GOS 1181020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_446
Annotathon code: GOS_1181020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : COMSATSISB
Username : Sadaf_Ali
Annotated on : 2010-01-24 15:53:54
  • Ali Sadaf

Synopsis

  • Taxonomy: Burkholderia (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 32008
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Betaproteobacteria - Order: Burkholderiales
    Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia;

Genomic Sequence

>JCVI_READ_446 GOS_1181020 Genomic DNA
GCGTCGGATATCCTCGAGAAGGTTCTGCTCGTCGACGTAATAGAAGTCGCCATCATCGCTATGCGTGCTCGGGGCATCCTCTTCCTCGATGTTGGCGGCC
AGCAACTTTTTAACATCTTTGTTTGAAATACCACGCAGGACAATTCTTAATCGCTGATTTTTCGTCAGGATACCGCTGCCCTTGCTTTCACCATCTGGCA
AATTGCGATTCCACCAGTCAATGCACCATTGAGTACGCTCCGAGTTCGCGTAAGGCGGACGCTGCTGCACTTTCTTCTGAATGGGGCTGGTCCATCCCGA
AACCGGAATATCCGTGAATCCCGGCATGCTGTTCTGCTTTCGCGACCCCCGCGGGTCGAACCAGATCAGCAACCGAACGGTGACAGGATTGTCCTTACGC
TGCGTAATCTCTTCCAGTAGTGCACCGTAGACAATTCCGCGGGGCCAGCCCCCCGCAGCAGGCTTGGTGGGAAGCGGCTTTCCTTGAAACGTTGGAACTC
CGATGCCAGCCGGAGACTCCGAACCACGCCAGATTTCCATACCCGGATCAAACCCCCAACAACAGATGTCGACTGTCCCCTGGGCGCCCATGAGATCGGC
TGCTATTGACCTGAACCCTTCCTCGCCACAGACGAAGAACCTCATGTCGTTGCCCGTGGTCGGCATGACATCTTTGTCGACGTTTTTTTCAAGCAGCCAC
TGCACAGTGCCTTGCGCTGCGCGGCCCGCTTCATCGACAGCGACATCTACCGGGTTATGAGTTTCGAGGGGAAGCTGTGCCACGTTCTTTTCCTTATTGT
TTGATGTGCGTCGATATCGAGATCACGCCAGGCGTTCGCCGCG

Translation

[22 - 843/843]   indirect strand
>GOS_1181020 Translation [22-843   indirect strand]
SRYRRTSNNKEKNVAQLPLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIWRG
SESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSPIQKKVQQRPPYANSERTQWC
IDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKLLAANIEEEDAPSTHSDDGDFYYVDEQNLLEDIRR

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The metagenomic sequence proved to be coding becuase the translated ORF(longest of all;821bp) had strong homology with a beta-proteobacteria(score-454, 83%identity and e-value of 5e^-126), although no domains were reported.Based on these computational results, it was hypothesised that the metagenomic sequence may be a partial protein, and since it shows strong homology for this protein ' phospholipase D/transphosphatidylase '.

Phospholipase D (PLD)1 (,1) is present in bacteria, fungi, plants, and animals. It is widely distributed in mammalian cells, where it is regulated by a variety of hormones, growth factors, and other extracellular signals. Its major substrate is phosphatidylcholine (PC), which is hydrolyzed to phosphatidic acid (PA) and choline, but it can also act on phosphatidylethanolamine and phosphatidylinositol in some organisms and tissues.


Common ancestor was determined based on e-values and scores of the homologs.True positive homologs were differentiated with false positive homologs based on e-vlaues.The homologs with gretater score were classified as in-group(beta-proteobacteria) and homologs with low score were classified as out-group( gamma-proteobacteria + firmicutes).Bssed on score and %identity it was hypothesised that metagenomic sequence is a close relative of beta-proteobacteria.This hypothesis proved true, in the tree.Hence, it is conlcuded that the metagenomic sequence is probably a bacteria, and codes for an enzyme-phospholipase D.




