  chaperonin GroEL [Anabaena variabilis ATCC 2...   270    8e-71  Gene info
ref|XP_002106653.1|  GD17003 [Drosophila simulans] >gb|EDX1761...   270    8e-71  UniGene infoGene info
ref|YP_001199711.1|  putative chaperonin GroEL [Streptococcus ...   270    8e-71  Gene info
ref|YP_924833.1|  chaperonin GroEL [Nocardioides sp. JS614] >s...   270    8e-71  Gene info
ref|YP_001735691.1|  chaperonin, 60 kDa protein [Synechococcus...   270    8e-71  Gene info
ref|ZP_05334703.1|  chaperonin GroEL [Thermoanaerobacter itali...   270    9e-71 
ref|XP_001424134.1|  hypothetical protein [Paramecium tetraure...   270    9e-71  UniGene infoGene info
emb|CAI39019.1|  hsp60, putative [Paramecium tetraurelia]           270    9e-71 
ref|ZP_05539321.1|  chaperonin GroEL [Streptomyces griseoflavu...   270    9e-71 
ref|ZP_05753141.1|  chaperone GroEL [Lactobacillus helveticus ...   270    9e-71 
ref|YP_002373009.1|  chaperonin GroEL [Cyanothece sp. PCC 8801...   270    9e-71  Gene info
ref|ZP_04686398.1|  chaperonin GroEL [Streptomyces ghanaensis ...   270    9e-71 
ref|XP_002067348.1|  GK16370 [Drosophila willistoni] >gb|EDW78...   270    9e-71  Gene info
ref|YP_001665694.1|  chaperonin GroEL [Thermoanaerobacter pseu...   270    9e-71  Gene info
ref|ZP_02211064.1|  hypothetical protein CLOBAR_00662 [Clostri...   270    1e-70 
dbj|BAH22173.1|  GroEL [Spirulina subsalsa]                         270    1e-70 
ref|YP_001718130.1|  chaperonin GroEL [Candidatus Desulforudis...   270    1e-70  Gene info
ref|NP_013360.1|  Hsp60p [Saccharomyces cerevisiae] >sp|P19882...   270    1e-70  UniGene infoGene info
ref|XP_002504338.1|  predicted protein [Micromonas sp. RCC299]...   270    1e-70  Gene info
ref|YP_290654.1|  chaperonin GroEL [Thermobifida fusca YX] >sp...   270    1e-70  Gene info
gb|ABA23371.1|  Chaperonin Cpn60/TCP-1 [Anabaena variabilis AT...   270    1e-70  Gene info
ref|ZP_00996700.1|  chaperonin GroEL [Janibacter sp. HTCC2649]...   270    1e-70 
emb|CAY81488.1|  Hsp60p [Saccharomyces cerevisiae EC1118]           270    1e-70 
ref|NP_633822.1|  chaperonin GroEL [Methanosarcina mazei Go1] ...   270    1e-70  Gene info
ref|YP_002929980.1|  chaperonin GroEL [Eubacterium eligens ATC...   269    1e-70  Gene info
ref|ZP_05007192.1|  60 kDa chaperonin [Streptomyces clavuliger...   269    1e-70 
ref|YP_001692194.1|  heat shock protein [Finegoldia magna ATCC...   269    1e-70  Gene info
ref|XP_743319.1|  hsp60 [Plasmodium chabaudi chabaudi] >emb|CA...   269    1e-70  Gene info
ref|NP_682202.1|  60kD chaperonin 2 [Thermosynechococcus elong...   269    1e-70  Gene info
gb|EFC48176.1|  mitochondrial chaperonin cpn60 [Naegleria grub...   269    1e-70 
ref|NP_599834.1|  chaperonin GroEL [Corynebacterium glutamicum...   269    2e-70  Gene info
sp|Q9EY76.2|CH60_SCAIO  RecName: Full=60 kDa chaperonin; AltNa...   269    2e-70 
ref|ZP_03292112.1|  hypothetical protein CLOHIR_00055 [Clostri...   269    2e-70 
emb|CAA67720.1|  heat shock protein 60 [Drosophila melanogaster]    269    2e-70 
gb|AAQ23524.1|  SD06594p [Drosophila melanogaster]                  269    2e-70 
emb|CAB58441.1|  Hsp60 protein [Myzus persicae]                     269    2e-70 
ref|NP_511115.2|  heat shock protein 60, isoform A [Drosophila...   269    2e-70  UniGene infoGene info
gb|EFC82084.1|  chaperonin GroEL [Frankia sp. EUN1f]                269    2e-70 
ref|XP_001228161.1|  heat shock protein 60, mitochondrial prec...   269    2e-70  Gene info
gb|ABO09590.1|  heat shock protein 60 [Lucilia cuprina]             269    2e-70 
ref|NP_628920.1|  chaperonin GroEL [Streptomyces coelicolor A3...   269    2e-70  Gene info
ref|XP_002011005.1|  GI16304 [Drosophila mojavensis] >gb|EDW05...   269    2e-70  Gene info
ref|XP_392899.2|  PREDICTED: similar to 60 kDa heat shock prot...   269    2e-70  UniGene infoGene info
emb|CAO87341.1|  groL2 [Microcystis aeruginosa PCC 7806]            269    2e-70 
ref|YP_001137589.1|  chaperonin GroEL [Corynebacterium glutami...   269    2e-70  Gene info
emb|CAJ72959.1|  strongly similar to 60 kDa chaperonin (GroEL ...   269    2e-70 
ref|ZP_03522171.1|  60 kDa chaperonin, heat shock protein [Rhi...   268    2e-70 
ref|XP_002041940.1|  GM11458 [Drosophila sechellia] >gb|EDW457...   268    2e-70  Gene info
ref|YP_001655355.1|  60 kDa molecular chaperonin 2 [Microcysti...   268    2e-70  Gene info
gb|AAR00669.1|  GroEL [Enterococcus casseliflavus]                  268    2e-70 
ref|YP_477934.1|  chaperonin GroEL [Synechococcus sp. JA-2-3B'...   268    3e-70  Gene info
ref|ZP_05349362.1|  60 kDa chaperonin [Clostridium difficile A...   268    3e-70 
ref|ZP_05622125.1|  chaperonin GroL [Treponema vincentii ATCC ...   268    3e-70 
ref|YP_002787043.1|  putative 60 kDa chaperonin (Protein Cpn60...   268    3e-70  Gene info
ref|YP_001864897.1|  chaperonin GroEL [Nostoc punctiforme PCC ...   268    3e-70  Gene info
ref|YP_002246991.1|  chaperonin GroL [Coprothermobacter proteo...   268    3e-70  Gene info
ref|XP_001988201.1|  GH11038 [Drosophila grimshawi] >gb|EDW030...   268    3e-70  Gene info
ref|NP_615594.1|  chaperonin GroEL [Methanosarcina acetivorans...   268    3e-70  Gene info
emb|CAA38048.1|  heat shock protein [Treponema pallidum]            268    3e-70 
ref|NP_485936.1|  chaperonin GroEL [Nostoc sp. PCC 7120] >sp|Q...   268    4e-70  Gene info
ref|ZP_02234043.1|  hypothetical protein DORFOR_00901 [Dorea f...   268    4e-70 
emb|CAI78830.1|  group i chaperon [uncultured bacterium]            268    4e-70 
ref|YP_003371550.1|  chaperonin GroEL [Pirellula staleyi DSM 6...   268    4e-70  Gene info
ref|ZP_01968328.1|  hypothetical protein RUMTOR_01896 [Ruminoc...   268    4e-70 
ref|YP_001180085.1|  chaperonin GroEL [Caldicellulosiruptor sa...   268    4e-70  Gene info
ref|YP_002378122.1|  chaperonin GroEL [Cyanothece sp. PCC 7424...   268    4e-70  Gene info
ref|YP_001086664.1|  60 kDa chaperonin [Clostridium difficile ...   268    4e-70  Gene info
ref|ZP_05399685.1|  60 kDa chaperonin [Clostridium difficile Q...   268    4e-70 
ref|YP_001560382.1|  chaperonin GroEL [Clostridium phytofermen...   268    5e-70  Gene info
gb|AAS54977.1|  chaperonin GroEL [Streptococcus sinensis]           268    5e-70 
ref|ZP_05515588.1|  chaperonin GroEL [Streptomyces hygroscopic...   268    5e-70 
ref|ZP_03155427.1|  chaperonin GroEL [Cyanothece sp. PCC 7822]...   267    5e-70 
ref|YP_002573985.1|  chaperonin GroEL [Anaerocellum thermophil...   267    5e-70  Gene info
ref|ZP_02438323.1|  hypothetical protein CLOSS21_00774 [Clostr...   267    5e-70 
gb|AAF80372.1|AF159449_1  heat shock protein GroEL [Clostridiu...   267    5e-70 
gb|AAW30392.2|  heat shock protein 60 [Liriomyza huidobrensis]      267    6e-70 
ref|YP_945636.1|  60 kDa chaperonin GroEL [Borrelia turicatae ...   267    6e-70  Gene info
ref|ZP_06047488.1|  chaperonin GroEL [Aeromicrobium marinum DS...   267    6e-70 
ref|ZP_04998469.1|  chaperonin GroEL [Streptomyces sp. Mg1] >g...   267    7e-70 
ref|XP_001448270.1|  hypothetical protein [Paramecium tetraure...   267    7e-70  UniGene infoGene info
ref|ZP_01624122.1|  chaperonin GroEL [Lyngbya sp. PCC 8106] >g...   267    7e-70 
ref|ZP_06269940.1|  chaperonin GroEL [Streptomyces sp. ACTE] >...   267    7e-70 
ref|ZP_06277076.1|  chaperonin GroEL [Streptomyces sp. ACT-1] ...   267    7e-70 
ref|ZP_01805114.1|  hypothetical protein CdifQ_04000217 [Clost...   267    8e-70 
ref|ZP_04702509.1|  chaperonin GroEL [Streptomyces albus J1074...   266    8e-70 
sp|Q9KKF0.1|CH60_CLODI  RecName: Full=60 kDa chaperonin; AltNa...   266    8e-70 
ref|ZP_05508443.1|  chaperonin GroEL [Streptomyces sp. C]           266    8e-70 
ref|ZP_03971851.1|  chaperonin GroEL protein [Corynebacterium ...   266    8e-70 
ref|ZP_00518839.1|  Chaperonin Cpn60/TCP-1 [Crocosphaera watso...   266    8e-70 
ref|ZP_06161272.1|  chaperonin GroL [Actinomyces sp. oral taxo...   266    8e-70 
ref|YP_001824281.1|  chaperonin GroEL [Streptomyces griseus su...   266    9e-70  Gene info
ref|ZP_04695588.1|  chaperonin GroEL [Streptomyces roseosporus...   266    9e-70 
gb|AAK97218.1|AF300645_2  chaperonin GroEL [Lactobacillus acid...   266    9e-70 
emb|CAJ72514.1|  strongly similar to chaperonin GroEL [Candida...   266    9e-70 
ref|YP_193328.1|  chaperonin GroEL [Lactobacillus acidophilus ...   266    9e-70  Gene info
ref|ZP_01629963.1|  Chaperonin [Nodularia spumigena CCY9414] >...   266    9e-70 
gb|ACO57619.1|  heat shock protein 60 [Pteromalus puparum]          266    9e-70 
ref|XP_001600045.1|  PREDICTED: similar to ENSANGP00000014839 ...   266    9e-70  UniGene infoGene info
ref|YP_001568199.1|  chaperonin GroEL [Petrotoga mobilis SJ95]...   266    1e-69  Gene info
ref|YP_001318718.1|  chaperonin GroEL [Alkaliphilus metallired...   266    1e-69  Gene info
ref|ZP_01091207.1|  heat shock protein GroEL [Blastopirellula ...   266    1e-69 
ref|ZP_01963619.1|  hypothetical protein RUMOBE_01341 [Ruminoc...   266    1e-69 
ref|ZP_03917351.1|  chaperonin GroEL [Corynebacterium glucuron...   266    1e-69 
gb|AAC47497.1|  60 kDa heat-shock protein PfHsp60 [Plasmodium ...   266    1e-69 
ref|ZP_05792670.1|  chaperonin GroEL [Butyrivibrio crossotus D...   266    1e-69 
gb|ACD01999.1|  putative chaperonin 60 [Clostridium septicum]       266    1e-69 
ref|ZP_05801991.1|  chaperonin GroEL [Streptomyces flavogriseu...   266    1e-69 
ref|XP_001995750.1|  GH17925 [Drosophila grimshawi] >gb|EDV954...   266    1e-69  Gene info
gb|AAX99085.1|  GroEL [Lactobacillus sanfranciscensis]              266    1e-69 
ref|YP_003322303.1|  chaperonin GroEL [Thermobaculum terrenum ...   266    1e-69 
ref|YP_359661.1|  chaperonin GroEL [Carboxydothermus hydrogeno...   266    1e-69  Gene info
ref|YP_723793.1|  chaperonin GroEL [Trichodesmium erythraeum I...   266    1e-69  Gene info
ref|YP_001802760.1|  chaperonin GroEL [Cyanothece sp. ATCC 511...   266    1e-69  Gene info
ref|YP_001504548.1|  chaperonin GroEL [Frankia sp. EAN1pec] >g...   266    1e-69  Gene info
ref|YP_001517526.1|  chaperonin GroEL [Acaryochloris marina MB...   266    1e-69  Gene info
ref|NP_737212.1|  chaperonin GroEL [Corynebacterium efficiens ...   266    2e-69  Gene info
ref|XP_002058167.1|  GJ15640 [Drosophila virilis] >gb|EDW66275...   266    2e-69  Gene info
ref|XP_001951373.1|  PREDICTED: similar to Hsp60 protein [Acyr...   266    2e-69  UniGene infoGene info
dbj|BAH22155.1|  GroEL [Geitlerinema sp. PCC 7105]                  266    2e-69 
ref|YP_001363363.1|  chaperonin GroEL [Kineococcus radiotolera...   266    2e-69  Gene info
ref|ZP_05497101.1|  chaperonin GroEL [Clostridium papyrosolven...   265    2e-69 
gb|AAQ96150.1|  GroEL protein [Klebsiella pneumoniae] >gb|AAQ9...   265    2e-69 
gb|AAQ96151.1|  GroEL protein [Klebsiella pneumoniae]               265    2e-69 
ref|ZP_01689734.1|  chaperonin GroL [Microscilla marina ATCC 2...   265    2e-69 
ref|YP_001733417.1|  chaperonin GroEL-II (Cpn 60) [Synechococc...   265    2e-69  Gene info
dbj|BAB79566.1|  60 kDa chaperonin [secondary symbiont of Acyr...   265    2e-69 
ref|YP_003109085.1|  chaperonin GroEL [Acidimicrobium ferrooxi...   265    2e-69  Gene info
ref|NP_868643.1|  60 kDa chaperonin 5 [Rhodopirellula baltica ...   265    2e-69  Gene info
ref|NP_622247.1|  chaperonin GroEL [Thermoanaerobacter tengcon...   265    2e-69  Gene info
ref|ZP_02420146.1|  hypothetical protein ANACAC_02757 [Anaeros...   265    2e-69 
ref|ZP_02207884.1|  hypothetical protein COPEUT_02710 [Coproco...   265    3e-69 
ref|ZP_03627924.1|  chaperonin GroEL [bacterium Ellin514] >gb|...   265    3e-69 
sp|Q60024.2|CH60_THEBR  RecName: Full=60 kDa chaperonin; AltNa...   265    3e-69 
ref|ZP_04036736.1|  chaperonin GroL [Meiothermus silvanus DSM ...   265    3e-69 
ref|ZP_03168779.1|  hypothetical protein RUMLAC_02471 [Ruminoc...   265    3e-69 
dbj|BAH22154.1|  GroEL [Arthrospira platensis]                      265    3e-69 
ref|ZP_03275215.1|  chaperonin GroEL [Arthrospira maxima CS-32...   265    3e-69 
ref|ZP_05427260.1|  chaperonin GroL [Eubacterium saphenum ATCC...   265    3e-69 
gb|AAQ96141.1|  GroEL protein [Hafnia alvei] >gb|AAQ96142.1| G...   265    3e-69 
gb|ABU92197.1|  GroEL [Vibrio vulnificus] >gb|ABU92198.1| GroE...   265    3e-69 
ref|ZP_06383813.1|  chaperonin GroEL [Arthrospira platensis st...   265    3e-69 
gb|ABU92213.1|  GroEL [Vibrio vulnificus]                           265    3e-69 
gb|ABW76102.1|  chaperonin 60 [Trimastix pyriformis]                265    4e-69 
dbj|BAH22163.1|  GroEL [Oscillatoria rosea IAM M-220]               265    4e-69 
ref|YP_001818115.1|  chaperonin GroEL [Opitutus terrae PB90-1]...   265    4e-69  Gene info
ref|ZP_04776753.1|  chaperonin GroL [Gemella haemolysans ATCC ...   265    4e-69 
sp|Q08854.3|CH60_STAAU  RecName: Full=60 kDa chaperonin; AltNa...   265    4e-69 
gb|ACB46469.1|  heat shock protein GroEL [Actinomadura kijaniata]   265    4e-69 
ref|ZP_01470072.1|  Chaperonin Cpn60/TCP-1 [Synechococcus sp. ...   265    4e-69 
ref|ZP_05016294.1|  60 kDa chaperonin [Streptomyces sviceus AT...   264    4e-69 
ref|YP_001621222.1|  chaperonin GroEL [Acholeplasma laidlawii ...   264    4e-69  Gene info
gb|ABU92221.1|  GroEL [Vibrio vulnificus]                           264    5e-69 
ref|ZP_03916444.1|  chaperone GroEL [Anaerococcus lactolyticus...   264    5e-69 
dbj|BAH22165.1|  GroEL [Phormidium ambiguum IAM M-71]               264    5e-69 
sp|P94820.1|CH60_HOLOB  RecName: Full=60 kDa chaperonin; AltNa...   264    5e-69 
gb|AAQ55588.1|  chaperonin GroEL [Streptococcus constellatus]       264    5e-69 
ref|ZP_05733228.1|  chaperonin GroL [Dialister invisus DSM 154...   264    5e-69 
gb|AAQ55585.1|  chaperonin GroEL [Streptococcus oralis]             264    5e-69 
gb|AAQ24831.1|  GroEL [Streptococcus mitis]                         264    6e-69 
ref|NP_938952.1|  chaperonin GroEL [Corynebacterium diphtheria...   264    6e-69  Gene info
gb|AAQ96131.1|  GroEL protein [Enterobacter cloacae]                264    6e-69 
dbj|BAH22156.1|  GroEL [Leptolyngbya sp. PCC 73110]                 264    6e-69 
sp|O50323.2|CH601_THEVL  RecName: Full=60 kDa chaperonin 1; Al...   264    6e-69 
ref|YP_003421828.1|  chaperonin GroL [cyanobacterium UCYN-A] >...   264    6e-69 
ref|ZP_04012437.1|  chaperonin GroEL [Lactobacillus ultunensis...   264    6e-69 
gb|AAQ96130.1|  GroEL protein [Enterobacter cloacae]                264    6e-69 
gb|ABU92242.1|  GroEL [Vibrio vulnificus]                           264    7e-69 
gb|AAQ96132.1|  GroEL protein [Enterobacter cloacae]                264    7e-69 
ref|YP_002483053.1|  chaperonin GroEL [Cyanothece sp. PCC 7425...   263    7e-69  Gene info
gb|AAQ96134.1|  GroEL protein [Enterobacter cloacae]                263    7e-69 
gb|AAQ96145.1|  GroEL protein [Klebsiella oxytoca]                  263    7e-69 
ref|YP_001508152.1|  chaperonin GroEL [Frankia sp. EAN1pec] >g...   263    7e-69  Gene info
ref|ZP_05037566.1|  chaperonin GroL [Synechococcus sp. PCC 733...   263    7e-69 
ref|XP_002002753.1|  GI17556 [Drosophila mojavensis] >gb|EDW12...   263    7e-69  Gene info
ref|ZP_01732054.1|  chaperonin GroEL [Cyanothece sp. CCY0110] ...   263    7e-69 
ref|ZP_02075905.1|  hypothetical protein CLOL250_02692 [Clostr...   263    8e-69 
gb|AAQ96146.1|  GroEL protein [Klebsiella oxytoca] >gb|AAQ9614...   263    8e-69 
ref|NP_440731.1|  chaperonin GroEL [Synechocystis sp. PCC 6803...   263    8e-69  Gene info
gb|ABU92215.1|  GroEL [Vibrio vulnificus] >gb|ABU92216.1| GroE...   263    8e-69 
ref|XP_318461.2|  AGAP004002-PA [Anopheles gambiae str. PEST] ...   263    8e-69  UniGene infoGene info
gb|ABU92245.1|  GroEL [Vibrio vulnificus] >gb|ABU92248.1| GroE...   263    8e-69 
ref|YP_377748.1|  chaperonin GroEL [Synechococcus sp. CC9902] ...   263    8e-69  Gene info
gb|ABU92226.1|  GroEL [Vibrio vulnificus] >gb|ABU92227.1| GroE...   263    8e-69 
ref|ZP_02043562.1|  hypothetical protein ACTODO_00405 [Actinom...   263    9e-69 
ref|ZP_05337091.1|  chaperonin GroEL [Thermoanaerobacterium th...   263    9e-69 
ref|YP_292974.1|  chaperonin GroEL [Prochlorococcus marinus st...   263    9e-69  Gene info
ref|ZP_06304948.1|  Chaperonin Cpn60/TCP-1 [Raphidiopsis brook...   263    9e-69 
ref|ZP_05487394.1|  chaperonin GroEL [Streptomyces sp. SPB78]       263    9e-69 
ref|YP_001360489.1|  chaperonin GroEL [Kineococcus radiotolera...   263    1e-68  Gene info
ref|ZP_04991396.1|  chaperonin 1 [Streptomyces sp. SPB74] >gb|...   263    1e-68 
gb|AAQ55589.1|  chaperonin GroEL [Streptococcus sanguinis]          263    1e-68 
ref|ZP_06309236.1|  Chaperonin Cpn60/TCP-1 [Cylindrospermopsis...   263    1e-68 
ref|YP_003238183.1|  chaperonin GroEL [Ammonifex degensii KC4]...   263    1e-68  Gene info
gb|ABU92259.1|  GroEL [Vibrio vulnificus] >gb|ABU92260.1| GroE...   263    1e-68 
gb|AAQ96135.1|  GroEL protein [Escherichia coli] >gb|AAQ96137....   263    1e-68 
ref|ZP_02963988.1|  chaperonin GroEL [Bifidobacterium animalis...   263    1e-68 
ref|YP_001014333.1|  chaperonin GroEL [Prochlorococcus marinus...   263    1e-68  Gene info
gb|AAQ96136.1|  GroEL protein [Escherichia coli] >gb|AAQ96140....   263    1e-68 
gb|AAF89507.2|  heat shock protein 60 [Bifidobacterium animali...   263    1e-68 
ref|YP_003336897.1|  chaperonin GroEL [Streptosporangium roseu...   263    1e-68  Gene info
ref|XP_001610603.1|  heat shock protein 60 [Babesia bovis T2Bo...   263    1e-68  Gene info
ref|ZP_05707982.1|  chaperonin GroEL [Corynebacterium genitali...   263    1e-68 
ref|ZP_02080614.1|  hypothetical protein CLOLEP_02071 [Clostri...   263    1e-68 
gb|AAW49251.2|  heat shock protein 60 [Liriomyza sativae]           263    1e-68 
gb|ACT52824.1|  heat shock protein 60 [Chilo suppressalis]          263    1e-68 
gb|AAQ55586.1|  chaperonin GroEL [Streptococcus intermedius]        263    1e-68 
gb|ABB76384.1|  heat shock protein 60 kDa [Paralichthys olivac...   263    1e-68 
sp|P31081.2|CH60_BOVIN  RecName: Full=60 kDa heat shock protei...   263    1e-68  Gene info
gb|ABB76381.1|  heat shock protein 60 kDa [Paralichthys olivac...   262    2e-68 
gb|AAM76713.1|  chaperonin Cpn60 [Danio rerio]                      262    2e-68  Gene info
ref|NP_897945.1|  chaperonin GroEL [Synechococcus sp. WH 8102]...   262    2e-68  Gene info
ref|ZP_05847066.1|  chaperonin GroEL [Corynebacterium jeikeium...   262    2e-68 
ref|ZP_05854975.1|  chaperonin GroL [Blautia hansenii DSM 2058...   262    2e-68 
ref|ZP_02025410.1|  hypothetical protein EUBVEN_00660 [Eubacte...   262    2e-68 
ref|YP_056459.1|  chaperonin GroEL [Propionibacterium acnes KP...   262    2e-68  Gene info
ref|NP_851847.1|  heat shock 60 kD protein 1 [Danio rerio] >gb...   262    2e-68  UniGene infoGene info
ref|ZP_03990822.1|  chaperone GroEL [Oribacterium sinus F0268]...   262    2e-68 
gb|AAW24883.1|  SJCHGC09129 protein [Schistosoma japonicum]         262    2e-68 
ref|YP_001102799.1|  chaperonin GroEL [Saccharopolyspora eryth...   262    2e-68  Gene info
ref|NP_001127086.1|  heat shock 60kDa protein 1 (chaperonin) p...   262    2e-68  Gene info
ref|YP_171554.1|  chaperonin GroEL [Synechococcus elongatus PC...   262    2e-68  Gene info
ref|YP_251523.1|  chaperonin GroEL [Corynebacterium jeikeium K...   262    2e-68  Gene info
gb|ACL00842.1|  heat shock protein 60 [Biomphalaria glabrata]       262    2e-68 
dbj|BAG48528.1|  chaperonin GroEL [Nostoc cf. commune KG-102]       262    2e-68 
ref|YP_001546443.1|  chaperonin GroEL [Herpetosiphon aurantiac...   262    2e-68  Gene info
ref|NP_680976.1|  chaperonin GroEL [Thermosynechococcus elonga...   262    2e-68  Gene info
gb|AAI02078.1|  HSPD1 protein [Bos taurus]                          262    2e-68  Gene info
ref|XP_857282.1|  PREDICTED: similar to 60 kDa heat shock prot...   262    2e-68  UniGene infoGene info
ref|ZP_02041330.1|  hypothetical protein RUMGNA_02097 [Ruminoc...   262    2e-68 
ref|YP_001849437.1|  60 kDa chaperone (GroEL1) [Mycobacterium ...   262    2e-68  Gene info
gb|ACN43305.1|  HSP60 [Strongyloides ratti]                         262    2e-68 
dbj|BAG48532.1|  chaperonin GroEL [Nostoc commune]                  262    2e-68 
ref|YP_951608.1|  chaperonin GroEL [Mycobacterium vanbaalenii ...   262    2e-68  Gene info
ref|XP_536016.2|  PREDICTED: similar to 60 kDa heat shock prot...   262    2e-68  UniGene infoGene info
ref|ZP_03768102.1|  chaperonin GroEL ['Nostoc azollae' 0708] >...   262    2e-68 
ref|XP_001502715.1|  PREDICTED: similar to 60 kDa heat shock p...   262    2e-68  UniGene infoGene info
ref|YP_473815.1|  chaperonin GroEL [Synechococcus sp. JA-3-3Ab...   262    3e-68  Gene info
gb|AAQ96126.1|  GroEL protein [Citrobacter freundii] >gb|AAQ96...   262    3e-68 
gb|AAQ96125.1|  GroEL protein [Citrobacter freundii]                262    3e-68 
ref|XP_001370003.1|  PREDICTED: similar to 60 kDa heat shock p...   261    3e-68  UniGene infoGene info
ref|XP_001169030.1|  PREDICTED: chaperonin isoform 2 [Pan trog...   261    3e-68  UniGene infoGene info
ref|XP_001928634.1|  PREDICTED: heat shock 60kDa protein 1 (ch...   261    3e-68  UniGene infoGene info
ref|NP_001160080.1|  60 kDa heat shock protein, mitochondrial ...   261    3e-68  UniGene infoGene info
ref|YP_001550335.1|  chaperonin GroEL [Prochlorococcus marinus...   261    3e-68  Gene info
dbj|BAG48520.1|  chaperonin GroEL [Nostoc flagelliforme MAC]        261    3e-68 
gb|AAQ96128.1|  GroEL protein [Citrobacter freundii]                261    3e-68 
gb|ABY65231.1|  HSP60 [Strongyloides ratti]                         261    3e-68 
dbj|BAE88661.1|  unnamed protein product [Macaca fascicularis]      261    3e-68 
ref|NP_002147.2|  chaperonin [Homo sapiens] >ref|NP_955472.1| ...   261    3e-68  UniGene infoGene info
ref|ZP_06238201.1|  chaperonin GroEL [Frankia sp. EuI1c] >gb|E...   261    3e-68 
ref|XP_001169156.1|  PREDICTED: chaperonin isoform 5 [Pan trog...   261    3e-68  UniGene infoGene info
gb|ACE06961.1|  mitochondrial heat shock 60kD protein 1 varian...   261    3e-68  Gene info
ref|ZP_05979756.1|  chaperonin GroL [Subdoligranulum variabile...   261    3e-68 
dbj|BAF95909.1|  chaperonin GroEL [Nostoc commune]                  261    3e-68 
ref|XP_001169135.1|  PREDICTED: chaperonin isoform 4 [Pan trog...   261    4e-68  UniGene infoGene info
ref|YP_002461865.1|  chaperonin GroEL [Chloroflexus aggregans ...   261    4e-68  Gene info
ref|XP_002133115.1|  GA28835 [Drosophila pseudoobscura pseudoo...   261    4e-68  Gene info
gb|AAF91444.1|AF281650_1  heat shock protein Hsp65 [Mycobacter...   261    4e-68 
gb|ABU92241.1|  GroEL [Vibrio vulnificus]                           261    4e-68 
ref|YP_001659622.1|  chaperonin GroEL [Microcystis aeruginosa ...   261    4e-68  Gene info
dbj|BAH22169.1|  GroEL [Pseudanabaena sp. PCC 6903]                 261    4e-68 
emb|CAO88453.1|  groL1 [Microcystis aeruginosa PCC 7806]            261    4e-68 
ref|ZP_05224769.1|  chaperonin GroEL [Mycobacterium intracellu...   261    4e-68 
gb|AAQ55590.1|  chaperonin GroEL [Streptococcus pneumoniae]         261    4e-68 
emb|CAX83020.1|  Heat shock protein 60 [Schistosoma japonicum]      261    4e-68 
ref|ZP_03705937.1|  hypothetical protein CLOSTMETH_00657 [Clos...   261    4e-68 
emb|CAA52630.1|  heat shock protein 65 [Mycobacterium avium su...   261    4e-68 
ref|NP_962870.1|  chaperonin GroEL [Mycobacterium avium subsp....   261    4e-68  Gene info
ref|XP_002065398.1|  GK14688 [Drosophila willistoni] >gb|EDW76...   261    4e-68  Gene info
ref|YP_883834.1|  chaperonin GroEL [Mycobacterium avium 104] >...   261    4e-68  Gene info
ref|ZP_04368139.1|  chaperonin GroL [Cellulomonas flavigena DS...   261    4e-68 
dbj|BAH22160.1|  GroEL [Microcoleus chthonoplastes PCC 7420]        261    5e-68 
ref|YP_946791.1|  chaperonin GroEL [Arthrobacter aurescens TC1...   261    5e-68  Gene info
ref|ZP_03783505.1|  hypothetical protein RUMHYD_02973 [Blautia...   261    5e-68 
ref|ZP_02442357.1|  hypothetical protein ANACOL_01647 [Anaerot...   261    5e-68 
dbj|BAG48530.1|  chaperonin GroEL [Nostoc commune IAM M-13]         261    5e-68 
ref|YP_001741691.1|  Cpn60 chaperonin GroEL, large subunit of ...   261    5e-68  Gene info
gb|AAB94640.1|  heat shock protein 60 [Culicoides variipennis]      261    5e-68 
ref|YP_001160649.1|  chaperonin GroEL [Salinispora tropica CNB...   261    5e-68  Gene info
dbj|BAA02180.1|  GroEL [Synechocystis sp. PCC 6803]                 261    5e-68 
ref|ZP_01084912.1|  60 kD chaperonin 2, GroEL-like 2 [Synechoc...   261    5e-68 
gb|AAK49534.1|AF359268_1  chaperonin 60 [Dictyostelium discoid...   261    5e-68 
ref|XP_002078259.1|  GD23355 [Drosophila simulans] >gb|EDX0384...   261    6e-68  UniGene infoGene info
emb|CAI62555.2|  heat shock protein 60 [Nyctotherus ovalis]         261    6e-68 
ref|ZP_05026862.1|  chaperonin GroL [Microcoleus chthonoplaste...   260    6e-68 
gb|ABI26641.1|  HSP60 [Carassius auratus]                           260    6e-68 
ref|XP_001962681.1|  GF15575 [Drosophila ananassae] >gb|EDV319...   260    6e-68  Gene info
gb|ABU92249.1|  GroEL [Vibrio vulnificus]                           260    6e-68 
ref|ZP_04605736.1|  chaperonin groEL [Micromonospora sp. ATCC ...   260    6e-68 
ref|YP_003371548.1|  chaperonin GroEL [Pirellula staleyi DSM 6...   260    6e-68  Gene info
gb|AAI06113.1|  Hspd1 protein [Mus musculus]                        260    6e-68  Gene info
ref|ZP_02866616.1|  hypothetical protein CLOSPI_00416 [Clostri...   260    7e-68 
ref|XP_971630.1|  PREDICTED: similar to 60 kDa heat shock prot...   260    7e-68  UniGene infoGene info
dbj|BAG48522.1|  chaperonin GroEL [Nostoc cf. commune SO-36]        260    7e-68 
ref|YP_830277.1|  chaperonin GroEL [Arthrobacter sp. FB24] >sp...   260    7e-68  Gene info
gb|ABU92240.1|  GroEL [Vibrio vulnificus] >gb|ABU92253.1| GroE...   260    7e-68 
ref|XP_001641093.1|  predicted protein [Nematostella vectensis...   260    7e-68  UniGene infoGene info
ref|NP_896609.1|  chaperonin GroEL [Synechococcus sp. WH 8102]...   260    8e-68  Gene info
ref|NP_034607.3|  heat shock protein 1 (chaperonin) [Mus muscu...   260    8e-68  UniGene infoGene info
ref|YP_003315890.1|  chaperonin GroL [Sanguibacter keddieii DS...   260    8e-68  Gene info
dbj|BAC40607.1|  unnamed protein product [Mus musculus]             260    8e-68  Gene info
emb|CAA38564.1|  heat shock protein (hsp60) precursor [Rattus ...   260    8e-68  Gene info
ref|XP_002037978.1|  GM18564 [Drosophila sechellia] >gb|EDW543...   260    9e-68  Gene info
ref|XP_002051422.1|  GJ15562 [Drosophila virilis] >gb|EDW63577...   260    9e-68  Gene info
ref|ZP_02993258.1|  hypothetical protein CLOSPO_00301 [Clostri...   260    9e-68 
emb|CAA38762.1|  heat shock protein 65 [Mus musculus]               260    9e-68  Gene info
ref|ZP_03757745.1|  hypothetical protein CLOSTASPAR_01755 [Clo...   260    9e-68 
ref|NP_001012934.1|  heat shock 60kDa protein 1 (chaperonin) p...   260    9e-68  UniGene infoGene info
emb|CAA37653.1|  unnamed protein product [Mus musculus]             260    9e-68  Gene info
ref|ZP_05025142.1|  chaperonin GroL [Microcoleus chthonoplaste...   260    9e-68 
ref|ZP_05367972.1|  chaperonin GroL [Rothia mucilaginosa ATCC ...   260    9e-68 
sp|P18687.1|CH60_CRIGR  RecName: Full=60 kDa heat shock protei...   260    9e-68 
ref|YP_003361898.1|  chaperonin GroEL [Rothia mucilaginosa DY-...   260    1e-67  Gene info
ref|ZP_05046175.1|  chaperonin GroL [Cyanobium sp. PCC 7001] >...   260    1e-67 
gb|AAA99670.2|  PTB65K [Mycobacterium avium subsp. paratubercu...   259    1e-67 
emb|CAA37654.1|  unnamed protein product [Rattus norvegicus]        259    1e-67  Gene info
ref|XP_636839.1|  chaperonin 60 [Dictyostelium discoideum AX4]...   259    1e-67  UniGene infoGene info
gb|AAC04902.1|  mitochondrial chaperonin (HSP60) [Arabidopsis ...   259    1e-67 
ref|YP_001864510.1|  chaperonin GroEL [Nostoc punctiforme PCC ...   259    1e-67  Gene info
gb|ACI49647.1|  heat shock protein 60 [Botrytis sp. OnionBC-59]     259    1e-67 
ref|YP_003327505.1|  chaperonin GroEL [Xylanimonas cellulosily...   259    1e-67 
ref|ZP_03274473.1|  chaperonin GroEL [Arthrospira maxima CS-32...   259    1e-67 
emb|CAA53019.1|  GroEL1 [Streptomyces coelicolor]                   259    1e-67 
gb|AAA36022.1|  chaperonin (HSP60) [Homo sapiens]                   259    1e-67  Gene info
ref|YP_905407.1|  chaperonin GroEL [Mycobacterium ulcerans Agy...   259    1e-67  Gene info
ref|XP_002089193.1|  GE25548 [Drosophila yakuba] >gb|EDW88905....   259    1e-67  Gene info
ref|YP_904989.1|  chaperonin GroEL [Mycobacterium ulcerans Agy...   259    1e-67  Gene info
gb|AAN62887.1|AF456472_1  heat shock protein 65 [Mycobacterium...   259    1e-67 
gb|ABY89662.1|  mitochondrial heat shock protein 60 [Calanus g...   259    1e-67 
ref|YP_001849074.1|  60 kDa chaperonin 2 GroEL2 [Mycobacterium...   259    1e-67  Gene info
gb|AAN62890.1|AF456475_1  heat shock protein 65 [Mycobacterium...   259    1e-67 
emb|CAJ72874.1|  strongly similar to 60 kDa chaperonin (groEL ...   259    1e-67 
ref|ZP_02089232.1|  hypothetical protein CLOBOL_06801 [Clostri...   259    1e-67 
ref|XP_001850501.1|  60 kDa heat shock protein, mitochondrial ...   259    1e-67  UniGene infoGene info
ref|YP_001701402.1|  chaperonin GroEL [Mycobacterium abscessus...   259    1e-67  Gene info
ref|NP_608948.2|  Hsp60C, isoform C [Drosophila melanogaster] ...   259    1e-67  UniGene infoGene info
gb|AAC53362.1|  chaperonin 60 [Rattus norvegicus]                   259    1e-67  Gene info
ref|ZP_05516828.1|  chaperonin GroEL [Streptomyces hygroscopic...   259    2e-67 
gb|AAA27314.1|  chaperonin [Synechococcus sp.]                      259    2e-67 
ref|YP_871863.1|  chaperonin GroEL [Acidothermus cellulolyticu...   259    2e-67  Gene info
gb|AAB21806.1|  heat shock protein hsp60, hsp60=chaperonin [mi...   259    2e-67 
dbj|BAG48534.1|  chaperonin GroEL [Nostoc linckia var. arvense...   259    2e-67 
gb|AAN62885.1|AF456470_1  heat shock protein 65 [Mycobacterium...   259    2e-67 
ref|XP_001963430.1|  GF20294 [Drosophila ananassae] >gb|EDV445...   259    2e-67  Gene info
ref|YP_001875814.1|  chaperonin GroEL [Elusimicrobium minutum ...   259    2e-67  Gene info
ref|YP_001228115.1|  chaperonin GroEL [Synechococcus sp. RCC30...   259    2e-67  Gene info
ref|NP_875980.1|  chaperonin GroEL [Prochlorococcus marinus su...   259    2e-67  Gene info
ref|YP_872123.1|  chaperonin GroEL [Acidothermus cellulolyticu...   259    2e-67  Gene info
ref|YP_001225586.1|  chaperonin GroEL [Synechococcus sp. WH 78...   259    2e-67  Gene info
ref|XP_001968832.1|  GG25088 [Drosophila erecta] >gb|EDV57891....   259    2e-67  Gene info
ref|XP_002192336.1|  PREDICTED: heat shock 60kDa protein 1 (ch...   259    2e-67  UniGene infoGene info
ref|NP_895161.1|  chaperonin GroEL [Prochlorococcus marinus st...   259    2e-67  Gene info
ref|NP_045126.1|  chaperonin GroEL [Cyanidium caldarium] >sp|Q...   259    2e-67  Gene info
ref|XP_001661764.1|  chaperonin-60kD, ch60 [Aedes aegypti] >gb...   259    2e-67  UniGene infoGene info
ref|ZP_01084067.1|  chaperonin GroEL [Synechococcus sp. WH 570...   259    2e-67 
dbj|BAH22147.1|  GroEL [Synechococcus elongatus PCC 6301]           259    2e-67 
dbj|BAG48516.1|  chaperonin GroEL [Nostoc cf. verrucosum]           259    2e-67 
ref|YP_003148578.1|  chaperonin GroL [Kytococcus sedentarius D...   259    2e-67  Gene info
ref|ZP_05553558.1|  chaperonin GroL [Lactobacillus coleohomini...   259    2e-67 
ref|ZP_01470924.1|  chaperonin GroEL [Synechococcus sp. RS9916...   259    2e-67 
ref|YP_288289.1|  chaperonin GroEL [Thermobifida fusca YX] >sp...   259    2e-67  Gene info
ref|XP_002484775.1|  antigenic mitochondrial protein HSP60, pu...   259    2e-67  Gene info
ref|XP_001686778.1|  chaperonin Hsp60, mitochondrial precursor...   259    2e-67  Gene info
gb|AAM29278.1|  AT16985p [Drosophila melanogaster]                  259    2e-67 
ref|YP_172499.1|  chaperonin GroEL [Synechococcus elongatus PC...   259    2e-67  Gene info
ref|YP_731479.1|  chaperonin GroEL [Synechococcus sp. CC9311] ...   258    2e-67  Gene info
gb|AAQ55587.1|  chaperonin GroEL [Streptococcus parasanguinis]      258    2e-67 
ref|YP_003098255.1|  chaperonin GroEL [Actinosynnema mirum DSM...   258    2e-67  Gene info
ref|YP_001016667.1|  chaperonin GroEL [Prochlorococcus marinus...   258    2e-67  Gene info
ref|ZP_03946505.1|  chaperone GroEL [Atopobium vaginae DSM 158...   258    2e-67 
ref|XP_002132071.1|  PREDICTED: similar to AGAP004002-PA [Cion...   258    2e-67  UniGene infoGene info
ref|YP_936626.1|  chaperonin GroEL [Mycobacterium sp. KMS] >re...   258    2e-67  Gene info
ref|XP_002149398.1|  antigenic mitochondrial protein HSP60, pu...   258    2e-67  Gene info
gb|ABG06728.1|  chaperonin GroEL [Mycobacterium sp. MCS]            258    2e-67  Gene info
ref|ZP_06344560.1|  chaperonin GroEL [Clostridium sp. M62/1]        258    3e-67 
ref|YP_292161.1|  chaperonin GroEL [Prochlorococcus marinus st...   258    3e-67  Gene info
gb|AAN62883.1|AF456468_1  heat shock protein 65 [Mycobacterium...   258    3e-67 
ref|XP_002428684.1|  Hsp60 protein, putative [Pediculus humanu...   258    3e-67  Gene info
ref|ZP_01123100.1|  hypothetical protein WH7805_13593 [Synecho...   258    3e-67 
ref|ZP_03926647.1|  chaperonin GroEL [Actinomyces urogenitalis...   258    3e-67 
emb|CAA29360.1|  unnamed protein product [Synechococcus elonga...   258    3e-67 
ref|YP_003317744.1|  chaperonin GroEL [Thermanaerovibrio acida...   258    3e-67  Gene info
sp|Q8RU00.1|CH60_BRECH  RecName: Full=60 kDa chaperonin; AltNa...   258    3e-67 
ref|XP_001082397.1|  PREDICTED: chaperonin isoform 2 [Macaca m...   258    3e-67  UniGene infoGene info
ref|ZP_05367719.1|  chaperonin GroL [Rothia mucilaginosa ATCC ...   258    3e-67 
ref|YP_001432868.1|  chaperonin GroEL [Roseiflexus castenholzi...   258    3e-67  Gene info
ref|NP_001096355.1|  hypothetical protein LOC100124945 [Xenopu...   258    3e-67  UniGene infoGene info
ref|YP_001799788.1|  chaperonin GroEL [Corynebacterium urealyt...   258    3e-67  Gene info
ref|YP_117096.1|  chaperonin GroEL [Nocardia farcinica IFM 101...   258    3e-67  Gene info
ref|XP_002110795.1|  hypothetical protein TRIADDRAFT_54071 [Tr...   258    3e-67  Gene info
gb|AAM34755.1|  heat shock protein 60 [Trichinella spiralis]        258    4e-67 
ref|NP_874842.1|  chaperonin GroEL [Prochlorococcus marinus su...   258    4e-67  Gene info
ref|YP_002371414.1|  chaperonin GroEL [Cyanothece sp. PCC 8801...   258    4e-67  Gene info
gb|EFC83152.1|  chaperonin GroEL [Frankia sp. EUN1f]                258    4e-67 
ref|YP_003362188.1|  chaperonin GroEL [Rothia mucilaginosa DY-...   258    4e-67  Gene info
gb|AAA62399.1|  groEL [Zymomonas mobilis subsp. mobilis CP4]        258    4e-67 
emb|CAJ78415.1|  heat shock protein 60 [Botrytis elliptica]         258    4e-67 
ref|YP_720226.1|  chaperonin GroEL [Trichodesmium erythraeum I...   258    4e-67  Gene info
emb|CAG29914.1|  heat shock protein 60 [Botrytis allii]             258    4e-67 
ref|YP_885283.1|  chaperonin GroEL [Mycobacterium smegmatis st...   258    4e-67  Gene info
emb|CAG29907.1|  heat shock protein 60 [Botryotinia pelargonii...   258    4e-67 
gb|ABE73686.1|  mitochondrial chaperonin Hsp56 [Paracentrotus ...   258    4e-67 
gb|AAL09728.1|  AT3g13860/MCP4_7 [Arabidopsis thaliana]             258    4e-67 
gb|ACB14356.1|  heat shock protein 60 [Botryotinia fuckeliana]      258    4e-67 
ref|YP_001275436.1|  chaperonin GroEL [Roseiflexus sp. RS-1] >...   258    4e-67  Gene info
emb|CAG29937.1|  heat shock protein 60 [Botryotinia ficariarum]     258    4e-67 
emb|CAG29954.1|  heat shock protein 60 [Botryotinia porri]          258    4e-67 
ref|ZP_05790488.1|  chaperonin GroL [Synechococcus sp. WH 8109...   258    4e-67 
emb|CAB56199.1|  Chaperonin [Paracentrotus lividus]                 258    4e-67 
ref|ZP_05046417.1|  chaperonin GroL [Cyanobium sp. PCC 7001] >...   258    4e-67 
ref|ZP_04748479.1|  chaperonin GroEL [Mycobacterium kansasii A...   258    4e-67 
dbj|BAG35173.1|  unnamed protein product [Homo sapiens]             258    4e-67  Gene info
ref|XP_001552177.1|  heat shock protein 60 [Botryotinia fuckel...   258    4e-67  Gene info
sp|P35480.1|CH60_BRANA  RecName: Full=Chaperonin CPN60, mitoch...   258    5e-67 
emb|CAJ78423.1|  heat shock protein 60 [Botrytis tulipae]           258    5e-67 
ref|YP_001636330.1|  chaperonin GroEL [Chloroflexus aurantiacu...   258    5e-67  Gene info
ref|YP_002048876.1|  chaperonin GroEL [Paulinella chromatophor...   258    5e-67  Gene info
ref|ZP_02616741.1|  chaperonin GroEL [Clostridium botulinum Bf...   257    5e-67 
ref|XP_002162506.1|  PREDICTED: similar to predicted protein [...   257    5e-67  UniGene infoGene info
ref|NP_566466.1|  HSP60-3A (HEAT SHOCK PROTEIN 60-3A); ATP bin...   257    5e-67  UniGene infoGene info
ref|ZP_01079478.1|  Chaperonin [Synechococcus sp. RS9917] >gb|...   257    5e-67 
ref|ZP_01623075.1|  chaperonin GroEL [Lyngbya sp. PCC 8106] >g...   257    5e-67 
gb|AAK61605.1|  heat shock protein 60 precursor [Neocallimasti...   257    5e-67 
ref|YP_003154308.1|  chaperonin GroL [Brachybacterium faecium ...   257    5e-67  Gene info
ref|YP_382463.1|  chaperonin GroEL [Synechococcus sp. CC9605] ...   257    5e-67  Gene info
ref|ZP_04452552.1|  hypothetical protein GCWU000182_01856 [Abi...   257    5e-67 
dbj|BAF94141.1|  heat shock protein 60 [Alligator mississippie...   257    5e-67 
gb|AAH41192.1|  Hspd1 protein [Xenopus laevis]                      257    5e-67  Gene info
ref|XP_001597891.1|  heat shock protein 60, mitochondrial prec...   257    5e-67  Gene info
ref|YP_001788614.1|  chaperonin GroEL [Clostridium botulinum A...   257    5e-67  Gene info
ref|YP_001518705.1|  chaperonin GroEL [Acaryochloris marina MB...   257    6e-67  Gene info
ref|NP_001083970.1|  similar to heat shock 60kDa protein 1 (ch...   257    6e-67  UniGene infoGene info
ref|NP_001056181.1|  Os05g0540300 [Oryza sativa (japonica cult...   257    6e-67  UniGene infoGene info
emb|CAG29908.1|  heat shock protein 60 [Monilinia fructigena] ...   257    6e-67 
emb|CAX83108.1|  Heat shock protein 60 [Schistosoma japonicum]      257    6e-67 
ref|YP_001255782.1|  chaperonin GroEL [Clostridium botulinum A...   257    6e-67  Gene info
ref|ZP_05913738.1|  chaperonin GroEL [Brevibacterium linens BL2]    257    6e-67 
gb|ABB01006.1|  heat shock protein 60 [Homo sapiens] >gb|EAW70...   257    6e-67  Gene info
gb|EEC79614.1|  hypothetical protein OsI_20809 [Oryza sativa I...   257    6e-67 
ref|YP_832365.1|  chaperonin GroEL [Arthrobacter sp. FB24] >sp...   257    7e-67  Gene info
gb|ACA63849.1|  chaperonin groEL [Mycobacterium avium] >gb|ACA...   257    7e-67 
ref|ZP_01628482.1|  Chaperonin [Nodularia spumigena CCY9414] >...   257    7e-67 
ref|XP_484008.1|  PREDICTED: similar to Heat shock protein 1 (...   257    7e-67  UniGene infoGene info
ref|ZP_01079593.1|  60 kD chaperonin 2, GroEL-like protein 2 [...   257    7e-67 
ref|ZP_01855423.1|  60 kDa chaperonin 5 [Planctomyces maris DS...   257    7e-67 
ref|YP_001015656.1|  chaperonin GroEL [Prochlorococcus marinus...   257    8e-67  Gene info
ref|YP_324127.1|  chaperonin GroEL [Anabaena variabilis ATCC 2...   257    8e-67  Gene info
gb|ABY86688.1|  chaperonin GroEL2 [Sorangium cellulosum]            257    8e-67 
ref|YP_376518.1|  chaperonin GroEL [Synechococcus sp. CC9902] ...   257    8e-67  Gene info
ref|YP_380944.1|  chaperonin GroEL [Synechococcus sp. CC9605] ...   257    8e-67  Gene info
ref|XP_795205.2|  PREDICTED: similar to mitochondrial chaperon...   256    9e-67  UniGene infoGene info
ref|YP_001551440.1|  chaperonin GroEL [Prochlorococcus marinus...   256    9e-67  Gene info
ref|NP_497429.1|  Heat Shock Protein family member (hsp-60) [C...   256    9e-67  UniGene infoGene info
ref|YP_716828.1|  chaperonin GroEL [Frankia alni ACN14a] >sp|Q...   256    9e-67  Gene info
gb|EFC83626.1|  chaperonin GroEL [Frankia sp. EUN1f]                256    9e-67 
ref|YP_944097.1|  chaperonin Cpn60, GroEL, large subunit of Gr...   256    9e-67  Gene info
ref|NP_487702.1|  chaperonin GroEL [Nostoc sp. PCC 7120] >sp|Q...   256    9e-67  Gene info
ref|YP_002485791.1|  chaperonin GroEL [Cyanothece sp. PCC 7425...   256    9e-67  Gene info
dbj|BAH22177.1|  GroEL [Fischerella muscicola PCC 7414]             256    1e-66 
ref|ZP_04856896.1|  conserved hypothetical protein [Ruminococc...   256    1e-66 
ref|YP_483473.1|  chaperonin GroEL [Frankia sp. CcI3] >sp|Q2J4...   256    1e-66  Gene info
emb|CAA65238.1|  heat shock protein 60 [Euglena gracilis]           256    1e-66 
emb|CAG29917.1|  heat shock protein 60 [Botrytis allii]             256    1e-66 
ref|YP_002486978.1|  chaperonin GroEL [Arthrobacter chlorophen...   256    1e-66  Gene info
gb|ACB06715.1|  heat shock protein 60 [Botryotinia porri]           256    1e-66 
ref|ZP_02427557.1|  hypothetical protein CLORAM_00944 [Clostri...   256    1e-66 
ref|ZP_03935326.1|  chaperonin GroEL [Corynebacterium striatum...   256    1e-66 
ref|ZP_03800175.1|  hypothetical protein COPCOM_02442 [Coproco...   256    1e-66 
gb|AAR88509.1|  mitochondrial 60 kDa heat shock protein [Anemo...   256    1e-66 
gb|ACB06710.1|  heat shock protein 60 [Botryotinia fuckeliana]      256    1e-66 
ref|ZP_04427359.1|  chaperonin GroL [Planctomyces limnophilus ...   256    1e-66 
ref|YP_003344285.1|  chaperonin GroEL [Streptosporangium roseu...   256    1e-66  Gene info
ref|YP_003179211.1|  chaperonin GroEL [Atopobium parvulum DSM ...   256    1e-66 
gb|AAA25298.1|  58-kDa common antigen [Legionella pneumophila]      256    1e-66 
gb|ACB14355.1|  heat shock protein 60 [Botrytis sp. BroadbeanB...   256    1e-66 
ref|ZP_06218230.1|  chaperonin GroEL [Micromonospora aurantiac...   256    1e-66 
emb|CAG29924.1|  heat shock protein 60 [Botryotinia fuckeliana...   256    1e-66 
emb|CAG29933.1|  heat shock protein 60 [Botrytis elliptica]         256    1e-66 
ref|XP_822882.1|  chaperonin Hsp60 [Trypanosoma brucei TREU927...   256    1e-66  Gene info
gb|ACY25666.1|  chaperonin-like protein HSP60 [Brugia malayi]       256    1e-66 
gb|ACN11370.1|  60 kDa heat shock protein, mitochondrial precu...   256    1e-66 
ref|NP_214954.1|  chaperonin GroEL [Mycobacterium tuberculosis...   256    1e-66  Gene info
gb|ACB06707.1|  heat shock protein 60 [Botrytis sp. BroadbeanB...   256    1e-66 
emb|CAG29919.1|  heat shock protein 60 [Botrytis allii]             256    1e-66 
ref|ZP_04668598.1|  conserved hypothetical protein [Clostridia...   256    2e-66 
ref|YP_711940.1|  chaperonin GroEL [Frankia alni ACN14a] >sp|Q...   256    2e-66  Gene info
ref|NP_001079654.1|  similar to heat shock 60kDa protein 1 (ch...   256    2e-66  UniGene infoGene info
sp|Q37683.2|CH60_TRYBB  RecName: Full=Chaperonin HSP60, mitoch...   256    2e-66 
ref|YP_001539003.1|  chaperonin GroEL [Salinispora arenicola C...   256    2e-66  Gene info
ref|ZP_01726909.1|  60kD chaperonin 2 [Cyanothece sp. CCY0110]...   256    2e-66 
dbj|BAE93569.1|  molecular chaperonin large subunit GroEL [Sum...   256    2e-66 
gb|ACI49650.1|  heat shock protein 60 [Botrytis byssoidea]          256    2e-66 
ref|XP_001469794.1|  chaperonin Hsp60, mitochondrial precursor...   256    2e-66  Gene info
ref|XP_001902773.1|  chaperonine protein HSP60 [Brugia malayi]...   256    2e-66  Gene info
gb|AAS77401.1|  65 kDa heat shock protein [Mycobacterium absce...   256    2e-66 
ref|XP_002433722.1|  chaperonin subunit, putative [Ixodes scap...   255    2e-66  UniGene infoGene info
ref|YP_001010028.1|  chaperonin GroEL [Prochlorococcus marinus...   255    2e-66  Gene info
ref|ZP_04427361.1|  chaperonin GroL [Planctomyces limnophilus ...   255    2e-66 
ref|XP_001469793.1|  chaperonin Hsp60, mitochondrial precursor...   255    2e-66  Gene info
ref|ZP_03568548.1|  chaperonin GroL [Atopobium rimae ATCC 4962...   255    2e-66 
ref|YP_001854529.1|  60 kDa chaperonin [Kocuria rhizophila DC2...   255    2e-66  Gene info
gb|AAN62888.1|AF456473_1  heat shock protein 65 [Mycobacterium...   255    2e-66 
ref|YP_001484903.1|  chaperonin GroEL [Prochlorococcus marinus...   255    2e-66  Gene info
emb|CAA10230.1|  heat shock protein 60 (HSP60) [Plectus acumin...   255    2e-66 
ref|XP_002527401.1|  chaperonin-60kD, ch60, putative [Ricinus ...   255    2e-66  Gene info
gb|ACI33148.1|  60 kDa heat shock protein, mitochondrial precu...   255    2e-66 
gb|ACA04000.1|  GroEL [Rhodomonas sp. CCMP2045]                     255    2e-66 
ref|ZP_06116141.1|  chaperonin GroEL [Clostridium hathewayi DS...   255    2e-66 
ref|ZP_03625033.1|  chaperonin Cpn60/TCP-1 [Streptococcus suis...   255    3e-66 
ref|ZP_04837345.1|  chaperonin GroL [Corynebacterium matruchot...   255    3e-66 
ref|YP_001404252.1|  chaperonin GroEL [Candidatus Methanoregul...   255    3e-66  Gene info
ref|YP_001091850.1|  chaperonin GroEL [Prochlorococcus marinus...   255    3e-66  Gene info
ref|YP_001131424.1|  chaperonin GroEL [Mycobacterium gilvum PY...   255    3e-66  Gene info
ref|ZP_03709716.1|  hypothetical protein CORMATOL_00531 [Coryn...   255    3e-66 
emb|CAJ78417.1|  heat shock protein 60 [Botryotinia fuckeliana...   255    3e-66 
ref|YP_948583.1|  chaperonin GroEL [Arthrobacter aurescens TC1...   254    3e-66  Gene info
gb|AAM83128.1|  chaperonin GroEL [Streptococcus dysgalactiae s...   254    3e-66 
gb|AAD04243.1|  60 kDa heat shock protein [Bartonella elizabet...   254    3e-66 
ref|YP_398025.1|  chaperonin GroEL [Prochlorococcus marinus st...   254    3e-66  Gene info
ref|ZP_05015144.1|  60 kDa chaperonin [Streptomyces sviceus AT...   254    3e-66 
ref|XP_001086546.1|  PREDICTED: chaperonin [Macaca mulatta]         254    3e-66  UniGene infoGene info
sp|Q39727.1|CH60_EUGGR  RecName: Full=Chaperonin CPN60, mitoch...   254    3e-66 
ref|NP_043141.1|  chaperonin GroEL [Cyanophora paradoxa] >ref|...   254    3e-66  Gene info
gb|AAM69406.1|AF310263_1  heat shock protein HSP60 [Schistosom...   254    3e-66 
ref|NP_301345.1|  chaperonin GroEL [Mycobacterium leprae TN] >...   254    4e-66  Gene info
ref|NP_628468.1|  chaperonin GroEL [Streptomyces coelicolor A3...   254    4e-66  Gene info
ref|ZP_06240134.1|  chaperonin GroEL [Frankia sp. EuI1c] >gb|E...   254    4e-66 
emb|CAF18442.1|  heat shock protein 60 [Enterococcus phoenicul...   254    4e-66 
ref|YP_003411373.1|  chaperonin GroEL [Geodermatophilus obscur...   254    4e-66 
ref|NP_895276.1|  chaperonin GroEL [Prochlorococcus marinus st...   254    4e-66  Gene info
ref|ZP_03717698.1|  hypothetical protein EUBHAL_02785 [Eubacte...   254    4e-66 
ref|YP_643594.1|  chaperonin GroEL [Rubrobacter xylanophilus D...   254    4e-66  Gene info
ref|ZP_01122913.1|  chaperonin GroEL [Synechococcus sp. WH 780...   254    4e-66 
ref|YP_001016521.1|  chaperonin GroEL [Prochlorococcus marinus...   254    4e-66  Gene info
ref|YP_002004222.1|  chaperonin GroEL [Candidatus Phytoplasma ...   254    4e-66  Gene info
ref|XP_002640959.1|  C. briggsae CBR-HSP-60 protein [Caenorhab...   254    4e-66  Gene info
gb|AAA25354.1|  65 kd antigen [Mycobacterium leprae]                254    4e-66 
gb|ACA03522.1|  mitochondrial heat shock protein 60 [Tigriopus...   254    5e-66 
ref|YP_003161996.1|  chaperonin GroEL [Jonesia denitrificans D...   254    5e-66  Gene info
ref|ZP_05420374.1|  heat shock protein 60 family chaperone Gro...   254    5e-66 
gb|AAD27589.1|AF121264_1  chaperonine protein HSP60 [Onchocerc...   254    5e-66 
ref|ZP_05487823.1|  chaperonin GroEL [Streptomyces sp. SPB78]       254    5e-66 
gb|ACN30235.1|  heat shock protein 60 [Litopenaeus vannamei]        254    5e-66 
ref|YP_001225721.1|  chaperonin GroEL [Synechococcus sp. WH 78...   254    5e-66  Gene info
ref|YP_001011929.1|  chaperonin GroEL [Prochlorococcus marinus...   254    5e-66  Gene info
ref|YP_925166.1|  chaperonin GroEL [Nocardioides sp. JS614] >s...   254    5e-66  Gene info
ref|ZP_06380920.1|  chaperonin GroEL [Arthrospira platensis st...   254    5e-66 
ref|ZP_03296468.1|  hypothetical protein COLSTE_00353 [Collins...   254    5e-66 
ref|ZP_02736491.1|  60 kDa chaperonin [Gemmata obscuriglobus U...   254    5e-66 
ref|YP_001293484.1|  type I chaperonin GroEL [Rhodomonas salin...   254    5e-66  Gene info
sp|Q7UM99.2|CH601_RHOBA  RecName: Full=60 kDa chaperonin 1; Al...   254    6e-66 
ref|ZP_04447012.1|  hypothetical protein COLINT_03772 [Collins...   254    6e-66 
ref|XP_001267850.1|  antigenic mitochondrial protein HSP60, pu...   254    6e-66  Gene info
ref|NP_893553.1|  chaperonin GroEL [Prochlorococcus marinus su...   254    6e-66  Gene info
ref|YP_002488648.1|  chaperonin GroEL [Arthrobacter chlorophen...   254    6e-66  Gene info
ref|YP_638323.1|  chaperonin GroEL [Mycobacterium sp. MCS] >re...   254    6e-66  Gene info
ref|ZP_05532375.1|  chaperonin GroEL [Streptomyces viridochrom...   254    6e-66 
ref|YP_002907000.1|  molecular chaperone protein [Corynebacter...   254    6e-66  Gene info
sp|Q93QI2.1|CH60_COREQ  RecName: Full=60 kDa chaperonin; AltNa...   254    6e-66 
ref|XP_001568845.1|  chaperonin Hsp60, mitochondrial precursor...   254    7e-66  Gene info
ref|YP_003340114.1|  chaperonin GroEL [Streptosporangium roseu...   253    7e-66  Gene info
ref|ZP_04687468.1|  chaperonin GroEL [Streptomyces ghanaensis ...   253    7e-66 
ref|ZP_03979949.1|  chaperonin GroEL [Corynebacterium lipophil...   253    7e-66 
dbj|BAB12250.1|  60 kDa heat shock protein [Propionibacterium ...   253    7e-66 
sp|Q00768.3|CH602_STRAL  RecName: Full=60 kDa chaperonin 2; Al...   253    8e-66 
ref|XP_001568844.1|  chaperonin Hsp60, mitochondrial precursor...   253    8e-66  Gene info
ref|XP_001686777.1|  chaperonin Hsp60, mitochondrial precursor...   253    8e-66  Gene info
gb|AAK97285.1|AF304016_1  heat shock protein Hsp60 [Bartonella...   253    8e-66 
gb|AAQ96147.1|  GroEL protein [Klebsiella oxytoca]                  253    8e-66 
ref|NP_825108.1|  chaperonin GroEL [Streptomyces avermitilis M...   253    8e-66  Gene info
ref|ZP_04746477.1|  chaperonin GroEL [Mycobacterium kansasii A...   253    8e-66 
ref|YP_003298433.1|  chaperonin GroEL [Thermomonospora curvata...   253    9e-66  Gene info
gb|AAS89951.1|  GroEL [Bartonella rattimassiliensis]                253    9e-66 
ref|YP_003149927.1|  chaperonin GroL [Kytococcus sedentarius D...   253    9e-66  Gene info
emb|CBG72089.1|  chaperonin 2 [Streptomyces scabiei 87.22]          253    9e-66 
gb|ACN25829.1|  unknown [Zea mays]                                  253    9e-66  Gene info
ref|ZP_05540518.1|  chaperonin GroEL [Streptomyces griseoflavu...   253    9e-66 
ref|XP_002279880.1|  PREDICTED: hypothetical protein [Vitis vi...   253    9e-66  UniGene infoGene info
ref|ZP_04703905.1|  chaperonin GroEL [Streptomyces albus J1074]     253    9e-66 
gb|ACT34879.1|  heat shock protein 60 [Mycobacterium haemophilum]   253    9e-66 
ref|YP_731337.1|  chaperonin GroEL [Synechococcus sp. CC9311] ...   253    1e-65  Gene info
ref|ZP_02863021.1|  hypothetical protein ANASTE_02254 [Anaerof...   253    1e-65 
gb|AAK97286.1|AF304017_1  heat shock protein Hsp60 [Bartonella...   253    1e-65 
ref|ZP_05003743.1|  60 kDa chaperonin [Streptomyces clavuliger...   253    1e-65 
ref|YP_002880844.1|  chaperonin GroEL [Beutenbergia cavernae D...   253    1e-65  Gene info
gb|AAS89950.1|  GroEL [Bartonella rattimassiliensis]                253    1e-65 
ref|NP_868641.1|  60 kDa chaperonin [Rhodopirellula baltica SH...   253    1e-65  Gene info
ref|YP_885962.1|  chaperonin GroEL [Mycobacterium smegmatis st...   253    1e-65  Gene info
dbj|BAE88218.1|  unnamed protein product [Macaca fascicularis]      253    1e-65 
ref|NP_442170.1|  60kD chaperonin 2 [Synechocystis sp. PCC 680...   253    1e-65  Gene info
ref|ZP_03681465.1|  hypothetical protein CATMIT_00077 [Catenib...   253    1e-65 
ref|NP_695233.1|  chaperonin GroEL [Bifidobacterium longum NCC...   253    1e-65  Gene info
emb|CAK99299.1|  groel chaperonin protein [Spiroplasma citri]       253    2e-65 
ref|ZP_05002082.1|  chaperonin 2 [Streptomyces sp. Mg1] >gb|ED...   253    2e-65 
gb|ABX10864.1|  type 1 chaperonin [Rhodomonas sp. CCMP1170]         253    2e-65 
ref|XP_002142730.1|  TCP-1/cpn60 chaperonin family protein [Cr...   252    2e-65  Gene info
gb|AAD16417.1|  chaperonin 60.2 precursor [Leishmania donovani]     252    2e-65 
ref|YP_002322176.1|  chaperonin GroEL [Bifidobacterium longum ...   252    2e-65  Gene info
ref|YP_001136178.1|  chaperonin GroEL [Mycobacterium gilvum PY...   252    2e-65  Gene info
ref|ZP_05801273.1|  chaperonin GroEL [Streptomyces flavogriseu...   252    2e-65 
gb|AAD28326.1|  GroEL [Oscillatoria sp. NKBG091600]                 252    2e-65 
ref|ZP_04331387.1|  chaperonin GroL [Nocardiopsis dassonvillei...   252    2e-65 
ref|YP_001108805.1|  60 kD chaperonin cpn60 [Saccharopolyspora...   252    2e-65  Gene info
ref|ZP_06269623.1|  chaperonin GroEL [Streptomyces sp. ACTE] >...   252    2e-65 
ref|YP_320421.1|  chaperonin GroEL [Anabaena variabilis ATCC 2...   252    2e-65  Gene info
ref|ZP_05508040.1|  chaperonin GroEL [Streptomyces sp. C]           252    2e-65 
gb|AAS77399.1|  65 kDa heat shock protein [Mycobacterium immun...   252    2e-65 
ref|ZP_04695101.1|  chaperonin GroEL [Streptomyces roseosporus...   252    2e-65 
ref|YP_003272875.1|  chaperonin GroEL [Gordonia bronchialis DS...   252    2e-65  Gene info
ref|YP_002957696.1|  chaperonin GroL [Micrococcus luteus NCTC ...   252    2e-65  Gene info
ref|ZP_06160176.1|  chaperonin GroL [Slackia exigua ATCC 70012...   252    3e-65 
ref|YP_001824737.1|  chaperonin GroEL [Streptomyces griseus su...   252    3e-65  Gene info
ref|YP_002533706.1|  60 kDa chaperonin [Thermotoga neapolitana...   252    3e-65  Gene info
ref|NP_963199.1|  chaperonin GroEL [Mycobacterium avium subsp....   252    3e-65  Gene info
gb|AAX93145.1|  unknown [Homo sapiens]                              252    3e-65  Gene info
ref|ZP_05218311.1|  chaperonin GroEL [Mycobacterium avium subs...   251    3e-65 