ORF finding

PROTOCOL


SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'universal' genetic code


SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'universal' genetic code




RESULTS ANALYSIS


The total number of ORFs obtained were nine:


DIRECT strand(5'-3')

Reading frame 1 : three ORFs were obtained

Reading frame 2 : one ORF was obtained

Reading frame 3 : two ORFs were obtained


REVERSE strand(3'-5')

Reading frame 1 : one ORF was obtained

Reading frame 2 : two ORFs were obtained

Reading frame 3 : no ORF was obtained


longest ORF was ORF from reverse strand, reading frame1 with 821 bps.













RAW RESULTS

------DIRECT------
~~Reading frame 1~
>ORF number 1 in reading frame 1 on the direct strand extends from base 151 to base 420.
TCGCTGATTTTTCGTCAGGATACCGCTGCCCTTGCTTTCACCATCTGGCAAATTGCGATT
CCACCAGTCAATGCACCATTGAGTACGCTCCGAGTTCGCGTAAGGCGGACGCTGCTGCAC
TTTCTTCTGAATGGGGCTGGTCCATCCCGAAACCGGAATATCCGTGAATCCCGGCATGCT
GTTCTGCTTTCGCGACCCCCGCGGGTCGAACCAGATCAGCAACCGAACGGTGACAGGATT
GTCCTTACGCTGCGTAATCTCTTCCAGTAG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SLIFRQDTAALAFTIWQIAIPPVNAPLSTLRVRVRRTLLHFLLNGAGPSRNRNIRESRHA
VLLSRPPRVEPDQQPNGDRIVLTLRNLFQ*

>ORF number 2 in reading frame 1 on the direct strand extends from base 421 to base 609.
TGCACCGTAGACAATTCCGCGGGGCCAGCCCCCCGCAGCAGGCTTGGTGGGAAGCGGCTT
TCCTTGAAACGTTGGAACTCCGATGCCAGCCGGAGACTCCGAACCACGCCAGATTTCCAT
ACCCGGATCAAACCCCCAACAACAGATGTCGACTGTCCCCTGGGCGCCCATGAGATCGGC
TGCTATTGA

>Translation of ORF number 2 in reading frame 1 on the direct strand.
CTVDNSAGPAPRSRLGGKRLSLKRWNSDASRRLRTTPDFHTRIKPPTTDVDCPLGAHEIG
CY*

>ORF number 3 in reading frame 1 on the direct strand extends from base 610 to base 804.
CCTGAACCCTTCCTCGCCACAGACGAAGAACCTCATGTCGTTGCCCGTGGTCGGCATGAC
ATCTTTGTCGACGTTTTTTTCAAGCAGCCACTGCACAGTGCCTTGCGCTGCGCGGCCCGC
TTCATCGACAGCGACATCTACCGGGTTATGAGTTTCGAGGGGAAGCTGTGCCACGTTCTT
TTCCTTATTGTTTGA

>Translation of ORF number 3 in reading frame 1 on the direct strand.
PEPFLATDEEPHVVARGRHDIFVDVFFKQPLHSALRCAARFIDSDIYRVMSFEGKLCHVL
FLIV*