ref|YP_952333.1|  chaperonin GroEL [Mycobacterium vanbaalenii ...   251    3e-65  Gene info
ref|ZP_05013170.1|  conserved hypothetical protein [Streptomyc...   251    3e-65 
ref|YP_883500.1|  chaperonin GroEL [Mycobacterium avium 104] >...   251    3e-65  Gene info
ref|ZP_04606055.1|  chaperonin groEL [Micromonospora sp. ATCC ...   251    3e-65 
ref|YP_001804744.1|  chaperonin 2 [Cyanothece sp. ATCC 51142] ...   251    3e-65  Gene info
ref|YP_001522017.1|  chaperonin GroEL [Acaryochloris marina MB...   251    3e-65  Gene info
gb|AAM83129.1|  chaperonin GroEL [Streptococcus dysgalactiae s...   251    3e-65 
gb|ACA04002.1|  GroEL [Rhodomonas sp. CCMP1178]                     251    3e-65 
ref|YP_002834010.1|  molecular chaperone protein [Corynebacter...   251    3e-65  Gene info
ref|ZP_06262860.1|  chaperonin GroL [Propionibacterium acnes J...   251    4e-65 
ref|ZP_04040309.1|  chaperonin GroL [Meiothermus ruber DSM 127...   251    4e-65 
ref|ZP_05228102.1|  chaperonin GroEL [Mycobacterium intracellu...   251    4e-65 
gb|ACB14357.1|  heat shock protein 60 [Botrytis fabae]              251    4e-65 
ref|YP_001636476.1|  chaperonin GroEL [Chloroflexus aurantiacu...   251    4e-65  Gene info
ref|XP_821465.1|  chaperonin HSP60 mitochondrial precursor [Tr...   251    4e-65  Gene info
ref|YP_002462405.1|  chaperonin GroEL [Chloroflexus aggregans ...   251    4e-65  Gene info
ref|ZP_06265196.1|  60 kDa chaperonin (Protein Cpn60) (groEL p...   251    4e-65 
gb|AAT95329.1|  GroEL [Bifidobacterium breve UCC2003]               251    4e-65 
ref|NP_789261.1|  chaperonin GroEL [Tropheryma whipplei TW08/2...   251    4e-65  Gene info
ref|YP_055163.1|  chaperonin GroEL [Propionibacterium acnes KP...   251    4e-65  Gene info
ref|YP_706125.1|  chaperonin GroEL [Rhodococcus jostii RHA1] >...   251    4e-65  Gene info
ref|NP_787569.1|  chaperonin GroEL [Tropheryma whipplei str. T...   251    4e-65  Gene info
ref|ZP_03932784.1|  chaperonin GroEL [Corynebacterium accolens...   251    5e-65 
ref|YP_716615.2|  chaperonin GroEL [Frankia alni ACN14a] >sp|Q...   251    5e-65  Gene info
gb|AAS77400.1|  65 kDa heat shock protein [Mycobacterium chelo...   251    5e-65 
emb|CAJ65109.1|  chaperone Hsp60 (GroEL), part of GroE chapero...   251    5e-65  Gene info
sp|Q9KI57.2|CH60_GARVA  RecName: Full=60 kDa chaperonin; AltNa...   251    5e-65 
gb|ACI49652.1|  heat shock protein 60 [Botryotinia porri]           251    5e-65 
sp|P28256.1|CH60_GALSU  RecName: Full=60 kDa chaperonin, chlor...   251    5e-65 
ref|ZP_03937530.1|  chaperone GroEL [Gardnerella vaginalis ATC...   251    6e-65 
ref|YP_003271921.1|  chaperonin GroEL [Gordonia bronchialis DS...   251    6e-65  Gene info
ref|YP_002783442.1|  60 kDa chaperonin [Rhodococcus opacus B4]...   251    6e-65  Gene info
ref|ZP_05861209.1|  chaperonin GroL [Jonquetella anthropi E3_3...   250    6e-65 
ref|YP_001507661.1|  chaperonin GroEL [Frankia sp. EAN1pec] >g...   250    6e-65  Gene info
ref|YP_121491.1|  chaperonin GroEL [Nocardia farcinica IFM 101...   250    6e-65  Gene info
ref|XP_819506.1|  chaperonin HSP60, mitochondrial precursor [T...   250    7e-65  Gene info
ref|YP_003421497.1|  chaperonin GroL [cyanobacterium UCYN-A] >...   250    7e-65 
gb|AAA27284.1|  chaperonin 60 [Synechocystis sp.]                   250    7e-65 
gb|AAP33147.1|AF426026_1  heat shock protein 60 [Piromyces sp....   250    7e-65 
ref|NP_053959.1|  chaperonin GroEL [Porphyra purpurea] >sp|P51...   250    7e-65  Gene info
gb|AAA28077.1|  homologous to chaperonin protein [Caenorhabdit...   250    8e-65 
ref|ZP_06219684.1|  chaperonin GroEL [Micromonospora aurantiac...   250    8e-65 
ref|YP_001799322.1|  Chaperonin GroEL (Hsp60) [Candidatus Phyt...   250    8e-65  Gene info
ref|ZP_04383221.1|  chaperonin GroL [Rhodococcus erythropolis ...   250    8e-65 
sp|Q95046.1|CH60_TRYCR  RecName: Full=Chaperonin HSP60, mitoch...   250    8e-65 
ref|XP_819508.1|  chaperonin HSP60, mitochondrial precursor [T...   250    8e-65  Gene info
ref|XP_001467869.1|  chaperonin Hsp60, mitochondrial precursor...   250    9e-65  Gene info
ref|ZP_03646057.1|  chaperonin GroEL [Bifidobacterium bifidum ...   250    9e-65 
emb|CAG02593.1|  unnamed protein product [Tetraodon nigroviridis]   250    9e-65 
ref|XP_002595084.1|  hypothetical protein BRAFLDRAFT_115228 [B...   250    9e-65  UniGene infoGene info
ref|YP_001535232.1|  chaperonin GroEL [Salinispora arenicola C...   250    9e-65  Gene info
ref|YP_001157132.1|  chaperonin GroEL [Salinispora tropica CNB...   250    1e-64  Gene info
ref|ZP_00513753.1|  Chaperonin Cpn60/TCP-1 [Crocosphaera watso...   250    1e-64 
gb|AAD16418.1|  chaperonin 60.1 precursor [Leishmania donovani]     249    1e-64 
ref|XP_001071820.1|  PREDICTED: similar to 60 kDa heat shock p...   249    1e-64  Gene info
gb|AAM83127.1|  chaperonin GroEL [Streptococcus dysgalactiae s...   249    1e-64 
ref|XP_001685504.1|  chaperonin Hsp60, mitochondrial precursor...   249    1e-64  Gene info
sp|Q94596.1|CH60_LEIMA  RecName: Full=Chaperonin HSP60, mitoch...   249    1e-64 
ref|ZP_04447134.1|  hypothetical protein BIFANG_02100 [Bifidob...   249    1e-64 
sp|P25420.1|CH63_HELVI  RecName: Full=63 kDa chaperonin, mitoc...   249    1e-64 
ref|XP_002441451.1|  hypothetical protein SORBIDRAFT_09g026970...   249    1e-64  UniGene infoGene info
ref|YP_002765371.1|  60 kDa chaperonin [Rhodococcus erythropol...   249    1e-64  Gene info
ref|YP_001866446.1|  chaperonin GroEL [Nostoc punctiforme PCC ...   249    1e-64  Gene info
ref|ZP_01976957.1|  60 kDa chaperonin 2 [Vibrio cholerae B33] ...   249    1e-64 
sp|P97086.1|CH60_TSUTY  RecName: Full=60 kDa chaperonin; AltNa...   249    1e-64 
ref|XP_001567558.1|  chaperonin Hsp60, mitochondrial precursor...   249    2e-64  Gene info
ref|ZP_03371099.1|  chaperonin GroEL [Salmonella enterica subs...   249    2e-64 
ref|ZP_02034964.1|  hypothetical protein BACCAP_00553 [Bactero...   249    2e-64 
ref|ZP_03743765.1|  hypothetical protein BIFPSEUDO_04372 [Bifi...   249    2e-64 
ref|YP_003397588.1|  chaperonin GroEL [Conexibacter woesei DSM...   249    2e-64  Gene info
ref|ZP_02919144.1|  hypothetical protein BIFDEN_02468 [Bifidob...   249    2e-64 
ref|ZP_01130380.1|  chaperonin GroEL [marine actinobacterium P...   249    2e-64 
ref|YP_481274.1|  chaperonin GroEL [Frankia sp. CcI3] >sp|Q2JA...   249    2e-64  Gene info
ref|NP_301373.1|  chaperonin GroEL [Mycobacterium leprae TN] >...   248    2e-64  Gene info
ref|ZP_03325052.1|  hypothetical protein BIFCAT_01868 [Bifidob...   248    2e-64 
ref|YP_003110433.1|  chaperonin GroEL [Acidimicrobium ferrooxi...   248    2e-64  Gene info
gb|AAA30203.1|  heat shock protein 60 [Trypanosoma cruzi]           248    2e-64 
ref|ZP_04025423.1|  chaperonin GroL [Tsukamurella paurometabol...   248    3e-64 
gb|ABE11322.1|  GroEL2 protein [uncultured Prochlorococcus mar...   248    3e-64 
ref|ZP_03393187.1|  chaperonin GroL [Corynebacterium amycolatu...   248    3e-64 
emb|CAA42909.1|  KCS [Mycobacterium tuberculosis]                   248    3e-64 
ref|ZP_01772003.1|  Hypothetical protein COLAER_00993 [Collins...   248    3e-64 
ref|YP_474840.1|  chaperonin GroEL [Synechococcus sp. JA-3-3Ab...   248    3e-64  Gene info
ref|YP_524251.1|  chaperonin GroEL [Rhodoferax ferrireducens T...   248    3e-64  Gene info
ref|YP_003142957.1|  chaperonin GroL [Slackia heliotrinireduce...   248    3e-64  Gene info
ref|NP_217934.1|  chaperonin GroEL [Mycobacterium tuberculosis...   248    3e-64  Gene info
gb|AAM83130.1|  chaperonin GroEL [Streptococcus dysgalactiae]       248    4e-64 
gb|AAK18613.1|  heat shock protein 60 [Nocardia farcinica]          248    4e-64 
ref|ZP_05324751.1|  chaperonin GroEL [Mycobacterium tuberculos...   248    4e-64 
sp|O33658.3|CH602_STRLI  RecName: Full=60 kDa chaperonin 2; Al...   248    4e-64 
ref|YP_456796.1|  chaperonin GroEL [Aster yellows witches'-bro...   248    4e-64  Gene info
ref|ZP_01470734.1|  hypothetical protein RS9916_33517 [Synecho...   248    4e-64 
ref|YP_980633.1|  chaperonin GroEL [Polaromonas naphthalenivor...   248    4e-64  Gene info
gb|ABJ97613.1|  mitochondrial 60 kDa heat shock protein [Micro...   248    4e-64 
ref|YP_477842.1|  chaperonin GroEL [Synechococcus sp. JA-2-3B'...   248    4e-64  Gene info
ref|YP_003373944.1|  chaperonin GroL [Gardnerella vaginalis 40...   248    4e-64  Gene info
ref|YP_002764973.1|  60 kDa chaperonin [Rhodococcus erythropol...   248    5e-64  Gene info
ref|ZP_02028450.1|  hypothetical protein BIFADO_00881 [Bifidob...   247    5e-64 
ref|YP_001139535.1|  chaperonin GroEL [Corynebacterium glutami...   247    5e-64  Gene info
ref|ZP_03970967.1|  chaperonin GroEL [Corynebacterium glucuron...   247    6e-64 
gb|ABI37013.1|  heat shock protein 65 [Mycobacterium haemophilum]   247    6e-64 
sp|Q9AMJ8.1|CH601_ANASL  RecName: Full=60 kDa chaperonin 1; Al...   247    6e-64 
ref|YP_001704459.1|  60 kDa chaperonin 1 (GroEL protein 1) [My...   247    6e-64  Gene info
ref|NP_601912.1|  chaperonin GroEL [Corynebacterium glutamicum...   247    6e-64  Gene info
ref|ZP_03919646.1|  chaperonin GroEL [Corynebacterium glucuron...   247    6e-64 
ref|YP_003359294.1|  chaperonin GroEL [Cryptomonas paramecium]...   247    6e-64  Gene info
ref|YP_702111.1|  chaperonin GroEL [Rhodococcus jostii RHA1] >...   247    7e-64  Gene info
dbj|BAH29731.1|  60 kDa heat shock protein [Dicyema japonicum]      247    7e-64 
ref|YP_001223222.1|  chaperonin GroEL [Clavibacter michiganens...   247    7e-64  Gene info
sp|Q9AFC5.1|CH60_NOCAS  RecName: Full=60 kDa chaperonin; AltNa...   247    7e-64 
gb|AAF18475.2|  heat shock protein 60 [Bifidobacterium adolesc...   247    8e-64 
ref|ZP_03994492.1|  chaperonin GroEL [Mobiluncus mulieris ATCC...   246    9e-64 
ref|ZP_05965815.1|  chaperonin GroL [Bifidobacterium gallicum ...   246    9e-64 
ref|ZP_05708652.1|  chaperonin groEL [Corynebacterium genitali...   246    9e-64 
ref|ZP_04339753.1|  chaperonin GroL [Dethiosulfovibrio peptido...   246    9e-64 
ref|YP_909428.1|  chaperonin GroEL [Bifidobacterium adolescent...   246    1e-63  Gene info
gb|ABW91170.2|  heat shock protein 65 [Mycobacterium lepromato...   246    1e-63 
ref|NP_739171.1|  chaperonin GroEL [Corynebacterium efficiens ...   246    1e-63  Gene info
ref|ZP_05765945.1|  chaperonin GroEL [Mycobacterium tuberculos...   246    1e-63 
ref|YP_002906935.1|  molecular chaperone protein [Corynebacter...   246    1e-63  Gene info
ref|YP_003002179.1|  60 kDa chaperonin [Aureoumbra lagunensis]...   246    1e-63  Gene info
ref|ZP_03393304.1|  chaperonin GroL [Corynebacterium amycolatu...   246    1e-63 
dbj|BAE93573.1|  molecular chaperonin large subunit GroEL [Por...   246    1e-63 
dbj|BAE93533.1|  molecular chaperonin GroEL [Mulberry dwarf ph...   246    1e-63 
ref|YP_002779055.1|  60 kDa chaperonin [Rhodococcus opacus B4]...   246    1e-63  Gene info
ref|YP_003132369.1|  chaperonin GroL [Saccharomonospora viridi...   246    2e-63  Gene info
ref|NP_950373.1|  chaperonin GroEL [Onion yellows phytoplasma ...   246    2e-63  Gene info
dbj|BAE93537.1|  molecular chaperonin GroEL [Paulownia witches...   246    2e-63 
ref|YP_537030.1|  chaperonin GroEL [Porphyra yezoensis] >dbj|B...   246    2e-63  Gene info
sp|Q1XDD8.2|CH60_PORYE  RecName: Full=60 kDa chaperonin, chlor...   246    2e-63 
ref|ZP_01094295.1|  60 kDa chaperonin [Blastopirellula marina ...   246    2e-63 
ref|YP_003183156.1|  chaperonin GroEL [Eggerthella lenta DSM 2...   245    2e-63 
dbj|BAE93521.1|  molecular chaperonin GroEL [Onion yellows phy...   245    2e-63 
ref|YP_003154206.1|  chaperonin GroL [Brachybacterium faecium ...   245    2e-63  Gene info
ref|NP_043619.1|  chaperonin GroEL [Odontella sinensis] >sp|P4...   245    3e-63  Gene info
ref|ZP_05036175.1|  chaperonin GroL [Synechococcus sp. PCC 733...   245    3e-63 
ref|YP_002835792.1|  molecular chaperone protein [Corynebacter...   245    3e-63  Gene info
ref|ZP_05748273.1|  chaperone protein GroEL [Erysipelothrix rh...   245    3e-63 
ref|XP_569211.1|  heat shock protein [Cryptococcus neoformans ...   245    3e-63  Gene info
ref|XP_763701.1|  heat shock protein 60 [Theileria parva strai...   245    3e-63  Gene info
sp|Q9AFA5.1|CH60_TSUPA  RecName: Full=60 kDa chaperonin; AltNa...   244    3e-63 
gb|ABQ42241.1|  65 kDa heat shock protein [Mycobacterium mucog...   244    3e-63 
ref|YP_003407919.1|  chaperonin GroEL [Geodermatophilus obscur...   244    4e-63 
gb|ABQ42252.1|  65 kDa heat shock protein [Mycobacterium mucog...   244    4e-63 
ref|NP_050670.1|  chaperonin GroEL [Guillardia theta] >sp|O784...   244    4e-63  Gene info
gb|ABY22232.1|  chaperonin GroEL [Renibacterium salmoninarum A...   244    4e-63  Gene info
ref|YP_002956505.1|  chaperonin GroL [Micrococcus luteus NCTC ...   244    4e-63  Gene info
ref|NP_940351.1|  chaperonin GroEL [Corynebacterium diphtheria...   244    4e-63  Gene info
dbj|BAE93545.1|  molecular chaperonin GroEL [Potato purple top...   244    4e-63 
ref|YP_001623646.2|  chaperonin GroEL [Renibacterium salmonina...   244    4e-63  Gene info
gb|AAS98955.1|  65-kDa heat shock protein [Mycobacterium sp. M...   244    5e-63 
ref|ZP_00997268.1|  chaperonin GroEL [Janibacter sp. HTCC2649]...   244    5e-63 
ref|ZP_03977936.1|  chaperonin GroEL [Corynebacterium lipophil...   244    6e-63 
ref|YP_003118786.1|  chaperonin GroEL [Catenulispora acidiphil...   244    6e-63  Gene info
ref|YP_062649.1|  chaperonin GroEL [Leifsonia xyli subsp. xyli...   244    6e-63  Gene info
ref|ZP_04484565.1|  chaperonin GroL [Stackebrandtia nassauensi...   244    6e-63 
gb|AAQ96133.1|  GroEL protein [Enterobacter cloacae]                244    6e-63 
ref|YP_277332.1|  chaperonin GroEL [Emiliania huxleyi] >sp|Q4G...   244    7e-63  Gene info
gb|AAS98954.1|  65-kDa heat shock protein [Mycobacterium sp. M...   244    7e-63 
ref|ZP_05846367.1|  chaperonin GroEL [Corynebacterium jeikeium...   243    9e-63 
ref|YP_250037.1|  chaperonin GroEL [Corynebacterium jeikeium K...   243    9e-63  Gene info
gb|AAS98957.1|  65-kDa heat shock protein [Mycobacterium sp. M...   243    9e-63 
ref|ZP_06300052.1|  Chaperonin GroEL [Parachlamydia acanthamoe...   243    1e-62 
ref|ZP_03923076.1|  chaperonin GroEL [Mobiluncus curtisii ATCC...   243    1e-62 
dbj|BAH12833.1|  unnamed protein product [Homo sapiens]             243    1e-62  Gene info
ref|YP_001624917.1|  60 kDa chaperonin GroEL [Renibacterium sa...   243    1e-62  Gene info
ref|ZP_03711288.1|  hypothetical protein CORMATOL_02129 [Coryn...   243    1e-62 
emb|CAZ65632.1|  GroEL protein [Acetobacter aceti]                  243    1e-62 
ref|ZP_04486413.1|  chaperonin GroL [Stackebrandtia nassauensi...   243    1e-62 
ref|ZP_02871111.1|  60 kDa chaperonin GROEL [candidate divisio...   243    2e-62 
emb|CBI35954.1|  unnamed protein product [Vitis vinifera]           243    2e-62 
ref|YP_001855690.1|  chaperonin GroEL [Kocuria rhizophila DC22...   242    2e-62  Gene info
ref|YP_002327574.1|  60KD chaperonin [Vaucheria litorea] >gb|A...   242    2e-62  Gene info
emb|CAN78641.1|  hypothetical protein [Vitis vinifera]              242    2e-62 
gb|AAS98953.1|  65-kDa heat shock protein [Mycobacterium sp. M...   242    2e-62 
gb|AAS98964.1|  65-kDa heat shock protein [Mycobacterium sp. M...   242    2e-62 
ref|ZP_03935977.1|  chaperonin GroEL [Corynebacterium striatum...   242    2e-62 
gb|AAS98958.1|  65-kDa heat shock protein [Mycobacterium sp. M...   242    2e-62 
ref|ZP_03932089.1|  chaperonin GroEL [Corynebacterium accolens...   242    3e-62 
emb|CAF18438.1|  heat shock protein 60 [Enterococcus gilvus]        242    3e-62 
ref|ZP_05476895.1|  chaperonin GroEL [Streptomyces sp. AA4]         242    3e-62 
gb|AAS98959.1|  65-kDa heat shock protein [Mycobacterium sp. M...   241    3e-62 
gb|AAS98963.1|  65-kDa heat shock protein [Mycobacterium sp. M...   241    3e-62 
ref|YP_003383792.1|  chaperonin GroEL [Kribbella flavida DSM 1...   241    4e-62  Gene info
gb|ABB87028.1|  65 kDa heat shock protein [Mycobacterium intra...   241    4e-62 
ref|YP_001801109.1|  chaperonin GroEL [Corynebacterium urealyt...   241    4e-62  Gene info
gb|ABB87019.1|  65 kDa heat shock protein [Mycobacterium avium...   241    4e-62 
gb|ABB87023.1|  65 kDa heat shock protein [Mycobacterium avium...   241    4e-62 
gb|AAB39487.1|  chaperonin 60 [Trichomonas vaginalis]               241    4e-62 
gb|ABB87024.1|  65 kDa heat shock protein [Mycobacterium avium...   241    4e-62 
ref|ZP_03920229.1|  chaperonin GroEL [Corynebacterium pseudoge...   241    5e-62 
ref|ZP_01976548.1|  60 kDa chaperonin 1 [Vibrio cholerae B33] ...   241    5e-62 
ref|ZP_05912571.1|  chaperonin GroEL [Brevibacterium linens BL2]    241    5e-62 
gb|AAS98962.1|  65-kDa heat shock protein [Mycobacterium sp. M...   241    5e-62 
ref|ZP_03921001.1|  possible chaperonin GroEL [Corynebacterium...   241    5e-62 
gb|ABZ81431.1|  60 kDa chaperonin 1 [Mycobacterium avium subsp...   241    6e-62 
gb|ABZ81432.1|  60 kDa chaperonin 1 [Mycobacterium avium subsp...   240    6e-62 
gb|ACJ09104.1|  65 kDa heat shock protein [Mycobacterium sp. F...   240    7e-62 
ref|ZP_05366914.1|  chaperonin GroL [Corynebacterium tuberculo...   240    7e-62 
ref|YP_001510251.1|  chaperonin GroEL [Frankia sp. EAN1pec] >g...   240    9e-62  Gene info
sp|O33659.3|CH601_STRLI  RecName: Full=60 kDa chaperonin 1; Al...   240    1e-61 
gb|ABZ81439.1|  60 kDa chaperonin 1 [Mycobacterium avium subsp...   239    1e-61 
ref|XP_001312753.1|  chaperonin 60 [Trichomonas vaginalis G3] ...   239    1e-61  Gene info
emb|CAY85861.1|  GroEL protein [Granulibacter bethesdensis]         239    1e-61 
ref|YP_874451.1|  60 kDa chaperonin [Phaeodactylum tricornutum...   239    1e-61  Gene info
dbj|BAG48544.1|  chaperonin GroEL [Nostoc sp. KU001]                239    1e-61 
ref|YP_711392.2|  chaperonin GroEL [Frankia alni ACN14a] >sp|Q...   239    2e-61  Gene info
ref|ZP_05092759.1|  chaperonin GroL [Carboxydibrachium pacific...   239    2e-61 
gb|ABK24483.1|  unknown [Picea sitchensis]                          239    2e-61 
ref|ZP_06341902.1|  chaperonin GroL [Bulleidia extructa W1219]...   239    2e-61 
ref|NP_892570.1|  chaperonin GroEL [Prochlorococcus marinus su...   239    2e-61  Gene info
emb|CAJ59798.1|  chaperone Hsp60 (GroEL), part of GroE chapero...   239    2e-61  Gene info
gb|ACJ09111.1|  65 kDa heat shock protein [Mycobacterium sp. F...   239    2e-61 
ref|YP_479746.1|  chaperonin GroEL [Frankia sp. CcI3] >sp|Q2JF...   239    2e-61  Gene info
ref|ZP_06144562.1|  chaperonin GroEL [Ruminococcus flavefacien...   238    2e-61 
ref|YP_003200603.1|  chaperonin GroEL [Nakamurella multipartit...   238    2e-61 
emb|CAY85840.1|  GroEL protein [Gluconacetobacter swingsii]         238    2e-61 
gb|ACJ09108.1|  65 kDa heat shock protein [Mycobacterium sp. F...   238    3e-61 
gb|ACJ09107.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   238    3e-61 
ref|ZP_04027381.1|  chaperonin GroL [Tsukamurella paurometabol...   238    3e-61 
ref|ZP_02532136.1|  chaperonin GroEL [Endoriftia persephone 'H...   238    3e-61 
gb|AAS98961.1|  65-kDa heat shock protein [Mycobacterium sp. M...   238    3e-61 
emb|CAY85833.1|  GroEL protein [Gluconacetobacter oboediens]        238    3e-61 
gb|ACJ09117.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   238    3e-61 
emb|CAY85854.1|  GroEL protein [Gluconobacter oxydans]              238    3e-61 
emb|CAY85822.1|  GroEL protein [Gluconacetobacter intermedius]...   238    3e-61 
ref|YP_001008902.1|  chaperonin GroEL [Prochlorococcus marinus...   238    3e-61  Gene info
ref|XP_001316281.1|  chaperonin 60 [Trichomonas vaginalis G3] ...   238    3e-61  Gene info
ref|YP_003289226.1|  60 kDa chaperone protein [Ectocarpus sili...   238    4e-61  Gene info
ref|YP_001090700.1|  chaperonin GroEL [Prochlorococcus marinus...   238    4e-61  Gene info
ref|YP_001010830.1|  chaperonin GroEL [Prochlorococcus marinus...   238    4e-61  Gene info
dbj|BAH22161.1|  GroEL [Oscillatoria acuminata]                     238    4e-61 
emb|CAY85856.1|  GroEL protein [Gluconobacter oxydans]              238    4e-61 
emb|CAY85836.1|  GroEL protein [Gluconacetobacter saccharivorans]   238    4e-61 
gb|ABZ81438.1|  60 kDa chaperonin 1 [Mycobacterium avium subsp...   238    4e-61 
emb|CAY85830.1|  GroEL protein [Gluconacetobacter nataicola]        238    4e-61 
gb|ACJ09099.1|  65 kDa heat shock protein [Mycobacterium sp. F...   238    4e-61 
emb|CAY85842.1|  GroEL protein [Gluconacetobacter xylinus]          238    4e-61 
emb|CAY85795.1|  GroEL protein [Acidomonas methanolica]             238    5e-61 
ref|ZP_02078397.1|  hypothetical protein EUBDOL_02217 [Eubacte...   238    5e-61 
emb|CAY85843.1|  GroEL protein [Gluconacetobacter xylinus]          238    5e-61 
ref|XP_001747265.1|  hypothetical protein [Monosiga brevicolli...   238    5e-61  Gene info
ref|YP_874582.1|  60 kDa chaperonin [Thalassiosira pseudonana]...   238    5e-61  Gene info
emb|CAY85794.1|  GroEL protein [Acidomonas methanolica]             237    5e-61 
gb|ABI96798.1|  heat shock protein 65 [Mycobacterium fortuitum]     237    6e-61 
emb|CAY85792.1|  GroEL protein [Acidomonas methanolica]             237    6e-61 
emb|CAY85793.1|  GroEL protein [Acidomonas methanolica]             237    6e-61 
gb|ACJ09106.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   237    6e-61 
gb|ACJ09101.1|  65 kDa heat shock protein [Mycobacterium sp. F...   237    6e-61 
gb|ACJ09115.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   237    7e-61 
emb|CAY85835.1|  GroEL protein [Gluconacetobacter rhaeticus]        237    7e-61 
ref|YP_003135230.1|  chaperonin GroL [Saccharomonospora viridi...   237    7e-61  Gene info
ref|ZP_03355237.1|  chaperonin GroEL [Salmonella enterica subs...   237    7e-61 
emb|CAY85826.1|  GroEL protein [Gluconacetobacter kombuchae]        237    8e-61 
gb|AAS89952.1|  GroEL [Bartonella phoceensis]                       237    8e-61 
emb|CAY85845.1|  GroEL protein [Gluconobacter albidus]              237    8e-61 
emb|CAY85821.1|  GroEL protein [Gluconacetobacter hansenii]         237    9e-61 
emb|CAY85844.1|  GroEL protein [Gluconobacter albidus]              236    9e-61 
ref|ZP_05483526.1|  chaperonin GroEL [Streptomyces sp. AA4]         236    9e-61 
gb|ACJ09103.1|  65 kDa heat shock protein [Mycobacterium sp. F...   236    9e-61 
ref|XP_667723.1|  Hsp60 [Cryptosporidium hominis TU502] >gb|EA...   236    1e-60  Gene info
emb|CAY85863.1|  GroEL protein [Neoasaia chiangmaiensis]            236    1e-60 
gb|ACJ09100.1|  65 kDa heat shock protein [Mycobacterium sp. F...   236    1e-60 
ref|XP_627821.1|  Hsp60; GroEL-like chaperone (ATpase), predic...   236    1e-60  Gene info
gb|ACJ09110.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   236    1e-60 
ref|ZP_03488392.1|  hypothetical protein EUBIFOR_00967 [Eubact...   236    1e-60 
emb|CAY85839.1|  GroEL protein [Gluconacetobacter sacchari]         236    1e-60 
emb|CAY85853.1|  GroEL protein [Gluconobacter oxydans]              236    1e-60 
emb|CAY85812.1|  GroEL protein [Gluconacetobacter diazotrophic...   236    1e-60 
ref|YP_001248602.1|  heat shock chaperonin protein 60 kD [Orie...   236    1e-60  Gene info
emb|CAY85829.1|  GroEL protein [Gluconacetobacter liquefaciens]     236    1e-60 
emb|CAY85841.1|  GroEL protein [Gluconacetobacter xylinus]          236    1e-60 
gb|ABI96787.1|  heat shock protein 65 [Mycobacterium salmoniph...   236    2e-60 
gb|AAQ09591.1|  heat shock protein 60 [Cryptosporidium parvum]      236    2e-60 
emb|CAY85827.1|  GroEL protein [Gluconacetobacter liquefaciens...   236    2e-60 
gb|ABI96786.1|  heat shock protein 65 [Mycobacterium salmoniph...   236    2e-60 
ref|YP_003104189.1|  chaperonin GroEL [Actinosynnema mirum DSM...   236    2e-60  Gene info
emb|CAF18441.1|  heat shock protein 60 [Enterococcus pallens]       236    2e-60 
ref|YP_063549.1|  chaperonin GroEL [Gracilaria tenuistipitata ...   236    2e-60  Gene info
ref|NP_001146890.1|  ruBisCO large subunit-binding protein sub...   235    2e-60  UniGene infoGene info
ref|YP_001936951.1|  chaperonin, 60 kDa [Orientia tsutsugamush...   235    2e-60  Gene info
emb|CAY85802.1|  GroEL protein [Asaia krungthepensis]               235    2e-60 
emb|CAY85797.1|  GroEL protein [Asaia bogorensis] >emb|CAY8579...   235    2e-60 
emb|CAY85799.1|  GroEL protein [Asaia bogorensis]                   235    2e-60 
emb|CAY85796.1|  GroEL protein [Asaia bogorensis] >emb|CAY8580...   235    2e-60 
gb|EEH57830.1|  predicted protein [Micromonas pusilla CCMP1545]     235    2e-60 
gb|ACN34709.1|  unknown [Zea mays]                                  235    2e-60 
sp|P16625.1|CH60_ORITS  RecName: Full=60 kDa chaperonin; AltNa...   235    2e-60 
emb|CAY85804.1|  GroEL protein [Asaia siamensis]                    235    2e-60 
emb|CAY85803.1|  GroEL protein [Asaia siamensis]                    235    3e-60 
gb|ACN28096.1|  unknown [Zea mays] >gb|ACN28325.1| unknown [Ze...   235    3e-60 
gb|ACC93831.1|  heat shock protein 65 [Mycobacterium sp. BF4c]      235    3e-60 
emb|CAX12412.1|  60 kDa chaperonin [Fucus vesiculosus]              235    3e-60 
ref|YP_308352.1|  chaperonin GroEL [Dehalococcoides sp. CBDB1]...   235    3e-60  Gene info
gb|ACJ09105.1|  65 kDa heat shock protein [Mycobacterium sp. F...   235    3e-60 
ref|XP_952758.1|  chaperonin (HSP60) [Theileria annulata strai...   235    3e-60  Gene info
ref|XP_002132552.1|  GA25838 [Drosophila pseudoobscura pseudoo...   234    3e-60  Gene info
ref|YP_003204091.1|  chaperonin GroEL [Nakamurella multipartit...   234    4e-60 
ref|YP_003002040.1|  60 kDa chaperonin [Aureococcus anophageff...   234    4e-60  Gene info
sp|P08927.2|RUBB_PEA  RecName: Full=RuBisCO large subunit-bind...   234    4e-60 
gb|ACJ09102.1|  65 kDa heat shock protein [Mycobacterium sp. F...   234    4e-60 
ref|XP_001418926.1|  chaperonin 60 beta chain, chloroplast [Os...   234    4e-60  Gene info
gb|ACJ09097.1|  65 kDa heat shock protein [Mycobacterium sp. 0...   234    4e-60 
ref|XP_002500045.1|  chaperonin 60 beta [Micromonas sp. RCC299...   234    4e-60  Gene info
ref|ZP_05039386.1|  chaperonin GroL [Synechococcus sp. PCC 733...   234    4e-60 
ref|XP_002064505.1|  GK23787 [Drosophila willistoni] >gb|EDW75...   234    4e-60  Gene info
emb|CAM84152.1|  60 kDa heat shock protein [Bartonella birtlesii]   234    4e-60 
gb|AAM83126.1|  chaperonin GroEL [Streptococcus dysgalactiae s...   234    5e-60 
emb|CAY85858.1|  GroEL protein [Gluconobacter thailandicus]         234    5e-60 
emb|CAY85848.1|  GroEL protein [Gluconobacter cerinus]              234    5e-60 
emb|CAY85860.1|  GroEL protein [Gluconobacter thailandicus]         234    5e-60 
emb|CAY85864.1|  GroEL protein [Swaminathania salitolerans]         234    5e-60 
emb|CAY85850.1|  GroEL protein [Gluconobacter frateurii] >emb|...   234    5e-60 
emb|CAY85851.1|  GroEL protein [Gluconobacter frateurii]            234    5e-60 
ref|NP_001056601.1|  Os06g0114000 [Oryza sativa (japonica cult...   234    6e-60  UniGene infoGene info
ref|XP_002003671.1|  GI21603 [Drosophila mojavensis] >gb|EDW13...   234    6e-60  Gene info
ref|ZP_03633274.1|  hypothetical protein HOLDEFILI_00554 [Hold...   234    6e-60 
ref|XP_001754571.1|  predicted protein [Physcomitrella patens ...   234    6e-60  UniGene infoGene info
ref|YP_001214693.1|  chaperonin GroEL [Dehalococcoides sp. BAV...   234    6e-60  Gene info
ref|XP_001754999.1|  predicted protein [Physcomitrella patens ...   234    7e-60  UniGene infoGene info
ref|YP_182136.1|  chaperonin GroEL [Dehalococcoides ethenogene...   234    7e-60  Gene info
gb|EEE64974.1|  hypothetical protein OsJ_19883 [Oryza sativa J...   234    7e-60 
emb|CAY85846.1|  GroEL protein [Gluconobacter cerinus] >emb|CA...   233    8e-60 
gb|ACG36615.1|  ruBisCO large subunit-binding protein subunit ...   233    8e-60 
emb|CAY85805.1|  GroEL protein [Asaia siamensis]                    233    8e-60 
ref|YP_003330650.1|  chaperonin GroEL (HSP60 family) [Dehaloco...   233    8e-60  Gene info
emb|CAY85824.1|  GroEL protein [Gluconacetobacter johannae]         233    9e-60 
emb|CAY85825.1|  GroEL protein [Gluconacetobacter johannae]         233    9e-60 
ref|XP_002523404.1|  rubisco subunit binding-protein beta subu...   233    9e-60  Gene info
gb|ACJ09098.1|  65 kDa heat shock protein [Mycobacterium sp. F...   233    1e-59 
ref|XP_001780334.1|  predicted protein [Physcomitrella patens ...   233    1e-59  UniGene infoGene info
ref|XP_002285746.1|  PREDICTED: hypothetical protein [Vitis vi...   233    1e-59  UniGene infoGene info
gb|AAK97211.1|  HSP60 [Bartonella alsatica]                         233    1e-59 
ref|NP_001045601.1|  Os02g0102900 [Oryza sativa (japonica cult...   233    1e-59  UniGene infoGene info
emb|CAY85807.1|  GroEL protein [Gluconacetobacter azotocaptans]     233    1e-59 
ref|YP_003150549.1|  chaperonin GroL [Cryptobacterium curtum D...   233    1e-59  Gene info
emb|CAL54492.1|  RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUNI...   233    1e-59 
ref|YP_396948.1|  chaperonin GroEL [Prochlorococcus marinus st...   233    1e-59  Gene info
ref|YP_502525.1|  chaperonin GroEL [Methanospirillum hungatei ...   233    1e-59  Gene info
ref|XP_002437709.1|  hypothetical protein SORBIDRAFT_10g001120...   233    2e-59  UniGene infoGene info
gb|AAU87289.1|  65 kDa heat shock protein [Mycobacterium sp. M...   233    2e-59 
emb|CAY85811.1|  GroEL protein [Gluconacetobacter diazotrophicus]   232    2e-59 
gb|ACZ60069.1|  Hsp60 [Fundulus heteroclitus]                       232    2e-59 
emb|CAY85855.1|  GroEL protein [Gluconobacter oxydans]              232    3e-59 
emb|CAF18437.1|  heat shock protein 60 [Enterococcus casselifl...   232    3e-59 
dbj|BAB11583.1|  RuBisCO subunit binding-protein beta subunit ...   231    3e-59 
dbj|BAF00280.1|  RuBisCO subunit binding-protein beta subunit ...   231    3e-59 
ref|NP_001032083.1|  ATP binding / protein binding [Arabidopsi...   231    3e-59  UniGene infoGene info
ref|ZP_06045411.1|  chaperonin GroEL [Aeromicrobium marinum DS...   231    3e-59 
ref|YP_002355066.1|  chaperonin GroEL [Thauera sp. MZ1T] >gb|A...   231    3e-59  Gene info
ref|XP_001965381.1|  GF20641 [Drosophila ananassae] >gb|EDV335...   231    4e-59  Gene info
ref|XP_002052822.1|  GJ17770 [Drosophila virilis] >gb|EDW64977...   231    4e-59  Gene info
gb|AAB39827.1|  chaperonin-60 beta subunit [Solanum tuberosum]      231    4e-59 
gb|ABD65297.1|  heat shock protein [Bartonella tamiae]              231    4e-59 
ref|NP_175945.1|  CPN60B (CHAPERONIN 60 BETA); ATP binding / p...   231    4e-59  UniGene infoGene info
gb|ACN21973.1|  heat shock protein 60 [Tsukamurella tyrosinoso...   231    5e-59 
ref|NP_849007.1|  chaperonin GroEL [Cyanidioschyzon merolae st...   231    5e-59  Gene info
gb|AAM63618.1|  putative rubisco subunit binding-protein alpha...   231    5e-59 
ref|XP_001968203.1|  GG24737 [Drosophila erecta] >gb|EDV57262....   230    6e-59  Gene info
emb|CAY85834.1|  GroEL protein [Gluconacetobacter oboediens]        230    7e-59 
gb|AAK97292.1|AF304023_1  heat shock protein Hsp60 [Bartonella...   230    8e-59 
ref|XP_002303983.1|  predicted protein [Populus trichocarpa] >...   230    8e-59  UniGene infoGene info
ref|XP_001582336.1|  chaperonin [Trichomonas vaginalis G3] >gb...   230    8e-59  Gene info
ref|NP_771275.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   230    9e-59  Gene info
ref|XP_002087459.1|  GE17001 [Drosophila yakuba] >gb|EDW87171....   230    1e-58  Gene info
ref|XP_002014595.1|  GL18870 [Drosophila persimilis] >gb|EDW28...   229    1e-58  Gene info
gb|AAK97291.1|AF304022_1  heat shock protein Hsp60 [Bartonella...   229    1e-58 
ref|YP_886342.1|  chaperonin GroEL [Mycobacterium smegmatis st...   229    2e-58  Gene info
ref|NP_524925.1|  heat shock protein 60 related [Drosophila me...   229    2e-58  UniGene infoGene info
ref|YP_001483733.1|  chaperonin GroEL [Prochlorococcus marinus...   229    2e-58  Gene info
sp|A8G3G6.2|CH601_PROM2  RecName: Full=60 kDa chaperonin 1; Al...   229    2e-58 
sp|P08926.2|RUBA_PEA  RecName: Full=RuBisCO large subunit-bind...   229    2e-58 
sp|P21241.1|RUBB_BRANA  RecName: Full=RuBisCO large subunit-bi...   229    2e-58 
ref|XP_002328161.1|  predicted protein [Populus trichocarpa] >...   229    2e-58  UniGene infoGene info
ref|XP_002534347.1|  rubisco subunit binding-protein alpha sub...   228    2e-58  Gene info
sp|Q95058.1|CH60_TRIVA  RecName: Full=Hydrogenosomal chaperoni...   228    2e-58 
ref|XP_002297617.1|  predicted protein [Populus trichocarpa] >...   228    3e-58  UniGene infoGene info
gb|AAK69694.1|AF355773_1  60 KDa heat shock protein [Bartonell...   228    3e-58 
ref|NP_200461.3|  ATP binding / protein binding [Arabidopsis t...   228    4e-58  UniGene infoGene info
ref|NP_187956.1|  chaperonin, putative [Arabidopsis thaliana] ...   228    4e-58  UniGene infoGene info
ref|XP_002284134.1|  PREDICTED: hypothetical protein [Vitis vi...   228    4e-58  UniGene infoGene info
ref|XP_002077669.1|  GD23041 [Drosophila simulans] >gb|EDX0325...   228    4e-58  Gene info
ref|NP_180367.1|  CPN60A (CHAPERONIN-60ALPHA); ATP binding / p...   228    4e-58  UniGene infoGene info
emb|CAE52530.1|  hsp60 [Lactobacillus delbrueckii subsp. indicus]   228    5e-58 
emb|CAE52527.1|  hsp60 [Lactobacillus delbrueckii subsp. delbr...   228    5e-58 
gb|AAK77276.1|  GH05807p [Drosophila melanogaster]                  228    5e-58 
ref|YP_003274643.1|  chaperonin GroEL [Gordonia bronchialis DS...   227    6e-58  Gene info
sp|P21239.2|RUB1_BRANA  RecName: Full=RuBisCO large subunit-bi...   227    6e-58 
gb|ABR18037.1|  unknown [Picea sitchensis]                          227    6e-58 
ref|XP_002041615.1|  GM16759 [Drosophila sechellia] >gb|EDW454...   227    6e-58  Gene info
gb|ABK91841.1|  mitochondrial heat shock protein 60 [Cryptospo...   227    6e-58 
emb|CAL55987.1|  chaperonin-60, mitochondrial precursor (IC) [...   227    7e-58 
emb|CBI17177.1|  unnamed protein product [Vitis vinifera]           227    9e-58 
ref|XP_001169231.1|  PREDICTED: chaperonin isoform 7 [Pan trog...   226    9e-58  UniGene infoGene info
emb|CAN69818.1|  hypothetical protein [Vitis vinifera]              226    1e-57 
ref|XP_002277357.1|  PREDICTED: hypothetical protein [Vitis vi...   226    1e-57  UniGene infoGene info
dbj|BAB16318.1|  chaperonin-60 alpha subunit [Avicennia marina]     226    2e-57 
ref|NP_001066567.1|  Os12g0277500 [Oryza sativa (japonica cult...   226    2e-57  UniGene infoGene info
gb|AAP03434.1|  GroEL [Ruminococcus flavefaciens FD-1]              226    2e-57 
ref|ZP_05137965.1|  chaperonin GroL [Prochlorococcus marinus s...   226    2e-57 
ref|XP_002313525.1|  predicted protein [Populus trichocarpa] >...   226    2e-57  UniGene infoGene info
ref|YP_008258.1|  heat shock protein GroEL [Candidatus Protoch...   226    2e-57  Gene info
gb|ACJ85785.1|  unknown [Medicago truncatula]                       225    2e-57 
gb|AAR17693.1|  GroEL [Ruminococcus albus 7]                        225    3e-57 
gb|ABK91840.1|  mitochondrial heat shock protein 60 [Cryptospo...   225    3e-57 
ref|YP_765335.1|  chaperonin GroEL [Rhizobium leguminosarum bv...   225    3e-57  Gene info
emb|CAY85849.1|  GroEL protein [Gluconobacter cerinus]              225    3e-57 
dbj|BAE71311.1|  putative rubisco subunit binding-protein alph...   224    4e-57 
gb|ABK91839.1|  mitochondrial heat shock protein 60 [Cryptospo...   224    5e-57 
dbj|BAE71231.1|  putative rubisco subunit binding-protein alph...   224    6e-57 
dbj|BAE71227.1|  putative rubisco subunit binding-protein alph...   224    6e-57 
dbj|BAE71302.1|  putative rubisco subunit binding-protein alph...   224    7e-57 
ref|YP_001936323.1|  chaperonin GroEL [Heterosigma akashiwo] >...   223    8e-57  Gene info
emb|CAE52528.1|  hsp60 [Lactobacillus delbrueckii subsp. bulga...   223    9e-57 
sp|P34794.1|RUB2_BRANA  RecName: Full=RuBisCO large subunit-bi...   223    9e-57 
gb|ACZ56329.1|  putative hsp60-like chaperonin [Mycobacterium ...   223    9e-57 
ref|XP_002572332.1|  heat shock protein 60 [Schistosoma manson...   223    1e-56  UniGene infoGene info
gb|ACA62989.1|  GroEL [Bacteriovorax sp. SJ]                        223    1e-56 
ref|ZP_05096864.1|  hypothetical protein GPB2148_1255 [marine ...   223    1e-56 
emb|CAF21847.1|  GroEL [Lactobacillus ingluviei]                    223    1e-56 
emb|CAF21848.1|  GroEL [Lactobacillus ingluviei]                    223    1e-56 
gb|ACA62988.1|  GroEL [Bacteriovorax sp. JS1]                       223    1e-56 
ref|XP_002440887.1|  hypothetical protein SORBIDRAFT_09g014430...   223    1e-56  UniGene infoGene info
ref|YP_700442.1|  chaperonin GroEL [Rhodococcus jostii RHA1] >...   222    2e-56  Gene info
ref|YP_002799733.1|  chaperonin Cpn60 GroL [Azotobacter vinela...   222    2e-56  Gene info
sp|P08823.1|RUBA_WHEAT  RecName: Full=RuBisCO large subunit-bi...   222    2e-56  Gene info
gb|AAR17694.1|  GroEL [Ruminococcus albus 8]                        222    2e-56 
gb|AAR17695.1|  GroEL [Ruminococcus albus]                          222    2e-56 
dbj|BAB69475.1|  heat shock 60kD protein [Tetrahymena pyriformis]   222    3e-56 
sp|Q7MBB2.1|CH60_MYCGA  RecName: Full=60 kDa chaperonin; AltNa...   222    3e-56 
ref|ZP_02736489.1|  60 kDa chaperonin 5 [Gemmata obscuriglobus...   221    3e-56 
emb|CAY85806.1|  GroEL protein [Asaia siamensis]                    221    4e-56 
gb|ABK91837.1|  mitochondrial heat shock protein 60 [Cryptospo...   221    4e-56 
ref|XP_002463468.1|  hypothetical protein SORBIDRAFT_01g000380...   221    4e-56  UniGene infoGene info
emb|CBH18569.1|  chaperonin Hsp60, mitochondrial precursor, pu...   221    4e-56 
ref|XP_829562.1|  chaperonin Hsp60 mitochondrial precursor [Tr...   221    4e-56  Gene info
gb|AAO24106.1|  heat shock protein GroEL [Chlamydophila felis]      221    4e-56 
ref|XP_002188748.1|  PREDICTED: heat shock 60kDa protein 1 (ch...   221    4e-56  UniGene infoGene info
ref|NP_853259.2|  chaperonin GroEL [Mycoplasma gallisepticum R...   221    5e-56  Gene info
ref|XP_001525500.1|  60 kDa chaperonin [Lodderomyces elongispo...   221    5e-56  Gene info
gb|AAR17696.1|  GroEL [Ruminococcus albus]                          221    5e-56 
gb|AAK60260.1|AF380943_1  short heat shock protein 60 Hsp60s1 ...   221    5e-56  Gene info
emb|CAJ19275.1|  beta chaperonin 60 [Solanum commersonii]           221    5e-56 
ref|XP_001713284.1|  CPN60 protein [Guillardia theta] >emb|CAC...   221    6e-56  Gene info
emb|CAE52531.1|  hsp60 [Lactobacillus delbrueckii subsp. indicus]   221    6e-56 
emb|CAA09304.1|  CPN60 protein [Guillardia theta]                   221    6e-56 
dbj|BAB69474.1|  heat shock 60kD protein [Tetrahymena thermoph...   220    7e-56 
gb|AAP44754.1|  putative rubisco subunit binding-protein alpha...   220    8e-56 
ref|ZP_01855425.1|  60 kDa chaperonin [Planctomyces maris DSM ...   220    8e-56 
ref|NP_001148093.1|  LOC100281701 [Zea mays] >gb|ACG29701.1| r...   220    9e-56  UniGene infoGene info
ref|XP_001703692.1|  chaperonin 60A [Chlamydomonas reinhardtii...   220    1e-55  UniGene infoGene info
gb|EAY92674.1|  hypothetical protein OsI_14427 [Oryza sativa I...   220    1e-55 
ref|ZP_05365107.1|  chaperonin GroL [Corynebacterium tuberculo...   219    1e-55 
emb|CAB51619.1|  unnamed protein product [Ricinus communis]         219    1e-55 
dbj|BAB33385.1|  hsp60 [Paramecium caudatum]                        219    1e-55 
gb|AAL56004.1|AF325453_1  GroEL [Escherichia coli]                  219    2e-55 
emb|CAF21849.1|  GroEL [Lactobacillus vaccinostercus]               219    2e-55 
sp|P08824.1|RUBA_RICCO  RecName: Full=RuBisCO large subunit-bi...   219    2e-55 
ref|XP_002392319.1|  hypothetical protein MPER_08124 [Moniliop...   219    2e-55  Gene info
dbj|BAH22149.1|  GroEL [Pleurocapsa sp. PCC 7319]                   219    2e-55 
gb|AAD04240.1|  60 kDa heat shock protein [Bartonella clarridg...   219    2e-55 
gb|ACA62982.1|  GroEL [Bacteriovorax sp. GSL4D]                     219    2e-55 
gb|ABK91836.1|  mitochondrial heat shock protein 60 [Cryptospo...   218    3e-55 
gb|ABK91838.1|  mitochondrial heat shock protein 60 [Cryptospo...   218    3e-55 
emb|CAE52529.1|  hsp60 [Lactobacillus delbrueckii subsp. lactis]    218    4e-55 
ref|XP_001712532.1|  cpn60 [Hemiselmis andersenii] >gb|ABW9820...   218    4e-55  Gene info
emb|CAF21846.1|  GroEL [Lactobacillus durianis]                     218    5e-55 
sp|Q42694.1|RUBA_CHLRE  RecName: Full=RuBisCO large subunit-bi...   218    5e-55 
emb|CAF18444.1|  heat shock protein 60 [Enterococcus sulfureus]     217    7e-55 
gb|ACA62983.1|  GroEL [Bacteriovorax sp. GSL4E]                     217    7e-55 
emb|CAF21844.1|  GroEL [Lactobacillus acidipiscis]                  217    8e-55 
emb|CAF21845.1|  GroEL [Lactobacillus cypricasei]                   217    9e-55 
gb|ACA62985.1|  GroEL [Bacteriovorax sp. GSL4A]                     217    9e-55 
gb|AAR17697.1|  GroEL [Ruminococcus albus]                          216    1e-54 
gb|AAC24232.1|  60 kDa heat shock protein [Bartonella washoensis]   216    1e-54 
dbj|BAH22151.1|  GroEL [Pleurocapsa sp. PCC 7516]                   216    1e-54 
ref|XP_002021686.1|  GL26372 [Drosophila persimilis] >gb|EDW25...   216    2e-54  Gene info
gb|AAL38954.1|  60 kDa heat shock protein GroEL [Chlamydophila...   216    2e-54 
ref|XP_002499889.1|  predicted protein [Micromonas sp. RCC299]...   216    2e-54  Gene info
gb|EEH61036.1|  predicted protein [Micromonas pusilla CCMP1545]     216    2e-54 
dbj|BAH22159.1|  GroEL [Lyngbya aestuarii PCC 7419]                 216    2e-54 
gb|AAC68501.1|  chaperonin 60 alpha subunit [Canavalia lineata]     216    2e-54 
dbj|BAH22179.1|  GroEL2 [Pseudanabaena sp. PCC 6903]                216    2e-54 
emb|CAY85862.1|  GroEL protein [Kozakia baliensis]                  216    2e-54 
gb|AAK97288.1|AF304019_1  heat shock protein Hsp60 [Bartonella...   215    2e-54 
emb|CAL57395.1|  RuBisCO subunit binding-protein alpha subunit...   215    2e-54 
gb|AAD04245.1|  60 kDa heat shock protein [Bartonella vinsonii...   215    3e-54 
dbj|BAH22166.1|  GroEL [Phormidium mucicola IAM M-221]              215    3e-54 
sp|P46224.1|CH60_PYRSA  RecName: Full=60 kDa chaperonin, chlor...   215    3e-54 
gb|ACA62987.1|  GroEL [Bacteriovorax sp. PR]                        215    3e-54 
ref|ZP_01463938.1|  chaperonin GroEL [Stigmatella aurantiaca D...   215    3e-54 
ref|XP_001988539.1|  GH11219 [Drosophila grimshawi] >gb|EDW034...   215    3e-54  Gene info
gb|ACA62990.1|  GroEL [Bacteriovorax sp. ORF]                       215    3e-54 
dbj|BAH22170.1|  GroEL [Pseudanabaena sp. PCC 7367]                 215    4e-54 
ref|XP_002514548.1|  rubisco subunit binding-protein beta subu...   214    4e-54  Gene info
gb|ACA62971.1|  GroEL [Bacteriovorax sp. SAN4]                      214    4e-54 
gb|AAK97287.1|AF304018_1  heat shock protein Hsp60 [Bartonella...   214    4e-54 
ref|XP_817645.1|  chaperonin HSP60 mitochondrial precursor [Tr...   214    4e-54  Gene info
gb|ACA62973.1|  GroEL [Bacteriovorax sp. MNZ5]                      214    4e-54 
ref|XP_001755211.1|  predicted protein [Physcomitrella patens ...   214    5e-54  UniGene infoGene info
ref|XP_001420863.1|  chaperonin 60 alpha chain, chloroplast [O...   214    5e-54  Gene info
gb|AAC24233.1|  60 kDa heat shock protein [Bartonella weissi]       214    5e-54 
gb|ABI83666.1|  Cpn60 [Azospirillum canadense]                      214    5e-54 
gb|ABU93374.1|  GroEL [Brucella pinnipedialis]                      214    6e-54 
dbj|BAH22167.1|  GroEL [Phormidium sp. IAM M-99]                    214    6e-54 
dbj|BAH22164.1|  GroEL [Oscillatoria sp. IAM M-117]                 214    7e-54 
ref|XP_001774009.1|  predicted protein [Physcomitrella patens ...   214    7e-54  UniGene infoGene info
dbj|BAH22150.1|  GroEL [Pleurocapsa sp. PCC 7327]                   214    7e-54 
emb|CAI91162.1|  chaperonin GroEL [Candidatus Epixenosoma ejec...   214    7e-54 
gb|ABI96795.1|  heat shock protein 65 [Mycobacterium sp. JAN1]...   213    1e-53 
dbj|BAH12542.1|  unnamed protein product [Homo sapiens]             213    1e-53  Gene info
ref|ZP_01993181.1|  60 kDa chaperonin 2 [Vibrio parahaemolytic...   213    1e-53 
dbj|BAH22171.1|  GroEL [Pseudanabaena sp. PCC 7403]                 213    1e-53 
ref|XP_001769377.1|  predicted protein [Physcomitrella patens ...   213    1e-53  UniGene infoGene info
ref|XP_002269341.1|  PREDICTED: hypothetical protein [Vitis vi...   213    1e-53  UniGene infoGene info
gb|ACC64865.1|  Cpn60 [uncultured soil bacterium]                   213    1e-53 
emb|CBI27426.1|  unnamed protein product [Vitis vinifera]           213    1e-53 
ref|YP_001085682.1|  chaperonin GroEL [Acinetobacter baumannii...   213    2e-53  Gene info
gb|AAZ39558.1|  65 kDa heat shock protein [Mycobacterium sp. X1]    213    2e-53 
gb|AAY22130.1|  heat shock protein Hsp60 [Zymomonas mobilis su...   213    2e-53 
gb|ABI96797.1|  heat shock protein 65 [Mycobacterium abscessus...   213    2e-53 
emb|CAF18439.1|  heat shock protein 60 [Enterococcus haemopero...   213    2e-53 
gb|ACC65358.1|  Cpn60 [uncultured soil bacterium]                   212    2e-53 
dbj|BAH22158.1|  GroEL [Leptolyngbya sp. PCC 7104]                  212    2e-53 
dbj|BAH22148.1|  GroEL [Chroococcidiopsis thermalis PCC 7203]       212    2e-53 
gb|ACC65065.1|  Cpn60 [uncultured soil bacterium]                   212    3e-53 
gb|ABI13588.1|  Cpn60 [Azospirillum brasilense]                     211    3e-53 
ref|XP_001467129.1|  chaperonin HSP60/CNP60 [Leishmania infant...   211    4e-53  Gene info
gb|AAQ96144.1|  GroEL protein [Hafnia alvei]                        211    4e-53 
gb|ABU93355.1|  GroEL [Brucella abortus]                            211    4e-53 
gb|ACA63014.1|  GroEL [Bacteriovorax sp. T3] >gb|ACA63015.1| G...   211    4e-53 
dbj|BAI49286.1|  chaperonin GroEL [Candidatus Curculioniphilus...   211    5e-53 
ref|ZP_01993969.1|  60 kDa chaperonin 2 [Vibrio parahaemolytic...   211    5e-53 
ref|ZP_03499002.1|  chaperonin GroEL [Rhizobium etli Kim 5]         211    5e-53 
dbj|BAI49287.1|  chaperonin GroEL [secondary endosymbiont of C...   211    6e-53 
gb|ABU93359.1|  GroEL [Brucella abortus]                            211    6e-53 
gb|ABH00992.1|  chaperonin [Azospirillum lipoferum]                 211    6e-53 
gb|AAX24018.1|  60 kDa chaperonin [Methylobacterium extorquens]     211    6e-53 
dbj|BAH22162.1|  GroEL [Oscillatoria neglecta IAM M-82]             211    6e-53 
gb|ACC64907.1|  Cpn60 [uncultured soil bacterium]                   211    7e-53 
gb|ACC64733.1|  Cpn60 [uncultured soil bacterium]                   210    7e-53 
dbj|BAI49291.1|  chaperonin GroEL [Candidatus Curculioniphilus...   210    8e-53 
emb|CAF18436.1|  heat shock protein 60 [Enterococcus canis]         210    8e-53 
gb|ACC93833.1|  heat shock protein 65 [Mycobacterium sp. BF5b]      210    9e-53 
gb|ACC93832.1|  heat shock protein 65 [Mycobacterium sp. BF4b]      210    9e-53 
gb|ACC64738.1|  Cpn60 [uncultured soil bacterium]                   210    1e-52 
gb|ACC64801.1|  Cpn60 [uncultured soil bacterium]                   209    1e-52 
gb|AAY22128.1|  heat shock protein Hsp60 [Zymomonas mobilis su...   209    1e-52 
gb|ABI96794.1|  heat shock protein 65 [Mycobacterium chelonae]      209    1e-52 
gb|ABI96788.1|  heat shock protein 65 [Mycobacterium salmoniph...   209    1e-52 
gb|AAK97289.1|AF304020_1  heat shock protein Hsp60 [Bartonella...   209    1e-52 
gb|ACA63013.1|  GroEL [Bacteriovorax sp. T9]                        209    2e-52 
dbj|BAI49290.1|  chaperonin GroEL [Candidatus Curculioniphilus...   209    2e-52 
dbj|BAI49288.1|  chaperonin GroEL [Candidatus Curculioniphilus...   209    2e-52 
dbj|BAI49285.1|  chaperonin GroEL [Candidatus Curculioniphilus...   209    2e-52 
ref|ZP_00145286.1|  60 kDa chaperonin GROEL [Fusobacterium nuc...   209    2e-52 
gb|ABI96793.1|  heat shock protein 65 [Mycobacterium chelonae]...   209    2e-52 
gb|ABU93358.1|  GroEL [Brucella abortus]                            209    2e-52 
gb|ACA63001.1|  GroEL [Bacteriovorax sp. JS8] >gb|ACA63002.1| ...   209    2e-52 
gb|ABU93357.1|  GroEL [Brucella abortus]                            209    2e-52 
gb|AAM21574.1|AF449762_1  heat shock protein Hsp 60 [Bartonell...   209    2e-52 
dbj|BAI49289.1|  chaperonin GroEL [Candidatus Curculioniphilus...   209    2e-52 
ref|XP_001684887.1|  chaperonin HSP60/CNP60 [Leishmania major ...   208    3e-52  Gene info
gb|ACC65017.1|  Cpn60 [uncultured soil bacterium]                   208    3e-52 
dbj|BAD95277.1|  chaperonin precursor [Arabidopsis thaliana]        208    3e-52 
ref|NP_173947.1|  chaperonin, putative [Arabidopsis thaliana] ...   208    3e-52  UniGene infoGene info
gb|ACA63005.1|  GroEL [Bacteriovorax sp. MIA3]                      208    3e-52 
pdb|1SJP|A  Chain A, Mycobacterium Tuberculosis Chaperonin60.2...   208    3e-52  Related structures
gb|EEC67866.1|  hypothetical protein OsI_35492 [Oryza sativa I...   208    4e-52 
dbj|BAH22168.1|  GroEL [Pseudanabaena sp. PCC 6802]                 208    4e-52 
gb|ACC65513.1|  Cpn60 [uncultured soil bacterium]                   208    4e-52 
gb|AAD04239.1|  60 kDa heat shock protein [Bartonella quintana]     207    4e-52 
dbj|BAH22157.1|  GroEL [Leptolyngbya sp. PCC 7375]                  207    5e-52 
gb|ABI96789.1|  heat shock protein 65 [Mycobacterium salmoniph...   207    5e-52 
ref|YP_932727.1|  chaperonin GroEL [Azoarcus sp. BH72] >emb|CA...   207    5e-52  Gene info
ref|XP_845527.1|  chaperonin Hsp60, mitochondrial precursor [T...   207    5e-52  Gene info
emb|CBH11910.1|  chaperonin Hsp60, mitochondrial precursor, pu...   207    5e-52 
dbj|BAH22175.1|  GroEL [Nodularia spumigena]                        207    5e-52 
ref|ZP_01993026.1|  chaperonin GroL [Vibrio parahaemolyticus A...   207    6e-52 
dbj|BAH22153.1|  GroEL [Stanieria sp. PCC 7301]                     207    7e-52 
gb|AAA32724.1|  60-kDa chaperonin-60 alpha-polypeptide [Arabid...   207    8e-52 
gb|AAM88522.1|  Cpn60 [Bartonella clarridgeiae]                     207    8e-52 
gb|ACC65170.1|  Cpn60 [uncultured soil bacterium]                   207    8e-52 
gb|AAM21575.1|AF449763_1  heat shock protein Hsp 60 [Bartonell...   207    8e-52 
gb|ABO26865.1|  chaperonin [Azospirillum melinis]                   207    9e-52 
gb|ABL86743.1|  Cpn60 [Caulobacteraceae bacterium SOC A20(60)]      207    9e-52 
gb|ACC65138.1|  Cpn60 [uncultured soil bacterium]                   207    1e-51 
dbj|BAH22176.1|  GroEL [Chlorogloeopsis fritschii PCC 6718]         206    1e-51 
dbj|BAI49292.1|  chaperonin GroEL [secondary endosymbiont of C...   206    1e-51 
gb|ACF20339.1|  60 kDa chaperonin [Erythromicrobium ramosum]        206    1e-51 
gb|ACC65338.1|  Cpn60 [uncultured soil bacterium]                   206    1e-51 
gb|ACC64869.1|  Cpn60 [uncultured soil bacterium]                   206    1e-51 
gb|ABG76017.1|  chaperonin [Azospirillum zeae]                      206    2e-51 
gb|ACC65453.1|  Cpn60 [uncultured soil bacterium]                   206    2e-51 
gb|ACC65143.1|  Cpn60 [uncultured soil bacterium]                   206    2e-51 
gb|ACC64854.1|  Cpn60 [uncultured soil bacterium]                   206    2e-51 
dbj|BAH22172.1|  GroEL [Pseudanabaena sp. PCC 7408]                 206    2e-51 
gb|ABB87026.1|  65 kDa heat shock protein [Mycobacterium avium]     206    2e-51 
gb|ACC65439.1|  Cpn60 [uncultured soil bacterium]                   206    2e-51 
ref|YP_002457240.1|  chaperonin GroEL [Desulfitobacterium hafn...   206    2e-51  Gene info
gb|ACC64773.1|  Cpn60 [uncultured soil bacterium]                   205    2e-51 
gb|ACC64780.1|  Cpn60 [uncultured soil bacterium]                   205    2e-51 
gb|ACC65398.1|  Cpn60 [uncultured soil bacterium]                   205    3e-51 
gb|ACC65373.1|  Cpn60 [uncultured soil bacterium]                   205    3e-51 
gb|ACC64870.1|  Cpn60 [uncultured soil bacterium]                   205    3e-51 
gb|ACC64924.1|  Cpn60 [uncultured soil bacterium]                   205    3e-51 
gb|ABL86746.1|  Cpn60 [Brevundimonas variabilis]                    205    3e-51 
gb|ABG76016.1|  chaperonin [Azospirillum zeae]                      205    3e-51 
ref|XP_956500.2|  heat shock protein 60, mitochondrial precurs...   205    3e-51  UniGene infoGene info
emb|CAY85820.2|  GroEL protein [Gluconacetobacter hansenii]         205    3e-51 
gb|ABH00991.1|  chaperonin [Azospirillum oryzae] >gb|ACF20348....   204    4e-51 
gb|ACC65544.1|  Cpn60 [uncultured soil bacterium]                   204    4e-51 
gb|ACC65459.1|  Cpn60 [uncultured soil bacterium]                   204    4e-51 
gb|ACC65352.1|  Cpn60 [uncultured soil bacterium]                   204    4e-51 
gb|ACC64811.1|  Cpn60 [uncultured soil bacterium]                   204    5e-51 
gb|ACC65261.1|  Cpn60 [uncultured soil bacterium]                   204    5e-51 
ref|YP_001234506.1|  chaperonin GroEL [Acidiphilium cryptum JF...   204    5e-51  Gene info
gb|ACC65219.1|  Cpn60 [uncultured soil bacterium]                   204    5e-51 
gb|ACC64771.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64789...   204    6e-51 
dbj|BAH22174.1|  GroEL [Symploca atlantica PCC 8002]                204    7e-51 
gb|ACC65552.1|  Cpn60 [uncultured soil bacterium]                   204    7e-51 
gb|ACC64871.1|  Cpn60 [uncultured soil bacterium]                   203    9e-51 
ref|XP_850959.1|  PREDICTED: similar to 60 kDa heat shock prot...   203    1e-50  UniGene infoGene info
gb|ACC65308.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64937.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC65534.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC65210.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64949.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64934.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC65121.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64774.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC65264.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64926.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC65522.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
ref|NP_770323.1|  chaperonin GroEL [Bradyrhizobium japonicum U...   203    1e-50  Gene info
gb|ACC64772.1|  Cpn60 [uncultured soil bacterium]                   203    1e-50 
gb|ACC64952.1|  Cpn60 [uncultured soil bacterium]                   202    1e-50 
gb|ACC65117.1|  Cpn60 [uncultured soil bacterium]                   202    1e-50 
gb|ACC64767.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64777...   202    1e-50 
gb|ACC64776.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACH56382.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   202    2e-50 
ref|YP_003183296.1|  chaperonin GroEL [Eggerthella lenta DSM 2...   202    2e-50 
gb|ACC64932.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC64815.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC65269.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
ref|ZP_05142969.1|  chaperonin GroEL [Mycobacterium tuberculos...   202    2e-50 
gb|ABL86753.1|  Cpn60 [Sphingomonas sp. A41]                        202    2e-50 
gb|ACC64858.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC64790.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC64938.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC65408.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|AAR17690.1|  GroEL [Ruminococcus flavefaciens]                   202    2e-50 
gb|ACC65518.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|AAF86372.1|AF210459_1  chaperonin GroEL [Ehrlichia muris]        202    2e-50 
emb|CAD29288.1|  GroEL protein [Blattabacterium sp.]                202    2e-50 
gb|ACC65500.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ADC32467.1|  heat shock protein [Ehrlichia muris]                202    2e-50 
ref|XP_002315987.1|  predicted protein [Populus trichocarpa] >...   202    2e-50  UniGene infoGene info
gb|ACC64770.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ABI98832.1|  heat shock protein 65 [Mycobacterium fortuitum]     202    2e-50 
gb|ACC64992.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACA62969.1|  GroEL [Bacteriovorax sp. MNZ3]                      202    2e-50 
gb|ACC64764.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ADC32463.1|  heat shock protein [Ehrlichia muris] >gb|ADC32...   202    2e-50 
gb|ACC65520.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACC65412.1|  Cpn60 [uncultured soil bacterium]                   202    2e-50 
gb|ACA62974.1|  GroEL [Bacteriovorax sp. MNZ4]                      202    3e-50 
gb|ACC64716.1|  Cpn60 [uncultured soil bacterium]                   202    3e-50 
gb|ACC65033.1|  Cpn60 [uncultured soil bacterium]                   202    3e-50 
gb|ACA62991.1|  GroEL [Bacteriovorax sp. IH11] >gb|ACA62999.1|...   202    3e-50 
gb|AAM88518.1|  Cpn60 [Bartonella elizabethae]                      202    3e-50 
dbj|BAA94828.1|  heat shock protein [Ehrlichia sp. Anan]            202    3e-50 
gb|ACA62986.1|  GroEL [Bacteriovorax sp. AQ]                        202    3e-50 
gb|ACC65203.1|  Cpn60 [uncultured soil bacterium]                   202    3e-50 
gb|ABG75756.1|  GroEL [Candidatus Ehrlichia ovata]                  202    3e-50 
gb|ACA62968.1|  GroEL [Bacteriovorax sp. NZAH11] >gb|ACA62975....   202    3e-50 
dbj|BAA94829.1|  heat shock protein [Ehrlichia sp. HF565]           202    3e-50 
gb|ACO55742.1|  60 kDa heat shock protein [Bartonella washoensis]   202    3e-50 
gb|ACC64768.1|  Cpn60 [uncultured soil bacterium]                   202    3e-50 
ref|ZP_00544712.1|  Chaperonin Cpn60/TCP-1 [Ehrlichia chaffeen...   202    3e-50 
ref|YP_507185.1|  chaperonin GroEL [Ehrlichia chaffeensis str....   202    3e-50  Gene info
ref|YP_299384.1|  chaperonin Cpn60/TCP-1 [Ralstonia eutropha J...   202    3e-50  Gene info
gb|ACC65441.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65442...   201    3e-50 
gb|ACA62967.1|  GroEL [Bacteriovorax sp. SAN1]                      201    3e-50 
gb|ACA63000.1|  GroEL [Bacteriovorax sp. PS82B]                     201    3e-50 
dbj|BAH22854.1|  heat shock protein [Ehrlichia sp. NS101]           201    3e-50 
gb|ACC64769.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
ref|XP_002177543.1|  nuclear-encoded-like protein of chloropla...   201    4e-50  UniGene infoGene info
gb|ACF20351.1|  60 kDa chaperonin [Brucella abortus] >gb|ACF20...   201    4e-50 
ref|YP_999124.1|  chaperonin GroEL [Verminephrobacter eiseniae...   201    4e-50  Gene info
gb|ACC64722.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
gb|ACC65012.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
gb|ACC65440.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
gb|ACC65353.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
gb|ABO25735.1|  60 kDa heat shock protein [Bartonella bovis] >...   201    4e-50 
gb|ACR56061.1|  heat shock protein [uncultured Ehrlichia sp.]       201    4e-50 
gb|ACC64775.1|  Cpn60 [uncultured soil bacterium]                   201    4e-50 
dbj|BAF92020.1|  groEL [Lactobacillus ingluviei] >dbj|BAF92021...   201    4e-50 
gb|AAM88515.1|  Cpn60 [Bartonella henselae str. Houston-1] >gb...   201    4e-50 
gb|AAF03899.1|AF195273_1  chaperonin GroEL [Ehrlichia ewingii]      201    5e-50 
gb|ACA62976.1|  GroEL [Bacteriovorax sp. MANZ1] >gb|ACA62978.1...   201    5e-50 
gb|AAV84345.1|  60 kDa chaperonin [Agrobacterium tumefaciens]       201    5e-50 
gb|ACC65313.1|  Cpn60 [uncultured soil bacterium]                   201    5e-50 
gb|ABX11598.1|  60 kDa chaperonin [Xanthobacter autotrophicus]      201    5e-50 
gb|ACC64967.1|  Cpn60 [uncultured soil bacterium]                   201    5e-50 
gb|ACC65374.1|  Cpn60 [uncultured soil bacterium]                   201    5e-50 
gb|ACC64959.1|  Cpn60 [uncultured soil bacterium]                   201    5e-50 
gb|ACC64935.1|  Cpn60 [uncultured soil bacterium]                   201    5e-50 
gb|ACC64928.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACC65268.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACC64939.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACH56413.1|  chaperonin-60 [uncultured bacterium]                201    6e-50 
gb|ACC64813.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACA62980.1|  GroEL [Bacteriovorax sp. MNZ2]                      201    6e-50 
gb|ACC65433.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACC65443.1|  Cpn60 [uncultured soil bacterium]                   201    6e-50 
gb|ACD36585.1|  GroEL [Vibrio parahaemolyticus] >gb|ACD36586.1...   201    7e-50 
gb|ACR56062.1|  heat shock protein [uncultured Ehrlichia sp.] ...   201    7e-50 
ref|XP_001566905.1|  chaperonin HSP60/CNP60 [Leishmania brazil...   201    7e-50  Gene info
gb|ACC65371.1|  Cpn60 [uncultured soil bacterium]                   200    7e-50 
gb|ACC64913.1|  Cpn60 [uncultured soil bacterium]                   200    7e-50 
gb|AAQ96154.1|  GroEL protein [Serratia plymuthica] >gb|AAQ961...   200    7e-50 
gb|ACC64990.1|  Cpn60 [uncultured soil bacterium]                   200    7e-50 
gb|AAM88513.1|  Cpn60 [Ochrobactrum anthropi ATCC 49188] >gb|A...   200    7e-50 
gb|ACC64984.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65362...   200    8e-50 
gb|ACC65025.1|  Cpn60 [uncultured soil bacterium]                   200    8e-50 
gb|ABL86736.1|  Cpn60 [subglacial bacterium M20(25)] >gb|ABL86...   200    8e-50 
gb|ACC65354.1|  Cpn60 [uncultured soil bacterium]                   200    8e-50 
gb|ACC65218.1|  Cpn60 [uncultured soil bacterium]                   200    8e-50 
gb|ABO31333.1|  60 kDa chaperonin [Gluconacetobacter diazotrop...   200    8e-50 
gb|ABL86755.1|  Cpn60 [Sphingomonas sp. C2]                         200    9e-50 
gb|ACH72270.1|  chaperonin-60 [uncultured bacterium]                200    1e-49 
gb|ACC64927.1|  Cpn60 [uncultured soil bacterium]                   200    1e-49 
sp|P47632.1|CH60_MYCGE  RecName: Full=60 kDa chaperonin; AltNa...   200    1e-49 
gb|AAL80021.1|  heat shock protein 60 [Piromyces sp. E2]            200    1e-49 
gb|ACC64786.1|  Cpn60 [uncultured soil bacterium]                   200    1e-49 
ref|NP_073065.2|  chaperonin GroEL [Mycoplasma genitalium G37]...   200    1e-49  Gene info
gb|ACF20340.1|  60 kDa chaperonin [Porphyrobacter sanguineus]       200    1e-49 
gb|AAC12772.1|  chaperonin 60 [Leishmania braziliensis]             200    1e-49 
gb|ACA62964.1|  GroEL [Bacteriovorax sp. NZAH13] >gb|ACA62965....   200    1e-49 
gb|ACA62963.1|  GroEL [Bacteriovorax sp. SAN2]                      200    1e-49 
gb|ACC64843.1|  Cpn60 [uncultured soil bacterium]                   200    1e-49 
gb|AAZ84918.1|  60 kDa chaperonin [uncultured bacterium]            200    1e-49 
ref|XP_516008.2|  PREDICTED: chaperonin isoform 9 [Pan troglod...   200    1e-49  UniGene infoGene info
ref|XP_857240.1|  PREDICTED: similar to 60 kDa heat shock prot...   200    1e-49  UniGene infoGene info
gb|ABO31334.1|  60 kDa chaperonin [Azospirillum amazonense]         200    1e-49 
ref|ZP_03266514.1|  chaperonin Cpn60/TCP-1 [Burkholderia sp. H...   200    1e-49 
gb|ACC64793.1|  Cpn60 [uncultured soil bacterium]                   199    1e-49 
gb|ACC65090.1|  Cpn60 [uncultured soil bacterium]                   199    1e-49 
gb|ACC64925.1|  Cpn60 [uncultured soil bacterium]                   199    1e-49 
gb|ACC65214.1|  Cpn60 [uncultured soil bacterium]                   199    1e-49 
gb|ABL86756.1|  Cpn60 [Sphingomonas sp. C10]                        199    1e-49 
dbj|BAI23116.1|  60 kDa heat shock protein [Bartonella washoen...   199    1e-49 
gb|ACA62977.1|  GroEL [Bacteriovorax sp. MANZ2]                     199    2e-49 
gb|ABB20578.1|  60 kDa chaperonin [uncultured bacterium]            199    2e-49 
ref|XP_002291674.1|  predicted protein [Thalassiosira pseudona...   199    2e-49  Gene info
dbj|BAC02721.1|  heat shock protein [Candidatus Neoehrlichia m...   199    2e-49 
gb|ABY86672.1|  chaperonin GroEL1 [Sorangium cellulosum]            199    2e-49 
gb|ACC65098.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
gb|ACA62979.1|  GroEL [Bacteriovorax sp. MANZ3]                     199    2e-49 
gb|ACC64753.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
gb|ACC64936.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
gb|ACC64785.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
gb|ACR56064.1|  heat shock protein [Candidatus Neoehrlichia mi...   199    2e-49 
gb|ABY86676.1|  chaperonin GroEL1 [Sorangium cellulosum]            199    2e-49 
dbj|BAF46061.1|  60 kDa heat shock protein [Bartonella quintana]    199    2e-49 
dbj|BAG48882.1|  60 kDa heat shock protein [Bartonella sp. Fuj...   199    2e-49 
gb|AAL12492.1|  heat shock protein GroEL [Neorickettsia sp. SF...   199    2e-49 
gb|ACB37698.1|  GroEL [Microcystis aeruginosa NIES-298]             199    2e-49 
gb|ABY86669.1|  chaperonin GroEL1 [Sorangium cellulosum]            199    2e-49 
dbj|BAI23119.1|  60 kDa heat shock protein [Bartonella washoen...   199    2e-49 
dbj|BAC02722.1|  heat shock protein [Candidatus Neoehrlichia m...   199    2e-49 
dbj|BAG12694.1|  60 kDa heat shock protein [Bartonella grahami...   199    2e-49 
ref|XP_001692504.1|  chaperonin 60B2 [Chlamydomonas reinhardti...   199    2e-49  UniGene infoGene info
dbj|BAG12697.1|  60 kDa heat shock protein [Bartonella grahamii]    199    2e-49 
gb|ACC65546.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
gb|ACF18095.1|  GroEL [Candidatus Neoehrlichia mikurensis] >gb...   199    2e-49 
gb|ABY86679.1|  chaperonin GroEL1 [Sorangium cellulosum]            199    2e-49 
gb|ACA09720.1|  heat shock protein [Candidatus Neoehrlichia mi...   199    2e-49 
emb|CAD29286.1|  GroEL protein [Blattabacterium sp.]                199    2e-49 
gb|ACC65432.1|  Cpn60 [uncultured soil bacterium]                   199    2e-49 
dbj|BAI23121.1|  60 kDa heat shock protein [Bartonella washoen...   199    3e-49 
gb|ABY86677.1|  chaperonin GroEL1 [Sorangium cellulosum]            199    3e-49 
dbj|BAD01637.1|  heat shock protein [Candidatus Ehrlichia shim...   199    3e-49 
dbj|BAI23125.1|  60 kDa heat shock protein [Bartonella washoen...   198    3e-49 
dbj|BAG12703.1|  60 kDa heat shock protein [Bartonella grahami...   198    3e-49 
gb|EEE61069.1|  hypothetical protein OsJ_14927 [Oryza sativa J...   198    3e-49 
gb|ACC65563.1|  Cpn60 [uncultured soil bacterium]                   198    3e-49 
dbj|BAG12704.1|  60 kDa heat shock protein [Bartonella grahamii]    198    3e-49 
dbj|BAG12698.1|  60 kDa heat shock protein [Bartonella grahami...   198    3e-49 
dbj|BAG12705.1|  60 kDa heat shock protein [Bartonella grahamii]    198    3e-49 
dbj|BAI47761.1|  60 kDa heat shock protein [Bartonella grahamii]    198    3e-49 
dbj|BAG12699.1|  60 kDa heat shock protein [Bartonella grahamii]    198    3e-49 
dbj|BAI23129.1|  60 kDa heat shock protein [Bartonella washoen...   198    3e-49 
gb|ACC65024.1|  Cpn60 [uncultured soil bacterium]                   198    3e-49 
ref|YP_481609.1|  chaperonin GroEL [Frankia sp. CcI3] >sp|Q2JA...   198    3e-49  Gene info
dbj|BAI23124.1|  60 kDa heat shock protein [Bartonella washoen...   198    3e-49 
ref|YP_303279.1|  chaperonin GroEL [Ehrlichia canis str. Jake]...   198    3e-49  Gene info
dbj|BAI23131.1|  60 kDa heat shock protein [Bartonella washoen...   198    3e-49 
dbj|BAI23122.1|  60 kDa heat shock protein [Bartonella washoen...   198    3e-49 
gb|ABB20544.1|  60 kDa chaperonin [uncultured bacterium]            198    3e-49 
gb|AAV84346.1|  60 kDa chaperonin [Agrobacterium tumefaciens]       198    3e-49 
gb|ACA62972.1|  GroEL [Bacteriovorax sp. SAN5]                      198    4e-49 
gb|AAM88487.1|  Cpn60 [Brevundimonas vesicularis]                   198    4e-49 
gb|ACC65163.1|  Cpn60 [uncultured soil bacterium]                   198    4e-49 
gb|ACC65267.1|  Cpn60 [uncultured soil bacterium]                   198    4e-49 
gb|ABY86673.1|  chaperonin GroEL1 [Sorangium cellulosum]            198    4e-49 
gb|ACC65322.1|  Cpn60 [uncultured soil bacterium]                   198    4e-49 
gb|ACC64759.1|  Cpn60 [uncultured soil bacterium]                   198    4e-49 
gb|ABY86678.1|  chaperonin GroEL1 [Sorangium cellulosum]            198    4e-49 
gb|ABY86674.1|  chaperonin GroEL1 [Sorangium cellulosum]            198    4e-49 
gb|ACC65217.1|  Cpn60 [uncultured soil bacterium]                   198    4e-49 
sp|O34194.1|CH60_EHRCA  RecName: Full=60 kDa chaperonin; AltNa...   198    4e-49 
gb|ACC64784.1|  Cpn60 [uncultured soil bacterium]                   198    5e-49 
gb|ABX11623.1|  60 kDa chaperonin [Sphingomonas paucimobilis]       197    5e-49 
gb|ACC64914.1|  Cpn60 [uncultured soil bacterium]                   197    6e-49 
gb|ABY86671.1|  chaperonin GroEL1 [Sorangium cellulosum]            197    6e-49 
gb|ABV03581.1|  GroEL [Candidatus Neoehrlichia lotoris]             197    6e-49 
ref|NP_110262.1|  chaperonin GroEL [Mycoplasma pneumoniae M129...   197    6e-49  Gene info
gb|AAK97290.1|AF304021_1  heat shock protein Hsp60 [Bartonella...   197    6e-49 
ref|ZP_05781227.1|  chaperonin GroEL [Citreicella sp. SE45] >g...   197    7e-49 
gb|ABU93352.1|  GroEL [Brucella abortus] >gb|ABU93354.1| GroEL...   197    7e-49 
gb|ABU93356.1|  GroEL [Brucella abortus]                            197    7e-49 
gb|ABU93366.1|  GroEL [Brucella canis]                              197    7e-49 
gb|ABY86680.1|  chaperonin GroEL1 [Sorangium cellulosum]            197    7e-49 
gb|ABY86670.1|  chaperonin GroEL1 [Sorangium cellulosum]            197    7e-49 
gb|ABU93372.1|  GroEL [Brucella ceti]                               197    8e-49 
dbj|BAE48681.1|  60 kDa heat shock protein [Bartonella sp. Fuj...   197    8e-49 
gb|ACC65523.1|  Cpn60 [uncultured soil bacterium]                   197    8e-49 
gb|ACC65451.1|  Cpn60 [uncultured soil bacterium]                   197    8e-49 
gb|ABU93373.1|  GroEL [Brucella ceti]                               197    8e-49 
gb|ACC65557.1|  Cpn60 [uncultured soil bacterium]                   197    8e-49 
dbj|BAI47757.1|  60 kDa heat shock protein [Bartonella sp. Shi...   197    8e-49 
gb|ABY86668.1|  chaperonin GroEL1 [Sorangium cellulosum]            197    8e-49 
dbj|BAG12709.1|  60 kDa heat shock protein [Bartonella grahami...   197    8e-49 
gb|ABX11620.1|  60 kDa chaperonin [Sphingobium yanoikuyae]          197    8e-49 
gb|ABU93370.1|  GroEL [Brucella pinnipedialis]                      197    9e-49 
dbj|BAI47754.1|  60 kDa heat shock protein [Bartonella sp. Oki...   197    9e-49 
gb|ACA63008.1|  GroEL [Bacteriovorax sp. T1]                        197    9e-49 
emb|CAA61520.1|  heat shock protein [Streptococcus pyogenes]        197    9e-49 
gb|ACC64908.1|  Cpn60 [uncultured soil bacterium]                   197    9e-49 
ref|YP_506520.1|  60 kDa chaperonin [Neorickettsia sennetsu st...   197    9e-49  Gene info
dbj|BAG48885.1|  60 kDa heat shock protein [Bartonella sp. Fuj...   197    9e-49 
gb|ACC65122.1|  Cpn60 [uncultured soil bacterium]                   197    1e-48 
gb|ACC64845.1|  Cpn60 [uncultured soil bacterium]                   197    1e-48 
dbj|BAF46056.1|  60 kDa heat shock protein [Bartonella chomelii]    197    1e-48 
gb|AAV84330.1|  60 kDa chaperonin [Agrobacterium vitis]             197    1e-48 
gb|ACC65320.1|  Cpn60 [uncultured soil bacterium]                   196    1e-48 
dbj|BAI23128.1|  60 kDa heat shock protein [Bartonella washoen...   196    1e-48 
gb|ABG37805.1|  60 kDa chaperonin [Ehrlichia ruminantium]           196    1e-48 
gb|ACC64951.1|  Cpn60 [uncultured soil bacterium]                   196    1e-48 
ref|YP_352918.1|  chaperonin GroEL [Rhodobacter sphaeroides 2....   196    1e-48  Gene info
dbj|BAH22855.1|  heat shock protein [Anaplasma sp. NS104]           196    1e-48 
gb|ABL86734.1|  Cpn60 [subglacial bacterium M20(19)]                196    1e-48 
gb|ACC64829.1|  Cpn60 [uncultured soil bacterium]                   196    1e-48 
gb|ACL31692.1|  60 kDa heat shock protein [Bartonella sp. Tel ...   196    1e-48 
dbj|BAI47764.1|  60 kDa heat shock protein [Bartonella grahamii]    196    1e-48 
ref|YP_002525531.1|  60 kDa chaperonin [Rhodobacter sphaeroide...   196    1e-48  Gene info
gb|AAV84344.1|  60 kDa chaperonin [Agrobacterium tumefaciens]       196    1e-48 
emb|CAD29287.1|  GroEL protein [Blattabacterium sp.]                196    1e-48 
gb|AAR17691.1|  GroEL [Ruminococcus flavefaciens]                   196    1e-48 
gb|AAM77029.1|  heat shock protein Hsp60 [Bartonella koehlerae]     196    2e-48 
gb|AAF67817.1|  GroEL-type chaperonin [Desulfitobacterium deha...   196    2e-48 
sp|Q43831.1|RUBB_SECCE  RecName: Full=RuBisCO large subunit-bi...   196    2e-48 
gb|ACC65333.1|  Cpn60 [uncultured soil bacterium]                   196    2e-48 
gb|ABC75363.2|  GroEL-like chaperone, ATPase [Medicago truncat...   196    2e-48 
gb|AAB65633.1|  GroEL [Neorickettsia risticii]                      196    2e-48 
gb|ACK56142.1|  GroEL [Anaplasma ovis]                              196    2e-48 
gb|ACC65406.1|  Cpn60 [uncultured soil bacterium]                   196    2e-48 
ref|YP_001043384.1|  chaperonin GroEL [Rhodobacter sphaeroides...   196    2e-48  Gene info
ref|YP_003081827.1|  chaperonin GroL [Neorickettsia risticii s...   196    2e-48  Gene info
gb|ACC65209.1|  Cpn60 [uncultured soil bacterium]                   196    2e-48 
gb|ABG37822.1|  60 kDa chaperonin [Ehrlichia ruminantium]           196    2e-48 
gb|ABY64753.1|  GroEL [Klebsiella pneumoniae]                       196    2e-48 
gb|AAR17689.1|  GroEL [Ruminococcus flavefaciens]                   196    2e-48 
ref|YP_001020151.1|  chaperonin GroEL [Methylibium petroleiphi...   196    2e-48  Gene info
gb|AAD04244.1|  60 kDa heat shock protein [Bartonella vinsonii...   196    2e-48 
gb|ACK56137.1|  GroEL [Anaplasma ovis]                              196    2e-48 
gb|ACK56145.1|  GroEL [Anaplasma ovis]                              196    2e-48 
sp|P48214.2|CH60_EHRRI  RecName: Full=60 kDa chaperonin; AltNa...   196    2e-48 
gb|ABG37816.1|  60 kDa chaperonin [Ehrlichia ruminantium]           196    2e-48 
gb|AAO72423.1|AF441131_1  GroEL [Anaplasma ovis]                    196    2e-48 
gb|ACC65315.1|  Cpn60 [uncultured soil bacterium]                   196    2e-48 
dbj|BAG12701.1|  60 kDa heat shock protein [Bartonella grahamii]    196    2e-48 
gb|ACC64715.1|  Cpn60 [uncultured soil bacterium]                   196    2e-48 
gb|ACK58228.1|  GroEL [uncultured Anaplasma sp.]                    196    2e-48 
gb|ACK56140.1|  GroEL [Anaplasma ovis]                              195    2e-48 
gb|ACK56139.1|  GroEL [Anaplasma ovis]                              195    2e-48 
gb|ABG37808.1|  60 kDa chaperonin [Ehrlichia ruminantium] >gb|...   195    2e-48 
gb|ACA63004.1|  GroEL [Bacteriovorax sp. MIA1] >gb|ACA63006.1|...   195    2e-48 
ref|YP_180506.1|  chaperonin GroEL [Ehrlichia ruminantium str....   195    2e-48  Gene info
gb|ABG37809.1|  60 kDa chaperonin [Ehrlichia ruminantium]           195    3e-48 
gb|AAA93153.1|  HSP-60 [Ehrlichia ruminantium]                      195    3e-48 
gb|ABG37812.1|  60 kDa chaperonin [Ehrlichia ruminantium] >gb|...   195    3e-48 
gb|ACC65282.1|  Cpn60 [uncultured soil bacterium]                   195    3e-48 
gb|ABG37803.1|  60 kDa chaperonin [Ehrlichia ruminantium]           195    3e-48 
gb|ACC64997.1|  Cpn60 [uncultured soil bacterium]                   195    3e-48 
gb|AAM88486.1|  Cpn60 [Brevundimonas diminuta]                      195    3e-48 
gb|ACC65063.1|  Cpn60 [uncultured soil bacterium]                   195    3e-48 
gb|ABY86681.1|  chaperonin GroEL1 [Sorangium cellulosum]            195    3e-48 
ref|ZP_06221807.1|  60 kDa chaperonin [Haemophilus influenzae ...   195    3e-48 
gb|ACC64863.1|  Cpn60 [uncultured soil bacterium]                   195    3e-48 
dbj|BAG12707.1|  60 kDa heat shock protein [Bartonella grahami...   195    3e-48 
gb|ABU93360.1|  GroEL [Brucella abortus]                            195    3e-48 
dbj|BAF46055.1|  60 kDa heat shock protein [Bartonella capreoli]    195    3e-48 
gb|ACC65535.1|  Cpn60 [uncultured soil bacterium]                   195    3e-48 
ref|YP_154105.1|  chaperonin GroEL [Anaplasma marginale str. S...   195    3e-48  Gene info
gb|ACC65410.1|  Cpn60 [uncultured soil bacterium]                   195    4e-48 
gb|AAR17687.1|  GroEL [Ruminococcus flavefaciens]                   195    4e-48 
ref|YP_003328341.1|  chaperonin GroEL [Anaplasma centrale str....   195    4e-48 
gb|AAO26674.1|AF414859_1  60 kDa heat shock protein [Anaplasma...   195    4e-48 
gb|ABS84259.1|  60 kDa heat shock protein [Anaplasma centrale]...   194    4e-48 
gb|AAD45382.1|AF165812_1  GroEL [Anaplasma marginale]               194    4e-48 
gb|ACK56141.1|  GroEL [Anaplasma ovis]                              194    4e-48 
gb|ACI43223.1|  heat shock protein [Anaplasma marginale]            194    4e-48 
gb|AAR17692.1|  GroEL [Ruminococcus flavefaciens]                   194    4e-48 
gb|AAO26681.1|AF414866_1  60 kDa heat shock protein [Anaplasma...   194    5e-48 
gb|ABS84257.1|  60 kDa heat shock protein [Anaplasma centrale]...   194    5e-48 
gb|AAR17688.1|  GroEL [Ruminococcus flavefaciens]                   194    5e-48 
gb|ACC64891.1|  Cpn60 [uncultured soil bacterium]                   194    5e-48 
gb|ACC65386.1|  Cpn60 [uncultured soil bacterium]                   194    5e-48 
ref|ZP_04210245.1|  60 kDa chaperonin 2 [Bacillus cereus Rock4...   194    5e-48 
dbj|BAG12702.1|  60 kDa heat shock protein [Bartonella grahamii]    194    6e-48 
gb|ACC64723.1|  Cpn60 [uncultured soil bacterium]                   194    6e-48 
gb|ACK44356.1|  65 kDa heat shock protein [Mycobacterium absce...   194    6e-48 
gb|ACK56144.1|  GroEL [Anaplasma ovis]                              194    7e-48 
gb|ACC65158.1|  Cpn60 [uncultured soil bacterium]                   194    7e-48 
gb|ACC65084.1|  Cpn60 [uncultured soil bacterium]                   194    7e-48 
gb|ACK56143.1|  GroEL [Anaplasma ovis]                              194    7e-48 
gb|ACC64803.1|  Cpn60 [uncultured soil bacterium]                   194    7e-48 
gb|ACA63007.1|  GroEL [Bacteriovorax sp. MIA4]                      194    8e-48 
ref|YP_003144856.1|  chaperonin GroEL [Slackia heliotrinireduc...   193    9e-48  Gene info
gb|ACK44371.1|  65 kDa heat shock protein [Mycobacterium fortu...   193    9e-48 
gb|ABG37814.1|  60 kDa chaperonin [Ehrlichia ruminantium]           193    9e-48 
gb|AAL12494.1|  heat shock protein GroEL [Neorickettsia helmin...   193    9e-48 
gb|ACC65039.1|  Cpn60 [uncultured soil bacterium]                   193    9e-48 
gb|ABU93353.1|  GroEL [Brucella abortus]                            193    1e-47 
gb|ACC64748.1|  Cpn60 [uncultured soil bacterium]                   193    1e-47 
emb|CAD29290.1|  GroEL protein [Blattabacterium sp.]                193    1e-47 
gb|ACC65201.1|  Cpn60 [uncultured soil bacterium]                   193    1e-47 
gb|ACA63003.1|  GroEL [Bacteriovorax sp. JS9]                       193    1e-47 
gb|ABY86675.1|  chaperonin GroEL1 [Sorangium cellulosum]            193    1e-47 
ref|XP_001701113.1|  chaperonin 60B1 [Chlamydomonas reinhardti...   193    1e-47  UniGene infoGene info
gb|ACD03143.1|  heat shock protein 60 [Campylobacter sp. 24/06...   193    1e-47 
gb|ACC65083.1|  Cpn60 [uncultured soil bacterium]                   193    1e-47 
gb|ACA62981.1|  GroEL [Bacteriovorax sp. JDF]                       193    1e-47 
gb|AAR17686.1|  GroEL [Ruminococcus flavefaciens FD-1]              193    1e-47 
gb|ACC65437.1|  Cpn60 [uncultured soil bacterium]                   192    1e-47 
gb|ACC65277.1|  Cpn60 [uncultured soil bacterium]                   192    1e-47 
gb|ABU93364.1|  GroEL [Brucella melitensis]                         192    1e-47 
gb|ABB88969.1|  60 kDa heat-shock protein [Vibrio harveyi]          192    2e-47 
gb|ABB88964.1|  60 kDa heat-shock protein [Vibrio harveyi]          192    2e-47 
gb|ACC65300.1|  Cpn60 [uncultured soil bacterium]                   192    2e-47 
gb|ACC65216.1|  Cpn60 [uncultured soil bacterium]                   192    2e-47 
gb|ABY86683.1|  chaperonin GroEL1 [Sorangium cellulosum]            192    2e-47 
ref|ZP_01821355.1|  chaperonin GroEL [Streptococcus pneumoniae...   192    2e-47 
gb|ACC65372.1|  Cpn60 [uncultured soil bacterium]                   192    2e-47 
gb|ABS84260.1|  60 kDa heat shock protein [Anaplasma centrale]      192    2e-47 
ref|XP_002154699.1|  PREDICTED: similar to Heat Shock Protein ...   192    2e-47  UniGene infoGene info
gb|ABY86686.1|  chaperonin GroEL1 [Sorangium cellulosum]            192    2e-47 
emb|CAZ65705.1|  heat shock protein 60 [Campylobacter sp. MIT ...   192    2e-47 
emb|CAY85823.1|  GroEL protein [Gluconacetobacter johannae]         192    3e-47 
gb|ACC65444.1|  Cpn60 [uncultured soil bacterium]                   192    3e-47 
gb|ABB88965.1|  60 kDa heat-shock protein [Vibrio harveyi] >gb...   192    3e-47 
ref|XP_804030.1|  chaperonin HSP60/CNP60 [Trypanosoma cruzi st...   192    3e-47  Gene info
gb|ACC64746.1|  Cpn60 [uncultured soil bacterium]                   192    3e-47 
emb|CAY85809.1|  GroEL protein [Gluconacetobacter azotocaptans]     192    3e-47 
gb|ACC64966.1|  Cpn60 [uncultured soil bacterium]                   191    3e-47 
gb|ABG37801.1|  60 kDa chaperonin [Ehrlichia ruminantium]           191    3e-47 
emb|CAM84153.1|  60 kDa heat shock protein [Bartonella chomelii]    191    3e-47 
ref|ZP_02370410.1|  chaperonin GroEL [Burkholderia thailandens...   191    3e-47 
dbj|BAI44111.1|  GroEL [endosymbiont of Euscepes postfasciatus]     191    4e-47 
gb|ACC64991.1|  Cpn60 [uncultured soil bacterium]                   191    4e-47 
ref|ZP_02384324.1|  chaperonin GroEL [Burkholderia thailandens...   191    4e-47 
ref|YP_439113.1|  chaperonin GroEL [Burkholderia thailandensis...   191    4e-47  Gene info
gb|AAB65625.1|  GroEL [Anaplasma phagocytophilum] >gb|AAB65627...   191    4e-47 
gb|ACC65048.1|  Cpn60 [uncultured soil bacterium]                   191    4e-47 
gb|AAF07941.1|AF192796_1  GroEL [Anaplasma phagocytophilum]         191    4e-47 
gb|ACF74530.1|  chaperonin GroEL [Anaplasma phagocytophilum] >...   191    4e-47 
gb|ABR67049.1|  60 kDa chaperonin [Anaplasma phagocytophilum]       191    4e-47 
gb|ABY78892.1|  chaperonin GroEL [Cystobacter fuscus]               191    4e-47 
gb|ACD68151.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    4e-47 
gb|AAU85584.1|  GroESL [Anaplasma phagocytophilum]                  191    4e-47 
gb|ABG75603.1|  60 kDa chaperonin [Anaplasma phagocytophilum]       191    4e-47 
gb|ACD68141.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    4e-47 
gb|AAF01681.1|AF173988_1  heat shock protein GroEL [Anaplasma ...   191    5e-47 
gb|ACQ45535.1|  chaperonin GroEL [Vesicomya gigas gill symbiont]    191    5e-47 
gb|ACQ45537.1|  chaperonin GroEL [Vesicomya sp. endosymbiont]       191    5e-47 
gb|AAL88677.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    5e-47 
gb|ACQ45534.1|  chaperonin GroEL [Calyptogena kilmeri gill sym...   191    5e-47 
gb|AAS21272.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    5e-47 
gb|ABV72591.1|  GroEL [Anaplasma phagocytophilum]                   191    5e-47 
gb|AAL04057.1|AF383226_1  GroEL [Anaplasma phagocytophilum] >g...   191    5e-47 
gb|ABV72590.1|  GroEL [Anaplasma phagocytophilum]                   191    5e-47 
gb|ABG79016.2|  GroEL [Anaplasma phagocytophilum]                   191    5e-47 
gb|AAZ94081.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    5e-47 
ref|YP_504857.1|  chaperonin GroEL [Anaplasma phagocytophilum ...   191    5e-47  Gene info
gb|AAM77030.1|  heat shock protein Hsp60 [Bartonella schoenbuc...   191    5e-47 
gb|AAS21271.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    5e-47 
sp|O34191.1|CH60_ANAPH  RecName: Full=60 kDa chaperonin; AltNa...   191    5e-47 
ref|ZP_03787920.1|  chaperonin, 60 kDa [Wolbachia endosymbiont...   191    5e-47 
ref|XP_002333518.1|  predicted protein [Populus trichocarpa] >...   191    5e-47  UniGene infoGene info
gb|ABA61361.1|  GroEL [Flavobacterium branchiophilum]               191    5e-47 
gb|AAD51016.1|  heat shock protein GroEL [Anaplasma phagocytop...   191    6e-47 
gb|ACC64729.1|  Cpn60 [uncultured soil bacterium]                   191    6e-47 
gb|ABY86684.1|  chaperonin GroEL1 [Sorangium cellulosum]            191    6e-47 
gb|ACC65228.1|  Cpn60 [uncultured soil bacterium]                   191    6e-47 
gb|ABY86682.1|  chaperonin GroEL1 [Sorangium cellulosum]            191    7e-47 
gb|ABG79015.2|  GroEL [Anaplasma phagocytophilum]                   191    7e-47 
ref|YP_002457235.1|  chaperonin Cpn60/TCP-1 [Desulfitobacteriu...   191    7e-47  Gene info
gb|ACC64985.1|  Cpn60 [uncultured soil bacterium]                   190    8e-47 
gb|ACF74528.1|  chaperonin GroEL [Anaplasma phagocytophilum]        190    8e-47 
gb|ABV72589.1|  GroEL [Anaplasma phagocytophilum] >gb|ABV72592...   190    8e-47 
dbj|BAH22856.1|  heat shock protein [Anaplasma sp. NS108]           190    8e-47 
emb|CAY85838.1|  GroEL protein [Gluconacetobacter sacchari]         190    8e-47 
gb|ACC65266.1|  Cpn60 [uncultured soil bacterium]                   190    9e-47 
emb|CAD61956.1|  GroEL homologue [Methylosinus trichosporium]       190    1e-46 
ref|YP_726465.1|  chaperonin GroEL [Ralstonia eutropha H16] >e...   190    1e-46  Gene info
gb|ABY86685.1|  chaperonin GroEL1 [Sorangium cellulosum]            190    1e-46 
gb|ACC65540.1|  Cpn60 [uncultured soil bacterium]                   190    1e-46 
gb|ACQ45536.1|  chaperonin GroEL [Ectenagena extenta gill symb...   189    1e-46 
gb|ACC64718.1|  Cpn60 [uncultured soil bacterium]                   189    1e-46 
gb|ABY78891.1|  chaperonin GroEL [Myxococcus fulvus]                189    1e-46 
gb|ACC65397.1|  Cpn60 [uncultured soil bacterium]                   189    1e-46 
gb|ABY86687.1|  chaperonin GroEL1 [Sorangium cellulosum]            189    2e-46 
ref|YP_001892921.1|  chaperonin GroEL [Ralstonia pickettii 12J...   189    2e-46  Gene info
gb|AAD51014.1|  heat shock protein GroEL [Anaplasma phagocytop...   189    2e-46 
gb|ACC65414.1|  Cpn60 [uncultured soil bacterium]                   189    2e-46 
gb|ACC65295.1|  Cpn60 [uncultured soil bacterium]                   189    2e-46 
ref|NP_966107.1|  chaperonin GroEL [Wolbachia endosymbiont of ...   189    2e-46  Gene info
ref|ZP_00372436.1|  chaperonin, 60 kDa [Wolbachia endosymbiont...   189    3e-46 
ref|XP_002459819.1|  hypothetical protein SORBIDRAFT_02g011260...   189    3e-46  UniGene infoGene info
gb|AAW52275.1|  GroEL [Wolbachia endosymbiont of Nasonia vitri...   189    3e-46 
gb|ACQ45541.1|  chaperonin GroEL [Vesicomya sp. mt-II symbiont]     188    3e-46 
ref|XP_808967.1|  chaperonin HSP60 mitochondrial precursor [Tr...   188    3e-46  Gene info
gb|ACC65331.1|  Cpn60 [uncultured soil bacterium]                   188    3e-46 
dbj|BAB86790.1|  molecular chaperon groEL [Wolbachia endosymbi...   188    3e-46 
gb|ACQ45545.1|  chaperonin GroEL [Vesicomya sp. mt-I symbiont]      188    3e-46 
dbj|BAB86787.1|  molecular chaperon groEL [Wolbachia endosymbi...   188    3e-46 
gb|ACC64825.1|  Cpn60 [uncultured soil bacterium]                   188    4e-46 
gb|AAW52268.1|  GroEL [Wolbachia endosymbiont of Drosophila si...   188    4e-46 
gb|AAP31415.1|AF478129_1  heat shock protein GroEL [Anaplasma ...   188    4e-46 
gb|ACD14149.1|  heat shock protein GroEL [Anaplasma platys]         188    5e-46 
ref|YP_001893165.1|  chaperonin GroEL [Ralstonia pickettii 12J...   188    5e-46  Gene info
gb|AAK72609.1|  heat shock protein [Anaplasma platys] >gb|AAL7...   188    5e-46 
gb|ABB16413.1|  heat-shock protein 60 kDa [Actinobacillus porc...   187    5e-46 
gb|ABB05450.1|  heat-shock protein 60 kDa [Haemophilus parasui...   187    5e-46 
gb|ACC65370.1|  Cpn60 [uncultured soil bacterium]                   187    5e-46 
gb|ACQ45542.1|  chaperonin GroEL [Calyptogena ponderosa endosy...   187    5e-46 
gb|AAQ64460.1|  heat shock protein 65 [Mycobacterium scrofulac...   187    5e-46 
gb|ABB16401.1|  heat-shock protein 60 kDa [Actinobacillus porc...   187    5e-46 
gb|ACC65307.1|  Cpn60 [uncultured soil bacterium]                   187    6e-46 
gb|ABB05411.1|  heat-shock protein 60 kDa [Haemophilus parasui...   187    6e-46 
gb|ABB05481.1|  heat-shock protein 60 kDa [Haemophilus parasui...   187    6e-46 
gb|AAK32145.1|AF335327_1  60 kDa heat shock protein [Flavobact...   187    6e-46 
gb|ABB05412.1|  heat-shock protein 60 kDa [Haemophilus parasui...   187    7e-46 
gb|ABY60431.1|  GroEL [Pseudomonas aeruginosa]                      187    7e-46 
gb|ACC65051.1|  Cpn60 [uncultured soil bacterium]                   187    7e-46 
gb|AAW52269.1|  GroEL [Wolbachia endosymbiont of Drosophila si...   187    7e-46 
gb|ACQ45544.1|  chaperonin GroEL [Vesicomya sp. mt-III symbiont]    187    8e-46 
gb|ACA62992.1|  GroEL [Bacteriovorax sp. JS7] >gb|ACA62998.1| ...   187    8e-46 
gb|AAW52271.1|  GroEL [Wolbachia endosymbiont of Melittobia di...   187    8e-46 
gb|ACC65502.1|  Cpn60 [uncultured soil bacterium]                   187    8e-46 
gb|AAQ64509.1|  heat shock protein 65 [Mycobacterium intermedium]   187    8e-46 
gb|AAW52270.1|  GroEL [Wolbachia endosymbiont of Drosophila si...   187    8e-46 
gb|AAQ73479.1|  heat shock protein [Mycobacterium kubicae]          187    9e-46 
gb|AAQ64459.1|  heat shock protein 65 [Mycobacterium avium sub...   187    9e-46 
gb|AAQ64462.1|  heat shock protein 65 [Mycobacterium shimoidei...   187    1e-45 
gb|ABB20536.1|  60 kDa chaperonin [Thiothrix eikelboomii]           186    1e-45 
gb|ABB05433.1|  heat-shock protein 60 kDa [Haemophilus parasui...   186    1e-45 
ref|YP_001857348.1|  chaperonin GroEL [Burkholderia phymatum S...   186    1e-45  Gene info
gb|AAW52273.1|  GroEL [Wolbachia endosymbiont of Nasonia girau...   186    1e-45 
gb|AAW52274.1|  GroEL [Wolbachia endosymbiont of Nasonia longi...   186    1e-45 
gb|ACQ45540.1|  chaperonin GroEL [Vesicomya sp. mt-II symbiont]     186    1e-45 
gb|ACA63009.1|  GroEL [Bacteriovorax sp. T2] >gb|ACA63010.1| G...   186    2e-45 
gb|AAW52272.1|  GroEL [Wolbachia endosymbiont of Asobara tabida]    186    2e-45 
gb|ACQ45539.1|  chaperonin GroEL [Vesicomya sp. endosymbiont]       186    2e-45 
gb|ABU93376.1|  GroEL [Brucella abortus]                            186    2e-45 
ref|XP_002276547.1|  PREDICTED: hypothetical protein [Vitis vi...   186    2e-45  UniGene infoGene info
ref|YP_001206315.1|  chaperonin GroEL [Bradyrhizobium sp. ORS2...   186    2e-45  Gene info
gb|ABB16408.1|  heat-shock protein 60 kDa [Actinobacillus porc...   186    2e-45 
dbj|BAA19540.1|  GroEL protein homolog [Wolbachia sp. group B]      186    2e-45 
gb|ABC87081.1|  GroEL [Wolbachia endosymbiont of Laodelphax st...   186    2e-45 
gb|ABO70317.1|  GroEL [Wolbachia endosymbiont of Laodelphax st...   186    2e-45 
emb|CAE82066.1|  GroEL protein [Wolbachia pipientis]                186    2e-45 
gb|ACA62994.1|  GroEL [Bacteriovorax sp. PS23S] >gb|ACA62995.1...   185    2e-45 
emb|CBI27180.1|  unnamed protein product [Vitis vinifera]           185    2e-45 
gb|ABB05413.1|  heat-shock protein 60 kDa [Haemophilus parasui...   185    2e-45 
gb|ABB20563.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   185    3e-45 
gb|ACA62996.1|  GroEL [Bacteriovorax sp. PS12B]                     185    3e-45 
gb|ABF71892.1|  heat shock protein 65 [Mycobacterium senuense]      185    3e-45 
gb|ABF71887.1|  heat shock protein 65 [Mycobacterium seoulense...   185    3e-45 
gb|AAQ64484.1|  heat shock protein 65 [Mycobacterium thermores...   185    3e-45 
ref|YP_001974861.1|  chaperonin, 60 kDa [Wolbachia endosymbion...   185    3e-45  Gene info
gb|ABB20562.1|  60 kDa chaperonin [uncultured bacterium]            185    3e-45 
gb|ACA62997.1|  GroEL [Bacteriovorax sp. PS21S]                     185    3e-45 
gb|ACC64846.1|  Cpn60 [uncultured soil bacterium]                   185    3e-45 
gb|AAQ73477.1|  heat shock protein [Mycobacterium hassiacum]        185    3e-45 
gb|ABY86667.1|  chaperonin GroEL1 [Sorangium cellulosum]            185    3e-45 
gb|ACC65011.1|  Cpn60 [uncultured soil bacterium]                   185    3e-45 
gb|AAQ64473.1|  heat shock protein 65 [Mycobacterium flavescens]    185    3e-45 
gb|AAQ64456.1|  heat shock protein 65 [Mycobacterium marinum] ...   185    3e-45 
gb|AAL57367.1|AF409113_1  GroEL [Wolbachia endosymbiont of Lit...   185    3e-45 
gb|ACC65016.1|  Cpn60 [uncultured soil bacterium]                   185    3e-45 
gb|ABL86735.1|  Cpn60 [subglacial bacterium A20(20)] >gb|ABX11...   185    4e-45 
ref|YP_001239628.1|  chaperonin GroEL [Bradyrhizobium sp. BTAi...   185    4e-45  Gene info
gb|AAD44540.2|AF115542_1  GroEL-type chaperonin [Desulfitobact...   185    4e-45 
gb|AAQ64510.1|  heat shock protein 65 [Mycobacterium intracell...   185    4e-45 
gb|ACC65312.1|  Cpn60 [uncultured soil bacterium]                   185    4e-45 
gb|AAQ64480.1|  heat shock protein 65 [Mycobacterium phlei]         184    4e-45 
gb|AAQ64455.1|  heat shock protein 65 [Mycobacterium asiaticum...   184    5e-45 
gb|ACX56582.1|  heat shock protein 60 [Vibrio sp. 0407MH21] >g...   184    5e-45 
gb|ABB20535.1|  60 kDa chaperonin [Thiothrix unzii]                 184    5e-45 
gb|AAZ79289.1|  60 kDa chaperonin [Brachyspira hyodysenteriae]      184    5e-45 
emb|CAD29289.1|  GroEL protein [Blattabacterium sp.]                184    6e-45 
gb|AAW52266.1|  GroEL [Wolbachia endosymbiont of Trichogramma ...   184    6e-45 
gb|ABB71558.1|  heat shock protein 60 [Wolbachia pipientis] >g...   184    6e-45 
gb|AAQ64469.1|  heat shock protein 65 [Mycobacterium aichiense]     184    6e-45 
gb|AAQ64507.1|  heat shock protein 65 [Mycobacterium haemophilum]   184    6e-45 
gb|ABB20533.1|  60 kDa chaperonin [Desulfovibrio vulgaris str....   184    6e-45 
gb|AAQ64468.1|  heat shock protein 65 [Mycobacterium abscessus]     184    6e-45 
gb|AAQ64464.1|  heat shock protein 65 [Mycobacterium terrae]        184    6e-45 
gb|ABS11949.1|  heat shock protein 65 [Mycobacterium abscessus...   184    6e-45 
dbj|BAB86789.1|  molecular chaperon groEL [Wolbachia endosymbi...   184    6e-45 
ref|YP_002457219.1|  chaperonin Cpn60/TCP-1 [Desulfitobacteriu...   184    7e-45  Gene info
gb|ACO09552.1|  60 kDa heat shock protein, mitochondrial precu...   184    7e-45 
gb|AAQ64515.1|  heat shock protein 65 [Mycobacterium malmoense]     184    7e-45 
gb|ABX11635.1|  60 kDa chaperonin [Burkholderia xenovorans]         184    7e-45 
ref|XP_001610625.1|  chaperonin cpn60 [Babesia bovis T2Bo] >gb...   184    7e-45  Gene info
gb|AAW52262.1|  GroEL [Wolbachia endosymbiont of Drosophila si...   184    7e-45 
gb|AAV35995.1|  GroEL [Wolbachia endosymbiont of Zootermopsis ...   184    7e-45 
gb|ACZ56450.1|  60 kDa chaperonin [Xanthobacter sp. CB6] >gb|A...   184    7e-45 
gb|AAZ79287.1|  60 kDa chaperonin [Brachyspira pilosicoli]          184    7e-45 
gb|AAW52267.1|  GroEL [Wolbachia endosymbiont of Culex quinque...   184    8e-45 
gb|AAV35994.1|  GroEL [Wolbachia endosymbiont of Zootermopsis ...   184    8e-45 
gb|ACC64705.1|  Cpn60 [uncultured soil bacterium]                   184    8e-45 
gb|ACC64941.1|  Cpn60 [uncultured soil bacterium]                   184    8e-45 
gb|AAW52261.1|  GroEL [Wolbachia endosymbiont of Tribolium con...   184    8e-45 
gb|AAQ73475.1|  heat shock protein [Mycobacterium xenopi]           184    8e-45 
gb|ACC65425.1|  Cpn60 [uncultured soil bacterium]                   184    9e-45 
gb|ACZ56451.1|  60 kDa chaperonin [Oxalicibacterium flavum] >g...   183    9e-45 
gb|ACA62984.1|  GroEL [Bacteriovorax sp. GSL4C]                     183    9e-45 
gb|AAQ64486.1|  heat shock protein 65 [Mycobacterium wolinskyi]     183    9e-45 
gb|AAQ64482.1|  heat shock protein 65 [Mycobacterium senegalense]   183    1e-44 
gb|AAQ64463.1|  heat shock protein 65 [Mycobacterium szulgai] ...   183    1e-44 
gb|AAQ64472.1|  heat shock protein 65 [Mycobacterium farcinoge...   183    1e-44 
gb|AAQ73474.1|  heat shock protein [Mycobacterium lentiflavum]...   183    1e-44 
gb|ACQ45538.1|  chaperonin GroEL [Vesicomya sp. endosymbiont]       183    1e-44 
gb|ABB71560.1|  heat shock protein 60 [Wolbachia pipientis] >g...   183    1e-44 
emb|CAA70570.1|  heat shock protein 60 [Onchocerca volvulus]        183    1e-44 
gb|ACC65100.1|  Cpn60 [uncultured soil bacterium]                   183    1e-44 
gb|ABB71556.1|  heat shock protein 60 [Wolbachia pipientis] >g...   183    1e-44 
gb|AAQ64481.1|  heat shock protein 65 [Mycobacterium peregrinum]    183    1e-44 
gb|ACC64866.1|  Cpn60 [uncultured soil bacterium]                   183    1e-44 
gb|AAQ64458.1|  heat shock protein 65 [Mycobacterium nonchromo...   183    1e-44 
gb|ACJ65756.1|  heat shock protein [Mycobacterium sp. 05-2522]      183    1e-44 
gb|ABU93363.1|  GroEL [Brucella melitensis]                         183    1e-44 
gb|ABL86742.1|  Cpn60 [subglacial bacterium A20(59)]                183    1e-44 
gb|AAQ64465.1|  heat shock protein 65 [Mycobacterium triviale]      183    1e-44 
gb|ABB16403.1|  heat-shock protein 60 kDa [Actinobacillus pleu...   183    1e-44 
ref|XP_763224.1|  chaperonin 60 kDa [Theileria parva strain Mu...   183    1e-44  Gene info
gb|AAV84348.1|  60 kDa chaperonin [Desulfovibrio oxamicus]          182    2e-44 
gb|AAZ79288.1|  60 kDa chaperonin [Brachyspira aalborgi]            182    2e-44 
gb|AAK95369.1|  heat shock protein 60 kDa [Campylobacter lari ...   182    2e-44 
gb|AAQ64513.1|  heat shock protein 65 [Mycobacterium kansasii]      182    2e-44 
gb|AAQ64492.1|  heat shock protein 65 [Mycobacterium kansasii]...   182    2e-44 
gb|ACC65466.1|  Cpn60 [uncultured soil bacterium]                   182    2e-44 
gb|ACC64950.1|  Cpn60 [uncultured soil bacterium]                   182    2e-44 
gb|ABB16409.1|  heat-shock protein 60 kDa [Haemophilus sp. CAP...   182    2e-44 
gb|AAZ79292.1|  60 kDa chaperonin [Brachyspira murdochii DSM 1...   182    2e-44 
gb|ACZ56456.1|  60 kDa chaperonin [ultramicrobacterium str. MY14]   182    2e-44 
gb|ACC64953.1|  Cpn60 [uncultured soil bacterium]                   182    2e-44 
gb|AAQ64502.1|  heat shock protein 65 [Mycobacterium celatum] ...   182    2e-44 
emb|CAE82062.1|  GroEL protein [Wolbachia pipientis]                182    2e-44 
gb|AAZ79291.1|  60 kDa chaperonin [Brachyspira alvinipulli]         182    2e-44 
gb|AAQ64477.1|  heat shock protein 65 [Mycobacterium mucogenicum]   182    2e-44 
gb|AAQ64508.1|  heat shock protein 65 [Mycobacterium interjectum]   182    2e-44 
gb|AAX24025.1|  60 kDa chaperonin [Xanthomonas campestris pv. ...   182    2e-44 
gb|ACJ47183.1|  chaperonin GroEL [Wolbachia endosymbiont of On...   182    2e-44 
emb|CAD89996.1|  GroEL protein [Wolbachia pipientis]                182    3e-44 
gb|AAX19049.1|  60 kDa chaperonin [Campylobacter coli] >gb|AAZ...   182    3e-44 
gb|AAQ64471.1|  heat shock protein 65 [Mycobacterium chitae]        182    3e-44 
gb|ACI40480.1|  GroEL [Clostridium septicum] >gb|ACI40481.1| G...   182    3e-44 
gb|AAT96608.1|  60 kDa chaperonin [Faecalibacterium prausnitzii]    182    3e-44 
gb|AAM88510.1|  Cpn60 [Balneatrix alpica]                           182    3e-44 
gb|ACZ56453.1|  60 kDa chaperonin [Oxalicibacterium horti]          182    3e-44 
emb|CAE82063.1|  GroEL protein [Wolbachia pipientis]                182    3e-44 
gb|ACC65328.1|  Cpn60 [uncultured soil bacterium]                   182    3e-44 
gb|ABY86666.1|  chaperonin GroEL1 [Sorangium cellulosum]            182    3e-44 
gb|AAK95367.1|  heat shock protein 60 kDa [Campylobacter coli]...   182    3e-44 
gb|ACO24567.1|  heat shock protein 65 [Mycobacterium austroafr...   182    3e-44 
gb|ACC64830.1|  Cpn60 [uncultured soil bacterium]                   182    3e-44 
gb|ACO24565.1|  heat shock protein 65 [Mycobacterium porcinum]      182    3e-44 
gb|ACO24557.1|  heat shock protein 65 [Mycobacterium chelonae]      181    3e-44 
emb|CAF31526.1|  groEL [Wolbachia pipientis]                        181    3e-44 
gb|AAQ64478.1|  heat shock protein 65 [Mycobacterium neoaurum]...   181    3e-44 
gb|ACC64918.1|  Cpn60 [uncultured soil bacterium]                   181    4e-44 
gb|ACH56344.1|  chaperonin-60 [uncultured bacterium]                181    4e-44 
ref|XP_002528171.1|  rubisco subunit binding-protein alpha sub...   181    4e-44  Gene info
gb|AAW52260.1|  GroEL [Wolbachia endosymbiont of Encarsia form...   181    4e-44 
emb|CAE82070.1|  GroEL protein [Wolbachia pipientis]                181    4e-44 
gb|AAW52259.1|  GroEL [Wolbachia endosymbiont of Nasonia vitri...   181    4e-44 
gb|AAW52265.1|  GroEL [Wolbachia endosymbiont of Leptopilina a...   181    4e-44 
gb|ABB20534.1|  60 kDa chaperonin [Thiothrix fructosivorans]        181    4e-44 
gb|AAQ64461.1|  heat shock protein 65 [Mycobacterium shimoidei]     181    4e-44 
emb|CAP69868.1|  60 kDa chaperonin protein [Campylobacter suba...   181    4e-44 
gb|AAQ64485.1|  heat shock protein 65 [Mycobacterium vaccae]        181    5e-44 
gb|ACC65000.1|  Cpn60 [uncultured soil bacterium]                   181    5e-44 
gb|AAQ64457.1|  heat shock protein 65 [Mycobacterium microti] ...   181    5e-44 
gb|ACQ84989.1|  60 kDa chaperonin [uncultured bacterium]            181    5e-44 
gb|ABB16402.1|  heat-shock protein 60 kDa [Pasteurella multocida]   181    5e-44 
gb|ACH56251.1|  chaperonin-60 [uncultured bacterium]                181    5e-44 
gb|EAZ10099.1|  hypothetical protein OsI_32408 [Oryza sativa I...   181    5e-44 
ref|XP_954903.1|  chaperonin CPN60 [Theileria annulata strain ...   181    5e-44  Gene info
gb|ACZ92040.1|  60 kDa chaperonin [Herminiimonas saxobsidens] ...   181    6e-44 
gb|AAQ64514.1|  heat shock protein 65 [Mycobacterium leprae]        181    6e-44 
gb|ACH72250.1|  chaperonin-60 [uncultured bacterium]                181    6e-44 
gb|ACH56260.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   181    6e-44 
gb|ABB71567.1|  heat shock protein 60 [Wolbachia pipientis]         181    6e-44 
gb|AAQ64470.1|  heat shock protein 65 [Mycobacterium chelonae]      181    6e-44 
ref|YP_002361601.1|  chaperonin Cpn60/TCP-1 [Methylocella silv...   181    6e-44  Gene info
gb|AAM88562.1|  Cpn60 [Comamonas terrigena]                         181    6e-44 
gb|ACC65473.1|  Cpn60 [uncultured soil bacterium]                   181    6e-44 
gb|ACC65326.1|  Cpn60 [uncultured soil bacterium]                   181    6e-44 
gb|ACO24558.1|  heat shock protein 65 [Mycobacterium chelonae]      181    6e-44 
gb|ACH56393.1|  chaperonin-60 [uncultured bacterium]                181    7e-44 
gb|ACO24562.1|  heat shock protein 65 [Mycobacterium psychroto...   181    7e-44 
gb|ACC64983.1|  Cpn60 [uncultured soil bacterium]                   181    7e-44 
emb|CAP58758.1|  60 kDa chaperonin [Campylobacter peloridis] >...   181    7e-44 
dbj|BAH22178.1|  GroEL2 [Pleurocapsa sp. PCC 7319]                  181    7e-44 
emb|CAG26669.1|  GroEL chaperonin [Lactobacillus plantarum sub...   181    7e-44 
gb|AAQ64474.1|  heat shock protein 65 [Mycobacterium fortuitum]     180    8e-44 
emb|CAF18443.1|  heat shock protein 60 [Tetragenococcus solita...   180    8e-44 
gb|ACK56138.1|  GroEL [Anaplasma ovis]                              180    8e-44 
gb|ABL86757.1|  Cpn60 [Variovorax sp. A90]                          180    8e-44 
emb|CAT12839.1|  heat shock protein 60 [Campylobacter sp. LMG ...   180    9e-44 
gb|ACC65429.1|  Cpn60 [uncultured soil bacterium]                   180    9e-44 
emb|CAP58757.1|  60 kDa chaperonin [Campylobacter insulaenigrae]    180    9e-44 
gb|ACH56409.1|  chaperonin-60 [uncultured bacterium]                180    9e-44 
gb|ACC65428.1|  Cpn60 [uncultured soil bacterium]                   180    9e-44 
gb|ACH72456.1|  chaperonin-60 [uncultured bacterium]                180    9e-44 
gb|ACH56294.1|  chaperonin-60 [uncultured bacterium]                180    9e-44 
emb|CAE82065.1|  GroEL protein [Wolbachia pipientis]                180    9e-44 
emb|CBG91948.1|  heat shock protein 60 [Arcobacter skirrowii]       180    1e-43 
gb|AAV84353.1|  60 kDa chaperonin [Neisseria perflava]              180    1e-43 
ref|XP_002018904.1|  GL25699 [Drosophila persimilis] >gb|EDW37...   180    1e-43  Gene info
gb|AAM88514.1|  Cpn60 [Comamonas testosteroni]                      180    1e-43 
ref|YP_198181.1|  chaperonin GroEL [Wolbachia endosymbiont str...   180    1e-43  Gene info
emb|CAX62306.1|  heat shock protein 60 [Arcobacter cryaerophil...   180    1e-43 
emb|CAE82064.1|  GroEL protein [Wolbachia pipientis]                180    1e-43 
gb|ACD78526.1|  heat shock protein 60 [Vibrio sp. FALF109]          180    1e-43 
gb|ABL86752.1|  Cpn60 [Polaromonas sp. A10]                         180    1e-43 
gb|ACH56372.1|  chaperonin-60 [uncultured bacterium]                180    1e-43 
gb|AAM49461.1|AF437200_1  60 kDa chaperonin [uncultured pig fa...   180    1e-43 
gb|ACF20344.1|  60 kDa chaperonin [Pseudomonas pictorum]            180    1e-43 
gb|AAZ94783.1|  60 kDa chaperonin [Campylobacter jejuni] >gb|A...   180    1e-43 
gb|ACC65527.1|  Cpn60 [uncultured soil bacterium]                   180    1e-43 
gb|ACO24560.1|  heat shock protein 65 [Mycobacterium chelonae]      180    1e-43 
gb|ACC64817.1|  Cpn60 [uncultured soil bacterium]                   180    1e-43 
gb|AAK95368.1|  heat shock protein 60 kDa [Campylobacter jejun...   180    1e-43 
gb|ACH72440.1|  chaperonin-60 [uncultured bacterium]                180    1e-43 
gb|ABB71562.1|  heat shock protein 60 [Wolbachia pipientis]         180    1e-43 
gb|ACH72442.1|  chaperonin-60 [uncultured bacterium]                180    1e-43 
gb|ACO24563.1|  heat shock protein 65 [Mycobacterium setense]       180    1e-43 
gb|ACH56272.1|  chaperonin-60 [uncultured bacterium]                180    1e-43 
gb|ACJ47182.1|  chaperonin GroEL [Wolbachia endosymbiont of Ar...   179    1e-43 
gb|AAZ94769.1|  60 kDa chaperonin [Campylobacter coli]              179    1e-43 
gb|ACC64864.1|  Cpn60 [uncultured soil bacterium]                   179    1e-43 
emb|CAF28467.1|  60 kDa chaperonin [Wolbachia endosymbiont of ...   179    1e-43 
ref|XP_002366679.1|  TCP-1/cpn60 chaperonin family protein, pu...   179    1e-43  Gene info
gb|ABX11622.1|  60 kDa chaperonin [Delftia acidovorans]             179    1e-43 
ref|XP_001357321.1|  GA14234 [Drosophila pseudoobscura pseudoo...   179    1e-43  Gene info
emb|CAX62323.1|  heat shock protein 60 [Arcobacter skirrowii]       179    1e-43 
gb|EEE24305.1|  chaperonin-60kD, ch60, putative [Toxoplasma go...   179    1e-43 
emb|CAF28468.1|  60 kDa chaperonin [Wolbachia endosymbiont of ...   179    1e-43 
gb|ACZ92042.1|  60 kDa chaperonin [Herminiimonas sp. NBRC 102664]   179    1e-43 
gb|AAM88502.1|  Cpn60 [Weeksella virosa]                            179    2e-43 
gb|ACO24566.1|  heat shock protein 65 [Mycobacterium llatzerense]   179    2e-43 
emb|CAX62307.1|  heat shock protein 60 [Arcobacter cryaerophilus]   179    2e-43 
gb|AAZ94817.1|  60 kDa chaperonin [Arcobacter cryaerophilus] >...   179    2e-43 
gb|ACC64837.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
emb|CAD90138.1|  heat shock protein 60 [Helicobacter mustelae]      179    2e-43 
gb|ACC65355.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
gb|AAZ79290.1|  60 kDa chaperonin [Brachyspira innocens]            179    2e-43 