~~Reading Frame 2~~~
>ORF number 1 in reading frame 2 on the direct strand extends from base 488 to base 760.
AACGTTGGAACTCCGATGCCAGCCGGAGACTCCGAACCACGCCAGATTTCCATACCCGGA
TCAAACCCCCAACAACAGATGTCGACTGTCCCCTGGGCGCCCATGAGATCGGCTGCTATT
GACCTGAACCCTTCCTCGCCACAGACGAAGAACCTCATGTCGTTGCCCGTGGTCGGCATG
ACATCTTTGTCGACGTTTTTTTCAAGCAGCCACTGCACAGTGCCTTGCGCTGCGCGGCCC
GCTTCATCGACAGCGACATCTACCGGGTTATGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
NVGTPMPAGDSEPRQISIPGSNPQQQMSTVPWAPMRSAAIDLNPSSPQTKNLMSLPVVGM
TSLSTFFSSSHCTVPCAARPASSTATSTGL*

~~~Reading Frame 3~~~
>ORF number 1 in reading frame 3 on the direct strand extends from base 114 to base 317.
CATCTTTGTTTGAAATACCACGCAGGACAATTCTTAATCGCTGATTTTTCGTCAGGATAC
CGCTGCCCTTGCTTTCACCATCTGGCAAATTGCGATTCCACCAGTCAATGCACCATTGAG
TACGCTCCGAGTTCGCGTAAGGCGGACGCTGCTGCACTTTCTTCTGAATGGGGCTGGTCC
ATCCCGAAACCGGAATATCCGTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
HLCLKYHAGQFLIADFSSGYRCPCFHHLANCDSTSQCTIEYAPSSRKADAAALSSEWGWS
IPKPEYP*

>ORF number 2 in reading frame 3 on the direct strand extends from base 408 to base 593.
TCTCTTCCAGTAGTGCACCGTAGACAATTCCGCGGGGCCAGCCCCCCGCAGCAGGCTTGG
TGGGAAGCGGCTTTCCTTGAAACGTTGGAACTCCGATGCCAGCCGGAGACTCCGAACCAC
GCCAGATTTCCATACCCGGATCAAACCCCCAACAACAGATGTCGACTGTCCCCTGGGCGC
CCATGA

>Translation of ORF number 2 in reading frame 3 on the direct strand.
SLPVVHRRQFRGASPPQQAWWEAAFLETLELRCQPETPNHARFPYPDQTPNNRCRLSPGR
P*


-------------REVERSE----------

~~READING FRMAE 1~~~

>ORF number 1 in reading frame 1 on the reverse strand extends from base 22 to base 843.
TCTCGATATCGACGCACATCAAACAATAAGGAAAAGAACGTGGCACAGCTTCCCCTCGAA
ACTCATAACCCGGTAGATGTCGCTGTCGATGAAGCGGGCCGCGCAGCGCAAGGCACTGTG
CAGTGGCTGCTTGAAAAAAACGTCGACAAAGATGTCATGCCGACCACGGGCAACGACATG
AGGTTCTTCGTCTGTGGCGAGGAAGGGTTCAGGTCAATAGCAGCCGATCTCATGGGCGCC
CAGGGGACAGTCGACATCTGTTGTTGGGGGTTTGATCCGGGTATGGAAATCTGGCGTGGT
TCGGAGTCTCCGGCTGGCATCGGAGTTCCAACGTTTCAAGGAAAGCCGCTTCCCACCAAG
CCTGCTGCGGGGGGCTGGCCCCGCGGAATTGTCTACGGTGCACTACTGGAAGAGATTACG
CAGCGTAAGGACAATCCTGTCACCGTTCGGTTGCTGATCTGGTTCGACCCGCGGGGGTCG
CGAAAGCAGAACAGCATGCCGGGATTCACGGATATTCCGGTTTCGGGATGGACCAGCCCC
ATTCAGAAGAAAGTGCAGCAGCGTCCGCCTTACGCGAACTCGGAGCGTACTCAATGGTGC
ATTGACTGGTGGAATCGCAATTTGCCAGATGGTGAAAGCAAGGGCAGCGGTATCCTGACG
AAAAATCAGCGATTAAGAATTGTCCTGCGTGGTATTTCAAACAAAGATGTTAAAAAGTTG
CTGGCCGCCAACATCGAGGAAGAGGATGCCCCGAGCACGCATAGCGATGATGGCGACTTC
TATTACGTCGACGAGCAGAACCTTCTCGAGGATATCCGACGC

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SRYRRTSNNKEKNVAQLPLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDM
RFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTK
PAAGGWPRGIVYGALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSP
IQKKVQQRPPYANSERTQWCIDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKL
LAANIEEEDAPSTHSDDGDFYYVDEQNLLEDIRR