emb|CAB96372.1|  heat shock protein 60 [Mycoplasma agalactiae ...   179    2e-43 
gb|AAZ94779.1|  60 kDa chaperonin [Campylobacter fetus subsp. ...   179    2e-43 
gb|ACO24569.1|  heat shock protein 65 [Mycobacterium arupense]      179    2e-43 
gb|ABX11590.1|  60 kDa chaperonin [Burkholderia cepacia]            179    2e-43 
gb|ACD78331.1|  heat shock protein 60 [Vibrio sp. FAL1295] >gb...   179    2e-43 
gb|ACC65204.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
sp|Q48900.1|CH60_MYCAV  RecName: Full=60 kDa chaperonin; AltNa...   179    2e-43 
gb|ACC65310.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
emb|CAX62315.1|  heat shock protein 60 [Arcobacter thereius] >...   179    2e-43 
emb|CAX62317.1|  heat shock protein 60 [Arcobacter thereius]        179    2e-43 
emb|CAE82068.1|  GroEL protein [Wolbachia pipientis] >gb|ACJ47...   179    2e-43 
gb|AAM88501.1|  Cpn60 [Acinetobacter lwoffii]                       179    2e-43 
emb|CAX62314.1|  heat shock protein 60 [Arcobacter cryaerophil...   179    2e-43 
gb|ACF20343.1|  60 kDa chaperonin [Pseudomonas resinovorans]        179    2e-43 
ref|ZP_06053476.1|  heat shock protein 60 family chaperone Gro...   179    2e-43 
gb|ACC65435.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
gb|ACC64816.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65148...   179    2e-43 
gb|AAZ94807.1|  60 kDa chaperonin [Arcobacter skirrowii] >emb|...   179    2e-43 
emb|CAX62308.1|  heat shock protein 60 [Arcobacter cryaerophil...   179    2e-43 
gb|AAZ94789.1|  60 kDa chaperonin [Campylobacter jejuni]            179    2e-43 
gb|ADB66145.1|  chaperonin GroEL1 [Sorangium cellulosum]            179    2e-43 
gb|ACC65497.1|  Cpn60 [uncultured soil bacterium]                   179    2e-43 
gb|ABL86741.1|  Cpn60 [subglacial bacterium A20(56)] >gb|ABL86...   179    3e-43 
gb|AAZ94809.1|  60 kDa chaperonin [Campylobacter helveticus]        179    3e-43 
gb|AAX19831.1|  60 kDa chaperonin [Helicobacter mustelae]           179    3e-43 
gb|AAZ94794.1|  60 kDa chaperonin [Campylobacter jejuni subsp....   179    3e-43 
gb|ABS11231.1|  heat shock protein 60 [Vibrio parahaemolyticus]     179    3e-43 
emb|CAX62310.1|  heat shock protein 60 [Arcobacter cryaerophil...   179    3e-43 
gb|ACD78587.1|  heat shock protein 60 [Vibrio sp. FALF181] >gb...   179    3e-43 
emb|CBG91939.1|  heat shock protein 60 [Arcobacter cryaerophilus]   178    3e-43 
gb|ADB66140.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   178    3e-43 
gb|ACH56345.1|  chaperonin-60 [uncultured bacterium]                178    3e-43 
gb|AAM88512.1|  Cpn60 [Pseudomonas oryzihabitans]                   178    3e-43 
gb|AAZ94770.1|  60 kDa chaperonin [Campylobacter upsaliensis] ...   178    3e-43 
gb|AAV84347.1|  60 kDa chaperonin [Desulfobacterium autotrophi...   178    4e-43 
sp|Q50220.1|CH60_MYCMR  RecName: Full=60 kDa chaperonin; AltNa...   178    4e-43 
gb|AAQ64476.1|  heat shock protein 65 [Mycobacterium aurum]         178    4e-43 
emb|CAF31525.1|  groEL [Wolbachia pipientis]                        178    4e-43 
emb|CAX62322.1|  heat shock protein 60 [Arcobacter mytili]          178    4e-43 
gb|ACF20342.1|  60 kDa chaperonin [Halothiobacillus halophilus]     178    4e-43 
gb|ABL86732.1|  Cpn60 [Flavobacterium sp. SOC A4(12)]               178    4e-43 
gb|AAV32667.1|  60 kDa chaperonin [Campylobacter lari] >gb|AAV...   178    4e-43 
gb|ACH56256.1|  chaperonin-60 [uncultured bacterium]                178    4e-43 
gb|ACC65519.1|  Cpn60 [uncultured soil bacterium]                   178    4e-43 
gb|ACC65499.1|  Cpn60 [uncultured soil bacterium]                   178    4e-43 
gb|AAX19829.1|  60 kDa chaperonin [Helicobacter winghamensis]       178    4e-43 
gb|AAX24028.1|  60 kDa chaperonin [Cytophaga hutchinsonii ATCC...   178    4e-43 
gb|ACH56335.1|  chaperonin-60 [uncultured bacterium]                178    5e-43 
gb|ACH72271.1|  chaperonin-60 [uncultured bacterium]                178    5e-43 
gb|AAZ94795.1|  60 kDa chaperonin [Campylobacter sputorum biov...   178    5e-43 
gb|ACD03146.1|  heat shock protein 60 [Campylobacter cuniculor...   178    5e-43 
gb|ACC65556.1|  Cpn60 [uncultured soil bacterium]                   178    5e-43 
gb|ABB20586.1|  60 kDa chaperonin [uncultured bacterium]            177    5e-43 
gb|ADB66135.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   177    5e-43 
ref|YP_001834439.1|  chaperonin Cpn60/TCP-1 [Beijerinckia indi...   177    5e-43  Gene info
emb|CAZ65704.1|  heat shock protein 60 [Campylobacter sp. MIT ...   177    5e-43 
gb|ADB66137.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   177    5e-43 
gb|ACC65470.1|  Cpn60 [uncultured soil bacterium]                   177    5e-43 
gb|ACC64901.1|  Cpn60 [uncultured soil bacterium]                   177    5e-43 
gb|ACC65284.1|  Cpn60 [uncultured soil bacterium]                   177    5e-43 
emb|CAX62319.1|  heat shock protein 60 [Arcobacter cibarius] >...   177    5e-43 
gb|ACH56296.1|  chaperonin-60 [uncultured bacterium]                177    5e-43 
gb|AAX19840.1|  60 kDa chaperonin [Helicobacter muridarum]          177    5e-43 
gb|AAX22908.1|  heat shock protein 60 [Vibrio sp. 12D12] >gb|A...   177    6e-43 
gb|ACX57044.1|  heat shock protein 60 [Vibrio sp. 9RW106]           177    6e-43 
gb|ACH56247.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   177    6e-43 
gb|ABS11229.1|  heat shock protein 60 [Vibrio metschnikovii]        177    6e-43 
gb|AAM88490.1|  Cpn60 [Pseudomonas putida]                          177    6e-43 
gb|ADB66139.1|  chaperonin GroEL1 [Sorangium cellulosum]            177    6e-43 
gb|ABS11230.1|  heat shock protein 60 [Vibrio harveyi] >gb|ABS...   177    6e-43 
ref|YP_514950.1|  chaperonin GroEL [Chlamydophila felis Fe/C-5...   177    6e-43  Gene info
emb|CAZ65703.1|  heat shock protein 60 [Campylobacter sp. MIT ...   177    6e-43 
gb|AAV32655.1|  60 kDa chaperonin [Campylobacter coli] >gb|AAV...   177    6e-43 
gb|ACD78750.1|  heat shock protein 60 [Vibrio sp. FALF464]          177    6e-43 
gb|ABL86740.1|  Cpn60 [gamma proteobacterium SOC A20(46)]           177    6e-43 
gb|ACC65380.1|  Cpn60 [uncultured soil bacterium]                   177    6e-43 
gb|ACR37371.1|  unknown [Zea mays]                                  177    6e-43 
gb|ACJ47184.1|  chaperonin GroEL [Wolbachia endosymbiont of Co...   177    7e-43 
gb|ACC64806.1|  Cpn60 [uncultured soil bacterium]                   177    7e-43 
gb|ACD78581.1|  heat shock protein 60 [Vibrio sp. FALF173] >gb...   177    7e-43 
gb|AAM88542.1|  Cpn60 [Bordetella holmesii]                         177    7e-43 
gb|ACC64920.1|  Cpn60 [uncultured soil bacterium]                   177    7e-43 
gb|ADB66136.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   177    7e-43 
ref|XP_987433.1|  PREDICTED: similar to Heat shock protein 1 (...   177    7e-43  Gene info
gb|ACC64744.1|  Cpn60 [uncultured soil bacterium]                   177    7e-43 
sp|Q49093.1|CH60_MYCCH  RecName: Full=60 kDa chaperonin; AltNa...   177    7e-43 
gb|ACD03152.1|  heat shock protein 60 [Campylobacter cuniculorum]   177    8e-43 
gb|ACC64724.1|  Cpn60 [uncultured soil bacterium]                   177    8e-43 
gb|ABX11638.1|  60 kDa chaperonin [Acidovorax sp. JS42]             177    8e-43 
gb|ACH56411.1|  chaperonin-60 [uncultured bacterium]                177    8e-43 
gb|ACD78245.1|  heat shock protein 60 [Vibrio sp. FAL1146] >gb...   177    8e-43 
gb|AAT46082.1|  heat shock protein 65 [Mycobacterium massiliense]   177    8e-43 
gb|ACH72330.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   177    8e-43 
gb|ACX56744.1|  heat shock protein 60 [Vibrio sp. 9ZB73] >gb|A...   177    8e-43 
gb|ACH72427.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   177    8e-43 
gb|ACC65220.1|  Cpn60 [uncultured soil bacterium]                   177    8e-43 
emb|CBG91952.1|  heat shock protein 60 [Arcobacter cryaerophilus]   177    8e-43 
gb|ACX56810.1|  heat shock protein 60 [Vibrio sp. 9ZB155]           177    9e-43 
ref|ZP_03504079.1|  chaperonin GroEL [Rhizobium etli Brasil 5]      177    9e-43 
gb|ACH72348.1|  chaperonin-60 [uncultured bacterium]                177    9e-43 
gb|ACO24559.1|  heat shock protein 65 [Mycobacterium chelonae]      177    9e-43 
gb|ACH72429.1|  chaperonin-60 [uncultured bacterium]                177    9e-43 
gb|ABX11596.1|  60 kDa chaperonin [Thiobacillus denitrificans]      177    9e-43 
gb|ACH56229.1|  chaperonin-60 [uncultured bacterium]                177    9e-43 
gb|AAX19838.1|  60 kDa chaperonin [Helicobacter canis]              177    9e-43 
gb|ABK59817.1|  chaperonin 60 [Sphingobacterium multivorum]         177    9e-43 
gb|AAX22880.1|  heat shock protein 60 [Vibrio sp. 12B02] >gb|A...   177    9e-43 
gb|AAX77207.1|  65 kDa heat shock protein [Mycobacterium bolle...   177    9e-43 
gb|AAZ94793.1|  60 kDa chaperonin [Campylobacter curvus]            177    9e-43 
gb|ACH72291.1|  chaperonin-60 [uncultured bacterium]                177    9e-43 
gb|AAM88520.1|  Cpn60 [Acidovorax facilis]                          177    9e-43 
gb|ACH56322.1|  chaperonin-60 [uncultured bacterium]                177    1e-42 
gb|ACH56318.1|  chaperonin-60 [uncultured bacterium]                177    1e-42 
gb|ACC65461.1|  Cpn60 [uncultured soil bacterium]                   177    1e-42 
gb|ABX11594.1|  60 kDa chaperonin [Pseudomonas putida] >gb|ABX...   177    1e-42 
gb|AAX22778.1|  heat shock protein 60 [Vibrio sp. 1B04]             177    1e-42 
gb|ADB66142.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   177    1e-42 
gb|ACH56376.1|  chaperonin-60 [uncultured bacterium]                177    1e-42 
gb|AAX22883.1|  heat shock protein 60 [Vibrio sp. 12B05] >gb|A...   177    1e-42 
gb|AAO91842.1|  chaperonin 60 [bacterium DRB3-250]                  177    1e-42 
gb|ABX11613.1|  60 kDa chaperonin [Pseudomonas sp. Y2]              177    1e-42 
gb|AAM88482.1|  Cpn60 [Achromobacter denitrificans]                 177    1e-42 
gb|ACH56339.1|  chaperonin-60 [uncultured bacterium]                177    1e-42 
gb|ACC64942.1|  Cpn60 [uncultured soil bacterium]                   177    1e-42 
gb|ACH56350.1|  chaperonin-60 [uncultured bacterium]                177    1e-42 
gb|AAK69014.1|  HSP60 [Vibrio parahaemolyticus]                     177    1e-42 
gb|AAA65602.1|  heat-shock protein [Neorickettsia risticii]         177    1e-42 
gb|ACC65469.1|  Cpn60 [uncultured soil bacterium]                   177    1e-42 
gb|ACC65020.1|  Cpn60 [uncultured soil bacterium]                   177    1e-42 
gb|ACD78476.1|  heat shock protein 60 [Vibrio sp. FAL5322]          177    1e-42 
gb|ACX56807.1|  heat shock protein 60 [Vibrio sp. 9ZB152] >gb|...   176    1e-42 
gb|ACC65349.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|ACX56735.1|  heat shock protein 60 [Vibrio sp. 9ZB63] >gb|A...   176    1e-42 
gb|ACC64760.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|AAK32146.1|AF335328_1  60 kDa heat shock protein [Terrimona...   176    1e-42 
gb|ABX11642.1|  60 kDa chaperonin [Burkholderia gladioli]           176    1e-42 
gb|AAZ94796.1|  60 kDa chaperonin [Arcobacter nitrofigilis]         176    1e-42 
gb|ACC65529.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|ACC64860.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
sp|Q49160.1|CH60_MYCFO  RecName: Full=60 kDa chaperonin; AltNa...   176    1e-42 
gb|ACH56395.1|  chaperonin-60 [uncultured bacterium]                176    1e-42 
gb|ACC65417.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|AAV32669.1|  60 kDa chaperonin [Campylobacter lari]              176    1e-42 
gb|ABX11639.1|  60 kDa chaperonin [Pseudomonas stutzeri]            176    1e-42 
gb|AAT67962.1|  60 kDa chaperonin [uncultured bacterium]            176    1e-42 
gb|ACH72377.1|  chaperonin-60 [uncultured bacterium]                176    1e-42 
gb|ADB66138.1|  chaperonin GroEL1 [Sorangium cellulosum] >gb|A...   176    1e-42 
gb|AAX77211.1|  65 kDa heat shock protein [Mycobacterium barra...   176    1e-42 
gb|ACC65221.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|ACH56317.1|  chaperonin-60 [uncultured bacterium]                176    1e-42 
gb|ACZ92039.1|  60 kDa chaperonin [Herminiimonas aquatilis]         176    1e-42 
gb|ACC64964.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65237...   176    1e-42 
gb|ACZ56454.1|  60 kDa chaperonin [Herminiimonas fonticola]         176    1e-42 
gb|ACH56236.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   176    1e-42 
gb|ACH72254.1|  chaperonin-60 [uncultured bacterium]                176    1e-42 
gb|EEE70234.1|  hypothetical protein OsJ_30349 [Oryza sativa J...   176    1e-42 
gb|ACC65383.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|ACH72397.1|  chaperonin-60 [uncultured bacterium]                176    1e-42 
gb|ACC64909.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|ACC64754.1|  Cpn60 [uncultured soil bacterium]                   176    1e-42 
gb|AAX77210.1|  65 kDa heat shock protein [Mycobacterium conce...   176    2e-42 
gb|ACC64988.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ACC65185.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|AAX22779.1|  heat shock protein 60 [Vibrio sp. 1B05]             176    2e-42 
gb|AAM88544.1|  Cpn60 [Ralstonia pickettii]                         176    2e-42 
gb|ACD78440.1|  heat shock protein 60 [Vibrio sp. FAL5257]          176    2e-42 
gb|AAL35346.1|AF441383_1  60 kDa chaperonin [Anaerobiospirillu...   176    2e-42 
gb|ACH56286.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|AAX22767.1|  heat shock protein 60 [Vibrio sp. 1A05] >gb|AA...   176    2e-42 
gb|ACH72317.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|AAO91840.1|  chaperonin 60 [bacterium DRB3-205]                  176    2e-42 
gb|AAV84352.1|  60 kDa chaperonin [Methylophilus methylotrophus]    176    2e-42 
gb|ACC64795.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ACC65037.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ACD78636.1|  heat shock protein 60 [Vibrio sp. FALF230]          176    2e-42 
gb|ABX11636.1|  60 kDa chaperonin [Acinetobacter sp. mA3]           176    2e-42 
gb|ACH56267.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|AAM88470.1|  Cpn60 [Grimontia hollisae]                          176    2e-42 
gb|AAK69003.1|  Hsp60 [Vibrio cholerae]                             176    2e-42 
gb|AAC44457.1|  65 kDa heat shock protein [Mycobacterium marinum]   176    2e-42 
gb|ACC65238.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ACC64844.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ABL86737.1|  Cpn60 [subglacial bacterium A20(27)]                176    2e-42 
gb|ACH72320.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|AAX19834.1|  60 kDa chaperonin [Helicobacter pametensis]         176    2e-42 
gb|AAM88517.1|  Cpn60 [Acinetobacter radioresistens]                176    2e-42 
gb|ACC64981.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|ACH72282.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|ACH72428.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|ACX56742.1|  heat shock protein 60 [Vibrio sp. 9ZB71] >gb|A...   176    2e-42 
gb|ACC65426.1|  Cpn60 [uncultured soil bacterium]                   176    2e-42 
gb|AAT67945.1|  60 kDa chaperonin [uncultured bacterium]            176    2e-42 
gb|ABJ16003.1|  Cpn60 [Sphingobacterium thalpophilum]               176    2e-42 
gb|ACH72261.1|  chaperonin-60 [uncultured bacterium]                176    2e-42 
gb|ACF20345.1|  60 kDa chaperonin [Vogesella indigofera]            176    2e-42 
gb|AAM88511.1|  Cpn60 [Chryseobacterium indologenes]                176    2e-42 
gb|AAT67750.1|  60 kDa chaperonin [uncultured bacterium]            176    2e-42 
gb|ACH56406.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   175    2e-42 
gb|ACX57987.1|  heat shock protein 60 [Vibrio sp. 9MG98]            175    2e-42 
gb|AAT67725.1|  60 kDa chaperonin [uncultured bacterium]            175    2e-42 
gb|ACH56386.1|  chaperonin-60 [uncultured bacterium]                175    3e-42 
gb|ABX11587.1|  60 kDa chaperonin [Acinetobacter calcoaceticus...   175    3e-42 
gb|ACA62993.1|  GroEL [Bacteriovorax sp. PS22S]                     175    3e-42 
gb|ACH56357.1|  chaperonin-60 [uncultured bacterium]                175    3e-42 
gb|ABX11634.1|  60 kDa chaperonin [Acinetobacter sp. YAA]           175    3e-42 
emb|CAX62321.1|  heat shock protein 60 [Arcobacter halophilus]      175    3e-42 
gb|ACX56746.1|  heat shock protein 60 [Vibrio sp. 9ZB75]            175    3e-42 
gb|AAV32663.1|  60 kDa chaperonin [Campylobacter jejuni] >gb|A...   175    3e-42 
gb|AAC44451.1|  65 kDa heat shock protein [Mycobacterium bovis...   175    3e-42 
gb|AAK69006.1|  Hsp60 [Grimontia hollisae]                          175    3e-42 
gb|ABB88968.1|  60 kDa heat-shock protein [Vibrio harveyi]          175    3e-42 
gb|AAM88489.1|  Cpn60 [Pseudomonas pseudoalcaligenes]               175    3e-42 
gb|AAM88504.1|  Cpn60 [Oligella ureolytica]                         175    3e-42 
gb|AAC44453.1|  65 kDa heat shock protein [Mycobacterium fortu...   175    3e-42 
gb|ACH56261.1|  chaperonin-60 [uncultured bacterium]                175    3e-42 
gb|ACC65560.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|ACC64750.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|ACD78249.1|  heat shock protein 60 [Vibrio sp. FAL1151]          175    3e-42 
gb|ADC30144.1|  heat shock protein 60 [Bifidobacterium animali...   175    3e-42 
gb|AAX22839.1|  heat shock protein 60 [Vibrio sp. 7C12]             175    3e-42 
gb|ACH56309.1|  chaperonin-60 [uncultured bacterium]                175    3e-42 
gb|AAK69015.1|  HSP60 [Vibrio parahaemolyticus]                     175    3e-42 
gb|ACX56868.1|  heat shock protein 60 [Vibrio sp. 9ZA64] >gb|A...   175    3e-42 
gb|ACC65452.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|ACH56334.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   175    3e-42 
gb|ACC64867.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|ACX57100.1|  heat shock protein 60 [Vibrio sp. 9CHC43]           175    3e-42 
gb|AAM88503.1|  Cpn60 [Pseudomonas aeruginosa] >gb|ABX11645.1|...   175    3e-42 
gb|ACC65233.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|AAX22928.1|  heat shock protein 60 [Vibrio sp. 12F11] >gb|A...   175    3e-42 
dbj|BAD03963.1|  putative chaperonin [Gordonia sp. TY-5]            175    3e-42 
gb|ACC65530.1|  Cpn60 [uncultured soil bacterium]                   175    3e-42 
gb|AAZ94810.1|  60 kDa chaperonin [Arcobacter butzleri] >emb|C...   175    3e-42 
gb|ACC65281.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|ACC64839.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|AAX22922.1|  heat shock protein 60 [Vibrio sp. 12F04]            175    4e-42 
gb|ACC65197.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|ACX56397.1|  heat shock protein 60 [Vibrio sp. 0407RW72] >g...   175    4e-42 
gb|ACC65376.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|ACC64880.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|AAX19835.1|  60 kDa chaperonin [Helicobacter canadensis]         175    4e-42 
gb|ACD78338.1|  heat shock protein 60 [Vibrio sp. FAL130] >gb|...   175    4e-42 
gb|ACC64965.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|ABK59816.1|  chaperonin 60 [Sphingobacterium canadense]          175    4e-42 
gb|ACH56311.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   175    4e-42 
gb|ACC64957.1|  Cpn60 [uncultured soil bacterium]                   175    4e-42 
gb|ACX56937.1|  heat shock protein 60 [Vibrio sp. 9ZA155]           174    4e-42 
gb|ACC64877.1|  Cpn60 [uncultured soil bacterium]                   174    4e-42 
gb|ACC65487.1|  Cpn60 [uncultured soil bacterium]                   174    4e-42 
gb|ACC65239.1|  Cpn60 [uncultured soil bacterium]                   174    4e-42 
gb|ACC64948.1|  Cpn60 [uncultured soil bacterium]                   174    4e-42 
gb|ACH56420.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   174    4e-42 
gb|ACH56353.1|  chaperonin-60 [uncultured bacterium]                174    4e-42 
gb|AAM88485.1|  Cpn60 [Acinetobacter junii] >gb|AAM88496.1| Cp...   174    4e-42 
gb|ACX56649.1|  heat shock protein 60 [Vibrio sp. 0407MHC131] ...   174    4e-42 
gb|ACX56466.1|  heat shock protein 60 [Vibrio sp. 0407CH81] >g...   174    4e-42 
gb|ACD78586.1|  heat shock protein 60 [Vibrio sp. FALF179] >gb...   174    4e-42 
gb|ACH56340.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|AAO91841.1|  chaperonin 60 [bacterium DRB3-202]                  174    5e-42 
gb|ACC65050.1|  Cpn60 [uncultured soil bacterium]                   174    5e-42 
gb|ACD78257.1|  heat shock protein 60 [Vibrio sp. FAL1160]          174    5e-42 
gb|ACH56333.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACH72423.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|AAX19837.1|  60 kDa chaperonin [Helicobacter pullorum] >gb|...   174    5e-42 
gb|ACH56416.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACH56387.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACH56245.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACH56250.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   174    5e-42 
gb|ACC64821.1|  Cpn60 [uncultured soil bacterium]                   174    5e-42 
gb|ACH56351.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|AAV32657.1|  60 kDa chaperonin [Campylobacter fetus subsp. ...   174    5e-42 
gb|AAZ94792.1|  60 kDa chaperonin [Campylobacter mucosalis]         174    5e-42 
gb|AAX22786.1|  heat shock protein 60 [Vibrio sp. 1C01] >gb|AA...   174    5e-42 
gb|AAM88483.1|  Cpn60 [Acinetobacter haemolyticus]                  174    5e-42 
gb|ACH72313.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACX56925.1|  heat shock protein 60 [Vibrio sp. 9ZA140] >gb|...   174    5e-42 
gb|ACH56391.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACC65475.1|  Cpn60 [uncultured soil bacterium]                   174    5e-42 
gb|ACH72384.1|  chaperonin-60 [uncultured bacterium]                174    5e-42 
gb|ACC64796.1|  Cpn60 [uncultured soil bacterium]                   174    5e-42 
gb|AAX22803.1|  heat shock protein 60 [Vibrio sp. 1D08] >gb|AA...   174    5e-42 
gb|AAV32665.1|  60 kDa chaperonin [Campylobacter jejuni]            174    5e-42 
gb|ACX56901.1|  heat shock protein 60 [Vibrio sp. 9ZA102] >gb|...   174    6e-42 
gb|AAD29392.1|AF126030_1  65 kDa heat shock protein [Mycobacte...   174    6e-42 
gb|ACX56351.1|  heat shock protein 60 [Vibrio sp. 0407SW54] >g...   174    6e-42 
gb|ACC64824.1|  Cpn60 [uncultured soil bacterium]                   174    6e-42 
gb|AAQ17462.1|  65 kDa heat shock protein [Mycobacterium paras...   174    6e-42 
gb|AAF97779.1|  65 kDa heat shock protein [Mycobacterium simia...   174    6e-42 
gb|ACD78601.1|  heat shock protein 60 [Vibrio sp. FALF195] >gb...   174    6e-42 
gb|AAQ17464.1|  65 kDa heat shock protein [Mycobacterium paras...   174    6e-42 
gb|ACD78691.1|  heat shock protein 60 [Vibrio sp. FALF307]          174    6e-42 
gb|ABB20537.1|  60 kDa chaperonin [uncultured bacterium]            174    6e-42 
gb|AAX19047.1|  60 kDa chaperonin [Helicobacter pylori] >gb|AA...   174    6e-42 
gb|ACX56923.1|  heat shock protein 60 [Vibrio sp. 9ZA135]           174    6e-42 
gb|AAM88495.1|  Cpn60 [Alcaligenes faecalis subsp. faecalis]        174    6e-42 
gb|AAX22797.1|  heat shock protein 60 [Vibrio sp. 1D01]             174    6e-42 
gb|ACH72262.1|  chaperonin-60 [uncultured bacterium]                174    6e-42 
gb|AAL33620.1|AF440235_1  CPN60 [Chryseobacterium gleum]            174    6e-42 
gb|ACX56432.1|  heat shock protein 60 [Vibrio sp. 0407CHC121]       174    6e-42 
gb|AAV32659.1|  60 kDa chaperonin [Campylobacter helveticus]        174    6e-42 
gb|AAZ94801.1|  60 kDa chaperonin [Campylobacter concisus]          174    6e-42 
gb|ACH56354.1|  chaperonin-60 [uncultured bacterium]                174    6e-42 
gb|ACH56240.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   174    6e-42 
gb|AAB06711.1|  cpn-60 [Naegleria fowleri]                          174    6e-42 
gb|ACF20346.1|  60 kDa chaperonin [Telluria mixta]                  174    6e-42 
gb|AAV32671.1|  60 kDa chaperonin [Campylobacter sputorum subs...   174    6e-42 
gb|AAK68997.1|  Hsp60 [Vibrio harveyi]                              174    6e-42 
gb|ACH72288.1|  chaperonin-60 [uncultured bacterium]                174    7e-42 
gb|ACC64906.1|  Cpn60 [uncultured soil bacterium]                   174    7e-42 
gb|ACX56906.1|  heat shock protein 60 [Vibrio sp. 9ZA109]           174    7e-42 
gb|AAX22888.1|  heat shock protein 60 [Vibrio sp. 12B11] >gb|A...   174    7e-42 
gb|ACX56712.1|  heat shock protein 60 [Vibrio sp. 9ZB34] >gb|A...   174    7e-42 
gb|ACX56789.1|  heat shock protein 60 [Vibrio sp. 9ZB124] >gb|...   174    7e-42 
gb|ACD78928.1|  heat shock protein 60 [Vibrio sp. SPR1105] >gb...   174    7e-42 
gb|ACH72331.1|  chaperonin-60 [uncultured bacterium]                174    7e-42 
gb|ACC65350.1|  Cpn60 [uncultured soil bacterium]                   174    7e-42 
gb|ACC64994.1|  Cpn60 [uncultured soil bacterium]                   174    7e-42 
gb|ACX56882.1|  heat shock protein 60 [Vibrio sp. 9ZA79]            174    7e-42 
gb|AAT96620.1|  60 kDa chaperonin [Pasteurella aerogenes] >gb|...   174    7e-42 
gb|AAK68998.1|  Hsp60 [Vibrio cholerae] >gb|AAK68999.1| Hsp60 ...   174    7e-42 
gb|ACC64820.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64881...   174    7e-42 
gb|AAX22781.1|  heat shock protein 60 [Vibrio sp. 1B07]             174    7e-42 
gb|AAX24019.1|  60 kDa chaperonin [Providencia stuartii]            174    7e-42 
gb|AAM88539.1|  Cpn60 [Aggregatibacter actinomycetemcomitans]       174    7e-42 
gb|AAG21831.1|  heat shock protein GroEL [Anaplasma platys]         174    7e-42 
gb|ACC64799.1|  Cpn60 [uncultured soil bacterium]                   174    7e-42 
gb|ABB20539.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   174    7e-42 
gb|ACD78809.1|  heat shock protein 60 [Vibrio sp. FALZ100]          174    7e-42 
gb|ACC65341.1|  Cpn60 [uncultured soil bacterium]                   174    7e-42 
gb|AAX22788.1|  heat shock protein 60 [Vibrio sp. 1C03]             174    7e-42 
gb|AAM88492.1|  Cpn60 [Oligella urethralis]                         174    7e-42 
gb|AAK69001.1|  Hsp60 [Vibrio cholerae]                             174    7e-42 
gb|ACC65385.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|ACC65114.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|ACQ85028.1|  60 kDa chaperonin [uncultured bacterium]            174    8e-42 
gb|AAX22822.1|  heat shock protein 60 [Vibrio sp. 7A04] >gb|AA...   174    8e-42 
gb|ACC64902.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|ACC64819.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|ACC64809.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|ACC64876.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65095...   174    8e-42 
gb|ABD64540.1|  60 kDa heat-shock protein [Vibrio harveyi]          174    8e-42 
gb|AAV32673.1|  60 kDa chaperonin [Campylobacter upsaliensis] ...   174    8e-42 
gb|ACC64919.1|  Cpn60 [uncultured soil bacterium]                   174    8e-42 
gb|AAX22849.1|  heat shock protein 60 [Vibrio sp. 7E07]             174    8e-42 
gb|ABX11612.1|  60 kDa chaperonin [Pseudomonas sp. JR1]             174    8e-42 
gb|ACH72372.1|  chaperonin-60 [uncultured bacterium]                174    9e-42 
ref|NP_829841.1|  chaperonin GroEL [Chlamydophila caviae GPIC]...   174    9e-42  Gene info
gb|AAX22871.1|  heat shock protein 60 [Vibrio sp. 12A04] >gb|A...   174    9e-42 
gb|AAX22772.1|  heat shock protein 60 [Vibrio sp. 1A10] >gb|AA...   174    9e-42 
gb|ACC64893.1|  Cpn60 [uncultured soil bacterium]                   174    9e-42 
gb|AAM88468.1|  Cpn60 [Myroides odoratus]                           174    9e-42 
gb|AAX22963.1|  heat shock protein 60 [Vibrio sp. 13B11]            174    9e-42 
gb|AAX22796.1|  heat shock protein 60 [Vibrio sp. 1C12]             174    9e-42 
gb|AAS00622.1|  65 kDa heat shock protein [Mycobacterium porci...   174    9e-42 
gb|ACC65488.1|  Cpn60 [uncultured soil bacterium]                   174    9e-42 
gb|ACC64972.1|  Cpn60 [uncultured soil bacterium]                   174    9e-42 
gb|AAX22821.1|  heat shock protein 60 [Vibrio sp. 7A03] >gb|AA...   174    9e-42 
gb|AAK69010.1|  HSP60 [Vibrio metschnikovii]                        174    9e-42 
gb|ABB20561.1|  60 kDa chaperonin [uncultured bacterium]            174    9e-42 
gb|ACX56851.1|  heat shock protein 60 [Vibrio sp. 9ZA43] >gb|A...   174    9e-42 
gb|ACH72301.1|  chaperonin-60 [uncultured bacterium]                174    9e-42 
gb|ACX56283.1|  heat shock protein 60 [Vibrio sp. 0407ZB16] >g...   173    9e-42 
gb|ACC65222.1|  Cpn60 [uncultured soil bacterium]                   173    9e-42 
gb|AAX22837.1|  heat shock protein 60 [Vibrio sp. 7C09]             173    9e-42 
gb|AAM88566.1|  Cpn60 [Proteus vulgaris]                            173    9e-42 
gb|ACX56422.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   173    9e-42 
gb|ACH72283.1|  chaperonin-60 [uncultured bacterium]                173    9e-42 
gb|ABW90051.1|  Cpn60 [Tatumella saanichensis]                      173    9e-42 
gb|ACX56781.1|  heat shock protein 60 [Vibrio sp. 9ZB116]           173    1e-41 
gb|ACH72355.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|AAM49212.1|AF436951_1  60 kDa chaperonin [uncultured pig fa...   173    1e-41 
gb|ACH72263.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACC64797.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|AAM49246.1|AF436985_1  60 kDa chaperonin [uncultured pig fa...   173    1e-41 
gb|ACH72441.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|AAX22989.1|  heat shock protein 60 [Vibrio sp. 13E10]            173    1e-41 
gb|AAM88467.1|  Cpn60 [Proteus mirabilis]                           173    1e-41 
gb|ACX57170.1|  heat shock protein 60 [Vibrio sp. 9CHC130] >gb...   173    1e-41 
gb|ACH72344.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACH72279.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|AAX22790.1|  heat shock protein 60 [Vibrio sp. 1C05] >gb|AA...   173    1e-41 
gb|AAL33617.1|AF440232_1  CPN60 [Bergeyella zoohelcum]              173    1e-41 
gb|AAM88484.1|  Cpn60 [Acinetobacter johnsonii]                     173    1e-41 
gb|ACH56329.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACC65199.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|AAX22780.1|  heat shock protein 60 [Vibrio sp. 1B06] >gb|AA...   173    1e-41 
gb|ACC64719.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|AAT68196.1|  GroESL [Chlamydophila pneumoniae]                   173    1e-41 
gb|AAM49182.1|AF436921_1  60 kDa chaperonin [uncultured pig fa...   173    1e-41 
gb|ACX57180.1|  heat shock protein 60 [Vibrio sp. 9CHC140] >gb...   173    1e-41 
gb|ACH56369.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACX56360.1|  heat shock protein 60 [Vibrio sp. 0407SW82] >g...   173    1e-41 
gb|ACH72357.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ABU43101.1|  65 kDa heat shock protein [Mycobacterium sp. 2...   173    1e-41 
gb|AAX22988.1|  heat shock protein 60 [Vibrio sp. 13E09] >gb|A...   173    1e-41 
gb|ACH72337.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACH72460.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|AAX22808.1|  heat shock protein 60 [Vibrio sp. 1E01]             173    1e-41 
gb|AAX22783.1|  heat shock protein 60 [Vibrio sp. 1B10] >gb|AA...   173    1e-41 
gb|AAX22830.1|  heat shock protein 60 [Vibrio sp. 7B07]             173    1e-41 
gb|ACX56425.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   173    1e-41 
gb|ACH72297.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACH56231.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   173    1e-41 
gb|AAX22769.1|  heat shock protein 60 [Vibrio sp. 1A07]             173    1e-41 
gb|ACX56770.1|  heat shock protein 60 [Vibrio sp. 9ZB105] >gb|...   173    1e-41 
gb|ACI02346.1|  60 kDa chaperonin [Sphaerotilus sp. HS]             173    1e-41 
gb|AAX22768.1|  heat shock protein 60 [Vibrio sp. 1A06] >gb|AA...   173    1e-41 
gb|AAX22892.1|  heat shock protein 60 [Vibrio sp. 12C03]            173    1e-41 
gb|AAX22865.1|  heat shock protein 60 [Vibrio sp. 7H01] >gb|AC...   173    1e-41 
gb|AAM88519.1|  Cpn60 [Pseudomonas luteola]                         173    1e-41 
gb|ACD78324.1|  heat shock protein 60 [Vibrio sp. FAL1282] >gb...   173    1e-41 
gb|AAK68993.1|  Hsp60 [Vibrio alginolyticus] >gb|AAK68994.1| H...   173    1e-41 
gb|ACC65038.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ACD78263.1|  heat shock protein 60 [Vibrio sp. FAL1171]          173    1e-41 
gb|ACC65447.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ACC64921.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|AAK69012.1|  HSP60 [Vibrio mimicus]                              173    1e-41 
ref|ZP_02544608.1|  chaperonin GroEL [candidate division TM7 s...   173    1e-41 
gb|ACX56292.1|  heat shock protein 60 [Vibrio sp. 0407ZB80] >g...   173    1e-41 
gb|ACH72258.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   173    1e-41 
gb|AAX22763.1|  heat shock protein 60 [Vibrio sp. 1A01] >gb|AA...   173    1e-41 
emb|CAD90119.1|  heat shock protein 60 [Helicobacter muridarum]     173    1e-41 
gb|ACX56371.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   173    1e-41 
gb|ACH56275.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|AAX22773.1|  heat shock protein 60 [Vibrio sp. 1A11] >gb|AA...   173    1e-41 
gb|ACO92537.1|  heat shock protein 65 [Mycobacterium marinum]       173    1e-41 
gb|ABB20531.1|  60 kDa chaperonin [Ornithobacterium rhinotrach...   173    1e-41 
gb|AAX23042.1|  heat shock protein 60 [Vibrio sp. 14C08]            173    1e-41 
gb|ACH72278.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACH72257.1|  chaperonin-60 [uncultured bacterium]                173    1e-41 
gb|ACD78380.1|  heat shock protein 60 [Vibrio sp. FAL5123] >gb...   173    1e-41 
gb|ACC65066.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ABW90052.1|  Cpn60 [Tatumella ptyseos]                           173    1e-41 
gb|AAX22818.1|  heat shock protein 60 [Vibrio sp. 1E12] >gb|AA...   173    1e-41 
gb|AAX22886.1|  heat shock protein 60 [Vibrio sp. 12B09] >gb|A...   173    1e-41 
gb|AAX22899.1|  heat shock protein 60 [Vibrio sp. 12D02] >gb|A...   173    1e-41 
gb|ACX56900.1|  heat shock protein 60 [Vibrio sp. 9ZA101] >gb|...   173    1e-41 
gb|ACC64794.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|AAX19836.1|  60 kDa chaperonin [Helicobacter fennelliae]         173    1e-41 
gb|ACX56533.1|  heat shock protein 60 [Vibrio sp. 0407CSC50]        173    1e-41 
gb|ACX56393.1|  heat shock protein 60 [Vibrio sp. 0407RW62] >g...   173    1e-41 
gb|ACM90486.1|  65 kDa heat shock protein [Mycobacterium avium]     173    1e-41 
gb|ACD78677.1|  heat shock protein 60 [Vibrio sp. FALF288]          173    1e-41 
gb|ACC65407.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ACD03153.1|  heat shock protein 60 [Campylobacter cuniculorum]   173    1e-41 
gb|AAT96641.1|  60 kDa chaperonin [Providencia alcalifaciens D...   173    1e-41 
gb|ACH56326.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   173    1e-41 
gb|ACC65023.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ACX56969.1|  heat shock protein 60 [Vibrio sp. 9SW81]            173    1e-41 
gb|ACC65548.1|  Cpn60 [uncultured soil bacterium]                   173    1e-41 
gb|ACX56325.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   173    2e-41 
gb|ACD78499.1|  heat shock protein 60 [Vibrio sp. FAL56]            173    2e-41 
gb|ACD78575.1|  heat shock protein 60 [Vibrio sp. FALF166] >gb...   173    2e-41 
gb|ABB20571.1|  60 kDa chaperonin [uncultured bacterium]            173    2e-41 
gb|AAX22873.1|  heat shock protein 60 [Vibrio sp. 12A06] >gb|A...   173    2e-41 
gb|ACH72341.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACX56343.1|  heat shock protein 60 [Vibrio sp. 0407SW39] >g...   172    2e-41 
gb|ACD78547.1|  heat shock protein 60 [Vibrio sp. FALF135]          172    2e-41 
gb|ACX57108.1|  heat shock protein 60 [Vibrio sp. 9CHC53]           172    2e-41 
gb|ACH72398.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACH72370.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACH72256.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACD78437.1|  heat shock protein 60 [Vibrio sp. FAL5253]          172    2e-41 
gb|ACC65229.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|AAX22970.1|  heat shock protein 60 [Vibrio sp. 13C10] >gb|A...   172    2e-41 
gb|ACC65505.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|AAX24026.1|  60 kDa chaperonin [Bordetella pertussis] >gb|A...   172    2e-41 
gb|ACH56343.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|AAB30518.1|  S1=hsp65 homolog [Spirochaeta bajacaliforniens...   172    2e-41 
gb|AAM88488.1|  Cpn60 [Pseudomonas fluorescens]                     172    2e-41 
gb|ACX57924.1|  heat shock protein 60 [Vibrio sp. 9MHC144]          172    2e-41 
gb|ACX56421.1|  heat shock protein 60 [Vibrio breoganii] >gb|A...   172    2e-41 
gb|ACD78853.1|  heat shock protein 60 [Vibrio sp. FALZ19]           172    2e-41 
gb|AAX22831.1|  heat shock protein 60 [Vibrio sp. 7B08]             172    2e-41 
gb|ACF20350.1|  60 kDa chaperonin [Stenotrophomonas maltophilia]    172    2e-41 
gb|ACH72253.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ABD15106.1|  65 kDa heat shock protein [Mycobacterium sp. I...   172    2e-41 
gb|ACX57581.1|  heat shock protein 60 [Vibrio sp. 9CSC145]          172    2e-41 
gb|ACV82496.1|  CPN60 [Proteobacterium N110]                        172    2e-41 
gb|ACX56984.1|  heat shock protein 60 [Vibrio sp. 9SW97]            172    2e-41 
gb|ACN87265.1|  65 kDa heat shock protein [Mycobacterium simul...   172    2e-41 
gb|ACC65167.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|ABD15105.1|  65 kDa heat shock protein [Mycobacterium sp. I...   172    2e-41 
gb|ACX56607.1|  heat shock protein 60 [Vibrio sp. 0407MH141] >...   172    2e-41 
gb|ACX57093.1|  heat shock protein 60 [Vibrio sp. 9CHC34] >gb|...   172    2e-41 
gb|ACD78241.1|  heat shock protein 60 [Vibrio sp. FAL1126] >gb...   172    2e-41 
gb|AAX22774.1|  heat shock protein 60 [Vibrio sp. 1A12] >gb|AA...   172    2e-41 
gb|ACH56288.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|AAK69011.1|  HSP60 [Vibrio mimicus]                              172    2e-41 
gb|ACX57182.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   172    2e-41 
gb|ACX56399.1|  heat shock protein 60 [Vibrio sp. 0407RW74] >g...   172    2e-41 
gb|ACH72405.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ABP87411.1|  Hsp60 [Helicobacter cynogastricus]                  172    2e-41 
gb|AAC45327.1|  GroEL [Neisseria gonorrhoeae]                       172    2e-41 
ref|YP_002457216.1|  chaperonin Cpn60/TCP-1 [Desulfitobacteriu...   172    2e-41  Gene info
gb|ACH56273.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACC64900.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|AAX22842.1|  heat shock protein 60 [Vibrio sp. 7D08]             172    2e-41 
gb|AAO41707.1|  heat shock protein 65 [Mycobacterium saskatche...   172    2e-41 
gb|ACH56253.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   172    2e-41 
gb|ACX57214.1|  heat shock protein 60 [Vibrio sp. 9CH22]            172    2e-41 
gb|ACX57003.1|  heat shock protein 60 [Vibrio sp. 9SW119] >gb|...   172    2e-41 
gb|ACH53608.1|  Hsp60 [Vibrio splendidus]                           172    2e-41 
gb|ACX56949.1|  heat shock protein 60 [Vibrio sp. 9SW23] >gb|A...   172    2e-41 
gb|AAT35544.1|  Hsp65 type I [Mycobacterium abscessus] >gb|AAT...   172    2e-41 
gb|ACX57151.1|  heat shock protein 60 [Vibrio sp. 9CHC109]          172    2e-41 
gb|AAO41708.1|  heat shock protein 65 [Mycobacterium saskatche...   172    2e-41 
gb|ACH72452.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|AAV32658.1|  60 kDa chaperonin [Campylobacter helveticus]        172    2e-41 
gb|ACX56337.1|  heat shock protein 60 [Vibrio ordalii] >gb|ACX...   172    2e-41 
gb|ACH72328.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|AAX23065.1|  heat shock protein 60 [Vibrio sp. 14E11]            172    2e-41 
gb|AAX23079.1|  heat shock protein 60 [Vibrio sp. 14G05] >gb|A...   172    2e-41 
gb|AAM49500.1|AF437239_1  60 kDa chaperonin [uncultured pig fa...   172    2e-41 
gb|ACX56702.1|  heat shock protein 60 [Vibrio sp. 9ZB24] >gb|A...   172    2e-41 
gb|ACX56352.1|  heat shock protein 60 [Vibrio sp. 0407SW56] >g...   172    2e-41 
emb|CAD90137.1|  heat shock protein 60 [Helicobacter canis]         172    2e-41 
gb|AAM49220.1|AF436959_1  60 kDa chaperonin [uncultured pig fa...   172    2e-41 
gb|ACC65132.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|ACC65085.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|ACC64800.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65235...   172    2e-41 
gb|ACH72350.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACX57999.1|  heat shock protein 60 [Aliivibrio logei]            172    2e-41 
gb|ACX56562.1|  heat shock protein 60 [Vibrio sp. 0407CG38] >g...   172    2e-41 
gb|ACH56328.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   172    2e-41 
gb|ACC65576.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|ACX56748.1|  heat shock protein 60 [Vibrio sp. 9ZB78] >gb|A...   172    2e-41 
gb|ACX56286.1|  heat shock protein 60 [Vibrio sp. 0407ZB38]         172    2e-41 
gb|ACH72305.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACH56370.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACH56330.1|  chaperonin-60 [uncultured bacterium]                172    2e-41 
gb|ACC65054.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|AAX19841.1|  60 kDa chaperonin [Helicobacter felis]              172    2e-41 
gb|ACC65101.1|  Cpn60 [uncultured soil bacterium]                   172    2e-41 
gb|ACX56976.1|  heat shock protein 60 [Vibrio sp. 9SW88] >gb|A...   172    3e-41 
gb|ACC64980.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|ACX56843.1|  heat shock protein 60 [Vibrio sp. 9ZA34] >gb|A...   172    3e-41 
gb|ACM90495.1|  65 kDa heat shock protein [Mycobacterium gordo...   172    3e-41 
gb|ACH56348.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   172    3e-41 
gb|AAX24021.1|  60 kDa chaperonin [Bacteroides ureolyticus] >e...   172    3e-41 
gb|AAK69004.1|  Hsp60 [Vibrio cincinnatiensis]                      172    3e-41 
gb|ACC65274.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|ACO24568.1|  heat shock protein 65 [Nocardia sp. MC12]           172    3e-41 
gb|AAX22840.1|  heat shock protein 60 [Vibrio sp. 7D03] >gb|AC...   172    3e-41 
gb|AAM88493.1|  Cpn60 [Moraxella osloensis]                         172    3e-41 
gb|AAK69005.1|  Hsp60 [Photobacterium damselae]                     172    3e-41 
gb|ACH56323.1|  chaperonin-60 [uncultured bacterium]                172    3e-41 
gb|ABB20538.1|  60 kDa chaperonin [uncultured bacterium]            172    3e-41 
gb|ACH56362.1|  chaperonin-60 [uncultured bacterium]                172    3e-41 
gb|ACX56630.1|  heat shock protein 60 [Vibrio cyclitrophicus] ...   172    3e-41 
gb|ACD79104.1|  heat shock protein 60 [Vibrio sp. SPRF103]          172    3e-41 
gb|AAM88546.2|  Cpn60 [Eikenella corrodens]                         172    3e-41 
gb|ACD79139.1|  heat shock protein 60 [Vibrio sp. SPRZ109]          172    3e-41 
gb|AAL33616.1|AF440231_1  CPN60 [Elizabethkingia meningoseptica]    172    3e-41 
gb|AAU12278.1|  heat shock protein 60 [Paramecium tetraurelia]      172    3e-41 
gb|AAX77212.1|  65 kDa heat shock protein [Mycobacterium morio...   172    3e-41 
gb|ACC65272.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|AAQ86757.1|  heat shock protein [Mycobacterium abscessus]        172    3e-41 
gb|ACD78895.1|  heat shock protein 60 [Vibrio sp. FALZ49]           172    3e-41 
gb|ACC65448.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|ACC65186.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|ACA62606.1|  65 kDa heat shock protein [Mycobacterium genav...   172    3e-41 
gb|AAM88509.1|  Cpn60 [Acinetobacter calcoaceticus]                 172    3e-41 
gb|AAZ94762.1|  60 kDa chaperonin [Campylobacter hyointestinal...   172    3e-41 
gb|AAX22764.1|  heat shock protein 60 [Vibrio sp. 1A02]             172    3e-41 
gb|ACD78949.1|  heat shock protein 60 [Vibrio sp. SPR1152]          172    3e-41 
gb|AAO91838.1|  chaperonin 60 [bacterium DRB3-216]                  172    3e-41 
gb|ABB88967.1|  60 kDa heat-shock protein [Vibrio parahaemolyt...   172    3e-41 
gb|ACP27863.1|  60 kDa chaperonin [Campylobacter lanienae]          172    3e-41 
gb|ACC65006.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|AAX22771.1|  heat shock protein 60 [Vibrio sp. 1A09] >gb|AA...   172    3e-41 
gb|ACC64996.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|AAQ86756.1|  heat shock protein [Mycobacterium peregrinum] ...   172    3e-41 
gb|ACX57262.1|  heat shock protein 60 [Vibrio sp. 9CH82]            172    3e-41 
gb|ACX56784.1|  heat shock protein 60 [Aliivibrio logei] >gb|A...   172    3e-41 
gb|ACC64812.1|  Cpn60 [uncultured soil bacterium]                   172    3e-41 
gb|ABX11593.1|  60 kDa chaperonin [Pseudomonas putida] >gb|ACF...   172    3e-41 
gb|ACH72311.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|ACC64711.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|AAX22945.1|  heat shock protein 60 [Vibrio sp. 12H05]            171    4e-41 
gb|AAD33467.1|AF130449_1  GroEL protein [Heliobacterium chlorum]    171    4e-41 
gb|ACP19231.1|  60 kDa chaperonin [Sphaerotilus sp. D-501] >gb...   171    4e-41 
gb|ACH56301.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|AAP22030.1|  60 kDa chaperonin [Pectobacterium carotovorum ...   171    4e-41 
gb|ACH72312.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|ACH56279.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|ACC65422.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|AAM88508.1|  Cpn60 [Achromobacter piechaudii]                    171    4e-41 
gb|ACD78230.1|  heat shock protein 60 [Vibrio sp. FAL1105] >gb...   171    4e-41 
gb|ACC64823.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64879...   171    4e-41 
gb|ABW22932.1|  heat shock protein 65 [Mycobacterium brasilien...   171    4e-41 
gb|ACH56269.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|ACC65387.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACC64875.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACC65205.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACH72426.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|ABB20540.1|  60 kDa chaperonin [uncultured bacterium]            171    4e-41 
gb|ACC65179.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACC64761.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|AAQ86761.1|  heat shock protein [Mycobacterium sp. E1455]        171    4e-41 
gb|ACM90488.1|  65 kDa heat shock protein [Mycobacterium avium]     171    4e-41 
gb|ACH56270.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|AAZ94797.2|  60 kDa chaperonin [Campylobacter showae]            171    4e-41 
gb|ACD78229.1|  heat shock protein 60 [Vibrio sp. FAL1104] >gb...   171    4e-41 
gb|ACC65493.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACH56254.1|  chaperonin-60 [uncultured bacterium]                171    4e-41 
gb|AAK69013.1|  HSP60 [Vibrio ordalii]                              171    4e-41 
gb|ACC65381.1|  Cpn60 [uncultured soil bacterium]                   171    4e-41 
gb|ACH56243.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   171    4e-41 
gb|ACH72368.1|  chaperonin-60 [uncultured bacterium]                171    5e-41 
gb|ACM90492.1|  65 kDa heat shock protein [Mycobacterium gordo...   171    5e-41 
gb|ACC65110.1|  Cpn60 [uncultured soil bacterium]                   171    5e-41 
gb|AAX22793.1|  heat shock protein 60 [Vibrio sp. 1C08]             171    5e-41 
gb|ACM90487.1|  65 kDa heat shock protein [Mycobacterium avium]     171    5e-41 
gb|ABR10930.1|  Hsp60 [Candidatus Helicobacter suis]                171    5e-41 
gb|ACH72259.1|  chaperonin-60 [uncultured bacterium]                171    5e-41 
gb|ACF20349.1|  60 kDa chaperonin [Enterobacter cloacae]            171    5e-41 
gb|ACD78943.1|  heat shock protein 60 [Vibrio sp. SPR1140]          171    5e-41 
gb|ACX56284.1|  heat shock protein 60 [Vibrio sp. 0407ZB18] >g...   171    5e-41 
gb|ACC64831.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65250...   171    5e-41 
gb|AAV84349.1|  60 kDa chaperonin [Enterobacter cloacae subsp....   171    5e-41 
gb|AAX24022.1|  60 kDa chaperonin [Rahnella aquatilis]              171    5e-41 
gb|AAK69008.1|  HSP60 [Vibrio fluvialis]                            171    5e-41 
emb|CAC36161.1|  65 kDa heat shock protein [Mycobacterium mari...   171    5e-41 
gb|AAK69018.1|  HSP60 [Vibrio vulnificus] >gb|AAK69019.1| HSP6...   171    5e-41 
gb|ACX56363.1|  heat shock protein 60 [Vibrio sp. 0407SW90]         171    5e-41 
gb|ACX57169.1|  heat shock protein 60 [Vibrio sp. 9CHC128]          171    5e-41 
gb|ACH56284.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   171    5e-41 
gb|ACD70346.1|  Hsp65 [Mycobacterium sp. XN10-17]                   171    5e-41 
gb|AAX22911.1|  heat shock protein 60 [Vibrio sp. 12E03]            171    5e-41 
gb|ADC30154.1|  heat shock protein 60 [Bifidobacterium indicum]     171    5e-41 
gb|ABB20552.1|  60 kDa chaperonin [uncultured bacterium]            171    5e-41 
gb|ACC65551.1|  Cpn60 [uncultured soil bacterium]                   171    5e-41 
gb|ACH72378.1|  chaperonin-60 [uncultured bacterium]                171    5e-41 
emb|CAD90134.1|  heat shock protein 60 [Helicobacter pametensis]    171    5e-41 
gb|ACX56690.1|  heat shock protein 60 [Vibrio sp. 9ZB4] >gb|AC...   171    5e-41 
gb|ACH56293.1|  chaperonin-60 [uncultured bacterium]                171    5e-41 
gb|ACH56324.1|  chaperonin-60 [uncultured bacterium]                171    5e-41 
gb|AAQ86759.1|  heat shock protein [Mycobacterium sp. E569]         171    5e-41 
gb|AAM49346.1|AF437085_1  60 kDa chaperonin [uncultured pig fa...   171    5e-41 
gb|AAX24017.1|  60 kDa chaperonin [uncultured bacterium]            171    5e-41 
gb|ACC65087.1|  Cpn60 [uncultured soil bacterium]                   171    5e-41 
gb|ACC64848.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65183...   171    5e-41 
gb|ACH56366.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   171    5e-41 
gb|ACH56249.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   171    5e-41 
gb|ACX56701.1|  heat shock protein 60 [Vibrio sp. 9ZB23] >gb|A...   171    6e-41 
gb|ACH56417.1|  chaperonin-60 [uncultured bacterium]                171    6e-41 
gb|ACD79052.1|  heat shock protein 60 [Vibrio sp. SPR5230] >gb...   171    6e-41 
gb|AAM88547.1|  Cpn60 [Actinobacillus ureae]                        171    6e-41 
gb|ACH56371.1|  chaperonin-60 [uncultured bacterium]                171    6e-41 
gb|ACE77067.1|  65 kDa heat shock protein [Mycobacterium terrae]    171    6e-41 
gb|ACX57690.1|  heat shock protein 60 [Vibrio sp. 9CG143]           171    6e-41 
gb|ABV55458.1|  Hsp65 [Mycobacterium engbaekii]                     171    6e-41 
gb|AAQ86758.1|  heat shock protein [Mycobacterium sp. E498]         171    6e-41 
gb|ACX57040.1|  heat shock protein 60 [Vibrio sp. 9RW101] >gb|...   171    6e-41 
gb|AAK69009.1|  HSP60 [Vibrio furnissii]                            171    6e-41 
gb|ACH72408.1|  chaperonin-60 [uncultured bacterium]                171    6e-41 
gb|ABL86751.1|  Cpn60 [Janthinobacterium sp. A99a]                  171    6e-41 
gb|ACC65057.1|  Cpn60 [uncultured soil bacterium]                   171    6e-41 
gb|ACC65042.1|  Cpn60 [uncultured soil bacterium]                   171    6e-41 
gb|ACC64710.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64713...   171    6e-41 
gb|ACH72431.1|  chaperonin-60 [uncultured bacterium]                171    6e-41 
gb|ACC65099.1|  Cpn60 [uncultured soil bacterium]                   171    6e-41 
gb|ACC64838.1|  Cpn60 [uncultured soil bacterium]                   171    6e-41 
gb|ACH56287.1|  chaperonin-60 [uncultured bacterium]                171    6e-41 
gb|ACD78454.1|  heat shock protein 60 [Vibrio sp. FAL5284] >gb...   171    7e-41 
gb|AAX22967.1|  heat shock protein 60 [Vibrio sp. 13C05]            171    7e-41 
gb|AAM49354.1|AF437093_1  60 kDa chaperonin [uncultured pig fa...   171    7e-41 
gb|ACX56563.1|  heat shock protein 60 [Vibrio sp. 0407CG67]         171    7e-41 
gb|ACC64745.1|  Cpn60 [uncultured soil bacterium]                   171    7e-41 
gb|ACC64873.1|  Cpn60 [uncultured soil bacterium] >gb|ACC64874...   171    7e-41 
gb|ACW83045.1|  heat shock protein 65 kDa [Mycobacterium scrof...   171    7e-41 
gb|ABB20542.1|  60 kDa chaperonin [uncultured bacterium]            171    7e-41 
gb|ACC65265.1|  Cpn60 [uncultured soil bacterium]                   171    7e-41 
gb|ACH72303.1|  chaperonin-60 [uncultured bacterium]                171    7e-41 
gb|ACX56281.1|  heat shock protein 60 [Vibrio sp. 0407ZB3] >gb...   171    7e-41 
gb|AAM49239.1|AF436978_1  60 kDa chaperonin [uncultured pig fa...   171    7e-41 
gb|ACX56293.1|  heat shock protein 60 [Vibrio sp. 0407ZB85] >g...   171    7e-41 
gb|ACH56442.1|  chaperonin-60 [uncultured bacterium]                171    7e-41 
gb|AAM49217.1|AF436956_1  60 kDa chaperonin [uncultured pig fa...   171    7e-41 
gb|ACX56973.1|  heat shock protein 60 [Vibrio sp. 9SW85] >gb|A...   171    8e-41 
gb|ACX56599.1|  heat shock protein 60 [Vibrio sp. 0407MH98]         171    8e-41 
gb|ACH72382.1|  chaperonin-60 [uncultured bacterium]                171    8e-41 
gb|ACW83044.1|  heat shock protein 65 kDa [Mycobacterium terrae]    171    8e-41 
gb|ACF20337.1|  60 kDa chaperonin [Buttiauxella ferragutiae]        171    8e-41 
gb|ACH72306.1|  chaperonin-60 [uncultured bacterium]                171    8e-41 
gb|ACC65301.1|  Cpn60 [uncultured soil bacterium]                   171    8e-41 
gb|ACO24564.1|  heat shock protein 65 [Mycobacterium insubricum]    170    8e-41 
gb|ABX11614.1|  60 kDa chaperonin [Cupriavidus necator]             170    8e-41 
gb|AAV84336.1|  60 kDa chaperonin [Pseudomonas cichorii]            170    8e-41 
gb|AAK69000.1|  Hsp60 [Vibrio cholerae]                             170    8e-41 
gb|ACC65361.1|  Cpn60 [uncultured soil bacterium]                   170    8e-41 
gb|AAV84329.1|  60 kDa chaperonin [Erwinia chrysanthemi]            170    8e-41 
gb|ACX56353.1|  heat shock protein 60 [Vibrio sp. 0407SW66]         170    8e-41 
gb|ACC65276.1|  Cpn60 [uncultured soil bacterium]                   170    8e-41 
gb|AAS65995.1|  65 kDa heat shock protein [Mycobacterium sp. G...   170    8e-41 
gb|ACC65291.1|  Cpn60 [uncultured soil bacterium]                   170    8e-41 
gb|ADC30165.1|  heat shock protein 60 [Bifidobacterium subtile]     170    8e-41 
gb|ACH72276.1|  chaperonin-60 [uncultured bacterium]                170    8e-41 
gb|AAO91837.1|  chaperonin 60 [bacterium DRB3-233]                  170    8e-41 
gb|ACC64735.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65137...   170    9e-41 
emb|CAC35966.1|  65 kDa heat shock protein [Mycobacterium fort...   170    9e-41 
gb|ACH72418.1|  chaperonin-60 [uncultured bacterium]                170    9e-41 
gb|ACH72413.1|  chaperonin-60 [uncultured bacterium]                170    9e-41 
gb|ACC65246.1|  Cpn60 [uncultured soil bacterium]                   170    9e-41 
gb|ACO88931.1|  groEL2 [Mycobacterium africanum]                    170    9e-41 
ref|YP_002361957.1|  chaperonin GroEL [Methylocella silvestris...   170    9e-41  Gene info
gb|AAM49341.1|AF437080_1  60 kDa chaperonin [uncultured pig fa...   170    9e-41 
gb|ACC65525.1|  Cpn60 [uncultured soil bacterium]                   170    9e-41 
gb|AAV32654.1|  60 kDa chaperonin [Arcobacter butzleri]             170    9e-41 
dbj|BAE19937.1|  65 kDa heat shock protein [Mycobacterium kans...   170    9e-41 
gb|ACH72290.1|  chaperonin-60 [uncultured bacterium]                170    9e-41 
gb|AAM88494.1|  Cpn60 [Moraxella atlantae]                          170    9e-41 
gb|ACS92567.1|  heat shock protein 60 [Vibrio harveyi]              170    1e-40 
gb|ACC65395.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|ACC64862.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|AAP22031.1|  60 kDa chaperonin [Pantoea stewartii subsp. st...   170    1e-40 
gb|ACA34576.1|  60 kDa chaperonin [Aeromonas sharmana]              170    1e-40 
gb|ACD78737.1|  heat shock protein 60 [Vibrio sp. FALF446] >gb...   170    1e-40 
gb|AAQ64487.1|  heat shock protein 65 [Tsukamurella paurometab...   170    1e-40 
gb|AAX24015.1|  60 kDa chaperonin [uncultured bacterium]            170    1e-40 
emb|CAL47036.1|  65 kDa heat-shock protein [Mycobacterium sp. ...   170    1e-40 
gb|AAR37019.1|  hsp65 [Mycobacterium cosmeticum] >gb|AAR37020....   170    1e-40 
gb|AAZ94764.1|  60 kDa chaperonin [Campylobacter rectus]            170    1e-40 
emb|CAD90118.1|  heat shock protein 60 [Helicobacter pullorum]      170    1e-40 
gb|ACI05265.1|  60 kDa chaperonin [Thiothrix sp. G1]                170    1e-40 
gb|ACD78231.1|  heat shock protein 60 [Vibrio sp. FAL1108] >gb...   170    1e-40 
gb|AAP22032.1|  60 kDa chaperonin [Erwinia amylovora]               170    1e-40 
gb|AAK95371.1|  heat shock protein 60 kDa [Salmonella enterica...   170    1e-40 
gb|ABL86750.1|  Cpn60 [Janthinobacterium sp. A22]                   170    1e-40 
gb|AAV84350.1|  60 kDa chaperonin [Enterobacter nimipressuralis]    170    1e-40 
gb|AAK95375.1|  heat shock protein 60 kDa [Yersinia pseudotube...   170    1e-40 
gb|ABX11633.1|  60 kDa chaperonin [Serratia marcescens]             170    1e-40 
gb|ACC65418.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|AAZ84754.1|  60 kDa chaperonin [uncultured bacterium]            170    1e-40 
gb|AAO91843.1|  chaperonin 60 [bacterium DRB3-203]                  170    1e-40 
gb|ACC65512.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|ACC64707.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|ACH72412.1|  chaperonin-60 [uncultured bacterium]                170    1e-40 
gb|ACH72326.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   170    1e-40 
gb|ACC64894.1|  Cpn60 [uncultured soil bacterium] >gb|ACH56405...   170    1e-40 
gb|ACC65511.1|  Cpn60 [uncultured soil bacterium]                   170    1e-40 
gb|ACH72265.1|  chaperonin-60 [uncultured bacterium]                170    1e-40 
gb|AAX22981.1|  heat shock protein 60 [Vibrio sp. 13D12]            170    1e-40 
dbj|BAB61892.1|  HSP60 [Yersinia enterocolitica]                    170    1e-40 
gb|ACH72410.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   170    1e-40 
gb|ACX56327.1|  heat shock protein 60 [Vibrio sp. 0407ZA39]         170    1e-40 
gb|ACD79002.1|  heat shock protein 60 [Vibrio sp. SPR512]           170    1e-40 
gb|AAX77208.1|  65 kDa heat shock protein [Mycobacterium phoca...   170    1e-40 
gb|ACX56492.1|  heat shock protein 60 [Vibrio sp. 0407CS17] >g...   169    1e-40 
dbj|BAB61891.1|  HSP60 [Yersinia pseudotuberculosis] >dbj|BAB6...   169    1e-40 
gb|ACH56434.1|  chaperonin-60 [uncultured bacterium]                169    1e-40 
gb|AAM49192.1|AF436931_1  60 kDa chaperonin [uncultured pig fa...   169    1e-40 
gb|AAV32670.1|  60 kDa chaperonin [Campylobacter mucosalis]         169    1e-40 
emb|CAL47034.1|  65 kDa heat-shock protein [Mycobacterium sp. ...   169    1e-40 
gb|ACH72419.1|  chaperonin-60 [uncultured bacterium]                169    1e-40 
gb|ACD78538.1|  heat shock protein 60 [Vibrio sp. FALF124] >gb...   169    1e-40 
gb|ACH56252.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   169    1e-40 
gb|ACC65347.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
emb|CAD90136.1|  heat shock protein 60 [Helicobacter hepaticus]     169    2e-40 
gb|AAZ84685.1|  60 kDa chaperonin [uncultured bacterium]            169    2e-40 
emb|CAD90140.1|  heat shock protein 60 [Helicobacter pylori] >...   169    2e-40 
gb|ABB91664.1|  65 kDa heat shock protein [Mycobacterium immun...   169    2e-40 
gb|AAK95370.1|  heat shock protein 60 kDa [Shigella boydii] >g...   169    2e-40 
gb|AAK69016.1|  HSP60 [Vibrio parahaemolyticus]                     169    2e-40 
gb|ACH56230.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|AAM49318.1|AF437057_1  60 kDa chaperonin [uncultured pig fa...   169    2e-40 
gb|ACH72249.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACC65258.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|AAZ84686.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   169    2e-40 
emb|CAD90124.1|  heat shock protein 60 [Helicobacter sp. 'Flex...   169    2e-40 
gb|ACC65293.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC64969.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACH56258.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|AAV84325.1|  60 kDa chaperonin [Pseudomonas syringae pv. gl...   169    2e-40 
gb|AAT96633.1|  60 kDa chaperonin [Bacteroides heparinolyticus]     169    2e-40 
gb|AAO91844.1|  chaperonin 60 [bacterium DRB3-204]                  169    2e-40 
gb|ACH72284.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ABB20532.1|  60 kDa chaperonin [Sphingobacterium multivorum]     169    2e-40 
gb|AAX77209.1|  65 kDa heat shock protein [Mycobacterium aubag...   169    2e-40 
gb|ACC65289.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC64872.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|AAV84331.1|  60 kDa chaperonin [Erwinia amylovora]               169    2e-40 
gb|ACH72252.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|AAK68995.1|  Hsp60 [Listonella anguillarum] >gb|AAK68996.1|...   169    2e-40 
gb|ACH72264.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACX56335.1|  heat shock protein 60 [Vibrio sp. 0407SW1] >gb...   169    2e-40 
gb|ACC65008.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC64712.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC65288.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC65445.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC64851.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
emb|CAC35972.1|  type III 65 kDa heat shock protein [Mycobacte...   169    2e-40 
gb|AAM88481.1|  Cpn60 [Flexispira rappini] >gb|AAX19839.1| 60 ...   169    2e-40 
gb|ACH72295.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACH72255.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|AAO91839.1|  chaperonin 60 [bacterium DRB3-207]                  169    2e-40 
gb|ACC65508.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ABW06438.1|  GroESL [Anaplasma phagocytophilum]                  169    2e-40 
gb|ACF20335.1|  60 kDa chaperonin [Buttiauxella agrestis]           169    2e-40 
gb|ACC64737.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|AAM49393.1|AF437132_1  60 kDa chaperonin [uncultured pig fa...   169    2e-40 
gb|AAT96640.1|  60 kDa chaperonin [Bacteroides zoogleoformans]      169    2e-40 
gb|ACC64968.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACF20336.1|  60 kDa chaperonin [Buttiauxella izardii]            169    2e-40 
gb|ACC65388.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ABL86739.1|  Cpn60 [Sphingobacteriaceae bacterium SOC A20(36)]   169    2e-40 
gb|ACC65329.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC65496.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|AAD33466.1|AF130448_1  GroEL protein [Deinococcus proteolyt...   169    2e-40 
gb|ACH72416.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACD79113.1|  heat shock protein 60 [Vibrio sp. SPRF176]          169    2e-40 
gb|AAX24016.1|  60 kDa chaperonin [uncultured bacterium]            169    2e-40 
gb|ACC65086.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
dbj|BAI67754.1|  heat shock protein 60 [Bacteroides coprosuis]      169    2e-40 
gb|ABB20566.1|  60 kDa chaperonin [uncultured bacterium]            169    2e-40 
gb|ABG75599.1|  60 kDa chaperonin [Bacteroides coprosuis DSM 1...   169    2e-40 
gb|ACH56384.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACC65521.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACH72289.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACH56421.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
gb|ACO35354.1|  60 kDa chaperonin [Thiothrix fructosivorans]        169    2e-40 
gb|AAK69023.1|  HSP60 [Plesiomonas shigelloides] >gb|AAM88497....   169    2e-40 
gb|ACC65123.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACC65040.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
gb|ACA34587.1|  60 kDa chaperonin [Escherichia coli]                169    2e-40 
gb|ACH72272.1|  chaperonin-60 [uncultured bacterium]                169    2e-40 
emb|CAC29006.1|  65 kDa heat shock protein [Mycobacterium hols...   169    2e-40 
gb|AAX24009.1|  60 kDa chaperonin [Listeria innocua]                169    2e-40 
gb|ACC65468.1|  Cpn60 [uncultured soil bacterium]                   169    2e-40 
dbj|BAF44322.1|  heat shock protein 60 [Helicobacter cinaedi] ...   169    3e-40 
gb|ACH72345.1|  chaperonin-60 [uncultured bacterium]                169    3e-40 
gb|AAX19048.1|  60 kDa chaperonin [Helicobacter acinonychis]        169    3e-40 
ref|ZP_02882382.1|  chaperonin GroEL [Burkholderia graminis C4...   169    3e-40 
gb|ABW89605.1|  heat shock protein 60 [Helicobacter canis] >gb...   169    3e-40 
gb|ACC65446.1|  Cpn60 [uncultured soil bacterium]                   169    3e-40 
gb|ACC65075.1|  Cpn60 [uncultured soil bacterium]                   169    3e-40 
gb|ACC64904.1|  Cpn60 [uncultured soil bacterium]                   169    3e-40 
emb|CAD90133.1|  heat shock protein 60 [Helicobacter cholecystus]   169    3e-40 
gb|AAT96637.1|  60 kDa chaperonin [Prevotella ruminicola]           169    3e-40 
gb|AAM49544.1|AF437283_1  60 kDa chaperonin [uncultured pig fa...   169    3e-40 
gb|ACC64897.1|  Cpn60 [uncultured soil bacterium]                   169    3e-40 
gb|ACN42167.1|  heat shock protein 60 [Vibrio vulnificus]           169    3e-40 
gb|AAT96622.1|  60 kDa chaperonin [Gallibacterium anatis]           168    3e-40 
gb|AAX09597.1|  65 kDa heat shock protein [Nocardia ignorata] ...   168    3e-40 
gb|ACC64963.1|  Cpn60 [uncultured soil bacterium]                   168    3e-40 
emb|CAM06990.1|  65 kDa heat shock protein [Mycobacterium sp. ...   168    3e-40 
dbj|BAF44318.1|  heat shock protein 60 [Helicobacter cinaedi] ...   168    3e-40 
gb|ACC64822.1|  Cpn60 [uncultured soil bacterium]                   168    3e-40 
dbj|BAF44325.1|  heat shock protein 60 [Helicobacter cinaedi] ...   168    3e-40 
gb|AAK69007.1|  HSP60 [Vibrio fluvialis]                            168    3e-40 
gb|ACC65491.1|  Cpn60 [uncultured soil bacterium]                   168    3e-40 
dbj|BAF44319.1|  heat shock protein 60 [Helicobacter cinaedi]       168    3e-40 
gb|AAW21712.1|  60 kDa chaperonin [Citrobacter freundii]            168    3e-40 
gb|ACH72439.1|  chaperonin-60 [uncultured bacterium]                168    3e-40 
gb|ACC64834.1|  Cpn60 [uncultured soil bacterium]                   168    3e-40 
gb|AAK95374.1|  heat shock protein 60 kDa [Salmonella enterica...   168    3e-40 
gb|ACH56268.1|  chaperonin-60 [uncultured bacterium]                168    3e-40 
gb|ACC65477.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ACH56426.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|AAV84324.1|  60 kDa chaperonin [Pseudomonas syringae pv. co...   168    4e-40 
gb|ACC64807.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
ref|XP_001737674.1|  chaperonin CPN60-2, mitochondrial precurs...   168    4e-40  Gene info
gb|AAD01808.1|  heat shock protein Hsp60 [Staphylococcus warneri]   168    4e-40 
gb|ACH56377.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|ACC65275.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ABR53883.1|  chaperonin GroEL [Rickettsiella melolonthae]        168    4e-40 
gb|ACH56238.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   168    4e-40 
gb|ACD78254.1|  heat shock protein 60 [Vibrio sp. FAL1156] >gb...   168    4e-40 
gb|ACC65348.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|AAM49478.1|AF437217_1  60 kDa chaperonin [uncultured pig fa...   168    4e-40 
gb|AAW82968.1|  65 kDa heat shock protein [Nocardia asteroides...   168    4e-40 
gb|AAM49226.1|AF436965_1  60 kDa chaperonin [uncultured pig fa...   168    4e-40 
gb|AAW82985.1|  65 kDa heat shock protein [Nocardia pseudovacc...   168    4e-40 
gb|ACC65375.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ACC64903.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|AAT94613.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   168    4e-40 
gb|ACH56424.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|ACC65547.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ACR56325.1|  chaperonin-60 [Trametes versicolor]                 168    4e-40 
gb|ACC65256.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ACH56241.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   168    4e-40 
gb|ABB20574.1|  60 kDa chaperonin [uncultured bacterium]            168    4e-40 
gb|ACC65124.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
dbj|BAI67766.1|  heat shock protein 60 [Bacteroides propionici...   168    4e-40 
gb|ACH56401.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|ACC64721.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65438...   168    4e-40 
gb|AAM49198.1|AF436937_1  60 kDa chaperonin [uncultured pig fa...   168    4e-40 
gb|ACH56244.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|ACF20338.1|  60 kDa chaperonin [Buttiauxella warmboldiae]        168    4e-40 
gb|ACC64944.1|  Cpn60 [uncultured soil bacterium]                   168    4e-40 
gb|ACH72307.1|  chaperonin-60 [uncultured bacterium]                168    4e-40 
gb|ACH56355.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   168    5e-40 
gb|ACC65368.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
emb|CAD90146.1|  heat shock protein 60 [Helicobacter felis]         168    5e-40 
emb|CAZ65710.1|  hsp60 protein [Bacteroides ureolyticus] >emb|...   168    5e-40 
gb|ACC65041.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|AAW82978.1|  65 kDa heat shock protein [Nocardia flavorosea...   168    5e-40 
gb|ACC64765.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACC64751.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACC65365.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACC64720.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACH56239.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   168    5e-40 
gb|ACC65195.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|AAT96657.1|  60 kDa chaperonin [Succinivibrio dextrinosolvens]   168    5e-40 
gb|ACF20341.1|  60 kDa chaperonin [Desulfurella acetivorans A63]    168    5e-40 
gb|ACC65335.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACJ02420.1|  65 kDa heat shock protein [Mycobacterium therm...   168    5e-40 
gb|ACH56332.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   168    5e-40 
gb|ACC65283.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ABW89613.1|  heat shock protein 60 [Helicobacter canis]          168    5e-40 
gb|AAW82984.1|  65 kDa heat shock protein [Nocardia pseudobras...   168    5e-40 
gb|ACC64763.1|  Cpn60 [uncultured soil bacterium]                   168    5e-40 
gb|ACD78293.1|  heat shock protein 60 [Vibrio sp. FAL1223] >gb...   168    5e-40 
gb|ABW89602.1|  heat shock protein 60 [Helicobacter canis] >gb...   167    5e-40 
gb|ACX56698.1|  heat shock protein 60 [Vibrio sp. 9ZB19] >gb|A...   167    5e-40 
gb|ACH72406.1|  chaperonin-60 [uncultured bacterium]                167    5e-40 
gb|ABW89603.1|  heat shock protein 60 [Helicobacter canis]          167    5e-40 
gb|AAM49211.1|AF436950_1  60 kDa chaperonin [uncultured pig fa...   167    5e-40 
gb|ACD78940.1|  heat shock protein 60 [Vibrio sp. SPR1136] >gb...   167    5e-40 
gb|ACC65174.1|  Cpn60 [uncultured soil bacterium]                   167    5e-40 
emb|CAD90151.1|  heat shock protein 60 [Helicobacter bizzozero...   167    5e-40 
gb|AAM49460.1|AF437199_1  60 kDa chaperonin [uncultured pig fa...   167    6e-40 
gb|ACH72251.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   167    6e-40 
gb|ACC65567.1|  Cpn60 [uncultured soil bacterium]                   167    6e-40 
gb|ACH56399.1|  chaperonin-60 [uncultured bacterium]                167    6e-40 
gb|ACX56494.1|  heat shock protein 60 [Vibrio sp. 0407CS24] >g...   167    6e-40 
gb|ACC65337.1|  Cpn60 [uncultured soil bacterium]                   167    6e-40 
gb|ACC65035.1|  Cpn60 [uncultured soil bacterium]                   167    6e-40 
gb|ACH56314.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   167    6e-40 
gb|AAM49189.1|AF436928_1  60 kDa chaperonin [uncultured pig fa...   167    6e-40 
gb|ACH72334.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   167    6e-40 
gb|ACC65480.1|  Cpn60 [uncultured soil bacterium]                   167    6e-40 
gb|ACH56414.1|  chaperonin-60 [uncultured bacterium]                167    6e-40 
gb|ACC64731.1|  Cpn60 [uncultured soil bacterium]                   167    6e-40 
gb|AAV84332.1|  60 kDa chaperonin [Pectobacterium atrosepticum]     167    6e-40 
gb|ACC65139.1|  Cpn60 [uncultured soil bacterium]                   167    7e-40 
gb|AAM49512.1|AF437251_1  60 kDa chaperonin [uncultured pig fa...   167    7e-40 
gb|ACH72385.1|  chaperonin-60 [uncultured bacterium]                167    7e-40 
gb|ABJ91206.1|  60 kDa heat-shock protein [Vibrio alginolyticus]    167    7e-40 
emb|CAD90142.1|  heat shock protein 60 [Helicobacter salomonis...   167    7e-40 
gb|ACH72417.1|  chaperonin-60 [uncultured bacterium]                167    7e-40 
gb|ACC65356.1|  Cpn60 [uncultured soil bacterium]                   167    7e-40 
gb|ACH72438.1|  chaperonin-60 [uncultured bacterium]                167    7e-40 
gb|ACH56341.1|  chaperonin-60 [uncultured bacterium]                167    7e-40 
gb|ACC65180.1|  Cpn60 [uncultured soil bacterium]                   167    7e-40 
gb|AAT96642.1|  60 kDa chaperonin [Rikenella microfusus]            167    7e-40 
gb|ACC65506.1|  Cpn60 [uncultured soil bacterium]                   167    7e-40 
gb|AAY17267.1|  65 kDa heat shock protein [Nocardia neocaledon...   167    7e-40 
gb|AAW82991.1|  65 kDa heat shock protein [Nocardia vaccinii]       167    7e-40 
gb|AAV32661.1|  60 kDa chaperonin [Campylobacter hyointestinal...   167    7e-40 
gb|AAK69017.1|  HSP60 [Aliivibrio salmonicida]                      167    8e-40 
gb|ACC64896.1|  Cpn60 [uncultured soil bacterium]                   167    8e-40 
gb|AAX22820.1|  heat shock protein 60 [Vibrio sp. 7A02] >gb|AA...   167    8e-40 
gb|ACC64826.1|  Cpn60 [uncultured soil bacterium]                   167    8e-40 
gb|ACC65465.1|  Cpn60 [uncultured soil bacterium]                   167    8e-40 
gb|ACM62107.1|  60 kDa chaperonin [uncultured bacterium]            167    8e-40 
gb|AAX19045.1|  60 kDa chaperonin [Helicobacter sp. Mainz] >gb...   167    8e-40 
gb|ACH56235.1|  chaperonin-60 [uncultured bacterium]                167    9e-40 
emb|CAD90152.1|  heat shock protein 60 [Helicobacter bizzozero...   167    9e-40 
gb|ACH72400.1|  chaperonin-60 [uncultured bacterium]                167    9e-40 
gb|AAY17265.1|  65 kDa heat shock protein [Nocardia testacea]       167    9e-40 
gb|ACC65136.1|  Cpn60 [uncultured soil bacterium]                   167    9e-40 
gb|ACC65135.1|  Cpn60 [uncultured soil bacterium]                   167    9e-40 
gb|AAZ84623.1|  60 kDa chaperonin [uncultured bacterium]            167    9e-40 
gb|AAO17524.1|  65 kDa heat shock protein [Mycobacterium therm...   167    9e-40 
gb|AAV32666.1|  60 kDa chaperonin [Campylobacter lanienae]          167    9e-40 
ref|XP_001620090.1|  hypothetical protein NEMVEDRAFT_v1g149214...   167    1e-39  UniGene infoGene info
gb|AAM49183.1|AF436922_1  60 kDa chaperonin [uncultured pig fa...   167    1e-39 
gb|AAW82980.1|  65 kDa heat shock protein [Nocardia ignorata] ...   167    1e-39 
gb|ACH56242.1|  chaperonin-60 [uncultured bacterium]                167    1e-39 
gb|ACC65327.1|  Cpn60 [uncultured soil bacterium]                   167    1e-39 
gb|ACC64958.1|  Cpn60 [uncultured soil bacterium]                   167    1e-39 
gb|ACC64734.1|  Cpn60 [uncultured soil bacterium]                   167    1e-39 
gb|ACX56411.1|  heat shock protein 60 [Vibrio sp. 0407RW140] >...   167    1e-39 
gb|ACH72293.1|  chaperonin-60 [uncultured bacterium]                167    1e-39 
gb|AAM49376.1|AF437115_1  60 kDa chaperonin [uncultured pig fa...   167    1e-39 
gb|ACC65516.1|  Cpn60 [uncultured soil bacterium]                   167    1e-39 
gb|ACQ85067.1|  60 kDa chaperonin [uncultured bacterium]            167    1e-39 
gb|AAM49509.1|AF437248_1  60 kDa chaperonin [uncultured pig fa...   167    1e-39 
gb|ACC64818.1|  Cpn60 [uncultured soil bacterium]                   167    1e-39 
gb|AAX24012.1|  60 kDa chaperonin [Aeromonas jandaei] >gb|ACA3...   167    1e-39 
gb|ACC65296.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACH72248.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   166    1e-39 
gb|AAT96605.1|  60 kDa chaperonin [Eubacterium fissicatena]         166    1e-39 
gb|ACC65176.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACC65128.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACC64841.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|AAW82972.1|  65 kDa heat shock protein [Nocardia carnea]         166    1e-39 
gb|ACH72383.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   166    1e-39 
gb|ACH72304.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|ACC65542.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACH56438.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|ACC65367.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACC64853.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACC65002.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|ACH72349.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|ACH56431.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|ACC65162.1|  Cpn60 [uncultured soil bacterium]                   166    1e-39 
gb|AAW82966.1|  65 kDa heat shock protein [Nocardia africana] ...   166    1e-39 
gb|ACM62140.1|  60 kDa chaperonin [uncultured bacterium]            166    1e-39 
gb|ACH72309.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|ACJ26827.1|  GroEL [Wolbachia symbiont of Radopholus similis]    166    1e-39 
gb|AAM49326.1|AF437065_1  60 kDa chaperonin [uncultured pig fa...   166    1e-39 
gb|ABV56823.1|  65 kDa heat shock protein [Nocardia altamirensis]   166    1e-39 
gb|ACH56289.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   166    1e-39 
gb|ACH56403.1|  chaperonin-60 [uncultured bacterium]                166    1e-39 
gb|AAM88477.1|  Cpn60 [Kingella kingae]                             166    1e-39 
gb|AAY17263.1|  65 kDa heat shock protein [Nocardia mexicana]       166    1e-39 
emb|CAY85808.1|  GroEL protein [Gluconacetobacter azotocaptans]     166    2e-39 
gb|ACC65343.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACC65411.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACC65133.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
ref|YP_220334.1|  chaperonin GroEL [Chlamydophila abortus S26/...   166    2e-39  Gene info
gb|ABQ65381.1|  65 kDa heat shock protein [Nocardia alba]           166    2e-39 
gb|ACH72339.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACO24561.1|  heat shock protein 65 [Rhodococcus sp. MC5]         166    2e-39 
gb|ACH72421.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACC65068.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACH72414.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH72455.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH56389.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACC65118.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|AAM49348.1|AF437087_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
gb|AAT96626.1|  60 kDa chaperonin [Porphyromonas macacae]           166    2e-39 
gb|ACC64828.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACH56277.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH56246.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH56352.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH72362.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ABB20569.1|  60 kDa chaperonin [uncultured bacterium]            166    2e-39 
gb|AAT96563.1|  60 kDa chaperonin [Bacteroides stercoris ATCC ...   166    2e-39 
gb|ACC64808.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACH72399.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH56303.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   166    2e-39 
gb|ACH56281.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACC65127.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
emb|CAJ44275.1|  heat shock protein 60 [Vibrio tapetis]             166    2e-39 
gb|ACC64923.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|AAM49358.1|AF437097_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
gb|AAZ94803.1|  60 kDa chaperonin [Campylobacter gracilis]          166    2e-39 
gb|ABQ65380.1|  65 kDa heat shock protein [Nocardia jejuensis]      166    2e-39 
gb|AAM49237.1|AF436976_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
gb|ACC64833.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACH56262.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACC65049.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|AAO17488.1|  65 kDa heat shock protein [Mycobacterium heide...   166    2e-39 
gb|ACH56439.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|AAW50397.1|  heat shock protein 60 [Staphylococcus simiae]       166    2e-39 
emb|CAZ65713.1|  hsp60 protein [Bacteroides ureolyticus]            166    2e-39 
gb|AAG21958.1|AF245677_1  60 kDa chaperonin [Enterococcus pseu...   166    2e-39 
gb|AAW82975.1|  65 kDa heat shock protein [Nocardia cummidelen...   166    2e-39 
ref|XP_725140.1|  chaperonin Cpn60, mitochondrial precursor [P...   166    2e-39  Gene info
gb|AAM49285.1|AF437024_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
emb|CAJ44272.1|  heat shock protein 60 [Vibrio chagasii]            166    2e-39 
emb|CAJ84445.1|  chaperonin 60 protein [Listonella anguillarum]     166    2e-39 
gb|AAM49158.1|AF436897_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
gb|AAM88491.1|  Cpn60 [Psychrobacter immobilis]                     166    2e-39 
gb|ACH72332.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
emb|CAJ84443.1|  chaperonin 60 protein [Vibrio fischeri]            166    2e-39 
gb|ACC65190.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACC65130.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|ACC64766.1|  Cpn60 [uncultured soil bacterium]                   166    2e-39 
gb|AAM49184.1|AF436923_1  60 kDa chaperonin [uncultured pig fa...   166    2e-39 
gb|AAS48629.1|  65 kDa heat shock protein [Nocardia abscessus]...   166    2e-39 
gb|AAL36939.1|  heat shock protein 60 [Macrococcus bovicus]         166    2e-39 
gb|AAK69020.1|  HSP60 [Vibrio sp. 971598]                           166    2e-39 
gb|ACH72366.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ACH56291.1|  chaperonin-60 [uncultured bacterium]                166    2e-39 
gb|ABB72767.1|  65 kDa heat shock protein [Nocardia ninae]          166    2e-39 
sp|P34940.1|CH60_PLAFG  RecName: Full=Chaperonin CPN60, mitoch...   166    2e-39 
gb|AAW82971.1|  65 kDa heat shock protein [Nocardia brevicaten...   165    3e-39 
ref|XP_677199.1|  chaperonin cpn60, mitochondrial precursor [P...   165    3e-39  Gene info
gb|ACC65230.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|ACC65526.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|ACC65168.1|  Cpn60 [uncultured soil bacterium] >gb|ACC65492...   165    3e-39 
gb|ACJ03969.1|  65kDa heat shock protein [Mycobacterium senuense]   165    3e-39 
gb|AAM49248.1|AF436987_1  60 kDa chaperonin [uncultured pig fa...   165    3e-39 
gb|AAM88549.1|  Cpn60 [Macrococcus bovicus]                         165    3e-39 
ref|XP_001350715.2|  chaperonin, cpn60 [Plasmodium falciparum ...   165    3e-39  Gene info
gb|ACC65160.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|AAW82977.1|  65 kDa heat shock protein [Nocardia farcinica]      165    3e-39 
gb|ACC64905.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
emb|CAJ44266.1|  heat shock protein 60 [Vibrio cyclitrophicus]      165    3e-39 
gb|ACC65106.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|ACA34543.1|  60 kDa chaperonin [Aeromonas bivalvium] >gb|AC...   165    3e-39 
gb|AAG21960.1|AF245679_1  60 kDa chaperonin [Enterococcus raff...   165    3e-39 
gb|AAM49303.1|AF437042_1  60 kDa chaperonin [uncultured pig fa...   165    3e-39 
gb|ACC64970.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|AAW82974.1|  65 kDa heat shock protein [Nocardia crassostreae]   165    3e-39 
gb|ACH72396.1|  chaperonin-60 [uncultured bacterium]                165    3e-39 
gb|ACC65074.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|ACI05264.1|  60 kDa chaperonin [Thiothrix sp. BL]                165    3e-39 
gb|ACC65571.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|AAM49417.1|AF437156_1  60 kDa chaperonin [uncultured pig fa...   165    3e-39 
gb|ACC64852.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|ACA52268.1|  hsp65 [Mycobacterium arosiense]                     165    3e-39 
gb|AAW65391.1|  60 kDa chaperonin [Macrococcus brunensis]           165    3e-39 
gb|AAX35724.1|  heat shock protein [Staphylococcus sciuri]          165    3e-39 
gb|ACH72329.1|  chaperonin-60 [uncultured bacterium]                165    3e-39 
gb|ACA34579.1|  60 kDa chaperonin [Aeromonas sobria] >gb|ACI14...   165    3e-39 
gb|AAZ84663.1|  60 kDa chaperonin [uncultured bacterium]            165    3e-39 
gb|AAW82967.1|  65 kDa heat shock protein [Nocardia asteroides]     165    3e-39 
gb|ACH72336.1|  chaperonin-60 [uncultured bacterium]                165    3e-39 
gb|AAT96559.1|  60 kDa chaperonin [Bacteroides caccae] >dbj|BA...   165    3e-39 
dbj|BAI67759.1|  heat shock protein 60 [Bacteroides gallinarum]     165    3e-39 
gb|ACC65336.1|  Cpn60 [uncultured soil bacterium]                   165    3e-39 
gb|AAM49247.1|AF436986_1  60 kDa chaperonin [uncultured pig fa...   165    3e-39 
gb|AAO17491.1|  65 kDa heat shock protein [Mycobacterium inter...   165    3e-39 
gb|ACQ84994.1|  60 kDa chaperonin [uncultured bacterium]            165    3e-39 
gb|AAY17264.1|  65 kDa heat shock protein [Nocardia inohanensi...   165    4e-39 
gb|ACH72316.1|  chaperonin-60 [uncultured bacterium]                165    4e-39 
gb|ACH56380.1|  chaperonin-60 [uncultured bacterium]                165    4e-39 
gb|AAM49467.1|AF437206_1  60 kDa chaperonin [uncultured pig fa...   165    4e-39 
gb|ACA34554.1|  60 kDa chaperonin [Aeromonas molluscorum] >gb|...   165    4e-39 
gb|ACA34557.1|  60 kDa chaperonin [Aeromonas molluscorum]           165    4e-39 
gb|ACQ84968.1|  60 kDa chaperonin [uncultured bacterium]            165    4e-39 
emb|CAA42011.1|  ORF [Yersinia enterocolitica]                      165    4e-39 
gb|ACC65431.1|  Cpn60 [uncultured soil bacterium]                   165    4e-39 
gb|ACC65401.1|  Cpn60 [uncultured soil bacterium]                   165    4e-39 
gb|AAM49487.1|AF437226_1  60 kDa chaperonin [uncultured pig fa...   165    4e-39 
gb|ACH72323.1|  chaperonin-60 [uncultured bacterium]                165    4e-39 
gb|AAL36952.1|  heat shock protein 60 [Staphylococcus vitulinus]    165    4e-39 
gb|AAY17274.1|  65 kDa heat shock protein [Nocardia shimofusen...   165    4e-39 
gb|ABB88963.1|  60 kDa heat-shock protein [Vibrio alginolyticus]    165    4e-39 
gb|ACI96259.1|  chaperonin 60 [Staphylococcus fleurettii]           165    4e-39 
gb|ACH56228.1|  chaperonin-60 [uncultured bacterium]                165    4e-39 
gb|ACH72373.1|  chaperonin-60 [uncultured bacterium]                165    4e-39 
gb|ACC65292.1|  Cpn60 [uncultured soil bacterium]                   165    4e-39 
gb|AAD11552.1|  heat shock protein 60 [Staphylococcus vitulinus]    165    4e-39 
gb|ABQ65382.1|  65 kDa heat shock protein [Streptomyces somali...   165    4e-39 
gb|AAZ84796.1|  60 kDa chaperonin [uncultured bacterium]            165    4e-39 
gb|ACC65175.1|  Cpn60 [uncultured soil bacterium]                   165    4e-39 
dbj|BAI67769.1|  heat shock protein 60 [Bacteroides salyersiae]     164    4e-39 
gb|ACA34553.1|  60 kDa chaperonin [Aeromonas media] >gb|ACI146...   164    4e-39 
gb|ABB92527.1|  60 kDa chaperonin [Wolbachia endosymbiont of C...   164    4e-39 
gb|AAZ84797.1|  60 kDa chaperonin [uncultured bacterium]            164    4e-39 
dbj|BAH12883.1|  unnamed protein product [Homo sapiens]             164    4e-39  Gene info
gb|ACH56232.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   164    5e-39 
gb|ACH56305.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   164    5e-39 
gb|AAW82969.1|  65 kDa heat shock protein [Nocardia beijingens...   164    5e-39 
gb|AAT96632.1|  60 kDa chaperonin [Prevotella enoeca]               164    5e-39 
gb|AAW82982.1|  65 kDa heat shock protein [Nocardia otitidisca...   164    5e-39 
gb|AAM49481.1|AF437220_1  60 kDa chaperonin [uncultured pig fa...   164    5e-39 
emb|CAJ44273.1|  heat shock protein 60 [Listonella anguillarum]     164    5e-39 
gb|AAD11264.1|  heat shock protein 60 [Macrococcus caseolyticus]    164    5e-39 
gb|ACQ84999.1|  60 kDa chaperonin [uncultured bacterium]            164    5e-39 
gb|ACH56310.1|  chaperonin-60 [uncultured bacterium]                164    5e-39 
gb|AAZ84649.1|  60 kDa chaperonin [uncultured bacterium]            164    5e-39 
emb|CAD90120.1|  heat shock protein 60 [Helicobacter trogontum...   164    5e-39 
gb|ACH56435.1|  chaperonin-60 [uncultured bacterium]                164    5e-39 
gb|ACC65424.1|  Cpn60 [uncultured soil bacterium]                   164    5e-39 
gb|AAW65392.1|  60 kDa chaperonin [Macrococcus lamae]               164    6e-39 
gb|ACC64804.1|  Cpn60 [uncultured soil bacterium]                   164    6e-39 
gb|AAL36940.1|  heat shock protein 60 [Macrococcus carouselicus]    164    6e-39 
dbj|BAI67767.1|  heat shock protein 60 [Bacteroides pyogenes] ...   164    6e-39 
gb|ACT89264.1|  60 kDa heat shock protein [Lactobacillus helve...   164    6e-39 
gb|AAM49446.1|AF437185_1  60 kDa chaperonin [uncultured pig fa...   164    6e-39 
gb|ACA34548.1|  60 kDa chaperonin [Aeromonas eucrenophila] >gb...   164    6e-39 
gb|AAM49327.1|AF437066_1  60 kDa chaperonin [uncultured pig fa...   164    6e-39 
gb|ACQ85019.1|  60 kDa chaperonin [uncultured bacterium]            164    6e-39 
emb|CAJ84446.1|  chaperonin 60 protein [Vibrio splendidus]          164    6e-39 
gb|AAG21959.1|AF245678_1  60 kDa chaperonin [Enterococcus aviu...   164    6e-39 
gb|ACH72266.1|  chaperonin-60 [uncultured bacterium]                164    6e-39 
gb|ACA34581.1|  60 kDa chaperonin [Aeromonas enteropelogenes] ...   164    6e-39 
gb|AAW82987.1|  65 kDa heat shock protein [Nocardia seriolae] ...   164    6e-39 
emb|CAD90125.1|  heat shock protein 60 [Helicobacter bilis] >e...   164    6e-39 
gb|ACH56388.1|  chaperonin-60 [uncultured bacterium]                164    6e-39 
gb|AAO17452.1|  65 kDa heat shock protein [Mycobacterium avium...   164    6e-39 
gb|ABB92543.1|  60 kDa chaperonin [Wolbachia endosymbiont of P...   164    7e-39 
gb|AAO17498.1|  65 kDa heat shock protein [Mycobacterium malmo...   164    7e-39 
gb|ACH56346.1|  chaperonin-60 [uncultured bacterium] >gb|ACH72...   164    7e-39 
gb|AAZ84778.1|  60 kDa chaperonin [uncultured bacterium]            164    7e-39 
gb|ACQ45384.1|  60 kDa chaperonin [uncultured bacterium]            164    7e-39 
gb|ABB20581.1|  60 kDa chaperonin [uncultured bacterium]            164    7e-39 
gb|AAM49274.1|AF437013_1  60 kDa chaperonin [uncultured pig fa...   164    7e-39 
gb|AAO17486.1|  65 kDa heat shock protein [Mycobacterium hassi...   164    7e-39 
gb|ABB92538.1|  60 kDa chaperonin [Wolbachia endosymbiont of N...   164    7e-39 
gb|ACH72401.1|  chaperonin-60 [uncultured bacterium]                164    7e-39 
gb|AAO17519.1|  65 kDa heat shock protein [Mycobacterium simiae]    164    7e-39 
gb|ACS14593.1|  Hsp60 [Lactobacillus helveticus] >gb|ACS14596....   164    7e-39 
emb|CAD90139.1|  heat shock protein 60 [Helicobacter acinonychis]   164    7e-39 
gb|AAM49315.1|AF437054_1  60 kDa chaperonin [uncultured pig fa...   164    7e-39 
gb|ACH72298.1|  chaperonin-60 [uncultured bacterium]                164    7e-39 
gb|AAZ84762.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   164    7e-39 
gb|AAT96560.1|  60 kDa chaperonin [Bacteroides eggerthii DSM 2...   164    7e-39 
gb|ACH56364.1|  chaperonin-60 [uncultured bacterium]                164    7e-39 
gb|AAV84306.1|  60 kDa chaperonin [Monilinia seaverii]              164    7e-39 
emb|CAJ41451.1|  heatshock protein 60 [Vibrio tapetis]              164    7e-39 
gb|ABB20568.1|  60 kDa chaperonin [uncultured bacterium]            164    8e-39 
gb|EDL32336.1|  mCG116284 [Mus musculus]                            164    8e-39 
gb|ACH72351.1|  chaperonin-60 [uncultured bacterium]                164    8e-39 
dbj|BAE53775.1|  heat shock protein 60 [uncultured bacterium]       164    8e-39 
gb|ACH56338.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   164    8e-39 
gb|ACH56315.1|  chaperonin-60 [uncultured bacterium]                164    8e-39 
gb|AAM49397.1|AF437136_1  60 kDa chaperonin [uncultured pig fa...   164    8e-39 
gb|ACT89258.1|  60 kDa heat shock protein [Lactobacillus helve...   164    8e-39 
gb|ACS14582.1|  Hsp60 [Lactobacillus helveticus]                    164    8e-39 
gb|ACC65402.1|  Cpn60 [uncultured soil bacterium]                   164    8e-39 
gb|AAM49169.1|AF436908_1  60 kDa chaperonin [uncultured pig fa...   164    8e-39 
emb|CAE82069.1|  GroEL protein [Wolbachia pipientis]                164    8e-39 
gb|AAV84343.1|  60 kDa chaperonin [Candida tropicalis]              164    8e-39 
dbj|BAI67751.1|  heat shock protein 60 [Bacteroides cellulosil...   164    8e-39 
gb|ACS14591.1|  Hsp60 [Lactobacillus helveticus]                    164    8e-39 
gb|ACC65360.1|  Cpn60 [uncultured soil bacterium]                   164    8e-39 
gb|ACT89281.1|  60 kDa heat shock protein [Lactobacillus helve...   164    8e-39 
gb|AAV84316.1|  60 kDa chaperonin [Phoma exigua var. exigua] >...   164    8e-39 
emb|CAJ44274.1|  heat shock protein 60 [Vibrio tapetis]             164    8e-39 
gb|ACC65177.1|  Cpn60 [uncultured soil bacterium]                   164    8e-39 
gb|AAM49181.1|AF436920_1  60 kDa chaperonin [uncultured pig fa...   164    8e-39 
gb|AAZ84859.1|  60 kDa chaperonin [uncultured bacterium]            164    8e-39 
gb|AAM49405.1|AF437144_1  60 kDa chaperonin [uncultured pig fa...   164    8e-39 
gb|ACQ45431.1|  60 kDa chaperonin [uncultured bacterium]            164    9e-39 
emb|CAL44985.1|  chaperonin 60 [Vibrio sp. NRP 45]                  164    9e-39 
gb|ACC65316.1|  Cpn60 [uncultured soil bacterium]                   164    9e-39 
gb|AAZ84902.1|  60 kDa chaperonin [uncultured bacterium]            164    9e-39 
gb|ACA34551.1|  60 kDa chaperonin [Aeromonas hydrophila subsp....   164    9e-39 
gb|ABB20583.1|  60 kDa chaperonin [uncultured bacterium]            164    9e-39 
gb|ACI02345.1|  60 kDa chaperonin [Sphaerotilus natans]             164    9e-39 
gb|ACH56282.1|  chaperonin-60 [uncultured bacterium]                164    9e-39 
gb|ACC65131.1|  Cpn60 [uncultured soil bacterium]                   164    9e-39 
emb|CAJ44268.1|  heat shock protein 60 [Vibrio lentus]              164    9e-39 
gb|ACC64898.1|  Cpn60 [uncultured soil bacterium]                   164    9e-39 
gb|AAV84305.1|  60 kDa chaperonin [Monilinia seaverii]              164    9e-39 
gb|ABB20582.1|  60 kDa chaperonin [uncultured bacterium]            164    9e-39 
gb|AAG21951.1|AF245670_1  60 kDa chaperonin [Enterococcus sp. ...   164    9e-39 
gb|ABS70972.1|  65 kDa heat shock protein [Mycobacterium gordo...   164    9e-39 
gb|AAV84338.1|  60 kDa chaperonin [Candida albicans] >gb|AAV84...   164    9e-39 
gb|AAO17510.1|  65 kDa heat shock protein [Mycobacterium phlei]     164    9e-39 
gb|ACS14532.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14546.1...   164    9e-39 
gb|ACH56368.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|ACQ45433.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
ref|XP_001613857.1|  chaperonin CPN60, mitochondrial precursor...   163    1e-38  Gene info
gb|ACH72411.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|AAL36944.1|  heat shock protein 60 [Staphylococcus chromoge...   163    1e-38 
gb|AAM88527.1|  Cpn60 [Granulicatella balaenopterae]                163    1e-38 
dbj|BAI67763.1|  heat shock protein 60 [Bacteroides nordii]         163    1e-38 
gb|ACS14547.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14555.1...   163    1e-38 
gb|ACS14545.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14552.1...   163    1e-38 
gb|ACH72437.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|AAM49168.1|AF436907_1  60 kDa chaperonin [uncultured pig fa...   163    1e-38 
gb|ACQ45426.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
gb|ACM62144.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
gb|ACC65330.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|ACH56400.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|ACC64960.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|AAV84322.1|  60 kDa chaperonin [Phoma multirostrata]             163    1e-38 
gb|AAO17472.1|  65 kDa heat shock protein [Mycobacterium eleph...   163    1e-38 
gb|ACC65569.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|AAO17512.1|  65 kDa heat shock protein [Mycobacterium porif...   163    1e-38 
gb|AAM49453.1|AF437192_1  60 kDa chaperonin [uncultured pig fa...   163    1e-38 
gb|ABB92544.1|  60 kDa chaperonin [Wolbachia endosymbiont of P...   163    1e-38 
gb|AAT96628.1|  60 kDa chaperonin [Prevotella buccalis ATCC 35...   163    1e-38 
gb|ACC64912.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
emb|CAJ84444.1|  chaperonin 60 protein [Vibrio parahaemolyticus]    163    1e-38 
gb|AAM88516.1|  Cpn60 [Psychrobacter phenylpyruvicus]               163    1e-38 
gb|ACM62150.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
gb|AAO17499.1|  65 kDa heat shock protein [Mycobacterium marin...   163    1e-38 
gb|ACC64971.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|ACS14600.1|  Hsp60 [Lactobacillus helveticus]                    163    1e-38 
ref|XP_002262395.1|  chaperonin cpn60 [Plasmodium knowlesi str...   163    1e-38  Gene info
gb|ACM62149.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
gb|ACC65047.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
emb|CAE82067.1|  GroEL protein [Wolbachia pipientis]                163    1e-38 
gb|AAO17506.1|  65 kDa heat shock protein [Mycobacterium novoc...   163    1e-38 
gb|AAM49497.1|AF437236_1  60 kDa chaperonin [uncultured pig fa...   163    1e-38 
gb|ACM62109.1|  60 kDa chaperonin [uncultured bacterium]            163    1e-38 
gb|ACS14615.1|  Hsp60 [Lactobacillus helveticus]                    163    1e-38 
gb|AAV84315.1|  60 kDa chaperonin [Phoma foveata] >gb|AAV84317...   163    1e-38 
dbj|BAI67773.1|  heat shock protein 60 [Bacteroides thetaiotao...   163    1e-38 
gb|ACS14523.1|  Hsp60 [Lactobacillus plantarum]                     163    1e-38 
gb|AAM49175.1|AF436914_1  60 kDa chaperonin [uncultured pig fa...   163    1e-38 
gb|ACS14531.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14543.1...   163    1e-38 
gb|ACC65166.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|AAB81429.1|  chaperonin 60 [Staphylococcus hyicus] >gb|AAB8...   163    1e-38 
emb|CAM06996.1|  65 kDa heat shock protein [Mycobacterium llat...   163    1e-38 
gb|ACH72292.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|ACC64741.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|ACS14554.1|  Hsp60 [Lactobacillus plantarum]                     163    1e-38 
gb|ACA34577.1|  60 kDa chaperonin [Aeromonas simiae] >gb|ACA34...   163    1e-38 
gb|AAO17460.1|  65 kDa heat shock protein [Mycobacterium brumae]    163    1e-38 
gb|ACA34575.1|  60 kDa chaperonin [Aeromonas schubertii] >gb|A...   163    1e-38 
gb|ACH56363.1|  chaperonin-60 [uncultured bacterium]                163    1e-38 
gb|ABR10931.1|  Hsp60 [Helicobacter felis]                          163    1e-38 
gb|ACS14529.1|  Hsp60 [Lactobacillus plantarum]                     163    1e-38 
gb|ACC64899.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|ACS14538.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14539.1...   163    1e-38 
gb|ACS14535.1|  Hsp60 [Lactobacillus plantarum]                     163    1e-38 
gb|ACC65113.1|  Cpn60 [uncultured soil bacterium]                   163    1e-38 
gb|ACS14570.1|  Hsp60 [Lactobacillus plantarum]                     163    2e-38 
gb|AAT96562.1|  60 kDa chaperonin [Bacteroides helcogenes P 36...   163    2e-38 
gb|ACC64999.1|  Cpn60 [uncultured soil bacterium]                   163    2e-38 
gb|ACH56381.1|  chaperonin-60 [uncultured bacterium]                163    2e-38 
gb|ACC64973.1|  Cpn60 [uncultured soil bacterium]                   163    2e-38 
gb|AAA32725.1|  60-kDa chaperonin-60 beta-polypeptide [Arabido...   163    2e-38 
gb|ACC65419.1|  Cpn60 [uncultured soil bacterium]                   163    2e-38 
gb|ACS14544.1|  Hsp60 [Lactobacillus plantarum]                     163    2e-38 
gb|ACS14537.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14541.1...   162    2e-38 
gb|ACQ85040.1|  60 kDa chaperonin [uncultured bacterium]            162    2e-38 
gb|AAW65393.1|  60 kDa chaperonin [Macrococcus hajekii]             162    2e-38 
gb|ACC65244.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|ACS14562.1|  Hsp60 [Lactobacillus plantarum] >gb|ACS14571.1...   162    2e-38 
emb|CAM06989.1|  65 kDa heat shock protein [Mycobacterium sp. ...   162    2e-38 
gb|ACS14534.1|  Hsp60 [Lactobacillus plantarum]                     162    2e-38 
gb|AAB81427.1|  chaperonin 60 [Staphylococcus hyicus] >gb|AAB8...   162    2e-38 
gb|ACH56383.1|  chaperonin-60 [uncultured bacterium] >gb|ACH56...   162    2e-38 
gb|ACA34546.1|  60 kDa chaperonin [Aeromonas encheleia] >gb|AC...   162    2e-38 
gb|ACA63012.1|  GroEL [Bacteriovorax sp. T8]                        162    2e-38 
gb|ACC64998.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|ACH56359.1|  chaperonin-60 [uncultured bacterium]                162    2e-38 
gb|ACC65561.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|ACC65490.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|ACC64757.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|AAO17450.1|  65 kDa heat shock protein [Mycobacterium asiat...   162    2e-38 
gb|ACC65482.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|ABB92545.1|  60 kDa chaperonin [Wolbachia endosymbiont of D...   162    2e-38 
gb|AAT96561.1|  60 kDa chaperonin [Bacteroides fragilis] >gb|A...   162    2e-38 
gb|AAO17448.1|  65 kDa heat shock protein [Mycobacterium aichi...   162    2e-38 
dbj|BAI67757.1|  heat shock protein 60 [Bacteroides finegoldii...   162    2e-38 
gb|ACH72376.1|  chaperonin-60 [uncultured bacterium]                162    2e-38 
gb|AAL36941.1|  heat shock protein 60 [Macrococcus equipercicus]    162    2e-38 
gb|ACC65345.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|AAM88548.1|  Cpn60 [Moraxella catarrhalis]                       162    2e-38 
gb|AAO17446.1|  65 kDa heat shock protein [Mycobacterium absce...   162    2e-38 
gb|AAV84354.1|  60 kDa chaperonin [Prevotella melaninogenica] ...   162    2e-38 
gb|ACC65194.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|AAO17455.1|  65 kDa heat shock protein [Mycobacterium bohem...   162    2e-38 
gb|AAO17471.1|  65 kDa heat shock protein [Mycobacterium duvalii]   162    2e-38 
gb|AAO17503.1|  65 kDa heat shock protein [Mycobacterium mural...   162    2e-38 
gb|ACC64717.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
emb|CAM06992.1|  65 kDa heat shock protein [Mycobacterium llat...   162    2e-38 
gb|AAM49540.1|AF437279_1  60 kDa chaperonin [uncultured pig fa...   162    2e-38 
emb|CAD90135.1|  heat shock protein 60 [Helicobacter cinaedi]       162    2e-38 
gb|AAZ84721.1|  60 kDa chaperonin [uncultured bacterium]            162    2e-38 
gb|AAK69022.1|  HSP60 [Aeromonas hydrophila] >gb|AAM88469.1| C...   162    2e-38 
gb|AAO17467.1|  65 kDa heat shock protein [Mycobacterium consp...   162    2e-38 
gb|AAY85528.1|  65 kDa heat shock protein [Mycobacterium neoau...   162    2e-38 
gb|ACH56428.1|  chaperonin-60 [uncultured bacterium]                162    2e-38 
gb|ACH72294.1|  chaperonin-60 [uncultured bacterium]                162    2e-38 
gb|ACC65504.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|AAM49490.1|AF437229_1  60 kDa chaperonin [uncultured pig fa...   162    2e-38 
gb|ACQ45388.1|  60 kDa chaperonin [uncultured bacterium]            162    2e-38 
gb|ACC65193.1|  Cpn60 [uncultured soil bacterium]                   162    2e-38 
gb|AAL36946.1|  heat shock protein 60 [Staphylococcus felis]        162    2e-38 
gb|ACM62029.1|  60 kDa chaperonin [uncultured bacterium]            162    2e-38 
gb|ABB92528.1|  60 kDa chaperonin [Wolbachia endosymbiont of C...   162    2e-38 
gb|ACH56398.1|  chaperonin-60 [uncultured bacterium]                162    2e-38 
gb|ACM62063.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   162    3e-38 
gb|AAZ84800.1|  60 kDa chaperonin [uncultured bacterium] >gb|A...   162    3e-38 
gb|AAO17485.1|  65 kDa heat shock protein [Mycobacterium haemo...   162    3e-38 
gb|AAD11256.1|  heat shock protein 60 [Staphylococcus aureus]       162    3e-38 
gb|AAD11263.1|  heat shock protein 60 [Staphylococcus kloosii]      162    3e-38 
gb|ACQ45382.1|  60 kDa chaperonin [uncultured bacterium]            162    3e-38 
gb|ACC65245.1|  Cpn60 [uncultured soil bacterium]                   162    3e-38 
gb|AAV84288.1|  60 kDa chaperonin [Gibberella stilboides] >gb|...   162    3e-38 
gb|AAL33621.1|AF440236_1  CPN60 [Bacteroides ovatus] >dbj|BAI6...   162    3e-38 
gb|AAO17451.1|  65 kDa heat shock protein [Mycobacterium austr...   162    3e-38 
gb|AAX39809.1|  65 kDa heat shock protein [Mycobacterium paras...   162    3e-38 
gb|AAX19832.1|  60 kDa chaperonin [Helicobacter hepaticus] >gb...   162    3e-38 
gb|AAM88524.1|  Cpn60 [Granulicatella elegans ATCC 700633]          162    3e-38 
gb|ACH58604.1|  65 kDa heat shock protein [Mycobacterium riyad...   162    3e-38 
gb|AAO17527.1|  65 kDa heat shock protein [Mycobacterium trivi...   162    3e-38 
gb|AAD01974.1|  60 kDa heat shock protein [Staphylococcus schl...   162    3e-38 
gb|AAV84290.1|  60 kDa chaperonin [Fusarium avenaceum]              162    3e-38 
gb|ACM62151.1|  60 kDa chaperonin [uncultured bacterium]            162    3e-38 
gb|ACC65153.1|  Cpn60 [uncultured soil bacterium]                   162    3e-38 
gb|ACA34545.1|  60 kDa chaperonin [Aeromonas punctata] >gb|ACI...   162    3e-38 
gb|ACM62153.1|  60 kDa chaperonin [uncultured bacterium]            162    3e-38 