~~~~READING FRAME 2~~~

>ORF number 1 in reading frame 2 on the reverse strand extends from base 242 to base 478.
CAGCCGATCTCATGGGCGCCCAGGGGACAGTCGACATCTGTTGTTGGGGGTTTGATCCGG
GTATGGAAATCTGGCGTGGTTCGGAGTCTCCGGCTGGCATCGGAGTTCCAACGTTTCAAG
GAAAGCCGCTTCCCACCAAGCCTGCTGCGGGGGGCTGGCCCCGCGGAATTGTCTACGGTG
CACTACTGGAAGAGATTACGCAGCGTAAGGACAATCCTGTCACCGTTCGGTTGCTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
QPISWAPRGQSTSVVGGLIRVWKSGVVRSLRLASEFQRFKESRFPPSLLRGAGPAELSTV
HYWKRLRSVRTILSPFGC*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 479 to base 679.
TCTGGTTCGACCCGCGGGGGTCGCGAAAGCAGAACAGCATGCCGGGATTCACGGATATTC
CGGTTTCGGGATGGACCAGCCCCATTCAGAAGAAAGTGCAGCAGCGTCCGCCTTACGCGA
ACTCGGAGCGTACTCAATGGTGCATTGACTGGTGGAATCGCAATTTGCCAGATGGTGAAA
GCAAGGGCAGCGGTATCCTGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
SGSTRGGRESRTACRDSRIFRFRDGPAPFRRKCSSVRLTRTRSVLNGALTGGIAICQMVK
ARAAVS*

~~~~READING FRAME 3~~~

No ORFs were found in reading frame 3.




Multiple Alignement

PROTOCOL


PROTOCOL


A)Multiple Alignment Of both INGROUP AND OUTGROUP sequences


using Muscle Default parameters without curation (CLUSTALW format)


B)Multiple Alignment Of both INGROUP AND OUTGROUP sequences


after curation (Gblock Result)





RESULTS ANALYSIS


I aligned my query sequence(the best hit of the blast) and got good alignments.


RAW RESULTS

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|1139688      -------------------------------------MSEYQYYKFER-----LDGYLDA
gi|1942917      ---------------MGAPDKQVYQIVGGDQKAAKTATSAPGCFVHGK-----DVFSEPV
gi|2398168      ----------MADLSKLLDEIQRPEVSHVDMI-KRRSKGTLQWFLEKD-----HKTHPIH
gi|1706995      -------------MADSILKSQNPTSVAIDEQ-SRAAKSSAQWLLEKR-----KDIAPIT
gi|9177754      ---------------MSNLKTQNPVDVAITEV-GGQAQGSVQWLLEKK---TCPDAPEIT
gi|1720603      -------------MAKLPLESHNAMDVAIDEA-GRIAKGTVQWLLEKD----VDDDVMPT
GOS_118102      SRYRRTSNNKEKNVAQLPLETHNPVDVAVDEA-GRAAQGTVQWLLEKN----VDKDVMPT
gi|7806384      -------------MAQLPLESHNAVDVAVDEA-GRAAQGTVQWLLEKN----VDEDVKPT
gi|2540001      ------------MKPHDPYKTHNRVTAPLDKE-TCEVTASFQWLLEKS------RSHPIT
gi|1070229      ---------------MSDTNTQNKSKAPIDVD-KRQAVASAQWFLEKQ----ADYYAPPY
gi|1720656      ---------------MSDTNTQNKSKAPVDVS-TRQSVASAQWFLEKN----ETYYAPPY
gi|1713213      ---------------MSDTNTQNKSKAPVDVS-TRQSVASAQWFLEKN----ETYYAPPY
gi|1160532      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|2542382      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|1071041      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|2188941      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|2542440      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|1560028      -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|2517920      -------------------MSQNKQQISTTEG-KLCATVNFNWFLKDAEKFENGTQSEPV
gi|2550682      -----------MPNDPKTQSKSKPKNGQMPIT-QKKSTVAESWFVGKG----GNKNVPSA
gi|3449668      --------------MSQPLAKHKPRQHNVDPSQHQTTRTSTPWFLADDHPVGYKPEFHEV
gi|6604819      -------------------MTTPSITTPVATGKNMSCNINLPWFVQDT-------EYRPA
gi|2378021      -------------------MTTPSITTPVATSKNMSCNINLPWFVQGT-------EYCPA
gi|7173368      -------------------MTTPLITTPVATSKNMSCNINLPWFVQGT-------EYCPT
gi|2065620      -----------------MANINKSITTPIAQNHTSSAMACLPWFVCNS-------EYSPS
gi|1342931      ------------------------------------------------------------
gi|1706979      ------------------MSQPAAITVPIAQSFGNAATLTLPHFVQGA-------EYKPR
gi|2542488      ------------------MSQSAPINVPIARSCGNTATLTLPHYVQDA-------EYGPR
gi|1720632      ------------MANSSPASDAFVATTPIALNHTNNGTVTFRWFVQKT-------EYNPA
gi|1713177      ------------MANSSPASNAFIATTPIALNHTNSGTVTFRWFVQKT-------EYNPA
gi|1706975      ------------MANSSPASNVFVATTPIALNHTNSGTVTFRWFVQKT-------EYNPA