first 10 alignments:

>ref|YP_265587.1| Gene info 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
 sp|Q4FPA5.1|CH60_PELUB Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
 gb|AAZ20984.1| Gene info 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
Length=554

 GENE ID: 3516889 groEL | 60 kDa chaperonin
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  422 bits (1085),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)

Query  2    MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEID  61
            M+K+VKFDSEAR+AM++GVDILANTVK TLGPKGRNVVIDKSYGAPR TKDGV+VAKEID
Sbjct  1    MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEID  60

Query  62   LEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGID  121
            LEDKFENMGAQMVKEVASKTN+EAGDGTTTATILAQAIVKEG KYVTAGMNPMDVKRGID
Sbjct  61   LEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGID  120

Query  122  AAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  181
            AAVE VK  LI+SAKKVKD+DEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK
Sbjct  121  AAVEHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  180

Query  182  GIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            G+ETELDVVEGMQFDRGYLSPYFITN DKMTTELENP ILLHEKK
Sbjct  181  GVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKK  225


>ref|ZP_01264674.1|  60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
 gb|EAS85161.1|  60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
Length=554

 Score =  420 bits (1079),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)

Query  2    MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEID  61
            M+K+VKFDSEAR+AM++GVDILANTVK TLGPKGRNVVIDKSYGAPR TKDGV+VAKEID
Sbjct  1    MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEID  60

Query  62   LEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGID  121
            LEDKFENMGAQMVKEVASKTN+EAGDGTTTATILAQAIVKEG KYVTAGMNPMDVKRGID
Sbjct  61   LEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGID  120

Query  122  AAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  181
            +AV+ VK  LI+SAKKVKD+DEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK
Sbjct  121  SAVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  180

Query  182  GIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            G+ETELDVVEGMQFDRGYLSPYFITN DKMTTELENP ILLHEKK
Sbjct  181  GVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKK  225


>ref|ZP_05069866.1|  chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ60865.1|  chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211]
Length=553

 Score =  411 bits (1057),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)

Query  2    MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEID  61
            M+KI+KFD+EAR++M++GV+ILA+TVK TLGPKGRNVV+DKSYGAPR TKDGV+VAKEID
Sbjct  1    MAKIIKFDAEARASMMRGVNILADTVKVTLGPKGRNVVMDKSYGAPRITKDGVSVAKEID  60

Query  62   LEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGID  121
            LEDKFENMGAQMVKEVASKTN+EAGDGTTTATILAQAIVKEG KYVTAGMNPMDVKRGID
Sbjct  61   LEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGID  120

Query  122  AAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  181
            AAVE VKE LISSAKKVKDSDEIAQVGTISANGDKEIG MIAKAMQKVGNEGVITVEEAK
Sbjct  121  AAVENVKENLISSAKKVKDSDEIAQVGTISANGDKEIGTMIAKAMQKVGNEGVITVEEAK  180

Query  182  GIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            GI+TELDVVEGMQFDRGYLSPYFITN DKMTTEL+NP ILLHE K
Sbjct  181  GIDTELDVVEGMQFDRGYLSPYFITNSDKMTTELDNPYILLHESK  225


>ref|ZP_06054579.1|  chaperonin GroL [alpha proteobacterium HIMB114]
 gb|EEY74348.1|  chaperonin GroL [alpha proteobacterium HIMB114]
Length=550

 Score =  375 bits (962),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/226 (83%), Positives = 212/226 (93%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            +  KIVKFD+EAR+AMLKGVDILAN VK TLGPKGRNVVIDKS+GAPR TKDGVTVAKE+
Sbjct  1    MAGKIVKFDTEARNAMLKGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEV  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVASKTNDEAGDGTTT+T+LAQ+I KEGCKYV+AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASKTNDEAGDGTTTSTVLAQSIAKEGCKYVSAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A+E+V E++ SS+KKVK S+EIAQVGTISANG+KEIG+MI+KAMQKVGNEGVITVEEA
Sbjct  121  DTAIEKVIEEIKSSSKKVKTSEEIAQVGTISANGEKEIGDMISKAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG++TELDVVEGMQFDRG+LSPYFITN DKM  EL+NPLILL EKK
Sbjct  181  KGLQTELDVVEGMQFDRGFLSPYFITNSDKMVAELDNPLILLCEKK  226


>gb|ABR27784.1|  HSP60 [Candidatus Pelagibacter ubique]
Length=510

 Score =  374 bits (960),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)

Query  31   LGPKGRNVVIDKSYGAPRTTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDEAGDGTT  90
            LGPKGRNVVIDKSYGAPR TKDGV+VAKEIDLEDKFENMGAQMVKEVASKTN+EAGDGTT
Sbjct  1    LGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTT  60

Query  91   TATILAQAIVKEGCKYVTAGMNPMDVKRGIDAAVEQVKEKLISSAKKVKDSDEIAQVGTI  150
            TATILAQAIVKEG KYVTAGMNPMDVKRGIDAAVE VK  LI+SAKKVKD+DEIAQVGTI
Sbjct  61   TATILAQAIVKEGVKYVTAGMNPMDVKRGIDAAVEHVKASLIASAKKVKDTDEIAQVGTI  120

Query  151  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGIETELDVVEGMQFDRGYLSPYFITNGDK  210
            SANGDKEIGNMIAKAMQKVGNEGVITVEEAKG+ETELDVVEGMQFDRGYLSPYFITN DK
Sbjct  121  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADK  180

Query  211  MTTELENPLILLHEKK  226
            MTTELENP ILLHEKK
Sbjct  181  MTTELENPFILLHEKK  196


>gb|ABR27777.1|  HSP60 [Candidatus Pelagibacter ubique]
Length=510

 Score =  372 bits (954),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)

Query  31   LGPKGRNVVIDKSYGAPRTTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDEAGDGTT  90
            LGPKGRNVVIDKSYGAPR TKDGV+VAKEIDLEDKFENMGAQMVKEVASKTN+EAGDGTT
Sbjct  1    LGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTT  60

Query  91   TATILAQAIVKEGCKYVTAGMNPMDVKRGIDAAVEQVKEKLISSAKKVKDSDEIAQVGTI  150
            TATILAQAIVKEG KYVTAGMNPMDVKRGIDAAV+ VK  LI+SAKKVKD+DEIAQVGTI
Sbjct  61   TATILAQAIVKEGVKYVTAGMNPMDVKRGIDAAVDHVKASLIASAKKVKDTDEIAQVGTI  120

Query  151  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGIETELDVVEGMQFDRGYLSPYFITNGDK  210
            SANGDKEIGNMIAKAMQKVGNEGVITVEEAKG+ETELDVVEGMQFDRGYLSPYFITN DK
Sbjct  121  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADK  180

Query  211  MTTELENPLILLHEKK  226
            MTTELENP ILLHEKK
Sbjct  181  MTTELENPFILLHEKK  196


>gb|ABR27782.1|  HSP60 [Candidatus Pelagibacter ubique]
Length=510

 Score =  371 bits (952),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 182/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)

Query  31   LGPKGRNVVIDKSYGAPRTTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDEAGDGTT  90
            LGPKGRNVVIDKSYGAPR TKDGV+VAKEIDLEDKFENMGAQMVKEVASKTN+EAGDGTT
Sbjct  1    LGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTT  60

Query  91   TATILAQAIVKEGCKYVTAGMNPMDVKRGIDAAVEQVKEKLISSAKKVKDSDEIAQVGTI  150
            TATILAQAIVKEG KYVTAGMNPMDVKRGID+AV+ VK  LI+SAKKVKD+DEIAQVGTI
Sbjct  61   TATILAQAIVKEGVKYVTAGMNPMDVKRGIDSAVDHVKASLIASAKKVKDTDEIAQVGTI  120

Query  151  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGIETELDVVEGMQFDRGYLSPYFITNGDK  210
            SANGDKEIGNMIAKAMQKVGNEGVITVEEAKG+ETELDVVEGMQFDRGYLSPYFITN DK
Sbjct  121  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADK  180

Query  211  MTTELENPLILLHEKK  226
            MTTELENP ILLHEKK
Sbjct  181  MTTELENPFILLHEKK  196


>gb|ABR27776.1|  HSP60 [Candidatus Pelagibacter ubique HTCC1002]
 gb|ABR27778.1|  HSP60 [Candidatus Pelagibacter ubique]
 gb|ABR27779.1|  HSP60 [Candidatus Pelagibacter ubique]
 gb|ABR27780.1|  HSP60 [Candidatus Pelagibacter ubique]
 gb|ABR27781.1|  HSP60 [Candidatus Pelagibacter ubique]
 gb|ABR27783.1|  HSP60 [Candidatus Pelagibacter ubique]
Length=510

 Score =  370 bits (951),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 182/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)

Query  31   LGPKGRNVVIDKSYGAPRTTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDEAGDGTT  90
            LGPKGRNVVIDKSYGAPR TKDGV+VAKEIDLEDKFENMGAQMVKEVASKTN+EAGDGTT
Sbjct  1    LGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTT  60

Query  91   TATILAQAIVKEGCKYVTAGMNPMDVKRGIDAAVEQVKEKLISSAKKVKDSDEIAQVGTI  150
            TATILAQAIVKEG KYVTAGMNPMDVKRGID+AV+ VK  LI+SAKKVKD+DEIAQVGTI
Sbjct  61   TATILAQAIVKEGVKYVTAGMNPMDVKRGIDSAVDHVKASLIASAKKVKDTDEIAQVGTI  120

Query  151  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGIETELDVVEGMQFDRGYLSPYFITNGDK  210
            SANGDKEIGNMIAKAMQKVGNEGVITVEEAKG+ETELDVVEGMQFDRGYLSPYFITN DK
Sbjct  121  SANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADK  180

Query  211  MTTELENPLILLHEKK  226
            MTTELENP ILLHEKK
Sbjct  181  MTTELENPFILLHEKK  196


>ref|ZP_02153075.1|  chaperonin GroEL [Oceanibulbus indolifex HEL-45]
 gb|EDQ06942.1|  chaperonin GroEL [Oceanibulbus indolifex HEL-45]
Length=548

 Score =  360 bits (924),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 176/226 (77%), Positives = 201/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD++AR+ MLKGV+ILA+ VK TLGPKGRNVV+DKS+GAPR TKDGV+VAKEI
Sbjct  1    MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAIVKEG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V E + ++A+ V DSDE+AQVGTISANG+KEIG  IA AMQKVGNEGVITVEE 
Sbjct  121  DLATAKVVEAIKAAARDVSDSDEVAQVGTISANGEKEIGRQIADAMQKVGNEGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKMT ELE+ +ILLHEKK
Sbjct  181  KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDAIILLHEKK  226


>ref|ZP_01749368.1|  60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
 gb|EBA13351.1|  60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
Length=549

 Score =  360 bits (924),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 176/226 (77%), Positives = 201/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD++AR+ ML GV+ LAN VK TLGPKGRNVV+DKS+GAPR TKDGV+VAKEI
Sbjct  3    MAAKDVKFDTDARNRMLTGVNTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI  62

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAIVKEG K V AGMNPMD+KRGI
Sbjct  63   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI  122

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V E + S+++ V DSDE+AQVGTISANG++EIG  IA AMQKVGNEGVITVEE 
Sbjct  123  DLATLKVVEAIKSASRPVSDSDEVAQVGTISANGEEEIGRQIADAMQKVGNEGVITVEEN  182

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKMTTELE+P+ILLHEKK
Sbjct  183  KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDPIILLHEKK  228


>ref|YP_001753228.1| Gene info chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
 sp|B1LVA0.1|CH60_METRJ Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
 gb|ACB22545.1| Gene info chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
Length=546

 GENE ID: 6136547 Mrad2831_0534 | chaperonin GroEL
[Methylobacterium radiotolerans JCM 2831]

 Score =  357 bits (917),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/226 (76%), Positives = 197/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K V+F ++AR  ML+GVDILA+ VK TLGPKGRNVVI+KS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +L DKFENMGAQMV+EVASKTND AGDGTTTAT+LAQAIV+EG KYV AG+NPMD+KRGI
Sbjct  61   ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A +   + +I+ AKKV  SDE+AQVGTISANGDKEIG MIA AMQKVGNEGVITVEEA
Sbjct  121  DLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETELDVVEGMQFDRGYLSPYFITN +KM  ELE+P IL+HEKK
Sbjct  181  KTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDPYILIHEKK  226


>ref|ZP_01016168.1|  putative heat shock protein groEL [Parvularcula bermudensis HTCC2503]
 gb|EAQ16679.1|  putative heat shock protein groEL [Parvularcula bermudensis HTCC2503]
Length=547

 Score =  357 bits (916),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/226 (77%), Positives = 201/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K V+F+++AR  ML+GVDILAN VK TLGPKGRNVVI+KS+GAPRTTKDGV+VAKEI
Sbjct  1    MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQ++KEVASKTNDEAGDGTTTAT+LAQAIV+EG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D AV +V E++ S+A  V  S  I QVGTISANG+KEIG MIAKAM+KVGNEGVITVEE+
Sbjct  121  DLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEES  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETELDVVEGMQFDRGYLSPYFITN +KMTTELE+P ILLHEKK
Sbjct  181  KTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILLHEKK  226




b) analyse BLAST of Translation of ORF number 2 in reading frame 1 on the direct strand - database: swissprot

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q4FPA5.1|CH60_PELUB  RecName: Full=60 kDa chaperonin; AltNa...   422    8e-118 Gene info
sp|B1LVA0.1|CH60_METRJ  RecName: Full=60 kDa chaperonin; AltNa...   357    3e-98  Gene info
sp|A8LJP9.1|CH60_DINSH  RecName: Full=60 kDa chaperonin; AltNa...   357    4e-98  Gene info
sp|Q16C40.1|CH601_ROSDO  RecName: Full=60 kDa chaperonin 1; Al...   353    3e-97  Gene info
sp|Q162U5.1|CH602_ROSDO  RecName: Full=60 kDa chaperonin 2; Al...   353    5e-97  Gene info
sp|Q1GJ36.1|CH60_SILST  RecName: Full=60 kDa chaperonin; AltNa...   353    6e-97  Gene info
sp|Q28LY7.1|CH60_JANSC  RecName: Full=60 kDa chaperonin; AltNa...   353    6e-97  Gene info
sp|Q98IH9.1|CH602_RHILO  RecName: Full=60 kDa chaperonin 2; Al...   352    1e-96 
sp|Q11DQ8.1|CH602_MESSB  RecName: Full=60 kDa chaperonin 2; Al...   352    1e-96  Gene info
sp|Q5LV15.1|CH60_SILPO  RecName: Full=60 kDa chaperonin; AltNa...   351    2e-96 
sp|B1ZAU5.1|CH60_METPB  RecName: Full=60 kDa chaperonin; AltNa...   351    2e-96  Gene info
sp|A4YRI5.1|CH601_BRASO  RecName: Full=60 kDa chaperonin 1; Al...   351    2e-96  Gene info
sp|Q11LG4.1|CH601_MESSB  RecName: Full=60 kDa chaperonin 1; Al...   350    4e-96  Gene info
sp|B6IU98.1|CH60_RHOCS  RecName: Full=60 kDa chaperonin; AltNa...   350    5e-96  Gene info
sp|A5EG60.1|CH603_BRASB  RecName: Full=60 kDa chaperonin 3; Al...   349    7e-96  Gene info
sp|Q2KAU2.1|CH602_RHIEC  RecName: Full=60 kDa chaperonin 2; Al...   349    9e-96  Gene info
sp|Q2JYW6.1|CH604_RHIEC  RecName: Full=60 kDa chaperonin 4; Al...   349    1e-95  Gene info
sp|A3PID0.1|CH60_RHOS1  RecName: Full=60 kDa chaperonin; AltNa...   348    1e-95  Gene info
sp|O33964.1|CH60_BARQU  RecName: Full=60 kDa chaperonin; AltNa...   348    1e-95 
sp|Q2RWV4.1|CH602_RHORT  RecName: Full=60 kDa chaperonin 2; Al...   348    1e-95  Gene info
sp|Q9L691.1|CH602_RHILE  RecName: Full=60 kDa chaperonin 2; Al...   348    1e-95 
sp|Q93MH1.1|CH60_RHOPA  RecName: Full=60 kDa chaperonin; AltNa...   348    2e-95 
sp|P20110.4|CH601_RHOSH  RecName: Full=60 kDa chaperonin 1; Al...   348    2e-95 
sp|Q6W1D5.1|CH602_RHISN  RecName: Full=60 kDa chaperonin 2; Al...   348    2e-95  Gene info
sp|Q983S4.1|CH604_RHILO  RecName: Full=60 kDa chaperonin 4; Al...   348    2e-95 
sp|Q9Z462.2|CH60_PARDE  RecName: Full=60 kDa chaperonin; AltNa...   347    2e-95 
sp|B8H163.1|CH60_CAUCN  RecName: Full=60 kDa chaperonin; AltNa...   347    3e-95 
sp|Q981J9.1|CH605_RHILO  RecName: Full=60 kDa chaperonin 5; Al...   347    4e-95 
sp|P35471.2|CH605_RHIME  RecName: Full=60 kDa chaperonin 5; Al...   347    5e-95 
sp|A9IY10.1|CH60_BART1  RecName: Full=60 kDa chaperonin; AltNa...   346    5e-95  Gene info
sp|Q92ZQ4.1|CH604_RHIME  RecName: Full=60 kDa chaperonin 4; Al...   346    5e-95 
sp|O33963.1|CH60_BARHE  RecName: Full=60 kDa chaperonin; AltNa...   346    6e-95 
sp|B0SXR2.1|CH60_CAUSK  RecName: Full=60 kDa chaperonin; AltNa...   346    7e-95  Gene info
sp|P35469.2|CH601_RHIME  RecName: Full=60 kDa chaperonin 1; Al...   345    1e-94 
sp|A6U901.1|CH603_SINMW  RecName: Full=60 kDa chaperonin 3; Al...   345    1e-94  Gene info
sp|B2ICU4.1|CH60_BEII9  RecName: Full=60 kDa chaperonin; AltNa...   345    1e-94  Gene info
sp|A6U6I5.1|CH601_SINMW  RecName: Full=60 kDa chaperonin 1; Al...   345    2e-94  Gene info
sp|Q5FPQ6.1|CH60_GLUOX  RecName: Full=60 kDa chaperonin; AltNa...   345    2e-94 
sp|Q0BQ24.1|CH60_GRABC  RecName: Full=60 kDa chaperonin; AltNa...   344    2e-94  Gene info
sp|Q98AX9.1|CH603_RHILO  RecName: Full=60 kDa chaperonin 3; Al...   344    2e-94 
sp|Q1M3H2.1|CH603_RHIL3  RecName: Full=60 kDa chaperonin 3; Al...   344    2e-94  Gene info
sp|Q89IK8.1|CH606_BRAJA  RecName: Full=60 kDa chaperonin 6; Al...   343    4e-94 
sp|A5EM76.1|CH604_BRASB  RecName: Full=60 kDa chaperonin 4; Al...   343    4e-94  Gene info
sp|Q3SQS3.1|CH601_NITWN  RecName: Full=60 kDa chaperonin 1; Al...   343    4e-94  Gene info
sp|A4YS25.1|CH602_BRASO  RecName: Full=60 kDa chaperonin 2; Al...   343    4e-94  Gene info
sp|Q89DA6.1|CH607_BRAJA  RecName: Full=60 kDa chaperonin 7; Al...   342    8e-94 
sp|Q2RY28.1|CH601_RHORT  RecName: Full=60 kDa chaperonin 1; Al...   342    8e-94  Gene info
sp|A8I5R5.1|CH602_AZOC5  RecName: Full=60 kDa chaperonin 2; Al...   342    9e-94  Gene info
sp|A6UM48.1|CH605_SINMW  RecName: Full=60 kDa chaperonin 5; Al...   342    1e-93  Gene info
sp|Q6W163.1|CH601_RHISN  RecName: Full=60 kDa chaperonin 1; Al...   342    2e-93  Gene info
sp|Q1QK71.1|CH602_NITHX  RecName: Full=60 kDa chaperonin 2; Al...   341    2e-93  Gene info
sp|B8ER20.1|CH60_METSB  RecName: Full=60 kDa chaperonin; AltNa...   341    3e-93 
sp|A9HK37.1|CH601_GLUDA  RecName: Full=60 kDa chaperonin 1; Al...   340    3e-93  Gene info
sp|Q8GBD2.2|CH60_ACEP3  RecName: Full=60 kDa chaperonin; AltNa...   340    3e-93 
sp|Q0AS40.1|CH60_MARMM  RecName: Full=60 kDa chaperonin; AltNa...   340    4e-93  Gene info
sp|A8ILV4.1|CH601_AZOC5  RecName: Full=60 kDa chaperonin 1; Al...   340    4e-93  Gene info
sp|Q1MKX4.1|CH601_RHIL3  RecName: Full=60 kDa chaperonin 1; Al...   340    4e-93  Gene info
sp|B5ZRD6.1|CH60_RHILW  RecName: Full=60 kDa chaperonin; AltNa...   340    4e-93  Gene info
sp|P95678.1|CH60_RHOCA  RecName: Full=60 kDa chaperonin; AltNa...   340    5e-93 
sp|A5G1G2.1|CH60_ACICJ  RecName: Full=60 kDa chaperonin; AltNa...   340    6e-93  Gene info
sp|A4Z0U1.1|CH603_BRASO  RecName: Full=60 kDa chaperonin 3; Al...   340    6e-93  Gene info
sp|P60365.1|CH602_RHOPA  RecName: Full=60 kDa chaperonin 2; Al...   339    6e-93 
sp|P60364.1|CH601_RHOPA  RecName: Full=60 kDa chaperonin 1; Al...   339    8e-93 
sp|A5ECI7.1|CH601_BRASB  RecName: Full=60 kDa chaperonin 1; Al...   339    8e-93  Gene info
sp|P30779.2|CH60_AGRT5  RecName: Full=60 kDa chaperonin; AltNa...   339    1e-92  Gene info
sp|P34939.1|CH60_RHILV  RecName: Full=60 kDa chaperonin; AltNa...   338    2e-92 
sp|Q2KBZ7.1|CH601_RHIEC  RecName: Full=60 kDa chaperonin 1; Al...   338    2e-92  Gene info
sp|Q2N5R9.1|CH602_ERYLH  RecName: Full=60 kDa chaperonin 2; Al...   338    2e-92  Gene info
sp|Q2WAW8.1|CH60_MAGMM  RecName: Full=60 kDa chaperonin; AltNa...   337    2e-92  Gene info
sp|P77829.3|CH601_BRAJA  RecName: Full=60 kDa chaperonin 1; Al...   337    3e-92 
sp|A5VBQ6.1|CH60_SPHWW  RecName: Full=60 kDa chaperonin; AltNa...   337    4e-92  Gene info
sp|B9K1Y8.1|CH60_AGRVS  RecName: Full=60 kDa chaperonin; AltNa...   337    4e-92 
sp|Q2G2Z4.1|CH60_NOVAD  RecName: Full=60 kDa chaperonin; AltNa...   337    4e-92  Gene info
sp|A6U7N0.1|CH602_SINMW  RecName: Full=60 kDa chaperonin 2; Al...   336    6e-92  Gene info
sp|A1UTX7.1|CH60_BARBK  RecName: Full=60 kDa chaperonin; AltNa...   336    6e-92  Gene info
sp|P35635.2|CH60_BARBA  RecName: Full=60 kDa chaperonin; AltNa...   336    6e-92 
sp|Q1GRD4.1|CH602_SPHAL  RecName: Full=60 kDa chaperonin 2; Al...   336    6e-92 
sp|Q2IZ16.1|CH601_RHOP2  RecName: Full=60 kDa chaperonin 1; Al...   336    7e-92  Gene info
sp|A0L4C9.1|CH60_MAGSM  RecName: Full=60 kDa chaperonin; AltNa...   335    9e-92  Gene info
sp|Q130Z3.1|CH602_RHOPS  RecName: Full=60 kDa chaperonin 2; Al...   335    1e-91  Gene info
sp|Q138M7.1|CH601_RHOPS  RecName: Full=60 kDa chaperonin 1; Al...   335    2e-91  Gene info
sp|Q3SQJ5.1|CH602_NITWN  RecName: Full=60 kDa chaperonin 2; Al...   335    2e-91  Gene info
sp|P35470.2|CH602_RHIME  RecName: Full=60 kDa chaperonin 2; Al...   334    3e-91 
sp|Q2KAR0.1|CH603_RHIEC  RecName: Full=60 kDa chaperonin 3; Al...   334    3e-91  Gene info
sp|Q2NBL8.1|CH601_ERYLH  RecName: Full=60 kDa chaperonin 1; Al...   333    6e-91  Gene info
sp|Q3SPG4.1|CH603_NITWN  RecName: Full=60 kDa chaperonin 3; Al...   333    7e-91  Gene info
sp|Q9L690.1|CH603_RHILE  RecName: Full=60 kDa chaperonin 3; Al...   332    8e-91 
sp|Q1MJF2.1|CH60_RHIL3  RecName: Full=60 kDa chaperonin; AltNa...   332    9e-91  Gene info
sp|P48220.2|CH60_ZYMMO  RecName: Full=60 kDa chaperonin; AltNa...   332    2e-90 
sp|Q1GVZ9.1|CH601_SPHAL  RecName: Full=60 kDa chaperonin 1; Al...   330    6e-90 
sp|A7HQQ0.1|CH60_PARL1  RecName: Full=60 kDa chaperonin; AltNa...   330    6e-90  Gene info
sp|Q20X88.1|CH602_RHOPB  RecName: Full=60 kDa chaperonin 2; Al...   330    6e-90  Gene info
sp|Q07TB7.1|CH601_RHOP5  RecName: Full=60 kDa chaperonin 1; Al...   329    1e-89  Gene info
sp|A6UH06.1|CH604_SINMW  RecName: Full=60 kDa chaperonin 4; Al...   328    2e-89  Gene info
sp|Q98IV5.1|CH601_RHILO  RecName: Full=60 kDa chaperonin 1; Al...   328    2e-89 
sp|Q930Y0.1|CH603_RHIME  RecName: Full=60 kDa chaperonin 3; Al...   327    4e-89 
sp|A1SXK4.1|CH602_PSYIN  RecName: Full=60 kDa chaperonin 2; Al...   326    7e-89  Gene info
sp|A1ST72.1|CH601_PSYIN  RecName: Full=60 kDa chaperonin 1; Al...   325    1e-88  Gene info
sp|A1AST1.1|CH60_PELPD  RecName: Full=60 kDa chaperonin; AltNa...   324    3e-88  Gene info
sp|A5EET6.1|CH602_BRASB  RecName: Full=60 kDa chaperonin 2; Al...   323    5e-88  Gene info
sp|Q0C0T0.1|CH60_HYPNA  RecName: Full=60 kDa chaperonin; AltNa...   322    1e-87  Gene info
sp|B7J561.1|CH60_ACIF2  RecName: Full=60 kDa chaperonin; AltNa...   322    1e-87  Gene info
sp|B9LZ35.1|CH60_GEOSF  RecName: Full=60 kDa chaperonin; AltNa...   321    2e-87 
sp|C5BP08.1|CH60_TERTT  RecName: Full=60 kDa chaperonin; AltNa...   321    2e-87 
sp|Q21MD3.1|CH60_SACD2  RecName: Full=60 kDa chaperonin; AltNa...   321    2e-87  Gene info
sp|Q2LTG7.1|CH602_SYNAS  RecName: Full=60 kDa chaperonin 2; Al...   321    2e-87  Gene info
sp|Q2IV30.1|CH602_RHOP2  RecName: Full=60 kDa chaperonin 2; Al...   321    2e-87  Gene info
sp|Q747C7.1|CH60_GEOSL  RecName: Full=60 kDa chaperonin; AltNa...   321    2e-87 
sp|A6X3D0.1|CH60_OCHA4  RecName: Full=60 kDa chaperonin; AltNa...   320    3e-87  Gene info
sp|Q8FX87.1|CH60_BRUSU  RecName: Full=60 kDa chaperonin; AltNa...   320    4e-87 
sp|Q39ZP5.1|CH60_GEOMG  RecName: Full=60 kDa chaperonin; AltNa...   320    5e-87  Gene info
sp|B4S112.1|CH60_ALTMD  RecName: Full=60 kDa chaperonin; AltNa...   320    6e-87  Gene info
sp|Q6MRI1.1|CH60_BDEBA  RecName: Full=60 kDa chaperonin; AltNa...   320    6e-87 
sp|A9HPH6.1|CH602_GLUDA  RecName: Full=60 kDa chaperonin 2; Al...   319    7e-87  Gene info
sp|Q30YH6.1|CH60_DESDG  RecName: Full=60 kDa chaperonin; AltNa...   319    1e-86  Gene info
sp|Q19NJ4.1|CH602_ECOK1  RecName: Full=60 kDa chaperonin 2; Al...   319    1e-86  Gene info
sp|Q2LU42.1|CH603_SYNAS  RecName: Full=60 kDa chaperonin 3; Al...   318    1e-86  Gene info
sp|Q2YIJ3.1|CH60_BRUA2  RecName: Full=60 kDa chaperonin; AltNa...   318    1e-86  Gene info
sp|A5VTU1.1|CH60_BRUO2  RecName: Full=60 kDa chaperonin; AltNa...   318    1e-86  Gene info
sp|A5G9I2.1|CH60_GEOUR  RecName: Full=60 kDa chaperonin; AltNa...   318    1e-86  Gene info
sp|Q8YB53.1|CH60_BRUME  RecName: Full=60 kDa chaperonin; AltNa...   318    1e-86 
sp|Q212H2.1|CH601_RHOPB  RecName: Full=60 kDa chaperonin 1; Al...   318    2e-86  Gene info
sp|C4XGI2.1|CH60_DESMR  RecName: Full=60 kDa chaperonin; AltNa...   318    2e-86  Gene info
sp|Q8RIT7.1|CH60_XANCH  RecName: Full=60 kDa chaperonin; AltNa...   318    2e-86 
sp|A7HGP8.1|CH602_ANADF  RecName: Full=60 kDa chaperonin 2; Al...   317    3e-86  Gene info
sp|Q07PA9.1|CH602_RHOP5  RecName: Full=60 kDa chaperonin 2; Al...   317    3e-86  Gene info
sp|B5E9Y2.1|CH60_GEOBB  RecName: Full=60 kDa chaperonin; AltNa...   317    4e-86  Gene info
sp|Q8PD23.1|CH60_XANCP  RecName: Full=60 kDa chaperonin; AltNa...   317    4e-86 
sp|Q1D2S1.1|CH602_MYXXD  RecName: Full=60 kDa chaperonin 2; Al...   317    5e-86  Gene info
sp|Q2IFK0.1|CH602_ANADE  RecName: Full=60 kDa chaperonin 2; Al...   317    5e-86  Gene info
sp|B0RN52.1|CH60_XANCB  RecName: Full=60 kDa chaperonin; AltNa...   316    6e-86  Gene info
sp|C6DY43.1|CH60_GEOSM  RecName: Full=60 kDa chaperonin; AltNa...   316    7e-86 
sp|Q1QP32.1|CH601_NITHX  RecName: Full=60 kDa chaperonin 1; Al...   316    7e-86  Gene info
sp|Q1MQP8.1|CH60_LAWIP  RecName: Full=60 kDa chaperonin; AltNa...   315    1e-85  Gene info
sp|P35861.2|CH602_BRAJA  RecName: Full=60 kDa chaperonin 2; Al...   315    1e-85 
sp|Q3BY61.1|CH60_XANC5  RecName: Full=60 kDa chaperonin; AltNa...   315    1e-85  Gene info
sp|Q5GUT1.1|CH60_XANOR  RecName: Full=60 kDa chaperonin; AltNa...   315    1e-85 
sp|Q8PPZ1.1|CH60_XANAC  RecName: Full=60 kDa chaperonin; AltNa...   315    1e-85 
sp|Q72AL6.1|CH60_DESVH  RecName: Full=60 kDa chaperonin; AltNa...   315    1e-85  Gene info
sp|Q8GBB4.1|CH60_AZOVI  RecName: Full=60 kDa chaperonin; AltNa...   315    2e-85 
sp|A9NA82.1|CH60_COXBR  RecName: Full=60 kDa chaperonin; AltNa...   314    3e-85  Gene info
sp|P19421.1|CH60_COXBU  RecName: Full=60 kDa chaperonin; AltNa...   314    3e-85 
sp|Q8KM30.1|CH60_OLEAN  RecName: Full=60 kDa chaperonin; AltNa...   314    3e-85 
sp|B8DJC4.1|CH60_DESVM  RecName: Full=60 kDa chaperonin; AltNa...   313    4e-85  Gene info
sp|Q607Q3.1|CH602_METCA  RecName: Full=60 kDa chaperonin 2; Al...   313    4e-85 
sp|Q2SDG0.1|CH60_HAHCH  RecName: Full=60 kDa chaperonin; AltNa...   313    5e-85  Gene info
sp|Q0VRW6.1|CH60_ALCBS  RecName: Full=60 kDa chaperonin; AltNa...   313    5e-85  Gene info
sp|Q8CWJ0.1|CH602_VIBVU  RecName: Full=60 kDa chaperonin 2; Al...   312    8e-85 
sp|A0M7D9.1|CH60_GRAFK  RecName: Full=60 kDa chaperonin; AltNa...   312    9e-85  Gene info
sp|A9M0Q6.1|CH60_NEIM0  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84  Gene info
sp|P94798.2|CH60_FRATH  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84 
sp|B8J123.1|CH60_DESDA  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84 
sp|B8F865.1|CH60_HAEPS  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84 
sp|B4SKL8.1|CH60_STRM5  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84  Gene info
sp|P35862.2|CH603_BRAJA  RecName: Full=60 kDa chaperonin 3; Al...   311    2e-84 
sp|Q60AY0.1|CH601_METCA  RecName: Full=60 kDa chaperonin 1; Al...   311    2e-84 
sp|Q2Y6I6.1|CH60_NITMU  RecName: Full=60 kDa chaperonin; AltNa...   311    2e-84  Gene info
sp|A5EX17.1|CH60_DICNV  RecName: Full=60 kDa chaperonin; AltNa...   311    3e-84  Gene info
sp|B4RRA1.1|CH60_NEIG2  RecName: Full=60 kDa chaperonin; AltNa...   311    3e-84  Gene info
sp|Q15PD3.1|CH60_PSEA6  RecName: Full=60 kDa chaperonin; AltNa...   311    3e-84  Gene info
sp|Q5QVT4.1|CH60_IDILO  RecName: Full=60 kDa chaperonin; AltNa...   311    3e-84 
sp|Q12FH7.1|CH60_POLSJ  RecName: Full=60 kDa chaperonin; AltNa...   311    3e-84  Gene info
sp|A9GB11.1|CH601_SORC5  RecName: Full=60 kDa chaperonin 1; Al...   311    3e-84  Gene info
sp|Q1QIL6.1|CH603_NITHX  RecName: Full=60 kDa chaperonin 3; Al...   310    3e-84  Gene info
sp|Q5F541.1|CH60_NEIG1  RecName: Full=60 kDa chaperonin; AltNa...   310    3e-84  Gene info
sp|B2FIU9.1|CH60_STRMK  RecName: Full=60 kDa chaperonin; AltNa...   310    3e-84  Gene info
sp|P57006.1|CH60_NEIMA  RecName: Full=60 kDa chaperonin; AltNa...   310    3e-84 
sp|A2SCV1.1|CH60_METPP  RecName: Full=60 kDa chaperonin; AltNa...   310    3e-84  Gene info
sp|A1VJZ8.1|CH602_POLNA  RecName: Full=60 kDa chaperonin 2; Al...   310    4e-84  Gene info
sp|Q7NQX1.1|CH602_CHRVO  RecName: Full=60 kDa chaperonin 2; Al...   310    4e-84 
sp|A6H125.1|CH60_FLAPJ  RecName: Full=60 kDa chaperonin; AltNa...   310    4e-84  Gene info
sp|Q2IKI2.1|CH601_ANADE  RecName: Full=60 kDa chaperonin 1; Al...   310    5e-84  Gene info
sp|Q9L7P5.2|CH601_VIBPA  RecName: Full=60 kDa chaperonin 1; Al...   310    5e-84 
sp|P42385.2|CH60_NEIMB  RecName: Full=60 kDa chaperonin; AltNa...   310    5e-84 
sp|Q5P7G2.1|CH60_AZOSE  RecName: Full=60 kDa chaperonin; AltNa...   310    5e-84  Gene info
sp|B0TX65.1|CH60_FRAP2  RecName: Full=60 kDa chaperonin; AltNa...   310    5e-84  Gene info
sp|A4IWC4.1|CH60_FRATW  RecName: Full=60 kDa chaperonin; AltNa...   310    5e-84  Gene info
sp|A7MX54.1|CH60_VIBHB  RecName: Full=60 kDa chaperonin; AltNa...   310    6e-84  Gene info
sp|A0Q838.1|CH60_FRATN  RecName: Full=60 kDa chaperonin; AltNa...   310    6e-84  Gene info
sp|C4K477.1|CH60_HAMD5  RecName: Full=60 kDa chaperonin; AltNa...   310    6e-84 
sp|B8GL19.1|CH60_THISH  RecName: Full=60 kDa chaperonin; AltNa...   309    7e-84 
sp|P46398.3|CH60_ACTAC  RecName: Full=60 kDa chaperonin; AltNa...   309    7e-84 
sp|B3PLM6.1|CH60_CELJU  RecName: Full=60 kDa chaperonin; AltNa...   309    8e-84  Gene info
sp|Q21ZD1.1|CH601_RHOFD  RecName: Full=60 kDa chaperonin 1; Al...   309    9e-84  Gene info
sp|Q3IW60.1|CH602_RHOS4  RecName: Full=60 kDa chaperonin 2; Al...   309    1e-83  Gene info
sp|Q1QVJ7.1|CH60_CHRSD  RecName: Full=60 kDa chaperonin; AltNa...   309    1e-83  Gene info
sp|B4EXE2.1|CH60_PROMH  RecName: Full=60 kDa chaperonin; AltNa...   309    1e-83  Gene info
sp|A1WL05.1|CH60_VEREI  RecName: Full=60 kDa chaperonin; AltNa...   308    1e-83  Gene info
sp|Q13ZW7.1|CH602_BURXL  RecName: Full=60 kDa chaperonin 2; Al...   308    1e-83  Gene info
sp|A9BXL3.1|CH60_DELAS  RecName: Full=60 kDa chaperonin; AltNa...   308    1e-83  Gene info
sp|B3H1P4.1|CH60_ACTP7  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|Q87JG6.1|CH602_VIBPA  RecName: Full=60 kDa chaperonin 2; Al...   308    2e-83 
sp|P94166.3|CH60_ACTPL  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|A6TH53.1|CH60_KLEP7  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|Q6F8P6.1|CH60_ACIAD  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|B9MDC5.1|CH60_DIAST  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|O66198.1|CH60_ENTAE  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|P48215.1|CH60_NEIFL  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|B2SFF8.1|CH60_FRATM  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|C6DKC7.1|CH60_PECCP  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|B5Y368.1|CH60_KLEP3  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|B2HXB6.1|CH60_ACIBC  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|B0VSP5.1|CH60_ACIBS  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|B7GY36.1|CH60_ACIB3  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|A5CWP6.1|CH60_VESOH  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|A3N120.1|CH60_ACTP2  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|C5BDK5.1|CH60_EDWI9  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|Q5NEE1.1|CH60_FRATT  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83 
sp|Q1LSP5.1|CH60_BAUCH  RecName: Full=60 kDa chaperonin; AltNa...   308    2e-83  Gene info
sp|O66220.1|CH60_PECCC  RecName: Full=60 kDa chaperonin; AltNa...   307    3e-83 
sp|A5UH48.1|CH60_HAEIG  RecName: Full=60 kDa chaperonin; AltNa...   307    3e-83  Gene info
sp|P29842.3|CH60_NEIGO  RecName: Full=60 kDa chaperonin; AltNa...   307    3e-83 
sp|A5F4Y1.1|CH602_VIBC3  RecName: Full=60 kDa chaperonin 2; Al...   307    3e-83  Gene info
sp|Q9XAU7.2|CH60_PSEHT  RecName: Full=60 kDa chaperonin; AltNa...   307    3e-83  Gene info
sp|B1XXY9.1|CH60_LEPCP  RecName: Full=60 kDa chaperonin; AltNa...   307    3e-83  Gene info
sp|A7MMC0.1|CH60_ENTS8  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|Q93GT8.2|CH60_COLMA  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83 
sp|Q3A0V2.1|CH60_PELCD  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|Q9KNR7.1|CH601_VIBCH  RecName: Full=60 kDa chaperonin 1; Al...   307    4e-83 
sp|Q0I284.1|CH60_HAES1  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|A6VM38.1|CH60_ACTSZ  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|Q3AR09.1|CH60_CHLCH  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|C5CPP8.1|CH60_VARPS  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83 
sp|A1K436.1|CH601_AZOSB  RecName: Full=60 kDa chaperonin 1; Al...   307    4e-83  Gene info
sp|A6VWY0.1|CH60_MARMS  RecName: Full=60 kDa chaperonin; AltNa...   307    4e-83  Gene info
sp|Q65VE4.1|CH60_MANSM  RecName: Full=60 kDa chaperonin; AltNa...   306    4e-83  Gene info
sp|A3QA46.1|CH60_SHELP  RecName: Full=60 kDa chaperonin; AltNa...   306    4e-83  Gene info
sp|Q87BC0.1|CH60_XYLFT  RecName: Full=60 kDa chaperonin; AltNa...   306    4e-83  Gene info
sp|O66202.1|CH60_SERRU  RecName: Full=60 kDa chaperonin; AltNa...   306    5e-83 
sp|Q9PFP2.1|CH60_XYLFA  RecName: Full=60 kDa chaperonin; AltNa...   306    5e-83 
sp|O66200.1|CH60_ENTAG  RecName: Full=60 kDa chaperonin; AltNa...   306    5e-83 
sp|Q7MAZ7.1|CH60_PHOLL  RecName: Full=60 kDa chaperonin; AltNa...   306    5e-83 
sp|A4VP82.1|CH60_PSEU5  RecName: Full=60 kDa chaperonin; AltNa...   306    6e-83  Gene info
sp|Q9ANR9.1|CH60_WIGBR  RecName: Full=60 kDa chaperonin; AltNa...   306    6e-83  Gene info
sp|A9GBQ2.1|CH602_SORC5  RecName: Full=60 kDa chaperonin 2; Al...   306    6e-83  Gene info
sp|A1AWK7.1|CH60_RUTMC  RecName: Full=60 kDa chaperonin; AltNa...   306    6e-83  Gene info
sp|Q4QN05.1|CH60_HAEI8  RecName: Full=60 kDa chaperonin; AltNa...   306    6e-83  Gene info
sp|Q83WI8.1|CH601_VIBHA  RecName: Full=60 kDa chaperonin 1; Al...   306    6e-83 
sp|Q8KIX2.1|CH60_BUCTS  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83 
sp|O66214.1|CH60_KLEOR  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83 
sp|O66210.1|CH60_KLEOX  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83 
sp|Q2LPJ8.1|CH601_SYNAS  RecName: Full=60 kDa chaperonin 1; Al...   306    7e-83  Gene info
sp|O66190.1|CH60_ENTAS  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83 
sp|A5U9V2.1|CH60_HAEIE  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83  Gene info
sp|B0U418.1|CH60_XYLFM  RecName: Full=60 kDa chaperonin; AltNa...   306    7e-83  Gene info
sp|O33500.1|CH60_PSEST  RecName: Full=60 kDa chaperonin; AltNa...   306    8e-83 
sp|O66206.1|CH60_SERMA  RecName: Full=60 kDa chaperonin; AltNa...   306    9e-83 
sp|B0KFQ2.1|CH60_PSEPG  RecName: Full=60 kDa chaperonin; AltNa...   306    9e-83  Gene info
sp|B1KIR6.1|CH60_SHEWM  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|O66204.1|CH60_SERFI  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82 
sp|A1W3W8.1|CH60_ACISJ  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|A5FIV1.1|CH60_FLAJO  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|A1SAC0.1|CH60_SHEAM  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|Q8KIX4.1|CH60_BUCPP  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82 
sp|Q0T9P8.1|CH60_ECOL5  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|A8Z640.1|CH60_SULMW  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|P48219.1|CH60_YEREN  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82 
sp|Q493W7.1|CH60_BLOPB  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82 
sp|A1JIP3.1|CH60_YERE8  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|P0A6F5.2|CH60_ECOLI  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82 
sp|A4W5N8.1|CH60_ENT38  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|Q7U348.1|CH60_BLOFL  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|A6T1E5.1|CH60_JANMA  RecName: Full=60 kDa chaperonin; AltNa...   305    1e-82  Gene info
sp|Q8KIX0.1|CH60_BUCCM  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|A8G8S7.1|CH60_SERP5  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82  Gene info
sp|Q1C0Y0.1|CH60_YERPA  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82  Gene info
sp|Q8ZIY3.1|CH60_YERPE  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|O66218.1|CH60_PANAN  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|O66196.1|CH60_ENTAM  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|A8H8W3.1|CH60_SHEPA  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82  Gene info
sp|Q9ZFE0.1|CH60_BURCE  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|Q93N34.1|CH60_BUCRP  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|P58723.1|CH60_BURTH  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|P31294.2|CH60_HAEDU  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|A6VB57.1|CH60_PSEA7  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82  Gene info
sp|P30718.3|CH60_PSEAE  RecName: Full=60 kDa chaperonin; AltNa...   305    2e-82 
sp|Q9ZFD8.1|CH60_BURVI  RecName: Full=60 kDa chaperonin; AltNa...   304    2e-82 
sp|Q1BYL5.1|CH601_BURCA  RecName: Full=60 kDa chaperonin 1; Al...   304    2e-82  Gene info
sp|A0LEH2.1|CH601_SYNFM  RecName: Full=60 kDa chaperonin 1; Al...   304    2e-82  Gene info
sp|P43733.1|CH60_HAEIN  RecName: Full=60 kDa chaperonin; AltNa...   304    2e-82 
sp|B8D6T6.1|CH60_BUCAT  RecName: Full=60 kDa chaperonin; AltNa...   304    2e-82 
sp|P25750.1|CH60_BUCAI  RecName: Full=60 kDa chaperonin; AltNa...   304    2e-82 
sp|Q59687.2|CH60_PASMU  RecName: Full=60 kDa chaperonin; AltNa...   304    2e-82 
sp|Q9ALA9.2|CH601_VIBVU  RecName: Full=60 kDa chaperonin 1; Al...   304    3e-82 
sp|O66192.1|CH60_ENTIT  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|Q144Q6.1|CH601_BURXL  RecName: Full=60 kDa chaperonin 1; Al...   304    3e-82  Gene info
sp|Q9F712.2|CH601_BURPS  RecName: Full=60 kDa chaperonin 1; Al...   304    3e-82 
sp|B2VL84.1|CH60_ERWT9  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|Q59177.3|CH60_BUCAP  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|Q3JPF6.1|CH601_BURP1  RecName: Full=60 kDa chaperonin 1; Al...   304    3e-82  Gene info
sp|Q62I82.1|CH60_BURMA  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|O66212.1|CH60_KLEPL  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|A8FQY1.1|CH60_SHESH  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82  Gene info
sp|A9MFR9.1|CH60_SALAR  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82  Gene info
sp|O51832.1|CH60_BUCMP  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|P0C193.1|CH60_SODGL  RecName: Full=60 kDa chaperonin; AltNa...   304    3e-82 
sp|Q2NW94.1|CH60_SODGM  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B5R991.1|CH60_SALG2  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B3E8G0.1|CH60_GEOLS  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B0TVL3.1|CH60_SHEHH  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B5F2L0.1|CH60_SALA4  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|P0A1D3.2|CH60_SALTY  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82 
sp|A8AMQ6.1|CH60_CITK8  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B3QSM9.1|CH60_CHLT3  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|Q47IZ8.1|CH60_DECAR  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|Q6D9J0.1|CH60_ERWCT  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82 
sp|B1J3K5.1|CH60_PSEPW  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|A1TKQ5.1|CH60_ACIAC  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|B2UKV8.1|CH60_AKKM8  RecName: Full=60 kDa chaperonin; AltNa...   303    4e-82  Gene info
sp|Q8KIX1.1|CH60_BUCTT  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82 
sp|Q3B5F5.1|CH60_PELLD  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82  Gene info
sp|Q4K764.1|CH60_PSEF5  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82  Gene info
sp|B2T0I0.1|CH60_BURPP  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82  Gene info
sp|Q9XCA9.1|CH60_RHOMR  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82 
sp|P95647.1|CH602_RHOSH  RecName: Full=60 kDa chaperonin 2; Al...   303    5e-82 
sp|A1K828.1|CH602_AZOSB  RecName: Full=60 kDa chaperonin 2; Al...   303    5e-82  Gene info
sp|Q0ACQ9.1|CH60_ALHEH  RecName: Full=60 kDa chaperonin; AltNa...   303    5e-82  Gene info
sp|B3QPB5.1|CH60_CHLP8  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82  Gene info
sp|A5W8M6.1|CH60_PSEP1  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82  Gene info
sp|A7HAD3.1|CH601_ANADF  RecName: Full=60 kDa chaperonin 1; Al...   303    6e-82  Gene info
sp|A4XYM0.1|CH60_PSEMY  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82  Gene info
sp|Q3SMK1.1|CH60_THIDA  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82  Gene info
sp|O66222.1|CH60_ERWAP  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82 
sp|B2JFE0.1|CH60_BURP8  RecName: Full=60 kDa chaperonin; AltNa...   303    6e-82  Gene info
sp|Q88N55.1|CH60_PSEPK  RecName: Full=60 kDa chaperonin; AltNa...   303    7e-82  Gene info
sp|A0L170.1|CH60_SHESA  RecName: Full=60 kDa chaperonin; AltNa...   303    7e-82  Gene info
sp|B4SEN1.1|CH60_PELPB  RecName: Full=60 kDa chaperonin; AltNa...   303    7e-82  Gene info
sp|Q1D3Y5.1|CH601_MYXXD  RecName: Full=60 kDa chaperonin 1; Al...   303    7e-82  Gene info
sp|O66194.1|CH60_ENTGE  RecName: Full=60 kDa chaperonin; AltNa...   303    8e-82 
sp|Q8CX48.1|CH60_SHEON  RecName: Full=60 kDa chaperonin; AltNa...   303    8e-82 
sp|Q1I5E2.1|CH60_PSEE4  RecName: Full=60 kDa chaperonin; AltNa...   303    8e-82  Gene info
sp|A4G837.1|CH60_HERAR  RecName: Full=60 kDa chaperonin; AltNa...   303    8e-82  Gene info
sp|Q0HEQ4.1|CH60_SHESM  RecName: Full=60 kDa chaperonin; AltNa...   302    8e-82  Gene info
sp|Q8Y1P8.1|CH60_RALSO  RecName: Full=60 kDa chaperonin; AltNa...   302    8e-82 
sp|P48216.3|CH60_PSEPU  RecName: Full=60 kDa chaperonin; AltNa...   302    8e-82 
sp|C3K1A0.1|CH60_PSEFS  RecName: Full=60 kDa chaperonin; AltNa...   302    9e-82  Gene info
sp|Q487Q9.1|CH60_COLP3  RecName: Full=60 kDa chaperonin; AltNa...   302    9e-82  Gene info
sp|A1BHS5.1|CH60_CHLPD  RecName: Full=60 kDa chaperonin; AltNa...   302    1e-81  Gene info
sp|Q1H4F2.1|CH60_METFK  RecName: Full=60 kDa chaperonin; AltNa...   302    1e-81  Gene info
sp|Q5E8E6.1|CH60_VIBF1  RecName: Full=60 kDa chaperonin; AltNa...   302    1e-81  Gene info
sp|Q39J12.1|CH602_BURS3  RecName: Full=60 kDa chaperonin 2; Al...   302    1e-81  Gene info
sp|Q0BHT1.1|CH601_BURCM  RecName: Full=60 kDa chaperonin 1; Al...   302    1e-81  Gene info
sp|Q93N35.1|CH60_BUCRM  RecName: Full=60 kDa chaperonin; AltNa...   302    1e-81 
sp|B8CID3.1|CH60_SHEPW  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81  Gene info
sp|B3EGF4.1|CH60_CHLL2  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81  Gene info
sp|Q0B1N7.1|CH603_BURCM  RecName: Full=60 kDa chaperonin 3; Al...   301    2e-81  Gene info
sp|B3ENV7.1|CH60_CHLPB  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81  Gene info
sp|Q8KF02.1|CH60_CHLTE  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81 
sp|Q9KLC6.1|CH602_VIBCH  RecName: Full=60 kDa chaperonin 2; Al...   301    2e-81 
sp|A4Y398.1|CH60_SHEPC  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81  Gene info
sp|C4LCA2.1|CH60_TOLAT  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81 
sp|P31293.1|CH60_CHRVI  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81 
sp|P59526.1|CH60_BUCBP  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81 
sp|B4S6H2.1|CH60_PROA2  RecName: Full=60 kDa chaperonin; AltNa...   301    2e-81  Gene info
sp|A1RNN6.1|CH60_SHESW  RecName: Full=60 kDa chaperonin; AltNa...   301    3e-81  Gene info
sp|A5WD52.1|CH60_PSYWF  RecName: Full=60 kDa chaperonin; AltNa...   301    3e-81  Gene info
sp|A6WJ17.1|CH60_SHEB8  RecName: Full=60 kDa chaperonin; AltNa...   300    3e-81  Gene info
sp|Q2KXZ3.1|CH60_BORA1  RecName: Full=60 kDa chaperonin; AltNa...   300    3e-81  Gene info
sp|Q8KIX3.1|CH60_BUCTC  RecName: Full=60 kDa chaperonin; AltNa...   300    3e-81 
sp|A9I685.1|CH60_BORPD  RecName: Full=60 kDa chaperonin; AltNa...   300    3e-81  Gene info
sp|A3D8W9.1|CH60_SHEB5  RecName: Full=60 kDa chaperonin; AltNa...   300    4e-81  Gene info
sp|O66026.1|CH60_KLEPN  RecName: Full=60 kDa chaperonin; AltNa...   300    4e-81 
sp|Q12S61.1|CH60_SHEDO  RecName: Full=60 kDa chaperonin; AltNa...   300    4e-81  Gene info
sp|Q7W134.1|CH60_BORPA  RecName: Full=60 kDa chaperonin; AltNa...   300    5e-81 
sp|P48210.1|CH60_BORPE  RecName: Full=60 kDa chaperonin; AltNa...   300    5e-81 
sp|A8EY36.1|CH60_RICCK  RecName: Full=60 kDa chaperonin; AltNa...   300    5e-81  Gene info
sp|Q4FU94.1|CH60_PSYA2  RecName: Full=60 kDa chaperonin; AltNa...   300    6e-81  Gene info
sp|Q11U19.1|CH60_CYTH3  RecName: Full=60 kDa chaperonin; AltNa...   300    7e-81  Gene info
sp|A0KGL1.1|CH60_AERHH  RecName: Full=60 kDa chaperonin; AltNa...   299    8e-81  Gene info
sp|Q07WX7.1|CH60_SHEFN  RecName: Full=60 kDa chaperonin; AltNa...   299    8e-81  Gene info
sp|Q058F3.1|CH60_BUCCC  RecName: Full=60 kDa chaperonin; AltNa...   299    9e-81  Gene info
sp|P42375.2|CH60_PORGI  RecName: Full=60 kDa chaperonin; AltNa...   299    9e-81 
sp|Q1QDC9.1|CH60_PSYCK  RecName: Full=60 kDa chaperonin; AltNa...   299    1e-80  Gene info
sp|B2RKS6.1|CH60_PORG3  RecName: Full=60 kDa chaperonin; AltNa...   299    1e-80  Gene info
sp|A0LKS4.1|CH602_SYNFM  RecName: Full=60 kDa chaperonin 2; Al...   299    1e-80  Gene info
sp|Q6LM06.1|CH60_PHOPR  RecName: Full=60 kDa chaperonin; AltNa...   298    1e-80 
sp|A4JPD1.1|CH602_BURVG  RecName: Full=60 kDa chaperonin 2; Al...   298    1e-80  Gene info
sp|Q3J729.1|CH60_NITOC  RecName: Full=60 kDa chaperonin; AltNa...   298    1e-80  Gene info
sp|Q6ARV6.1|CH60_DESPS  RecName: Full=60 kDa chaperonin; AltNa...   298    2e-80 
sp|P95800.1|CH60_STEMA  RecName: Full=60 kDa chaperonin; AltNa...   298    2e-80 
sp|B3ER92.1|CH60_AMOA5  RecName: Full=60 kDa chaperonin; AltNa...   298    2e-80  Gene info
sp|Q6MBZ5.1|CH602_PARUW  RecName: Full=60 kDa chaperonin 2; Al...   298    3e-80  Gene info
sp|Q3K7L6.1|CH60_PSEPF  RecName: Full=60 kDa chaperonin; AltNa...   297    3e-80  Gene info
sp|Q0KDR7.1|CH60_RALEH  RecName: Full=60 kDa chaperonin; AltNa...   297    3e-80  Gene info
sp|A4SR80.1|CH60_AERS4  RecName: Full=60 kDa chaperonin; AltNa...   297    4e-80  Gene info
sp|O68309.1|CH60_AERSA  RecName: Full=60 kDa chaperonin; AltNa...   297    4e-80 
sp|A6UNR2.1|CH60_METVS  RecName: Full=60 kDa chaperonin; AltNa...   296    5e-80  Gene info
sp|A4SDP9.1|CH60_PROVI  RecName: Full=60 kDa chaperonin; AltNa...   296    5e-80  Gene info
sp|Q7NT31.1|CH601_CHRVO  RecName: Full=60 kDa chaperonin 1; Al...   296    5e-80 
sp|Q31IT1.1|CH60_THICR  RecName: Full=60 kDa chaperonin; AltNa...   296    5e-80  Gene info
sp|B6YQT0.1|CH60_AZOPC  RecName: Full=60 kDa chaperonin; AltNa...   296    6e-80  Gene info
sp|Q4UMF2.1|CH60_RICFE  RecName: Full=60 kDa chaperonin; AltNa...   296    7e-80 
sp|C1A8L8.1|CH60_GEMAT  RecName: Full=60 kDa chaperonin; AltNa...   296    8e-80 
sp|A6QBP8.1|CH60_SULNB  RecName: Full=60 kDa chaperonin; AltNa...   296    8e-80  Gene info
sp|A0AXY5.1|CH602_BURCH  RecName: Full=60 kDa chaperonin 2; Al...   296    9e-80  Gene info
sp|B9KCR7.1|CH60_CAMLR  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79  Gene info
sp|Q9ZCT7.1|CH60_RICPR  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79 
sp|O85754.2|CH60_RICTY  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79 
sp|Q87X14.1|CH60_PSESM  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79 
sp|Q48EI5.1|CH60_PSE14  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79  Gene info
sp|O34198.1|CH60_RICRI  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79 
sp|Q4ZP20.1|CH60_PSEU2  RecName: Full=60 kDa chaperonin; AltNa...   295    1e-79  Gene info
sp|B3R2Y3.1|CH60_CUPTR  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-79  Gene info
sp|Q46XW6.1|CH60_RALEJ  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-79  Gene info
sp|B8E1A9.1|CH60_DICTD  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-79  Gene info
sp|B5YDR9.1|CH60_DICT6  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-79  Gene info
sp|A8GT30.1|CH60_RICRS  RecName: Full=60 kDa chaperonin; AltNa...   295    2e-79  Gene info
sp|Q92H04.1|CH60_RICCN  RecName: Full=60 kDa chaperonin; AltNa...   294    2e-79 
sp|C3PP72.1|CH60_RICAE  RecName: Full=60 kDa chaperonin; AltNa...   294    2e-79 
sp|Q0AJH9.1|CH60_NITEC  RecName: Full=60 kDa chaperonin; AltNa...   294    2e-79  Gene info
sp|Q1LQS4.1|CH60_RALME  RecName: Full=60 kDa chaperonin; AltNa...   294    3e-79  Gene info
sp|A8ERY3.1|CH60_ARCB4  RecName: Full=60 kDa chaperonin; AltNa...   294    4e-79  Gene info
sp|A8GPB6.1|CH60_RICAH  RecName: Full=60 kDa chaperonin; AltNa...   294    4e-79  Gene info
sp|A8F2B5.2|CH60_RICM5  RecName: Full=60 kDa chaperonin; AltNa...   293    5e-79 
sp|A6LIG0.1|CH60_PARD8  RecName: Full=60 kDa chaperonin; AltNa...   293    6e-79  Gene info
sp|A7H2F8.1|CH60_CAMJD  RecName: Full=60 kDa chaperonin; AltNa...   293    7e-79  Gene info
sp|Q1BV70.1|CH602_BURCA  RecName: Full=60 kDa chaperonin 2; Al...   293    7e-79  Gene info
sp|A8FMS6.1|CH60_CAMJ8  RecName: Full=60 kDa chaperonin; AltNa...   293    8e-79  Gene info
sp|Q1RIZ3.1|CH60_RICBR  RecName: Full=60 kDa chaperonin; AltNa...   293    8e-79  Gene info
sp|Q5HTP2.1|CH60_CAMJR  RecName: Full=60 kDa chaperonin; AltNa...   292    9e-79  Gene info
sp|O69289.2|CH60_CAMJE  RecName: Full=60 kDa chaperonin; AltNa...   292    9e-79 
sp|Q9AEP7.1|CH60_LACLM  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78  Gene info
sp|Q391Y9.1|CH601_BURS3  RecName: Full=60 kDa chaperonin 1; Al...   292    1e-78  Gene info
sp|A0RNU3.1|CH60_CAMFF  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78  Gene info
sp|P37282.2|CH60_LACLA  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78 
sp|Q031S8.1|CH60_LACLS  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78  Gene info
sp|B5YJN3.1|CH60_THEYD  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78  Gene info
sp|B1XRX1.1|CH60_POLNS  RecName: Full=60 kDa chaperonin; AltNa...   292    1e-78  Gene info
sp|A8AZE1.1|CH60_STRGC  RecName: Full=60 kDa chaperonin; AltNa...   291    2e-78 
sp|P61439.1|CH60_LEPIN  RecName: Full=60 kDa chaperonin; AltNa...   291    2e-78 
sp|Q8VT58.1|CH60_STRGN  RecName: Full=60 kDa chaperonin; AltNa...   291    2e-78 
sp|Q30SX1.1|CH60_SULDN  RecName: Full=60 kDa chaperonin; AltNa...   291    2e-78  Gene info
sp|Q2S0Q3.1|CH602_SALRD  RecName: Full=60 kDa chaperonin 2; Al...   291    2e-78  Gene info
sp|P81284.3|CH60_BACFO  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78 
sp|Q8KJ20.1|CH60_STRAP  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78 
sp|A4SZV4.1|CH60_POLSQ  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78  Gene info
sp|C4L1L2.1|CH60_EXISA  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78 
sp|Q8KJ18.1|CH60_STRCV  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78 
sp|Q93EU6.2|CH60_ENTFA  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78 
sp|Q04S01.1|CH60_LEPBJ  RecName: Full=60 kDa chaperonin; AltNa...   291    3e-78  Gene info
sp|B7GFR6.1|CH60_ANOFW  RecName: Full=60 kDa chaperonin; AltNa...   290    3e-78  Gene info
sp|Q13NE4.1|CH604_BURXL  RecName: Full=60 kDa chaperonin 4; Al...   290    3e-78  Gene info
sp|Q5L3E6.1|CH60_GEOKA  RecName: Full=60 kDa chaperonin; AltNa...   290    3e-78 
sp|Q9WWL4.1|CH60_METSS  RecName: Full=60 kDa chaperonin; AltNa...   290    3e-78 
sp|A0AKH5.1|CH60_LISW6  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78  Gene info
sp|A7GZ43.1|CH60_CAMC5  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78  Gene info
sp|B8DH59.1|CH60_LISMH  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78 
sp|Q9AGE6.1|CH60_LISMO  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78 
sp|Q8CX00.1|CH60_STRA5  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78 
sp|A4IJV3.1|CH60_GEOTN  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78  Gene info
sp|Q82Y60.1|CH60_NITEU  RecName: Full=60 kDa chaperonin; AltNa...   290    4e-78 
sp|Q929V0.1|CH60_LISIN  RecName: Full=60 kDa chaperonin; AltNa...   290    5e-78 
sp|Q38YR7.1|CH60_LACSS  RecName: Full=60 kDa chaperonin; AltNa...   290    5e-78  Gene info
sp|A7GKG0.1|CH60_BACCN  RecName: Full=60 kDa chaperonin; AltNa...   290    5e-78  Gene info
sp|P61438.1|CH60_LEPIC  RecName: Full=60 kDa chaperonin; AltNa...   290    5e-78 
sp|C5D4F4.1|CH60_GEOSW  RecName: Full=60 kDa chaperonin; AltNa...   290    5e-78 
sp|B7IUT0.1|CH60_BACC2  RecName: Full=60 kDa chaperonin; AltNa...   290    7e-78  Gene info
sp|Q814B0.1|CH60_BACCR  RecName: Full=60 kDa chaperonin; AltNa...   290    7e-78  Gene info
sp|B7H4Q7.1|CH60_BACC4  RecName: Full=60 kDa chaperonin; AltNa...   289    7e-78  Gene info
sp|Q7MAE3.1|CH60_WOLSU  RecName: Full=60 kDa chaperonin; AltNa...   289    8e-78 
sp|Q4MPR6.3|CH60_BACCE  RecName: Full=60 kDa chaperonin; AltNa...   289    8e-78 
sp|Q81VE1.1|CH60_BACAN  RecName: Full=60 kDa chaperonin; AltNa...   289    9e-78 
sp|Q63GV7.1|CH60_BACCZ  RecName: Full=60 kDa chaperonin; AltNa...   289    9e-78  Gene info
sp|Q07201.1|CH60_BACST  RecName: Full=60 kDa chaperonin; AltNa...   289    1e-77 
sp|P31681.2|CH60_CHLPN  RecName: Full=60 kDa chaperonin; AltNa...   289    1e-77 
sp|Q05046.1|CH62_CUCMA  RecName: Full=Chaperonin CPN60-2, mito...   289    1e-77 
sp|Q13IM9.1|CH605_BURXL  RecName: Full=60 kDa chaperonin 5; Al...   289    1e-77  Gene info
sp|Q01RQ2.1|CH60_SOLUE  RecName: Full=60 kDa chaperonin; AltNa...   288    1e-77  Gene info
sp|Q8CX22.1|CH60_STRA3  RecName: Full=60 kDa chaperonin; AltNa...   288    1e-77 
sp|A9VQG8.1|CH60_BACWK  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77  Gene info
sp|B0SCC0.1|CH60_LEPBA  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77  Gene info
sp|A8FAG3.1|CH60_BACP2  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77  Gene info
sp|Q2T3W7.1|CH602_BURTA  RecName: Full=60 kDa chaperonin 2; Al...   288    2e-77  Gene info
sp|Q8R5X7.1|CH60_FUSNN  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77 
sp|Q8VV84.1|CH60_BACTR  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77 
sp|Q2S5Z8.1|CH601_SALRD  RecName: Full=60 kDa chaperonin 1; Al...   288    2e-77  Gene info
sp|Q8CWW6.1|CH60_STRMU  RecName: Full=60 kDa chaperonin; AltNa...   288    2e-77 
sp|A1U292.1|CH60_MARAV  RecName: Full=60 kDa chaperonin; AltNa...   287    3e-77  Gene info
sp|Q8KJ16.1|CH60_STRSA  RecName: Full=60 kDa chaperonin; AltNa...   287    3e-77 
sp|Q0B4V5.1|CH602_BURCM  RecName: Full=60 kDa chaperonin 2; Al...   287    3e-77  Gene info
sp|Q9AME7.1|CH60_STRAG  RecName: Full=60 kDa chaperonin; AltNa...   287    3e-77 
sp|C0M7S3.1|CH60_STRE4  RecName: Full=60 kDa chaperonin; AltNa...   286    5e-77  Gene info
sp|A1WZJ2.1|CH60_HALHL  RecName: Full=60 kDa chaperonin; AltNa...   286    5e-77  Gene info
sp|B4U081.1|CH60_STREM  RecName: Full=60 kDa chaperonin; AltNa...   286    5e-77  Gene info
sp|Q65MZ8.1|CH60_BACLD  RecName: Full=60 kDa chaperonin; AltNa...   286    5e-77  Gene info
sp|P29197.2|CH60A_ARATH  RecName: Full=Chaperonin CPN60, mitoc...   286    5e-77 
sp|O32847.1|CH60_LACZE  RecName: Full=60 kDa chaperonin; AltNa...   286    6e-77 
sp|Q8L7B5.1|CH60B_ARATH  RecName: Full=Chaperonin CPN60-like 1...   286    6e-77 
sp|P26209.1|CH60_BACP3  RecName: Full=60 kDa chaperonin; AltNa...   286    6e-77 
sp|A0Q2T1.1|CH60_CLONN  RecName: Full=60 kDa chaperonin; AltNa...   286    7e-77  Gene info
sp|A7ZCV2.1|CH60_CAMC1  RecName: Full=60 kDa chaperonin; AltNa...   286    7e-77  Gene info
sp|Q9ZN50.1|CH60_HELPJ  RecName: Full=60 kDa chaperonin; AltNa...   286    7e-77  Gene info
sp|Q93GW2.1|CH60_WOLRE  RecName: Full=60 kDa chaperonin; AltNa...   286    7e-77 
sp|B2UW12.1|CH60_HELPS  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77  Gene info
sp|Q1CVE5.1|CH60_HELPH  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77  Gene info
sp|P42383.2|CH60_HELPY  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77 
sp|C0MES3.1|CH60_STRS7  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77 
sp|B5Z6D1.1|CH60_HELPG  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77  Gene info
sp|Q8CXL3.1|CH60_OCEIH  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77 
sp|B3DZP5.1|CH60_METI4  RecName: Full=60 kDa chaperonin; AltNa...   286    8e-77  Gene info
sp|B6JPA7.1|CH60_HELP2  RecName: Full=60 kDa chaperonin; AltNa...   286    9e-77  Gene info
sp|B9DW28.1|CH60_STRU0  RecName: Full=60 kDa chaperonin; AltNa...   286    1e-76 
sp|Q045Q8.1|CH60_LACGA  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76  Gene info
sp|Q64QU2.1|CH60_BACFR  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76 
sp|Q59322.3|CH60_CHLMU  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76 
sp|Q255A1.1|CH60_CHLFF  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76  Gene info
sp|Q3KMQ9.3|CH60_CHLTA  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76  Gene info
sp|B8FM86.1|CH60_DESAA  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76 
sp|B1YEP6.1|CH60_EXIS2  RecName: Full=60 kDa chaperonin; AltNa...   285    1e-76  Gene info
sp|Q5HEH2.1|CH60_STAAC  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76  Gene info
sp|P63767.1|CH60_STAAW  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76  Gene info
sp|Q2YUD8.1|CH60_STAAB  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76  Gene info
sp|Q6GF43.1|CH60_STAAR  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76  Gene info
sp|P0C0Z7.2|CH60_CHLTR  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76 
sp|P15599.1|CH601_CHLCV  RecName: Full=60 kDa chaperonin 1; Al...   285    2e-76 
sp|Q8GJ00.1|CH60_FUSNP  RecName: Full=60 kDa chaperonin; AltNa...   285    2e-76 
sp|A7Z207.1|CH60_BACA2  RecName: Full=60 kDa chaperonin; AltNa...   284    2e-76  Gene info
sp|P28598.3|CH60_BACSU  RecName: Full=60 kDa chaperonin; AltNa...   284    2e-76 
sp|Q8KJ24.1|CH60_CLOBO  RecName: Full=60 kDa chaperonin; AltNa...   284    2e-76 
sp|Q1WSW0.1|CH60_LACS1  RecName: Full=60 kDa chaperonin; AltNa...   284    3e-76  Gene info
sp|Q8A6P8.1|CH60_BACTN  RecName: Full=60 kDa chaperonin; AltNa...   284    3e-76 
sp|Q9KJ23.2|CH60_LACJO  RecName: Full=60 kDa chaperonin; AltNa...   284    3e-76 
sp|A3P2X2.1|CH602_BURP0  RecName: Full=60 kDa chaperonin 2; Al...   284    4e-76  Gene info
sp|B9E899.1|CH60_MACCJ  RecName: Full=60 kDa chaperonin; AltNa...   284    4e-76 
sp|A3NHB6.1|CH602_BURP6  RecName: Full=60 kDa chaperonin 2; Al...   284    4e-76  Gene info
sp|B1I8B2.1|CH60_STRPI  RecName: Full=60 kDa chaperonin; AltNa...   284    4e-76  Gene info
sp|Q7MBB4.1|CH602_GLOVI  RecName: Full=60 kDa chaperonin 2; Al...   284    4e-76 
sp|P0A335.1|CH60_STRPN  RecName: Full=60 kDa chaperonin; AltNa...   284    4e-76 
sp|B8FNT7.1|CH60_DESHD  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|C1CML7.1|CH60_STRZP  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|Q5X9L8.3|CH60_STRP6  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|P69883.2|CH60_STRP1  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|Q2FWN4.1|CH60_STAA8  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76  Gene info
sp|Q8NZ56.3|CH60_STRP8  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|Q63N20.1|CH602_BURPS  RecName: Full=60 kDa chaperonin 2; Al...   283    5e-76 
sp|Q1J9G4.1|CH60_STRPB  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|B5XIW7.1|CH60_STRPZ  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76  Gene info
sp|Q1JEL5.1|CH60_STRPD  RecName: Full=60 kDa chaperonin; AltNa...   283    5e-76 
sp|Q8K5M5.3|CH60_STRP3  RecName: Full=60 kDa chaperonin; AltNa...   283    6e-76 
sp|A7I0W5.1|CH60_CAMHC  RecName: Full=60 kDa chaperonin; AltNa...   283    6e-76  Gene info
sp|Q4L7R4.1|CH60_STAHJ  RecName: Full=60 kDa chaperonin; AltNa...   283    7e-76  Gene info
sp|B9DMM2.1|CH60_STACT  RecName: Full=60 kDa chaperonin; AltNa...   283    9e-76  Gene info
sp|Q1G937.1|CH60_LACDA  RecName: Full=60 kDa chaperonin; AltNa...   283    9e-76  Gene info
sp|Q03H05.1|CH60_PEDPA  RecName: Full=60 kDa chaperonin; AltNa...   282    9e-76  Gene info
sp|Q8CXQ7.1|CH60_MYCPE  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75 
sp|P29185.2|CH61_MAIZE  RecName: Full=Chaperonin CPN60-1, mito...   282    1e-75  Gene info
sp|Q43298.1|CH62_MAIZE  RecName: Full=Chaperonin CPN60-2, mito...   282    1e-75  Gene info
sp|Q5HMZ1.1|CH60_STAEQ  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75  Gene info
sp|Q49YY5.1|CH60_STAS1  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75  Gene info
sp|A6LJ30.1|CH60_THEM4  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75  Gene info
sp|Q8KTS0.1|CH60_TREPR  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75 
sp|Q24QE3.2|CH60_DESHY  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75 
sp|A4J8H4.1|CH60_DESRM  RecName: Full=60 kDa chaperonin; AltNa...   282    1e-75  Gene info
sp|B7LLS5.1|CH60_ESCF3  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75  Gene info
sp|B1HT15.1|CH60_LYSSC  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75  Gene info
sp|Q9WYX6.1|CH60_THEMA  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75 
sp|O74261.1|HSP60_CANAL  RecName: Full=Heat shock protein 60, ...   281    2e-75 
sp|A5IJR6.1|CH60_THEP1  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75  Gene info
sp|B9L698.1|CH60_NAUPA  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75 
sp|Q1ISQ0.1|CH60_ACIBL  RecName: Full=60 kDa chaperonin; AltNa...   281    2e-75  Gene info
sp|P50142.2|HSP60_AJECA  RecName: Full=Heat shock protein 60, ...   281    2e-75 
sp|Q5WJN4.1|CH60_BACSK  RecName: Full=60 kDa chaperonin; AltNa...   281    3e-75  Gene info
sp|B2GAI0.1|CH60_LACF3  RecName: Full=60 kDa chaperonin; AltNa...   281    3e-75 
sp|Q05FT9.1|CH60_CARRP  RecName: Full=60 kDa chaperonin; AltNa...   281    3e-75  Gene info
sp|Q88YM5.1|CH60_LACPL  RecName: Full=60 kDa chaperonin; AltNa...   281    3e-75 
sp|Q17VC6.1|CH60_HELAH  RecName: Full=60 kDa chaperonin; AltNa...   281    3e-75  Gene info
sp|Q03SQ9.1|CH60_LACBA  RecName: Full=60 kDa chaperonin; AltNa...   280    4e-75  Gene info
sp|Q05045.1|CH61_CUCMA  RecName: Full=Chaperonin CPN60-1, mito...   280    4e-75 
sp|P30717.1|CH60_CLOAB  RecName: Full=60 kDa chaperonin; AltNa...   280    4e-75 
sp|P0C0N6.2|CH60_STAEP  RecName: Full=60 kDa chaperonin; AltNa...   280    4e-75 
sp|A8ZU48.1|CH60_DESOH  RecName: Full=60 kDa chaperonin; AltNa...   280    5e-75  Gene info
sp|O67943.1|CH60_AQUAE  RecName: Full=60 kDa chaperonin; AltNa...   280    5e-75 
sp|O50305.2|CH60_BACHD  RecName: Full=60 kDa chaperonin; AltNa...   280    5e-75 
sp|B8D0Z4.1|CH60_HALOH  RecName: Full=60 kDa chaperonin; AltNa...   280    6e-75 
sp|B4U8T6.1|CH60_HYDS0  RecName: Full=60 kDa chaperonin; AltNa...   279    8e-75  Gene info
sp|Q7TTY9.1|CH603_RHOBA  RecName: Full=60 kDa chaperonin 3; Al...   279    8e-75 
sp|B2A5V3.1|CH60_NATTJ  RecName: Full=60 kDa chaperonin; AltNa...   279    8e-75 
sp|Q891G4.1|CH60_CLOTE  RecName: Full=60 kDa chaperonin; AltNa...   279    9e-75 
sp|B0B9L8.1|CH60_CHLT2  RecName: Full=60 kDa chaperonin; AltNa...   279    1e-74  Gene info
sp|C4ZD46.1|CH60_EUBR3  RecName: Full=60 kDa chaperonin; AltNa...   279    1e-74 
sp|Q5M1M9.1|CH60_STRT1  RecName: Full=60 kDa chaperonin; AltNa...   279    1e-74  Gene info
sp|Q9EZV1.1|CH60_THENE  RecName: Full=60 kDa chaperonin; AltNa...   279    1e-74 
sp|Q93GT6.2|CH60_TETHA  RecName: Full=60 kDa chaperonin; AltNa...   278    2e-74 
sp|P61490.2|CH60_THET2  RecName: Full=60 kDa chaperonin; AltNa...   278    2e-74  Gene info
sp|O60008.1|HSP60_PARBA  RecName: Full=Heat shock protein 60, ...   278    2e-74 
sp|Q0AVV1.1|CH60_SYNWW  RecName: Full=60 kDa chaperonin; AltNa...   278    2e-74  Gene info
sp|A6LQ87.1|CH60_CLOB8  RecName: Full=60 kDa chaperonin; AltNa...   278    3e-74  Gene info
sp|B0TCA0.1|CH60_HELMI  RecName: Full=60 kDa chaperonin; AltNa...   277    3e-74  Gene info
sp|A6Q2B4.1|CH60_NITSB  RecName: Full=60 kDa chaperonin; AltNa...   277    3e-74  Gene info
sp|P26821.2|CH60_CLOPE  RecName: Full=60 kDa chaperonin; AltNa...   277    4e-74 
sp|Q0TN27.1|CH60_CLOP1  RecName: Full=60 kDa chaperonin; AltNa...   277    4e-74  Gene info
sp|Q73NH7.1|CH60_TREDE  RecName: Full=60 kDa chaperonin; AltNa...   277    4e-74 
sp|B2UZ02.1|CH60_CLOBA  RecName: Full=60 kDa chaperonin; AltNa...   277    4e-74  Gene info
sp|Q03VC3.1|CH60_LEUMM  RecName: Full=60 kDa chaperonin; AltNa...   277    4e-74  Gene info
sp|A6KXA0.1|CH60_BACV8  RecName: Full=60 kDa chaperonin; AltNa...   277    5e-74  Gene info
sp|Q660M1.1|CH60_BORGA  RecName: Full=60 kDa chaperonin; AltNa...   276    5e-74 
sp|Q0SMK4.1|CH60_BORAP  RecName: Full=60 kDa chaperonin; AltNa...   276    5e-74  Gene info
sp|B7IFA6.1|CH60_THEAB  RecName: Full=60 kDa chaperonin; AltNa...   276    6e-74  Gene info
sp|A5IGM1.1|CH60_LEGPC  RecName: Full=60 kDa chaperonin; AltNa...   276    6e-74  Gene info
sp|A8F401.1|CH60_THELT  RecName: Full=60 kDa chaperonin; AltNa...   276    6e-74  Gene info
sp|B7J2K5.1|CH60_BORBZ  RecName: Full=60 kDa chaperonin; AltNa...   276    6e-74  Gene info
sp|Q5X762.1|CH60_LEGPA  RecName: Full=60 kDa chaperonin; AltNa...   276    7e-74  Gene info
sp|Q6MF95.1|CH601_PARUW  RecName: Full=60 kDa chaperonin 1; Al...   276    7e-74  Gene info
sp|Q5ZXP3.2|CH60_LEGPH  RecName: Full=60 kDa chaperonin; AltNa...   276    8e-74 
sp|A7NIK8.1|CH601_ROSCS  RecName: Full=60 kDa chaperonin 1; Al...   275    1e-73  Gene info
sp|P69050.1|CH60_LEGPN  RecName: Full=60 kDa chaperonin; AltNa...   275    2e-73 
sp|A8MJJ7.1|CH60_ALKOO  RecName: Full=60 kDa chaperonin; AltNa...   275    2e-73  Gene info
sp|Q46CA1.1|CH60_METBF  RecName: Full=60 kDa chaperonin; AltNa...   274    2e-73  Gene info
sp|Q09864.1|HSP60_SCHPO  RecName: Full=Heat shock protein 60, ...   274    3e-73  Gene info
sp|B5RMJ5.1|CH60_BORDL  RecName: Full=60 kDa chaperonin; AltNa...   274    3e-73  Gene info
sp|Q7U317.1|CH60_HELHP  RecName: Full=60 kDa chaperonin; AltNa...   274    3e-73 
sp|Q5B041.1|HSP60_EMENI  RecName: Full=Heat shock protein 60; ...   274    3e-73 
sp|B2TIX0.1|CH60_CLOBB  RecName: Full=60 kDa chaperonin; AltNa...   274    3e-73  Gene info
sp|P26194.1|CH60_LEGMI  RecName: Full=60 kDa chaperonin; AltNa...   274    3e-73 
sp|A5VIE9.1|CH60_LACRD  RecName: Full=60 kDa chaperonin; AltNa...   274    4e-73  Gene info
sp|Q67KB8.1|CH60_SYMTH  RecName: Full=60 kDa chaperonin; AltNa...   274    4e-73 
sp|A5V0S2.1|CH602_ROSS1  RecName: Full=60 kDa chaperonin 2; Al...   273    4e-73  Gene info
sp|P48212.3|CH60_CLOTH  RecName: Full=60 kDa chaperonin; AltNa...   273    4e-73  Gene info
sp|Q82DI5.3|CH601_STRAW  RecName: Full=60 kDa chaperonin 1; Al...   273    5e-73 
sp|P26004.1|CH60_AMOPS  RecName: Full=60 kDa chaperonin; AltNa...   273    6e-73 
sp|Q2RL13.1|CH601_MOOTA  RecName: Full=60 kDa chaperonin 1; Al...   273    6e-73 
sp|Q1IW59.1|CH60_DEIGD  RecName: Full=60 kDa chaperonin; AltNa...   273    6e-73  Gene info
sp|Q2RGL8.1|CH602_MOOTA  RecName: Full=60 kDa chaperonin 2; Al...   273    7e-73 
sp|B2V8F1.1|CH60_SULSY  RecName: Full=60 kDa chaperonin; AltNa...   272    1e-72  Gene info
sp|Q7MBC7.1|CH601_GLOVI  RecName: Full=60 kDa chaperonin 1; Al...   272    1e-72 
sp|B1GYR7.1|CH60_UNCTG  RecName: Full=60 kDa chaperonin; AltNa...   272    1e-72 
sp|Q7WVY0.1|CH602_ANASL  RecName: Full=60 kDa chaperonin 2; Al...   272    1e-72 
sp|A5N5D7.1|CH60_CLOK5  RecName: Full=60 kDa chaperonin; AltNa...   271    2e-72  Gene info
sp|Q9RWQ9.3|CH60_DEIRA  RecName: Full=60 kDa chaperonin; AltNa...   271    2e-72 
sp|B8I5W0.1|CH60_CLOCE  RecName: Full=60 kDa chaperonin; AltNa...   271    3e-72 
sp|Q04E64.1|CH60_OENOB  RecName: Full=60 kDa chaperonin; AltNa...   271    3e-72  Gene info
sp|A8YTH8.1|CH60_LACH4  RecName: Full=60 kDa chaperonin; AltNa...   271    3e-72  Gene info
sp|A7HNA3.1|CH60_FERNB  RecName: Full=60 kDa chaperonin; AltNa...   271    3e-72  Gene info
sp|Q9KI71.2|CH60_PARDN  RecName: Full=60 kDa chaperonin; AltNa...   271    3e-72 
sp|P23033.4|CH60_TREPA  RecName: Full=60 kDa chaperonin; AltNa...   270    4e-72 
sp|A5CZ03.1|CH60_PELTS  RecName: Full=60 kDa chaperonin; AltNa...   270    4e-72  Gene info
sp|Q3M6L5.2|CH602_ANAVT  RecName: Full=60 kDa chaperonin 2; Al...   270    5e-72  Gene info
sp|A1SMW1.1|CH601_NOCSJ  RecName: Full=60 kDa chaperonin 1; Al...   270    5e-72  Gene info
sp|O68324.1|CH60_LACHE  RecName: Full=60 kDa chaperonin; AltNa...   270    5e-72 
sp|B0KBR3.1|CH60_THEP3  RecName: Full=60 kDa chaperonin; AltNa...   270    6e-72  Gene info
sp|B1I661.1|CH60_DESAP  RecName: Full=60 kDa chaperonin; AltNa...   270    6e-72  Gene info
sp|P19882.1|HSP60_YEAST  RecName: Full=Heat shock protein 60, ...   270    6e-72  Gene info
sp|Q47LP1.1|CH602_THEFY  RecName: Full=60 kDa chaperonin 2; Al...   270    7e-72  Gene info
sp|Q8PW06.1|CH60_METMA  RecName: Full=60 kDa chaperonin; AltNa...   270    7e-72 
sp|C4Z3R4.1|CH60_EUBE2  RecName: Full=60 kDa chaperonin; AltNa...   269    8e-72 
sp|B0S1R4.1|CH60_FINM2  RecName: Full=60 kDa chaperonin; AltNa...   269    8e-72  Gene info
sp|P0A337.1|CH602_THEEB  RecName: Full=60 kDa chaperonin 2; Al...   269    9e-72  Gene info
sp|Q8NSS0.1|CH601_CORGL  RecName: Full=60 kDa chaperonin 1; Al...   269    9e-72 
sp|Q9EY76.2|CH60_SCAIO  RecName: Full=60 kDa chaperonin; AltNa...   269    1e-71 
sp|O02649.3|CH60_DROME  RecName: Full=60 kDa heat shock protei...   269    1e-71  Gene info
sp|P40171.3|CH601_STRCO  RecName: Full=60 kDa chaperonin 1; Al...   269    1e-71 
sp|A4QBU0.1|CH601_CORGB  RecName: Full=60 kDa chaperonin 1; Al...   269    1e-71  Gene info
sp|Q2JKV7.1|CH602_SYNJB  RecName: Full=60 kDa chaperonin 2; Al...   268    2e-71  Gene info
sp|C1CZP1.1|CH60_DEIDV  RecName: Full=60 kDa chaperonin; AltNa...   268    2e-71 
sp|B5Y894.1|CH60_COPPD  RecName: Full=60 kDa chaperonin; AltNa...   268    2e-71  Gene info
sp|Q8TGX7.1|CH60_METAC  RecName: Full=60 kDa chaperonin; AltNa...   268    2e-71 
sp|Q8YVS8.1|CH602_ANASP  RecName: Full=60 kDa chaperonin 2; Al...   268    2e-71  Gene info
sp|A4XJ09.1|CH60_CALS8  RecName: Full=60 kDa chaperonin; AltNa...   268    2e-71  Gene info
sp|Q18CT5.1|CH60_CLOD6  RecName: Full=60 kDa chaperonin; AltNa...   268    3e-71  Gene info
sp|A9KSJ1.1|CH60_CLOPH  RecName: Full=60 kDa chaperonin; AltNa...   268    3e-71  Gene info
sp|B9MLY9.1|CH60_ANATD  RecName: Full=60 kDa chaperonin; AltNa...   267    3e-71  Gene info
sp|A1R074.1|CH60_BORT9  RecName: Full=60 kDa chaperonin; AltNa...   267    4e-71 
sp|Q00767.3|CH601_STRAL  RecName: Full=60 kDa chaperonin 1; Al...   266    5e-71 
sp|Q9KKF0.1|CH60_CLODI  RecName: Full=60 kDa chaperonin; AltNa...   266    5e-71 
sp|Q93G07.2|CH60_LACAC  RecName: Full=60 kDa chaperonin; AltNa...   266    6e-71 
sp|A9BHK4.1|CH60_PETMO  RecName: Full=60 kDa chaperonin; AltNa...   266    6e-71  Gene info
sp|A6TLJ1.1|CH60_ALKMQ  RecName: Full=60 kDa chaperonin; AltNa...   266    6e-71  Gene info
sp|Q3ADX3.1|CH60_CARHZ  RecName: Full=60 kDa chaperonin; AltNa...   266    8e-71  Gene info
sp|Q10WQ4.1|CH602_TRIEI  RecName: Full=60 kDa chaperonin 2; Al...   266    8e-71  Gene info
sp|B0CFQ6.1|CH601_ACAM1  RecName: Full=60 kDa chaperonin 1; Al...   266    9e-71  Gene info
sp|Q8CY27.1|CH601_COREF  RecName: Full=60 kDa chaperonin 1; Al...   266    1e-70 
sp|A6WE60.1|CH602_KINRD  RecName: Full=60 kDa chaperonin 2; Al...   266    1e-70  Gene info
sp|Q7UM97.1|CH602_RHOBA  RecName: Full=60 kDa chaperonin 2; Al...   265    1e-70 
sp|Q8R5T7.1|CH60_THETN  RecName: Full=60 kDa chaperonin; AltNa...   265    1e-70 
sp|Q60024.2|CH60_THEBR  RecName: Full=60 kDa chaperonin; AltNa...   265    2e-70 
sp|Q08854.3|CH60_STAAU  RecName: Full=60 kDa chaperonin; AltNa...   265    2e-70 
sp|A9NHL6.1|CH60_ACHLI  RecName: Full=60 kDa chaperonin; AltNa...   264    3e-70  Gene info
sp|P94820.1|CH60_HOLOB  RecName: Full=60 kDa chaperonin; AltNa...   264    3e-70 
sp|Q6NJ37.1|CH601_CORDI  RecName: Full=60 kDa chaperonin 1; Al...   264    3e-70 
sp|O50323.2|CH601_THEVL  RecName: Full=60 kDa chaperonin 1; Al...   264    4e-70 
sp|Q05972.4|CH601_SYNY3  RecName: Full=60 kDa chaperonin 1; Al...   263    5e-70  Gene info
sp|Q3AUZ9.1|CH602_SYNS9  RecName: Full=60 kDa chaperonin 2; Al...   263    5e-70  Gene info
sp|Q46GW7.1|CH602_PROMT  RecName: Full=60 kDa chaperonin 2; Al...   263    6e-70  Gene info
sp|A6W5Y6.1|CH601_KINRD  RecName: Full=60 kDa chaperonin 1; Al...   263    6e-70  Gene info
sp|B8DTZ2.1|CH60_BIFA0  RecName: Full=60 kDa chaperonin; AltNa...   263    7e-70  Gene info
sp|A2C0Q8.1|CH601_PROM1  RecName: Full=60 kDa chaperonin 1; Al...   263    7e-70  Gene info
sp|P31081.2|CH60_BOVIN  RecName: Full=60 kDa heat shock protei...   263    9e-70  Gene info
sp|Q7TTT6.1|CH602_SYNPX  RecName: Full=60 kDa chaperonin 2; Al...   262    1e-69  Gene info
sp|Q6A6W2.1|CH602_PROAC  RecName: Full=60 kDa chaperonin 2; Al...   262    1e-69 
sp|A4F749.1|CH601_SACEN  RecName: Full=60 kDa chaperonin 1; Al...   262    1e-69  Gene info
sp|Q5NVM5.1|CH60_PONAB  RecName: Full=60 kDa heat shock protei...   262    1e-69  Gene info
sp|Q5N3T6.1|CH602_SYNP6  RecName: Full=60 kDa chaperonin 2; Al...   262    1e-69  Gene info
sp|Q4JTF2.1|CH602_CORJK  RecName: Full=60 kDa chaperonin 2; Al...   262    1e-69  Gene info
sp|A9B6A4.1|CH60_HERA2  RecName: Full=60 kDa chaperonin; AltNa...   262    1e-69  Gene info
sp|Q8DMD4.1|CH60_THEEB  RecName: Full=60 kDa chaperonin; AltNa...   262    1e-69  Gene info
sp|A1T352.1|CH601_MYCVP  RecName: Full=60 kDa chaperonin 1; Al...   262    2e-69  Gene info
sp|Q2JXD4.1|CH601_SYNJA  RecName: Full=60 kDa chaperonin 1; Al...   262    2e-69  Gene info
sp|P10809.2|CH60_HUMAN  RecName: Full=60 kDa heat shock protei...   261    2e-69  Gene info
sp|P42384.4|CH602_MYCPA  RecName: Full=60 kDa chaperonin 2; Al...   261    3e-69 
sp|A0QLP6.1|CH602_MYCA1  RecName: Full=60 kDa chaperonin 2; Al...   261    3e-69  Gene info
sp|A1R3H9.1|CH601_ARTAT  RecName: Full=60 kDa chaperonin 1; Al...   261    3e-69  Gene info
sp|A4XBH2.1|CH602_SALTO  RecName: Full=60 kDa chaperonin 2; Al...   261    3e-69  Gene info
sp|A0JT07.1|CH601_ARTS2  RecName: Full=60 kDa chaperonin 1; Al...   260    4e-69  Gene info
sp|Q7TTX1.1|CH601_SYNPX  RecName: Full=60 kDa chaperonin 1; Al...   260    5e-69  Gene info
sp|P63039.1|CH60_RAT  RecName: Full=60 kDa heat shock protein,...   260    5e-69  Gene info
sp|Q5ZL72.1|CH60_CHICK  RecName: Full=60 kDa heat shock protei...   260    6e-69  Gene info
sp|P18687.1|CH60_CRIGR  RecName: Full=60 kDa heat shock protei...   260    6e-69 
sp|Q54J97.1|CH60_DICDI  RecName: Full=60 kDa heat shock protei...   259    6e-69 
sp|A0PNL7.1|CH602_MYCUA  RecName: Full=60 kDa chaperonin 2; Al...   259    8e-69  Gene info
sp|A0PME9.1|CH601_MYCUA  RecName: Full=60 kDa chaperonin 1; Al...   259    8e-69  Gene info
sp|Q9VMN5.2|CH60C_DROME  RecName: Full=60 kDa heat shock prote...   259    9e-69  Gene info
sp|A0LR17.1|CH601_ACIC1  RecName: Full=60 kDa chaperonin 1; Al...   259    9e-69  Gene info
sp|B2KD81.1|CH60_ELUMP  RecName: Full=60 kDa chaperonin; AltNa...   259    1e-68 
sp|A5GV53.1|CH60_SYNR3  RecName: Full=60 kDa chaperonin; AltNa...   259    1e-68  Gene info
sp|Q7TV93.1|CH602_PROMA  RecName: Full=60 kDa chaperonin 2; Al...   259    1e-68 
sp|A0LRS7.1|CH602_ACIC1  RecName: Full=60 kDa chaperonin 2; Al...   259    1e-68  Gene info
sp|A5GMX4.1|CH601_SYNPW  RecName: Full=60 kDa chaperonin 1; Al...   259    1e-68  Gene info
sp|Q7V643.1|CH601_PROMM  RecName: Full=60 kDa chaperonin 1; Al...   259    1e-68  Gene info
sp|Q9TLZ1.1|CH60_CYACA  RecName: Full=60 kDa chaperonin, chlor...   259    1e-68  Gene info
sp|Q47TE8.1|CH601_THEFY  RecName: Full=60 kDa chaperonin 1; Al...   259    1e-68  Gene info
sp|P12834.2|CH601_SYNP6  RecName: Full=60 kDa chaperonin 1; Al...   259    1e-68  Gene info
sp|Q0I7U3.1|CH602_SYNS3  RecName: Full=60 kDa chaperonin 2; Al...   258    1e-68  Gene info
sp|A2C7E2.1|CH602_PROM3  RecName: Full=60 kDa chaperonin 2; Al...   258    1e-68  Gene info
sp|A3PU33.1|CH601_MYCSJ  RecName: Full=60 kDa chaperonin 1; Al...   258    1e-68  Gene info
sp|Q46J70.1|CH601_PROMT  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68  Gene info
sp|Q8RU00.1|CH60_BRECH  RecName: Full=60 kDa chaperonin; AltNa...   258    2e-68 
sp|A7NMS9.1|CH602_ROSCS  RecName: Full=60 kDa chaperonin 2; Al...   258    2e-68  Gene info
sp|Q5Z1F9.1|CH601_NOCFA  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68 
sp|Q7TVA6.1|CH601_PROMA  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68 
sp|Q119S1.1|CH601_TRIEI  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68  Gene info
sp|A0QQU5.1|CH601_MYCS2  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68  Gene info
sp|A5US83.1|CH601_ROSS1  RecName: Full=60 kDa chaperonin 1; Al...   258    2e-68  Gene info
sp|P35480.1|CH60_BRANA  RecName: Full=Chaperonin CPN60, mitoch...   258    3e-68 
sp|A9WJN7.1|CH601_CHLAA  RecName: Full=60 kDa chaperonin 1; Al...   258    3e-68  Gene info
sp|C3KUC8.1|CH60_CLOB6  RecName: Full=60 kDa chaperonin; AltNa...   257    3e-68  Gene info
sp|Q93ZM7.2|CH60C_ARATH  RecName: Full=Chaperonin CPN60-like 2...   257    3e-68 
sp|Q3AHM4.1|CH602_SYNSC  RecName: Full=60 kDa chaperonin 2; Al...   257    3e-68  Gene info
sp|B1L1K0.1|CH60_CLOBM  RecName: Full=60 kDa chaperonin; AltNa...   257    3e-68  Gene info
sp|B0CEZ1.1|CH602_ACAM1  RecName: Full=60 kDa chaperonin 2; Al...   257    3e-68  Gene info
sp|A7FYP3.1|CH60_CLOB1  RecName: Full=60 kDa chaperonin; AltNa...   257    4e-68  Gene info
sp|A0JYZ5.1|CH602_ARTS2  RecName: Full=60 kDa chaperonin 2; Al...   257    4e-68  Gene info
sp|A2C4I2.1|CH602_PROM1  RecName: Full=60 kDa chaperonin 2; Al...   257    5e-68  Gene info
sp|Q3M704.1|CH601_ANAVT  RecName: Full=60 kDa chaperonin 1; Al...   257    5e-68  Gene info
sp|Q3AZK3.1|CH601_SYNS9  RecName: Full=60 kDa chaperonin 1; Al...   257    5e-68  Gene info
sp|Q3ALZ3.1|CH601_SYNSC  RecName: Full=60 kDa chaperonin 1; Al...   257    5e-68  Gene info
sp|P50140.2|CH60_CAEEL  RecName: Full=Chaperonin homolog Hsp-6...   256    5e-68  Gene info
sp|Q0RB64.1|CH604_FRAAA  RecName: Full=60 kDa chaperonin 4; Al...   256    6e-68  Gene info
sp|A1SYD3.1|CH603_PSYIN  RecName: Full=60 kDa chaperonin 3; Al...   256    6e-68  Gene info
sp|Q8YQZ8.1|CH601_ANASP  RecName: Full=60 kDa chaperonin 1; Al...   256    6e-68  Gene info
sp|Q2J4P8.1|CH604_FRASC  RecName: Full=60 kDa chaperonin 4; Al...   256    6e-68  Gene info
sp|P0A520.2|CH602_MYCTU  RecName: Full=60 kDa chaperonin 2; Al...   256    9e-68 
sp|Q0RQ25.1|CH602_FRAAA  RecName: Full=60 kDa chaperonin 2; Al...   256    9e-68  Gene info
sp|Q37683.2|CH60_TRYBB  RecName: Full=Chaperonin HSP60, mitoch...   256    9e-68 
sp|A8M497.1|CH602_SALAI  RecName: Full=60 kDa chaperonin 2; Al...   256    1e-67  Gene info
sp|A2BT10.1|CH602_PROMS  RecName: Full=60 kDa chaperonin 2; Al...   255    1e-67  Gene info
sp|A8G6T6.1|CH602_PROM2  RecName: Full=60 kDa chaperonin 2; Al...   255    1e-67  Gene info
sp|A7I798.1|CH60_METB6  RecName: Full=60 kDa chaperonin; AltNa...   255    2e-67  Gene info
sp|A3PES4.1|CH602_PROM0  RecName: Full=60 kDa chaperonin 2; Al...   255    2e-67  Gene info
sp|A4T2X3.1|CH601_MYCGI  RecName: Full=60 kDa chaperonin 1; Al...   255    2e-67  Gene info
sp|A1R8M1.1|CH602_ARTAT  RecName: Full=60 kDa chaperonin 2; Al...   254    2e-67  Gene info
sp|Q318V6.1|CH602_PROM9  RecName: Full=60 kDa chaperonin 2; Al...   254    2e-67  Gene info
sp|Q39727.1|CH60_EUGGR  RecName: Full=Chaperonin CPN60, mitoch...   254    2e-67 
sp|Q37757.1|CH60_CYAPA  RecName: Full=60 kDa chaperonin, cyane...   254    2e-67  Gene info
sp|P09239.3|CH602_MYCLE  RecName: Full=60 kDa chaperonin 2; Al...   254    2e-67 
sp|Q9KXU5.1|CH602_STRCO  RecName: Full=60 kDa chaperonin 2; Al...   254    2e-67 
sp|Q7TUS4.1|CH602_PROMM  RecName: Full=60 kDa chaperonin 2; Al...   254    2e-67  Gene info
sp|Q1AXU6.1|CH60_RUBXD  RecName: Full=60 kDa chaperonin; AltNa...   254    2e-67  Gene info
sp|A2C6Z6.1|CH601_PROM3  RecName: Full=60 kDa chaperonin 1; Al...   254    2e-67  Gene info
sp|A5GNA9.1|CH602_SYNPW  RecName: Full=60 kDa chaperonin 2; Al...   254    3e-67  Gene info
sp|A2BYG1.1|CH602_PROM5  RecName: Full=60 kDa chaperonin 2; Al...   254    3e-67  Gene info
sp|A1SNU4.1|CH602_NOCSJ  RecName: Full=60 kDa chaperonin 2; Al...   254    3e-67  Gene info
sp|Q7UM99.2|CH601_RHOBA  RecName: Full=60 kDa chaperonin 1; Al...   254    3e-67 
sp|Q7TU44.1|CH602_PROMP  RecName: Full=60 kDa chaperonin 2; Al...   254    4e-67  Gene info
sp|Q1BCW7.1|CH602_MYCSS  RecName: Full=60 kDa chaperonin 2; Al...   254    4e-67  Gene info
sp|Q93QI2.1|CH60_COREQ  RecName: Full=60 kDa chaperonin; AltNa...   254    4e-67 
sp|Q00768.3|CH602_STRAL  RecName: Full=60 kDa chaperonin 2; Al...   253    5e-67 
sp|Q82GG6.1|CH602_STRAW  RecName: Full=60 kDa chaperonin 2; Al...   253    5e-67 
sp|Q0I885.1|CH601_SYNS3  RecName: Full=60 kDa chaperonin 1; Al...   253    6e-67  Gene info
sp|C5BZB0.1|CH60_BEUC1  RecName: Full=60 kDa chaperonin; AltNa...   253    8e-67 
sp|A0QSS4.1|CH602_MYCS2  RecName: Full=60 kDa chaperonin 2; Al...   253    8e-67  Gene info
sp|P22034.4|CH602_SYNY3  RecName: Full=60 kDa chaperonin 2; Al...   253    8e-67  Gene info
sp|Q8G879.1|CH60_BIFLO  RecName: Full=60 kDa chaperonin; AltNa...   253    9e-67 
sp|B7GPR8.1|CH60_BIFLI  RecName: Full=60 kDa chaperonin; AltNa...   252    1e-66 
sp|A4TEN6.1|CH602_MYCGI  RecName: Full=60 kDa chaperonin 2; Al...   252    1e-66  Gene info
sp|A4FPA5.1|CH602_SACEN  RecName: Full=60 kDa chaperonin 2; Al...   252    1e-66  Gene info
sp|Q3M1B1.1|CH603_ANAVT  RecName: Full=60 kDa chaperonin 3; Al...   252    1e-66  Gene info
sp|P60545.1|CH601_MYCPA  RecName: Full=60 kDa chaperonin 1; Al...   252    2e-66 
sp|A1T577.1|CH602_MYCVP  RecName: Full=60 kDa chaperonin 2; Al...   251    2e-66  Gene info
sp|A0QKR2.1|CH601_MYCA1  RecName: Full=60 kDa chaperonin 1; Al...   251    2e-66  Gene info
sp|A8ZNW7.1|CH603_ACAM1  RecName: Full=60 kDa chaperonin 3; Al...   251    2e-66  Gene info
sp|A9WFA3.1|CH602_CHLAA  RecName: Full=60 kDa chaperonin 2; Al...   251    2e-66  Gene info
sp|Q83NN0.1|CH60_TROW8  RecName: Full=60 kDa chaperonin; AltNa...   251    3e-66  Gene info
sp|Q9K2U4.1|CH601_PROAC  RecName: Full=60 kDa chaperonin 1; Al...   251    3e-66 
sp|Q0S3B9.1|CH602_RHOSR  RecName: Full=60 kDa chaperonin 2; Al...   251    3e-66  Gene info
sp|P69204.1|CH60_TROWH  RecName: Full=60 kDa chaperonin; AltNa...   251    3e-66 
sp|Q0RBS5.2|CH603_FRAAA  RecName: Full=60 kDa chaperonin 3; Al...   251    3e-66  Gene info
sp|Q9KI57.2|CH60_GARVA  RecName: Full=60 kDa chaperonin; AltNa...   251    3e-66 
sp|P28256.1|CH60_GALSU  RecName: Full=60 kDa chaperonin, chlor...   251    3e-66 
sp|Q9AFA6.2|CH602_NOCFA  RecName: Full=60 kDa chaperonin 2; Al...   250    4e-66 
sp|P51349.1|CH60_PORPU  RecName: Full=60 kDa chaperonin, chlor...   250    5e-66  Gene info
sp|Q95046.1|CH60_TRYCR  RecName: Full=Chaperonin HSP60, mitoch...   250    5e-66 
sp|A8LYN0.1|CH601_SALAI  RecName: Full=60 kDa chaperonin 1; Al...   250    6e-66  Gene info
sp|A4X1K4.1|CH601_SALTO  RecName: Full=60 kDa chaperonin 1; Al...   250    6e-66  Gene info
sp|Q94596.1|CH60_LEIMA  RecName: Full=Chaperonin HSP60, mitoch...   249    7e-66 
sp|P25420.1|CH63_HELVI  RecName: Full=63 kDa chaperonin, mitoc...   249    8e-66 
sp|P97086.1|CH60_TSUTY  RecName: Full=60 kDa chaperonin; AltNa...   249    9e-66 
sp|Q2JAZ7.1|CH602_FRASC  RecName: Full=60 kDa chaperonin 2; Al...   249    1e-65  Gene info
sp|P37578.1|CH601_MYCLE  RecName: Full=60 kDa chaperonin 1; Al...   248    1e-65 
sp|Q2JUN7.1|CH602_SYNJA  RecName: Full=60 kDa chaperonin 2; Al...   248    2e-65  Gene info
sp|Q21U33.1|CH602_RHOFD  RecName: Full=60 kDa chaperonin 2; Al...   248    2e-65  Gene info
sp|P0A518.1|CH601_MYCTU  RecName: Full=60 kDa chaperonin 1; Al...   248    2e-65 
sp|O33658.3|CH602_STRLI  RecName: Full=60 kDa chaperonin 2; Al...   248    2e-65 
sp|Q2NIM6.1|CH60_AYWBP  RecName: Full=60 kDa chaperonin; AltNa...   248    2e-65  Gene info
sp|A1VJ84.1|CH601_POLNA  RecName: Full=60 kDa chaperonin 1; Al...   248    3e-65  Gene info
sp|Q2JL43.1|CH601_SYNJB  RecName: Full=60 kDa chaperonin 1; Al...   248    3e-65  Gene info
sp|A4QHB7.1|CH602_CORGB  RecName: Full=60 kDa chaperonin 2; Al...   247    3e-65  Gene info
sp|Q9AMJ8.1|CH601_ANASL  RecName: Full=60 kDa chaperonin 1; Al...   247    4e-65 
sp|Q8NM64.1|CH602_CORGL  RecName: Full=60 kDa chaperonin 2; Al...   247    4e-65 
sp|Q0SET3.1|CH601_RHOSR  RecName: Full=60 kDa chaperonin 1; Al...   247    4e-65  Gene info
sp|A5CTX3.1|CH60_CLAM3  RecName: Full=60 kDa chaperonin; AltNa...   247    4e-65  Gene info
sp|Q9AFC5.1|CH60_NOCAS  RecName: Full=60 kDa chaperonin; AltNa...   247    5e-65 
sp|Q9REU4.3|CH60_BIFAA  RecName: Full=60 kDa chaperonin; AltNa...   246    6e-65  Gene info
sp|Q8CY22.1|CH602_COREF  RecName: Full=60 kDa chaperonin 2; Al...   246    6e-65 
sp|Q6YR94.1|CH60_ONYPE  RecName: Full=60 kDa chaperonin; AltNa...   246    1e-64 
sp|Q1XDD8.2|CH60_PORYE  RecName: Full=60 kDa chaperonin, chlor...   246    1e-64 
sp|P49464.1|CH60_ODOSI  RecName: Full=60 kDa chaperonin, chlor...   245    2e-64  Gene info
sp|Q9AFA5.1|CH60_TSUPA  RecName: Full=60 kDa chaperonin; AltNa...   244    2e-64 
sp|O78419.1|CH60_GUITH  RecName: Full=60 kDa chaperonin, chlor...   244    2e-64  Gene info
sp|Q6NF74.1|CH602_CORDI  RecName: Full=60 kDa chaperonin 2; Al...   244    3e-64 
sp|A9WMA0.2|CH601_RENSM  RecName: Full=60 kDa chaperonin 1; Al...   244    3e-64  Gene info
sp|Q6ADK2.1|CH60_LEIXX  RecName: Full=60 kDa chaperonin; AltNa...   244    4e-64 
sp|Q4G3D5.1|CH60_EMIHU  RecName: Full=60 kDa chaperonin, chlor...   244    4e-64  Gene info
sp|Q4JXN8.1|CH601_CORJK  RecName: Full=60 kDa chaperonin 1; Al...   243    6e-64  Gene info
sp|A9WN14.1|CH602_RENSM  RecName: Full=60 kDa chaperonin 2; Al...   243    6e-64  Gene info
sp|O33659.3|CH601_STRLI  RecName: Full=60 kDa chaperonin 1; Al...   240    6e-63 
sp|A0T0H6.1|CH60_PHATR  RecName: Full=60 kDa chaperonin, chlor...   239    8e-63  Gene info
sp|Q0RRL9.2|CH601_FRAAA  RecName: Full=60 kDa chaperonin 1; Al...   239    1e-62  Gene info
sp|Q7V2M3.1|CH601_PROMP  RecName: Full=60 kDa chaperonin 1; Al...   239    1e-62  Gene info
sp|Q2JFC5.1|CH601_FRASC  RecName: Full=60 kDa chaperonin 1; Al...   239    1e-62  Gene info
sp|A2BPT4.1|CH601_PROMS  RecName: Full=60 kDa chaperonin 1; Al...   238    2e-62  Gene info
sp|A3PBH4.1|CH601_PROM0  RecName: Full=60 kDa chaperonin 1; Al...   238    2e-62  Gene info
sp|A2BVB2.1|CH601_PROM5  RecName: Full=60 kDa chaperonin 1; Al...   238    2e-62  Gene info
sp|A0T0X0.1|CH60_THAPS  RecName: Full=60 kDa chaperonin, chlor...   238    3e-62  Gene info
sp|A5CDL9.1|CH60_ORITB  RecName: Full=60 kDa chaperonin; AltNa...   236    9e-62  Gene info
sp|Q6B911.1|CH60_GRATL  RecName: Full=60 kDa chaperonin, chlor...   236    1e-61  Gene info
sp|B3CQ26.1|CH60_ORITI  RecName: Full=60 kDa chaperonin; AltNa...   235    1e-61  Gene info
sp|P16625.1|CH60_ORITS  RecName: Full=60 kDa chaperonin; AltNa...   235    2e-61 
sp|Q3ZYW8.1|CH60_DEHSC  RecName: Full=60 kDa chaperonin; AltNa...   235    2e-61  Gene info
sp|P08927.2|RUBB_PEA  RecName: Full=RuBisCO large subunit-bind...   234    2e-61 
sp|A5FPR4.1|CH60_DEHSB  RecName: Full=60 kDa chaperonin; AltNa...   234    4e-61  Gene info
sp|Q3Z6L3.1|CH60_DEHE1  RecName: Full=60 kDa chaperonin; AltNa...   234    4e-61  Gene info
sp|Q31C83.1|CH601_PROM9  RecName: Full=60 kDa chaperonin 1; Al...   233    8e-61  Gene info
sp|Q2FPN5.1|CH60_METHJ  RecName: Full=60 kDa chaperonin; AltNa...   233    9e-61  Gene info
sp|P21240.3|RUBB_ARATH  RecName: Full=RuBisCO large subunit-bi...   231    3e-60 
sp|Q85G22.1|CH60_CYAME  RecName: Full=60 kDa chaperonin, chlor...   231    3e-60 
sp|Q89LB1.1|CH605_BRAJA  RecName: Full=60 kDa chaperonin 5; Al...   230    5e-60 
sp|Q9VPS5.1|CH60B_DROME  RecName: Full=60 kDa heat shock prote...   229    9e-60  Gene info
sp|A8G3G6.2|CH601_PROM2  RecName: Full=60 kDa chaperonin 1; Al...   229    1e-59 
sp|P08926.2|RUBA_PEA  RecName: Full=RuBisCO large subunit-bind...   229    1e-59 
sp|P21241.1|RUBB_BRANA  RecName: Full=RuBisCO large subunit-bi...   229    1e-59 
sp|Q95058.1|CH60_TRIVA  RecName: Full=Hydrogenosomal chaperoni...   228    2e-59 
sp|P21238.2|RUBA_ARATH  RecName: Full=RuBisCO large subunit-bi...   228    3e-59 
sp|P21239.2|RUB1_BRANA  RecName: Full=RuBisCO large subunit-bi...   227    4e-59 
sp|Q6MBR6.1|CH603_PARUW  RecName: Full=60 kDa chaperonin 3; Al...   226    1e-58  Gene info
sp|P34794.1|RUB2_BRANA  RecName: Full=RuBisCO large subunit-bi...   223    6e-58 
sp|P08823.1|RUBA_WHEAT  RecName: Full=RuBisCO large subunit-bi...   222    1e-57  Gene info
sp|Q7MBB2.1|CH60_MYCGA  RecName: Full=60 kDa chaperonin; AltNa...   222    2e-57 
sp|P08824.1|RUBA_RICCO  RecName: Full=RuBisCO large subunit-bi...   219    1e-56 
sp|Q42694.1|RUBA_CHLRE  RecName: Full=RuBisCO large subunit-bi...   218    3e-56 
sp|P46224.1|CH60_PYRSA  RecName: Full=60 kDa chaperonin, chlor...   215    2e-55 
sp|Q89P00.1|CH604_BRAJA  RecName: Full=60 kDa chaperonin 4; Al...   203    9e-52 
sp|P42382.1|CH60_EHRCH  RecName: Full=60 kDa chaperonin; AltNa...   202    2e-51 
sp|P47632.1|CH60_MYCGE  RecName: Full=60 kDa chaperonin; AltNa...   200    6e-51 
sp|Q2JA12.1|CH603_FRASC  RecName: Full=60 kDa chaperonin 3; Al...   198    2e-50  Gene info
sp|Q3YRH4.1|CH60_EHRCJ  RecName: Full=60 kDa chaperonin; AltNa...   198    2e-50  Gene info
sp|O34194.1|CH60_EHRCA  RecName: Full=60 kDa chaperonin; AltNa...   198    3e-50 
sp|P78012.1|CH60_MYCPN  RecName: Full=60 kDa chaperonin; AltNa...   197    4e-50 
sp|O32606.1|CH60_EHRSE  RecName: Full=60 kDa chaperonin; AltNa...   197    6e-50 
sp|Q43831.1|RUBB_SECCE  RecName: Full=RuBisCO large subunit-bi...   196    1e-49 
sp|P48214.2|CH60_EHRRI  RecName: Full=60 kDa chaperonin; AltNa...   196    1e-49 
sp|P48213.2|CH60_EHRRW  RecName: Full=60 kDa chaperonin; AltNa...   195    2e-49  Gene info
sp|Q5PA30.1|CH60_ANAMM  RecName: Full=60 kDa chaperonin; AltNa...   195    2e-49  Gene info
sp|Q2GL94.1|CH60_ANAPZ  RecName: Full=60 kDa chaperonin; AltNa...   191    3e-48  Gene info
sp|O34191.1|CH60_ANAPH  RecName: Full=60 kDa chaperonin; AltNa...   191    3e-48 
sp|Q73I71.1|CH60_WOLPM  RecName: Full=60 kDa chaperonin; AltNa...   189    2e-47 
sp|C0R2V3.1|CH60_WOLWR  RecName: Full=60 kDa chaperonin; AltNa...   189    2e-47 
sp|B3CL71.1|CH60_WOLPP  RecName: Full=60 kDa chaperonin; AltNa...   185    2e-46  Gene info
sp|Q5GST5.1|CH60_WOLTR  RecName: Full=60 kDa chaperonin; AltNa...   180    6e-45  Gene info
sp|Q48900.1|CH60_MYCAV  RecName: Full=60 kDa chaperonin; AltNa...   179    1e-44 
sp|Q50220.1|CH60_MYCMR  RecName: Full=60 kDa chaperonin; AltNa...   178    2e-44 
sp|Q49093.1|CH60_MYCCH  RecName: Full=60 kDa chaperonin; AltNa...   177    4e-44 
sp|Q49160.1|CH60_MYCFO  RecName: Full=60 kDa chaperonin; AltNa...   176    7e-44 
sp|P59698.1|CH602_CHLCV  RecName: Full=60 kDa chaperonin 2; Al...   174    5e-43 
sp|P34940.1|CH60_PLAFG  RecName: Full=Chaperonin CPN60, mitoch...   166    2e-40 
sp|Q7WZ32.1|CH603_METCA  RecName: Full=60 kDa chaperonin 3; Al...   162    2e-39 
sp|Q50382.1|CH60_MYCSC  RecName: Full=60 kDa chaperonin; AltNa...   140    5e-33 
sp|Q50212.1|CH60_MYCMA  RecName: Full=60 kDa chaperonin; AltNa...   139    1e-32 
sp|Q49564.1|CH60_MYCIT  RecName: Full=60 kDa chaperonin; AltNa...   139    1e-32 
sp|Q50271.1|CH60_MYCPV  RecName: Full=60 kDa chaperonin; AltNa...   138    3e-32 
sp|Q50826.1|CH60_MYCUL  RecName: Full=60 kDa chaperonin; AltNa...   137    4e-32 
sp|Q48884.1|CH60_MYCAS  RecName: Full=60 kDa chaperonin; AltNa...   137    4e-32 
sp|Q50373.1|CH60_MYCRH  RecName: Full=60 kDa chaperonin; AltNa...   137    4e-32 
sp|Q49375.1|CH60_MYCGO  RecName: Full=60 kDa chaperonin; AltNa...   137    6e-32 
sp|Q50270.1|CH60_MYCPH  RecName: Full=60 kDa chaperonin; AltNa...   137    7e-32 
sp|Q50852.1|CH60_MYCXE  RecName: Full=60 kDa chaperonin; AltNa...   137    7e-32 
sp|Q49374.1|CH60_MYCGN  RecName: Full=60 kDa chaperonin; AltNa...   137    8e-32 
sp|Q49373.1|CH60_MYCGS  RecName: Full=60 kDa chaperonin; AltNa...   136    1e-31 
sp|Q9Z7C9.2|CH602_CHLPN  RecName: Full=60 kDa chaperonin 2; Al...   135    1e-31 
sp|Q49155.1|CH60_MYCFA  RecName: Full=60 kDa chaperonin; AltNa...   135    2e-31 
sp|Q50255.1|CH60_MYCNO  RecName: Full=60 kDa chaperonin; AltNa...   135    2e-31 
sp|Q48883.1|CH60_MYCAG  RecName: Full=60 kDa chaperonin; AltNa...   135    2e-31 
sp|Q50383.1|CH60_MYCSH  RecName: Full=60 kDa chaperonin; AltNa...   135    2e-31 
sp|Q49025.1|CH60_MYCCI  RecName: Full=60 kDa chaperonin; AltNa...   135    2e-31 
sp|Q50827.1|CH60_MYCVA  RecName: Full=60 kDa chaperonin; AltNa...   134    4e-31 
sp|Q42693.1|RUBB_CHLRE  RecName: Full=RuBisCO large subunit-bi...  99.0    2e-20 
sp|O26885.1|THSB_METTH  RecName: Full=Thermosome subunit beta;...  80.1    1e-14  Gene info
sp|O26320.2|THSA_METTH  RecName: Full=Thermosome subunit alpha...  80.1    1e-14 
sp|Q9V2Q7.1|THS_PYRAB  RecName: Full=Thermosome subunit; AltNa...  78.2    4e-14 
sp|O30560.1|THS2_HALVO  RecName: Full=Thermosome subunit 2; Al...  76.6    1e-13 
sp|O57762.1|THS_PYRHO  RecName: Full=Thermosome subunit; AltNa...  76.6    1e-13 
sp|Q9HNI0.2|THSB_HALSA  RecName: Full=Thermosome subunit beta;...  75.9    2e-13 
sp|O93624.1|THS_METTL  RecName: Full=Thermosome subunit; AltNa...  75.9    2e-13 
sp|O28821.1|THSB_ARCFU  RecName: Full=Thermosome subunit beta;...  74.3    6e-13 
sp|Q58405.1|THS_METJA  RecName: Full=Thermosome subunit; AltNa...  73.2    1e-12 
sp|O24731.1|THSA_THEK8  RecName: Full=Thermosome subunit alpha...  72.8    2e-12 
sp|O28045.1|THSA_ARCFU  RecName: Full=Thermosome subunit alpha...  72.8    2e-12 
sp|P61111.1|THSA_PYRKO  RecName: Full=Thermosome subunit alpha...  71.6    3e-12  Gene info
sp|Q53546.1|THS_DESSY  RecName: Full=Thermosome subunit; AltNa...  71.2    4e-12 
sp|P50016.1|THS_METKA  RecName: Full=Thermosome subunit; AltNa...  71.2    5e-12 
sp|O24732.1|THSB_THEK8  RecName: Full=Thermosome subunit beta;...  70.5    7e-12 
sp|Q52500.1|THSB_PYRKO  RecName: Full=Thermosome subunit beta;...  69.7    1e-11  Gene info
sp|O24730.2|THSB_THEK1  RecName: Full=Thermosome subunit beta;...  69.7    1e-11 
sp|P47209.1|TCPE_CAEEL  RecName: Full=T-complex protein 1 subu...  67.4    7e-11  Gene info
sp|O30561.1|THS1_HALVO  RecName: Full=Thermosome subunit 1; Al...  67.0    9e-11 
sp|Q9HN70.2|THSA_HALSA  RecName: Full=Thermosome subunit alpha...  66.2    1e-10 
sp|Q5R5C8.1|TCPH_PONAB  RecName: Full=T-complex protein 1 subu...  65.1    3e-10  Gene info
sp|Q99832.2|TCPH_HUMAN  RecName: Full=T-complex protein 1 subu...  65.1    3e-10  Gene info
sp|P40413.3|TCPE_YEAST  RecName: Full=T-complex protein 1 subu...  65.1    3e-10  Gene info
sp|P80313.1|TCPH_MOUSE  RecName: Full=T-complex protein 1 subu...  64.7    4e-10  Gene info
sp|P48643.1|TCPE_HUMAN  RecName: Full=T-complex protein 1 subu...  64.7    5e-10  Gene info
sp|Q2NKZ1.1|TCPH_BOVIN  RecName: Full=T-complex protein 1 subu...  64.7    5e-10  Gene info
sp|Q5RF02.1|TCPE_PONAB  RecName: Full=T-complex protein 1 subu...  64.3    5e-10  Gene info
sp|P48424.1|THSA_THEAC  RecName: Full=Thermosome subunit alpha...  63.9    6e-10 
sp|Q9YDK6.2|THSA_AERPE  RecName: Full=Thermosome subunit alpha...  63.9    7e-10 
sp|P48425.1|THSB_THEAC  RecName: Full=Thermosome subunit beta;...  63.5    9e-10 
sp|P47207.2|TCPB_CAEEL  RecName: Full=T-complex protein 1 subu...  63.5    1e-09  Gene info
sp|Q54ES9.1|TCPB_DICDI  RecName: Full=T-complex protein 1 subu...  63.2    1e-09 
sp|P80314.4|TCPB_MOUSE  RecName: Full=T-complex protein 1 subu...  62.4    2e-09  Gene info
sp|Q5ZJK8.1|TCPH_CHICK  RecName: Full=T-complex protein 1 subu...  62.0    3e-09  Gene info
sp|Q54ER7.1|TCPH_DICDI  RecName: Full=T-complex protein 1 subu...  62.0    3e-09 
sp|Q75A36.1|TCPD_ASHGO  RecName: Full=T-complex protein 1 subu...  61.2    5e-09 
sp|Q68FQ0.1|TCPE_RAT  RecName: Full=T-complex protein 1 subuni...  61.2    5e-09  Gene info
sp|Q5XIM9.3|TCPB_RAT  RecName: Full=T-complex protein 1 subuni...  60.8    6e-09  Gene info
sp|P39078.2|TCPD_YEAST  RecName: Full=T-complex protein 1 subu...  60.8    6e-09  Gene info
sp|P80316.1|TCPE_MOUSE  RecName: Full=T-complex protein 1 subu...  60.5    7e-09  Gene info
sp|Q6CL82.1|TCPD_KLULA  RecName: Full=T-complex protein 1 subu...  60.5    8e-09 
sp|Q7TPB1.3|TCPD_RAT  RecName: Full=T-complex protein 1 subuni...  60.5    9e-09  Gene info
sp|P78371.4|TCPB_HUMAN  RecName: Full=T-complex protein 1 subu...  60.1    9e-09  Gene info
sp|P54409.1|TCPH_TETPY  RecName: Full=T-complex protein 1 subu...  60.1    1e-08 
sp|Q9YA66.2|THSB_AERPE  RecName: Full=Thermosome subunit beta;...  60.1    1e-08 
sp|P80315.3|TCPD_MOUSE  RecName: Full=T-complex protein 1 subu...  60.1    1e-08  Gene info
sp|P50991.4|TCPD_HUMAN  RecName: Full=T-complex protein 1 subu...  59.7    1e-08  Gene info
sp|Q5R637.3|TCPD_PONAB  RecName: Full=T-complex protein 1 subu...  59.7    1e-08  Gene info
sp|Q54TD3.1|TCPE_DICDI  RecName: Full=T-complex protein 1 subu...  59.3    2e-08 
sp|Q6FQT2.1|TCPD_CANGA  RecName: Full=T-complex protein 1 subu...  58.5    3e-08 
sp|Q9UTM4.1|TCPE_SCHPO  RecName: Full=T-complex protein 1 subu...  58.5    3e-08  Gene info
sp|Q55BM4.1|TCPA_DICDI  RecName: Full=T-complex protein 1 subu...  58.2    4e-08 
sp|Q3ZBH0.3|TCPB_BOVIN  RecName: Full=T-complex protein 1 subu...  58.2    4e-08  Gene info
sp|P80317.3|TCPZ_MOUSE  RecName: Full=T-complex protein 1 subu...  57.8    6e-08  Gene info
sp|O24735.1|THSB_SULTO  RecName: Full=Thermosome subunit beta;...  57.4    6e-08 
sp|Q54CL2.1|TCPD_DICDI  RecName: Full=T-complex protein 1 subu...  57.4    6e-08 
sp|Q3MHL7.3|TCPZ_BOVIN  RecName: Full=T-complex protein 1 subu...  57.4    6e-08  Gene info
sp|P53451.1|TCPD_FUGRU  RecName: Full=T-complex protein 1 subu...  57.4    7e-08  Gene info
sp|Q9NB32.1|TCPD_AEDTR  RecName: Full=T-complex protein 1 subu...  57.4    7e-08 
sp|Q5RCD2.3|TCPZ_PONAB  RecName: Full=T-complex protein 1 subu...  57.4    7e-08  Gene info
sp|P40227.3|TCPZ_HUMAN  RecName: Full=T-complex protein 1 subu...  57.4    7e-08  Gene info
sp|Q8SSC9.1|TCPA_ENCCU  RecName: Full=T-complex protein 1 subu...  57.0    8e-08 
sp|Q94757.1|TCPA_SCHMA  RecName: Full=T-complex protein 1 subu...  57.0    8e-08 
sp|O77622.3|TCPZ_RABIT  RecName: Full=T-complex protein 1 subu...  57.0    9e-08  Gene info
sp|O04450.1|TCPE_ARATH  RecName: Full=T-complex protein 1 subu...  56.6    1e-07 
sp|Q2T9X2.3|TCPD_BOVIN  RecName: Full=T-complex protein 1 subu...  56.6    1e-07  Gene info
sp|Q8SRP9.1|TCPE_ENCCU  RecName: Full=T-complex protein 1 subu...  56.2    1e-07 
sp|Q9V2S9.2|THSA_SULSO  RecName: Full=Thermosome subunit alpha...  56.2    2e-07 
sp|P46219.1|THSA_SULSH  RecName: Full=Thermosome subunit alpha...  55.8    2e-07 
sp|Q5ZJ54.3|TCPZ_CHICK  RecName: Full=T-complex protein 1 subu...  55.5    3e-07  Gene info
sp|Q8SR76.1|TCPG_ENCCU  RecName: Full=T-complex protein 1 subu...  55.1    3e-07 
sp|Q9HHA2.1|THS3_HALVO  RecName: Full=Thermosome subunit 3; Al...  55.1    3e-07 
sp|P54411.1|TCPE2_AVESA  RecName: Full=T-complex protein 1 sub...  54.7    4e-07 
sp|Q10147.1|TCPB_SCHPO  RecName: Full=Probable T-complex prote...  54.7    4e-07  Gene info
sp|P40412.1|TCPE1_AVESA  RecName: Full=T-complex protein 1 sub...  54.7    4e-07 
sp|Q9V2T5.2|THSA_SULAC  RecName: Full=Thermosome subunit alpha...  54.3    5e-07 
sp|O77323.1|TCPH_PLAF7  RecName: Full=T-complex protein 1 subu...  53.9    7e-07  Gene info
sp|P50999.2|TCPD_SCHPO  RecName: Full=T-complex protein 1 subu...  53.9    8e-07  Gene info
sp|Q92526.4|TCPW_HUMAN  RecName: Full=T-complex protein 1 subu...  53.5    9e-07  Gene info
sp|O15891.1|TCPA_TETPY  RecName: Full=T-complex protein 1 subu...  53.5    1e-06 
sp|Q6BXF6.1|TCPD_DEBHA  RecName: Full=T-complex protein 1 subu...  53.1    1e-06 
sp|P87153.1|TCPH_SCHPO  RecName: Full=Probable T-complex prote...  53.1    1e-06  Gene info
sp|Q6C100.1|TCPD_YARLI  RecName: Full=T-complex protein 1 subu...  53.1    1e-06 
sp|P28769.1|TCPA_ARATH  RecName: Full=T-complex protein 1 subu...  52.8    2e-06 
sp|P39076.1|TCPB_YEAST  RecName: Full=T-complex protein 1 subu...  52.8    2e-06  Gene info
sp|Q3T084.3|TCPW_BOVIN  RecName: Full=T-complex protein 1 subu...  52.8    2e-06  Gene info
sp|O24734.1|THSA_SULTO  RecName: Full=Thermosome subunit alpha...  52.8    2e-06 
sp|P11984.2|TCPA1_MOUSE  RecName: Full=T-complex protein 1 sub...  52.4    2e-06  Gene info
sp|Q8SQP2.1|TCPB_ENCCU  RecName: Full=T-complex protein 1 subu...  52.4    2e-06 
sp|O94515.1|TCPZ_SCHPO  RecName: Full=T-complex protein 1 subu...  52.0    3e-06  Gene info
sp|P28480.1|TCPA_RAT  RecName: Full=T-complex protein 1 subuni...  52.0    3e-06  Gene info
sp|P18279.1|TCPA_CRIGR  RecName: Full=T-complex protein 1 subu...  52.0    3e-06 
sp|P17987.1|TCPA_HUMAN  RecName: Full=T-complex protein 1 subu...  52.0    3e-06  Gene info
sp|Q32L40.1|TCPA_BOVIN  RecName: Full=T-complex protein 1 subu...  51.6    3e-06  Gene info
sp|Q9V2T4.2|THSB_SULAC  RecName: Full=Thermosome subunit beta;...  51.6    4e-06 
sp|P80502.1|CH60_SOLTU  RecName: Full=Chaperonin HSP60, mitoch...  51.6    4e-06 
sp|Q9XT06.1|TCPA_MONDO  RecName: Full=T-complex protein 1 subu...  50.8    6e-06  Gene info
sp|Q61390.4|TCPW_MOUSE  RecName: Full=T-complex protein 1 subu...  50.8    6e-06  Gene info
sp|P42943.1|TCPH_YEAST  RecName: Full=T-complex protein 1 subu...  50.8    6e-06  Gene info
sp|P11983.3|TCPA2_MOUSE  RecName: Full=T-complex protein 1 sub...  50.4    7e-06  Gene info
sp|Q9W790.1|TCPA_PALPA  RecName: Full=T-complex protein 1 subu...  50.4    8e-06 
sp|P39079.1|TCPZ_YEAST  RecName: Full=T-complex protein 1 subu...  50.4    8e-06  Gene info
sp|P12613.2|TCPA_DROME  RecName: Full=T-complex protein 1 subu...  50.4    8e-06  Gene info
sp|O94501.1|TCPA_SCHPO  RecName: Full=T-complex protein 1 subu...  50.1    1e-05  Gene info
sp|P41988.2|TCPA_CAEEL  RecName: Full=T-complex protein 1 subu...  50.1    1e-05  Gene info
sp|P12612.2|TCPA_YEAST  RecName: Full=T-complex protein 1 subu...  50.1    1e-05  Gene info
sp|P47208.1|TCPD_CAEEL  RecName: Full=T-complex protein 1 subu...  49.7    1e-05  Gene info
sp|P61491.2|CH60_THETH  RecName: Full=60 kDa chaperonin; AltNa...  49.7    2e-05 
sp|Q9V2T8.2|THSB_SULSO  RecName: Full=Thermosome subunit beta;...  49.3    2e-05 
sp|Q9V2T3.1|THSB_DESMO  RecName: Full=Thermosome subunit beta;...  48.9    3e-05 
sp|Q54TH8.1|TCPG_DICDI  RecName: Full=T-complex protein 1 subu...  48.5    3e-05 
sp|Q76NU3.1|TCPZ_DICDI  RecName: Full=T-complex protein 1 subu...  48.5    3e-05 
sp|Q4R5G2.1|TCPA_MACFA  RecName: Full=T-complex protein 1 subu...  48.5    3e-05 
sp|P28488.1|THSB_SULSH  RecName: Full=Thermosome subunit beta;...  48.5    3e-05 
sp|O74341.1|TCPG_SCHPO  RecName: Full=T-complex protein 1 subu...  48.1    4e-05  Gene info
sp|O00782.1|TCPG_OXYGR  RecName: Full=T-complex protein 1 subu...  48.1    4e-05 
sp|P54410.1|TCPH_TETTH  RecName: Full=T-complex protein 1 subu...  48.1    4e-05 
sp|P48605.2|TCPG_DROME  RecName: Full=T-complex protein 1 subu...  47.8    5e-05  Gene info
sp|Q6EE31.3|TCPQ_CHICK  RecName: Full=T-complex protein 1 subu...  47.8    5e-05  Gene info
sp|P39077.2|TCPG_YEAST  RecName: Full=T-complex protein 1 subu...  47.8    5e-05  Gene info
sp|Q9LKI7.1|TCPG_THAWE  RecName: Full=T-complex protein 1 subu...  47.8    6e-05 
sp|Q29236.1|TCPZ_PIG  RecName: Full=T-complex protein 1 subuni...  47.4    7e-05 
sp|P46550.1|TCPZ_CAEEL  RecName: Full=T-complex protein 1 subu...  46.6    1e-04  Gene info
sp|Q5NVF9.1|TCPG_PONAB  RecName: Full=T-complex protein 1 subu...  45.8    2e-04  Gene info
sp|P49368.4|TCPG_HUMAN  RecName: Full=T-complex protein 1 subu...  45.8    2e-04  Gene info
sp|Q552J0.1|TCPQ_DICDI  RecName: Full=T-complex protein 1 subu...  45.4    3e-04 
sp|P80318.1|TCPG_MOUSE  RecName: Full=T-complex protein 1 subu...  45.1    3e-04  Gene info
sp|Q3T0K2.1|TCPG_BOVIN  RecName: Full=T-complex protein 1 subu...  45.1    3e-04  Gene info
sp|Q6P502.1|TCPG_RAT  RecName: Full=T-complex protein 1 subuni...  45.1    3e-04  Gene info
sp|P50143.2|TCPG_XENLA  RecName: Full=T-complex protein 1 subu...  44.7    4e-04  Gene info
sp|P47828.2|TCPQ_CANAL  RecName: Full=T-complex protein 1 subu...  44.7    5e-04 
sp|Q9V2T7.1|THSG_SULSO  RecName: Full=Thermosome subunit gamma...  43.9    7e-04 
sp|Q4R5J0.1|TCPQ_MACFA  RecName: Full=T-complex protein 1 subu...  43.9    7e-04 
sp|P50990.4|TCPQ_HUMAN  RecName: Full=T-complex protein 1 subu...  43.9    8e-04  Gene info
sp|P78921.3|TCPQ_SCHPO  RecName: Full=Probable T-complex prote...  43.9    8e-04  Gene info
sp|A6NM43.1|TCPQL_HUMAN  RecName: Full=Putative T-complex prot...  43.5    0.001  Gene info
sp|P42932.3|TCPQ_MOUSE  RecName: Full=T-complex protein 1 subu...  43.5    0.001  Gene info
sp|P56281.1|CH60_LEITA  RecName: Full=Chaperonin HSP60, mitoch...  43.1    0.001 
sp|Q4R963.1|TCPG_MACFA  RecName: Full=T-complex protein 1 subu...  42.7    0.002 
sp|P54408.1|TCPG_TETPY  RecName: Full=T-complex protein 1 subu...  42.4    0.002 
sp|Q96SF2.1|TCPQM_HUMAN  RecName: Full=Putative T-complex prot...  42.0    0.003  Gene info
sp|Q9N358.2|TCPQ_CAEEL  RecName: Full=T-complex protein 1 subu...  42.0    0.003  Gene info
sp|Q3ZCI9.3|TCPQ_BOVIN  RecName: Full=T-complex protein 1 subu...  40.8    0.006  Gene info
sp|Q29068.1|TCPG_PIG  RecName: Full=T-complex protein 1 subuni...  40.8    0.007  Gene info
sp|P47079.1|TCPQ_YEAST  RecName: Full=T-complex protein 1 subu...  40.4    0.009  Gene info
sp|Q9HH21.1|THSG_SULSH  RecName: Full=Thermosome subunit gamma...  40.0    0.011 
sp|Q8SSH3.1|TCPD_ENCCU  RecName: Full=T-complex protein 1 subu...  39.7    0.014 
sp|Q8SS33.1|TCPQ_ENCCU  RecName: Full=T-complex protein 1 subu...  37.0    0.10  
sp|Q8SR53.1|TCPH_ENCCU  RecName: Full=T-complex protein 1 subu...  35.4    0.28  
sp|Q1LU41.1|THIG_BAUCH  RecName: Full=Thiazole biosynthesis pr...  34.7    0.49   Gene info
sp|Q8TAM1.2|BBS10_HUMAN  RecName: Full=Bardet-Biedl syndrome 1...  34.3    0.60   Gene info
sp|Q5R8P3.1|BBS10_PONAB  RecName: Full=Bardet-Biedl syndrome 1...  34.3    0.60   Gene info
sp|Q9DBI2.2|BBS10_MOUSE  RecName: Full=Bardet-Biedl syndrome 1...  32.3    2.3    Gene info
sp|Q1AW85.1|FABZ_RUBXD  RecName: Full=(3R)-hydroxymyristoyl-[a...  32.0    2.7    Gene info
sp|P81339.1|CH60_CLOPA  RecName: Full=60 kDa chaperonin; AltNa...  32.0    2.8   
sp|Q9HIH4.1|RLME_THEAC  RecName: Full=Ribosomal RNA large subu...  32.0    3.2   
sp|Q9Y8T6.1|TRPF_AERPE  RecName: Full=N-(5'-phosphoribosyl)ant...  31.6    3.9   
sp|Q3MHJ9.1|KCC2B_BOVIN  RecName: Full=Calcium/calmodulin-depe...  31.2    4.7    Gene info
sp|Q8DEK5.2|MURE_VIBVU  RecName: Full=UDP-N-acetylmuramoyl-L-a...  31.2    5.6   
sp|O67853.1|TRPF_AQUAE  RecName: Full=N-(5'-phosphoribosyl)ant...  31.2    5.8   
sp|P28652.2|KCC2B_MOUSE  RecName: Full=Calcium/calmodulin-depe...  30.8    7.4    Gene info
sp|P08413.1|KCC2B_RAT  RecName: Full=Calcium/calmodulin-depend...  30.8    7.6    Gene info
sp|Q7MNV6.2|MURE_VIBVY  RecName: Full=UDP-N-acetylmuramoyl-L-a...  30.4    8.9   
sp|Q9VYQ5.4|CP318_DROME  RecName: Full=Probable cytochrome P45...  30.4    8.9    Gene info
sp|P0A0X0.2|RL7_NEIMA  RecName: Full=50S ribosomal protein L7/...  30.4    9.4   
sp|P0A0W8.1|RL7_NEILA  RecName: Full=50S ribosomal protein L7/...  30.4    9.8   