gi|9430957      -------------------MTQPFITVPIALSCTRSATITLPWFVQCT-------EYNPA
gi|1754885      -------------------MANKPIVTPLALSRTRTATLTLPWFVQHT-------EYDSA
gi|1706912      ------------------MTKQQSITVPVALSSTRSATVPSPWFVQNT-------EYNPA
                                                                            

gi|1139688      KARQ----------------ALRTISSRADITATSFQ--VYY------------------
gi|1942917      KGNAVQFFVTGTEYFDNVARAIEGAQSSVFITGWQVNFDVVL------------------
gi|2398168      DNNALQFFMCGQEGFAAIEKDILAAGSSIDLVLWGFDPGMELTRSRNT------------
gi|1706995      YENHLEFLVCGEEGFANIANDLKLAKGSVNLCCWGFDPGMELIREKGETK----------
gi|9177754      EGNDLQFFICGQEGFGQLSKDLRAAKSTVDIVCWGFDPGMEVERTGEA------------
gi|1720603      TGNKLEFFVCGEEGFRAIATDILAAKSTVDICCWGFDPGMELVRGDGPACWIGDPQVN-M
GOS_118102      TGNDMRFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGK
gi|7806384      LGNDLKFFVCGEEGFRSIATDLMGAQGTVDICCWGFDPGMEIWRGAESPKGIGVPKVDGK
gi|2540001      EGNRIETLICGQEGFGRIAQDIEHARGSLCIVCWGFDPGMALVRGEGQANYP--------
gi|1070229      EKNNIDVFICGEDAFTQIAADLKAAKHSVEIICWGFDPGMELIR-KGTV-----------
gi|1720656      AKNNLDVFICGEDAFKQIAADLKAAKHSVEIICWGFDPGMELIRNGSV------------
gi|1713213      EKNNLDVFICGEDAFKQIAADLKAAKHSVEIICWGFDPGMELIRNGSV------------
gi|1160532      AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|2542382      AGVHIKPLINGQAAFDAVHAAMEAARQSIDIITWGFDPAMRFKR----------------
gi|1071041      AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|2188941      AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|2542440      AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|1560028      AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|2517920      PATF-KALVNGKEAFEELHDRIANAQHSIDIAIWGFQPSMHFKRDG--------------
gi|2550682      EQATFLSLVNGEVAFGELYDSIEKAKKSVEIVCWGFQPSMYFKRGVN-------------
gi|3449668      NATF-EPLINGERAFGAIYDAILAAKHSVDIVCWGFQPSMYFKRGAGAPPIQYYLQQPQL
gi|6604819      EATF-EPLVNGERAFGAVYDAIMAAKHSVEIICWGFQPSMYFKRGA--------------
gi|2378021      EATF-EPLVNGERAFGAVYDAIMAAKHSVEIACWGFQPSMYFKRGD--------------
gi|7173368      EATF-EPLVNGERAFGAVYDAIMKAEQSVEIICWGFQPSMYFKRGD--------------
gi|2065620      AAGF-RPLVNGRDAFAAVYKAIADAKHSIDIICWGFQPSMYFLRDG--------------
gi|1342931      ----MRPTVNGKEAFGALYDAICNAKHSIDYVCWGFQPSMYFKRDG--------------
gi|1706979      NATH-CPLVNGEEAFGAVYDAIASAQHSVDIVCWGFQPSMYFKRGSSG------------
gi|2542488      YATH-YPLVNGEEAFGAVYDAISAAQHSVDMVCWGFQPSMYFKRGASG------------
gi|1720632      AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|1713177      AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|1706975      AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|9430957      PATF-KPLVNGETAFRDIYDAIFLAVKSVDIICWGFQPSMFFKRGAGG------------
gi|1754885      QATF-RPLVNGEEAFGAVYDAIAAAKHSIDIICWGFQPSMYFKRGSGA------------
gi|1706912      PATY-LPLVNGEAAFGAVFDAIRQAEHSIDILCWGFQPSMYFRRGGDA------------
                                     :             .:  :                    

gi|1139688      ---------------------------------TYSDLKAEPS-------------TLML
gi|1942917      -----------------------------TGKKTLWNCLRTAV--R------NGASVYVM
gi|2398168      ----------W------------------PRGTTYGDLLVRKA--G------EGVKVRML
gi|1706995      ----------W------------------PRGQTYGQLLEEVA--N---KG---VTVRLM
gi|9177754      ----------W------------------PRDLRYGDLLEQLA--K---AE---VRVRLL
gi|1720603      PFVP----GTW------------------PRGTVYGALLEEIT--Q---RKDNPVTVRLL
GOS_118102      PLPTKPAAGGW------------------PRGIVYGALLEEIT--Q---RKDNPVTVRLL
gi|7806384      PYSPTPADGLW------------------PRGIVYGALLEEIT--Q---RKDNPVTVRLL
gi|2540001      ----------W------------------ANGLPYGELLRRKA--A------EGVQIRLL
gi|1070229      ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|1720656      ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|1713213      ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|1160532      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|2542382      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|1071041      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|2188941      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|2542440      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|1560028      -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|2517920      ------------------------------KSPCIGDLLIQKA--L------EGKKVRIL
gi|2550682      -----------------------------LAGAPIGELLMEKFI-Q------NNVDVKIL
gi|3449668      PPLTADNIDKIADDMAGKLPFTRRKLHPKDKIMPIGELLEMKS--L------EGVKVRIL
gi|6604819      -----------------------------TCSLCIGELLALKA--Q------EGVQVKIL
gi|2378021      -----------------------------TCSLCIGELLALKA--Q------EGVQVKVL
gi|7173368      -----------------------------TSSLCIGQLLAMKA--D------KGVKVRIL
gi|2065620      ------------------------------TGKRIGELLEQKG--K------EGVKVRLL
gi|1342931      -----------------------------GKSLRIGDLLIQQA--K------QGVKVRIL
gi|1706979      -----------------------------QGSLSIGELLLERA--K------HNVKVRLL
gi|2542488      -----------------------------QGSLSIGELLLERA--R------HNVKIRLL
gi|1720632      ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|1713177      ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|1706975      ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|9430957      -----------------------------QGTKCIGELLEDVG--K------RGVKVRLL
gi|1754885      -----------------------------QDTLPIGDLLEAMG--K------RGVKVRLL
gi|1706912      -----------------------------HGSPSIGELLEFKGLEK------PGIKIRLL
                                                                          ::

gi|1139688      KYFDI-------------------------------------------GF----------
gi|1942917      PWMSPKVGVDTGDLETALTVIQLNAGLPSPRAFVLPAVSQCDQP----GA----------
gi|2398168      LWFDN----------------------------LVVNKAAGNVP----DF----------
gi|1706995      VWYDE----------------------------T-ASAKQNNVP----GY----------
gi|9177754      LWFDP----------------------------R-ASRKQNSMP----GY----------
gi|1720603      IWFDP----------------------------R-ASRKQNSMP----GF----------
GOS_118102      IWFDP----------------------------R-GSRKQNSMP----GF----------
gi|7806384      IWFDP----------------------------R-GSRKQNSMP----GF----------
gi|2540001      VWYNS----------------------------S-GSSVQNNLV----GY----------
gi|1070229      SWYGV----------------------------I-GSTLSNNMP----GY----------
gi|1720656      SWYGF----------------------------I-GSLGSNNMP----GH----------
gi|1713213      SWYGF----------------------------I-GSLGSNNMP----GH----------
gi|1160532      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|2542382      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|1071041      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|2188941      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|2542440      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|1560028      VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|2517920      VWSLP--------------------------GSI-QTFAEANL-----GN----------
gi|2550682      CWQTN--------------------------PFATEKFLEDNTP----GRSTLLFMHEYL
gi|3449668      TWNDP----------------------------I-SQIPEVMNP----GY----------
gi|6604819      CWSDS--------------------------THM-AQFLENPTP----GD----------
gi|2378021      CWSDS--------------------------THM-AQAMENTTP----GD----------
gi|7173368      CWSDS--------------------------AHVTAAFSENMTP----GR----------
gi|2065620      CWRDP--------------------------FYM-AELSENNMP----GN----------
gi|1342931      CWLDS--------------------------AWV-AQFSEQEAP----EY----------