first 10 alignments:

>sp|Q4FPA5.1|CH60_PELUB Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=554

 GENE ID: 3516889 groEL | 60 kDa chaperonin
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  422 bits (1085),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)

Query  2    MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEID  61
            M+K+VKFDSEAR+AM++GVDILANTVK TLGPKGRNVVIDKSYGAPR TKDGV+VAKEID
Sbjct  1    MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEID  60

Query  62   LEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGID  121
            LEDKFENMGAQMVKEVASKTN+EAGDGTTTATILAQAIVKEG KYVTAGMNPMDVKRGID
Sbjct  61   LEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGID  120

Query  122  AAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  181
            AAVE VK  LI+SAKKVKD+DEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK
Sbjct  121  AAVEHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  180

Query  182  GIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            G+ETELDVVEGMQFDRGYLSPYFITN DKMTTELENP ILLHEKK
Sbjct  181  GVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKK  225


>sp|B1LVA0.1|CH60_METRJ Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=546

 GENE ID: 6136547 Mrad2831_0534 | chaperonin GroEL
[Methylobacterium radiotolerans JCM 2831]

 Score =  357 bits (917),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 174/226 (76%), Positives = 197/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K V+F ++AR  ML+GVDILA+ VK TLGPKGRNVVI+KS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +L DKFENMGAQMV+EVASKTND AGDGTTTAT+LAQAIV+EG KYV AG+NPMD+KRGI
Sbjct  61   ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A +   + +I+ AKKV  SDE+AQVGTISANGDKEIG MIA AMQKVGNEGVITVEEA
Sbjct  121  DLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETELDVVEGMQFDRGYLSPYFITN +KM  ELE+P IL+HEKK
Sbjct  181  KTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDPYILIHEKK  226


>sp|A8LJP9.1|CH60_DINSH Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=547

 GENE ID: 5710770 groL | 60 kDa chaperonin [Dinoroseobacter shibae DFL 12]

 Score =  357 bits (915),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD +AR+ MLKGV+ILA+ VK TLGPKGRNVV+DKS+GAPR TKDGV+VAKEI
Sbjct  1    MAAKDVKFDIDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAIVKEG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V E + S+A+ V DS E+AQVGTISANG+ EIG  IA AMQKVGNEGVITVEE 
Sbjct  121  DLATSKVVEAIKSAARPVNDSAEVAQVGTISANGESEIGQQIADAMQKVGNEGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKMTTELE+ +ILLHEKK
Sbjct  181  KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDAIILLHEKK  226


>sp|Q16C40.1|CH601_ROSDO Gene info RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cpn60 
1; AltName: Full=groEL protein 1
Length=543

 GENE ID: 4197876 groEL | chaperonin GroEL [Roseobacter denitrificans OCh 114]
(10 or fewer PubMed links)

 Score =  353 bits (907),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 198/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD+ ARS ML+GV+ LA+ VK TLGPKGRNVVIDKS+GAPR TKDGVTVAKEI
Sbjct  1    MSAKDVKFDTAARSRMLRGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TND+AGDGTTT+T+LAQAIV EG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDQAGDGTTTSTVLAQAIVNEGMKAVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V E + ++A+ VKDSDE+AQVGTISANG+ EIG  IA AMQKVGN+GVITVEE 
Sbjct  121  DLATSKVVEAIKAAARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE +VVEGMQFDRGYLSPYF+TN DKMT ELE+P IL+HEKK
Sbjct  181  KGLETETEVVEGMQFDRGYLSPYFVTNPDKMTAELEDPFILIHEKK  226


>sp|Q162U5.1|CH602_ROSDO Gene info RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cpn60 
2; AltName: Full=groEL protein 2
Length=547

 GENE ID: 4195865 groEL | chaperonin GroEL [Roseobacter denitrificans OCh 114]
(10 or fewer PubMed links)

 Score =  353 bits (906),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 173/226 (76%), Positives = 199/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD++AR+ MLKGV+ILA+ VK TLGPKGRNVV+DKS+GAPR TKDGV+VAKEI
Sbjct  1    MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAIVKEG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V   +  +A++V DS E+AQVGTISANG+ EIG  IA AMQKVGNEGVITVEE 
Sbjct  121  DLATVKVVAAIKDAAREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKMTTELE+ ++LLHEKK
Sbjct  181  KGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELEDCIVLLHEKK  226


>sp|Q1GJ36.1|CH60_SILST Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=547

 GENE ID: 4078635 groEL | chaperonin GroEL [Silicibacter sp. TM1040]

 Score =  353 bits (905),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/226 (75%), Positives = 201/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKFD++AR+ MLKGV+ LA+ VK TLGPKGRNVV++KS+GAPR TKDGV+VAKEI
Sbjct  1    MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQ+IV+EG K V AG+NPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGLKQVAAGLNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A ++V E + + A++VKDSDE+AQVGTISANG+ EIG  IA AMQKVGN+GVITVEE 
Sbjct  121  DLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKMT ELE+ LILLHEKK
Sbjct  181  KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILLHEKK  226


>sp|Q28LY7.1|CH60_JANSC Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=546

 GENE ID: 3935831 groEL | chaperonin GroEL [Jannaschia sp. CCS1]

 Score =  353 bits (905),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 173/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)

Query  2    MSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEID  61
            M+K V+FD++AR+ MLKGV+ LA+ VK TLGPKGRNVVIDKS+GAPR TKDGV+VAKEI+
Sbjct  1    MAKDVRFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIE  60

Query  62   LEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGID  121
            LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAI+KEG K V AGMNPMD+KRGID
Sbjct  61   LEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKSVAAGMNPMDLKRGID  120

Query  122  AAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAK  181
             AV +V  ++  SA++V DSDE+AQVGTISANG+ EIG  IA AMQKVGN+GVITVEE K
Sbjct  121  LAVTKVIAEIQGSAREVADSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEENK  180

Query  182  GIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            G+ETE DVVEGMQFDRGYLSPYF+TN DKM  EL++ LILLHEKK
Sbjct  181  GLETETDVVEGMQFDRGYLSPYFVTNPDKMIAELDDCLILLHEKK  225


>sp|Q98IH9.1|CH602_RHILO  RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cpn60 
2; AltName: Full=groEL protein 2
Length=542

 Score =  352 bits (902),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/226 (76%), Positives = 198/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKF S+AR  ML+GV+ILA+ VK TLGPKGRNVVIDKS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMV+EVASKT+D AGDGTTTAT+LAQAIVKEG K V +GMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D AVE + ++L ++A+KV  +DEIAQVGTISANGD EIG  +A+AMQKVGNEGVITVEEA
Sbjct  121  DKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETEL+VVEGMQFDRGYLSPYFITN DKM  ELE P +L+HEKK
Sbjct  181  KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKK  226


>sp|Q11DQ8.1|CH602_MESSB Gene info RecName: Full=60 kDa chaperonin 2; AltName: Full=Protein Cpn60 
2; AltName: Full=groEL protein 2
Length=542

 GENE ID: 4183282 groEL | chaperonin GroEL [Mesorhizobium sp. BNC1]

 Score =  352 bits (902),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 197/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKF S+AR  ML+GVD+LAN VK TLGPKGRNVVIDKS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKDVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMV+EVASKTND AGDGTTTAT+L QAIVKEG K V +GMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVREVASKTNDAAGDGTTTATVLTQAIVKEGAKAVASGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D AVE + E+L  +A+KV  +DEIAQVGTISANGD+EIG  +A+AM+KVGNEGVITVEEA
Sbjct  121  DKAVEAIVEELKKNARKVTKNDEIAQVGTISANGDQEIGRFLAQAMEKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETEL+VVEGMQFDRGYLSPYFITN +KM  EL+ P +L+HEKK
Sbjct  181  KTAETELEVVEGMQFDRGYLSPYFITNQEKMRVELDEPYLLIHEKK  226


>sp|Q5LV15.1|CH60_SILPO  RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=546

 Score =  351 bits (901),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/226 (75%), Positives = 199/226 (88%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKF++EAR+ MLKGV+ILA+ VK TLGPKGRNVV+DKS+GAPR TKDGV+VAKEI
Sbjct  1    MAAKDVKFNTEARNKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMVKEVAS+TNDEAGDGTTTAT+LAQAIV+EG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A  +V E + ++++ V DS E+AQVGTISANG+ EIG  IA+AMQKVGNEGVITVEE 
Sbjct  121  DLATAKVVEAIKAASRPVNDSAEVAQVGTISANGESEIGRQIAEAMQKVGNEGVITVEEN  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            KG+ETE DVVEGMQFDRGYLSPYF+TN DKM  ELE+ +ILLHEKK
Sbjct  181  KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCMILLHEKK  226


>sp|B1ZAU5.1|CH60_METPB Gene info RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; 
AltName: Full=groEL protein
Length=546

 GENE ID: 6309210 Mpop_5325 | chaperonin GroEL [Methylobacterium populi BJ001]

 Score =  351 bits (901),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (86%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K V+F ++AR  ML+GVDILA+ VK TLGPKGRNVVI+KS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +L DKFENMGAQMV+EVASKTND AGDGTTTAT+LAQAIV+EG K+V AG+NPMD+KRGI
Sbjct  61   ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKFVAAGINPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D A +   + + + AKKV  S+E+AQVGTISANGDKEIG MIA AMQKVGNEGVITVEEA
Sbjct  121  DLATQAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K  ETELDVVEGMQFDRGYLSPYF+TN +KM  ELE+P IL+HEKK
Sbjct  181  KTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKK  226


>sp|A4YRI5.1|CH601_BRASO Gene info RecName: Full=60 kDa chaperonin 1; AltName: Full=Protein Cpn60 
1; AltName: Full=groEL protein 1
Length=539

 GENE ID: 5121038 groEL | chaperonin GroEL [Bradyrhizobium sp. ORS278]
(10 or fewer PubMed links)

 Score =  351 bits (900),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/226 (75%), Positives = 197/226 (87%), Gaps = 0/226 (0%)

Query  1    LMSKIVKFDSEARSAMLKGVDILANTVKTTLGPKGRNVVIDKSYGAPRTTKDGVTVAKEI  60
            + +K VKF ++AR  ML+GVDILAN VK TLGPKGRNVVI+KS+GAPR TKDGVTVAKEI
Sbjct  1    MAAKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI  60

Query  61   DLEDKFENMGAQMVKEVASKTNDEAGDGTTTATILAQAIVKEGCKYVTAGMNPMDVKRGI  120
            +LEDKFENMGAQMV+EVASKT D AGDGTTTAT+LAQAIVKEG K V AGMNPMD+KRGI
Sbjct  61   ELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI  120

Query  121  DAAVEQVKEKLISSAKKVKDSDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEA  180
            D AVE + + L + AKK+  +DEIAQVGTISANGD EIG  +A+AMQKVGNEGVITVEEA
Sbjct  121  DLAVEAIVKDLKAHAKKITSNDEIAQVGTISANGDSEIGRFLAEAMQKVGNEGVITVEEA  180

Query  181  KGIETELDVVEGMQFDRGYLSPYFITNGDKMTTELENPLILLHEKK  226
            K ++TEL+VVEGMQFDRGY+SPYF+TN +KM  ELE+P IL+HEKK
Sbjct  181  KSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKK  226

c)
YP_265587.1	
60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062] >sp|Q4FPA5.1|CH60_PELUB RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; AltName: Full=groEL protein >gb|AAZ20984.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
408	 433	98%	5e-113	91%	
ZP_01264674.1	
60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002] >gb|EAS85161.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
405	 431	98%	3e-112	90%	
ZP_05069866.1	
chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211] >gb|EDZ60865.1| chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211]
399	 424	98%	4e-110	89%	
ZP_06054579.1	
chaperonin GroL [alpha proteobacterium HIMB114] >gb|EEY74348.1| chaperonin GroL [alpha proteobacterium HIMB114]
377	 377	94%	5e-103	83%	
ABR27784.1	
HSP60 [Candidatus Pelagibacter ubique]
362	 387	86%	4e-99	93%	
ABR27777.1	
HSP60 [Candidatus Pelagibacter ubique]
360	 386	86%	8e-99	92%	
ABR27776.1	
HSP60 [Candidatus Pelagibacter ubique HTCC1002] >gb|ABR27778.1| HSP60 [Candidatus Pelagibacter ubique] >gb|ABR27779.1| HSP60 [Candidatus Pelagibacter ubique] >gb|ABR27780.1| HSP60 [Candidatus Pelagibacter ubique] >gb|ABR27781.1| HSP60 [Candidatus Pelagibacter ubique] >gb|ABR27783.1| HSP60 [Candidatus Pelagibacter ubique]
359	 385	86%	2e-98	92%	
ABR27782.1	
HSP60 [Candidatus Pelagibacter ubique]
359	 385	86%	2e-98	92%	
ZP_02153075.1	
chaperonin GroEL [Oceanibulbus indolifex HEL-45] >gb|EDQ06942.1| chaperonin GroEL [Oceanibulbus indolifex HEL-45]
350	 374	99%	2e-95	77%	
ZP_01749368.1	
60 kDa chaperonin 1, putative [Roseobacter sp. CCS2] >gb|EBA13351.1| 60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
350	 374	99%	3e-95	77%	
ZP_00948346.1	
chaperonin GroEL [Sulfitobacter sp. NAS-14.1] >ref|ZP_00953801.1| chaperonin GroEL [Sulfitobacter sp. EE-36] >gb|EAP81826.1| chaperonin GroEL [Sulfitobacter sp. NAS-14.1] >gb|EAP85034.1| chaperonin GroEL [Sulfitobacter sp. EE-36]
347	 371	99%	3e-94	77%	
YP_001534253.1	
60 kDa chaperonin [Dinoroseobacter shibae DFL 12] >sp|A8LJP9.1|CH60_DINSH RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; AltName: Full=groEL protein >gb|ABV94652.1| 60 kDa chaperonin [Dinoroseobacter shibae DFL 12]
347	 371	99%	3e-94	77%	
ZP_05786825.1	
chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157] >gb|EEX09941.1| chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157]
346	 370	99%	6e-94	76%	
ZP_01016168.1	
putative heat shock protein groEL [Parvularcula bermudensis HTCC2503] >gb|EAQ16679.1| putative heat shock protein groEL [Parvularcula bermudensis HTCC2503]
347	 347	94%	7e-94	77%	
ZP_00959312.1	
chaperonin GroEL [Roseovarius nubinhibens ISM] >gb|EAP77774.1| chaperonin GroEL [Roseovarius nubinhibens ISM]
345	 369	99%	8e-94	76%	
ZP_05100668.1	
chaperonin GroL [Roseobacter sp. GAI101] >gb|EEB84970.1| chaperonin GroL [Roseobacter sp. GAI101]
345	 369	99%	1e-93	76%	
YP_001753228.1	
chaperonin GroEL [Methylobacterium radiotolerans JCM 2831] >sp|B1LVA0.1|CH60_METRJ RecName: Full=60 kDa chaperonin; AltName: Full=Protein Cpn60; AltName: Full=groEL protein >gb|ACB22545.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
345	 345	94%	2e-93	76%	
ZP_01438707.1	
chaperonin GroEL [Fulvimarina pelagi HTCC2506] >gb|EAU41771.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
345	 345	94%	3e-93	76%	
ZP_05742950.1	
chaperonin GroL [Silicibacter sp. TrichCH4B] >gb|EEW57109.1| chaperonin GroL [Silicibacter sp. TrichCH4B]
343	 367	99%	3e-93	75%	
YP_683684.1	
chaperonin GroEL [Roseobac