gi|1706979      VWGDK--------------------------FHV-AQFLENMMP----GG----------
gi|2542488      VWGDK--------------------------AHV-AQFLENMMP----GG----------
gi|1720632      VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|1713177      VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|1706975      VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|9430957      CWGGQ----------------------------VLGLPEINNRF----GP----------
gi|1754885      VWSDS--------------------------LHL-AQFFENMTP----GN----------
gi|1706912      VWSDS--------------------------LHV-ASFSEDMMP----GN----------
                 :                                                          

gi|1139688      ------------------------------------------------------------
gi|1942917      --------------LGIAFSHHQKLVVIDNKFAYVGGIDLAYGRRDDG---KYS--LKAE
gi|2398168      --PVFWAPTSFSKTSRTTWP-------------------EGAGSYDDRSNSAWV--LTDR
gi|1706995      --------------SDTGHN---------------PITHLPAFLVGTSKS-PYD--SKDR
gi|9177754      -----------TDVPVSLAT-------------------SPIQRMVQGDD-PYG--NPVR
gi|1720603      -----------TDVPVSGWT-------------------SPVQKKVQQAP-PYK--NAKR
GOS_118102      -----------TDIPVSGWT-------------------SPIQKKVQQRP-PYA--NSER
gi|7806384      -----------TDVPVSGWT-------------------SPIQKTVQQEA-PYA--NAKR
gi|2540001      ---VATGNTPPGGTLTSTWD----------------------ERNPNAKTPKPL--ADVR
gi|1070229      --------------SGGRLT-------YEQKMAREVGKAGGIYVQLGNAPQPLT-PQDRR
gi|1720656      --------------SSGRLN-------YEEKMAMMVGAGGGIYLPTGKPPQP-QTPQERR
gi|1713213      --------------SSGRLN-------YEEKMAMMVGAGGGIYLPTGKPPQPQT-PQERR
gi|1160532      --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|2542382      --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|1071041      --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|2188941      --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|2542440      --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|1560028      --------------SGGTWV--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|2517920      --------------KPGVWL----------------------------NKVEGV--TSEQ
gi|2550682      AYEHFLDFILEPDNIYSHFEKLEKEKFLEPKVAMHKMGSRERHKFYRGKRSH----SVEQ
gi|3449668      ----------------------------------------------NVKRGDNE--NFLQ
gi|6604819      --------------NVSNWIPGLDDFFHASAVTKGLGLDSVNKTIEGRRTQAEQNRNEEQ
gi|2378021      --------------NVSNWIPGLDDFFHATSISKGLGFDSTTRKLEEFRAKGAQDRDKDQ
gi|7173368      -------------------------------------------NLASVMD-DLR--NETQ
gi|2065620      ------DFITPLKRALPKWV---------------------YDHVSMLGR-DYQ--TDEE
gi|1342931      ----------------------------------------NLKRFVTQNE------DTQQ
gi|1706979      -------------------------------------------RFSHLPD-NR---NSAQ
gi|2542488      -------------------------------------------RFSHKPDNR----NSAQ
gi|1720632      --------------DIATDV-------------KQRLPDSAYETFSMMSR-DYQ--TDQQ
gi|1713177      --------------DIATDV-------------KQRLPDSAYEKFSMMSR-DYQ--TDQQ
gi|1706975      --------------DIATDV-------------KQRLPDSAYEKFSMMSR-DYQ--TDQQ
gi|9430957      ------------------------------------EPNMPHRPAAHMRPRPHP--SRHA
gi|1754885      ----------------------------------------NVASYRSDTR------NSTQ
gi|1706912      ---------------------------------------HGIFGLAGAAS-DGR--TRAQ
                                                                            

gi|1139688      --YYADWGS---------------------------------------------------
gi|1942917      GRQGSEFYNSCVPAIHSLSSVEQTAYLTRAELVAACFDNKAGRAAQFFLSAPMKPLAGAM
gi|2398168      SNYCKQWWEDA-------------------------------------------------
gi|1706995      QQYCIEWWKTH-------------------------------------------------
gi|9177754      HDWCKAWWKRH----------------------------------------------GLE
gi|1720603      TQYCIDWWNRN-----------------------------------------------LP
GOS_118102      TQWCIDWWNRN-----------------------------------------------LP
gi|7806384      TQWCIDWWKRN-----------------------------------------------LP
gi|2540001      QDYCIHWWRDA-------------------------------------------------
gi|1070229      EDFNARWYDDA-------------------------------------------------
gi|1720656      EDFNARWYDDA-------------------------------------------------
gi|1713213      EDFNARWYDDA-------------------------------------------------
gi|1160532      QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|2542382      QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|1071041      QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|2188941      QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|2542440      QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|1560028      QQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAEN-----------AEIQRTLDSS
gi|2517920      VDYDRWWYEAI----QGELDEVIVNAKTDGIVHVWEAHE-----------IEKHEKLVEF
gi|2550682      RRFDWAWYDAVEGYNTITSDEEFHKTMEEFQSLHDEFHG-----------LGMGAVGFVL
gi|3449668      ECYDIGWHQDI-------------------------------------------------
gi|6604819      IQIDKMWYRQV-------------------RLAYTGAET-----------GPIEIGQRFF
gi|2378021      IEIDKLWYRQV-------------------RLAYTGAET-----------GVIELGQRFF
gi|7173368      HAIDWEWYRRA------------------------TKST-----------LGNRSLLLDR
gi|2065620      RVFDINWYQRA-----NLNNVTNPVSHSVTDRIIEDTVN-----------LPLNVVAALS
gi|1342931      RAYDRNWYYCA-----------------------------------------RQPRGTQR
gi|1706979      REFDAWWYEMV----------------KMDKKNQGGTEW-----------TGVGIAPIPV
gi|2542488      REFDAWWYEMV----------------KMDKKNQMGTEW-----------TGVSIAPVPV
gi|1720632      RKIDEEWYRRA------------------------NLHN-----------VTLSLPAGPR
gi|1713177      RKIDQEWYRRA------------------------NLHN-----------VSLNLPAGPR
gi|1706975      RKIDEEWYRRA------------------------NLHN-----------VSLNLPAGPR
gi|9430957      EDFDRWWYWSV---------------------AQKDPRR-----------LTFRNVVMDP
gi|1754885      REFDQLWYWRA----------------------NLNNVT-----------KGSAAKWLMP
gi|1706912      QEFDQLWYRRA------------------------NLNNVTRTSAETRVNPLSKAKSTAT
                                                                            

gi|1139688      ----------------------------------------IDVYIK-----------LPA
gi|1942917      DAYSSASDKIKDVNK-------------QISDWWVTSDVVPEFVRKAQDKVIDAAQETAA
gi|2398168      -----LAGRFKN----------------------------LEVRLRR----------GSP
gi|1706995      ---RPKGNCSGTNKH-------------------------LLVTFRS----------VDS
gi|9177754      NDRIDPRKALYPDH--------------------------LQIVLRG----------IEK
gi|1720603      DGESKRSGILTKNPR-------------------------LQIVLRS----------IAS
GOS_118102      DGESKGSGILTKNQR-------------------------LRIVLRG----------ISN
gi|7806384      DGESKRSGILTQNQR-------------------------LRIVLRS----------ISS
gi|2540001      --------TTGRIPN-------------------------LTVRCRD-------------
gi|1070229      -----FAGRLPN----------------------------LSLRTRD----------GSS
gi|1720656      -----FAGRLAN----------------------------LSIRTRD----------GSS
gi|1713213      -----FAGRLAN----------------------------LSIRTRD----------GSS
gi|1160532      EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|2542382      EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|1071041      EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|2188941      EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|2542440      EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|1560028      GAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|2517920      TKSPKRTNLIYKNRK--------------------VAPQNEDFKPRI---------LPDG
gi|2550682      RVKKSVGTGIDEFKE---FFDTHLLPDWIKELRDGWRN--MRFGIRE-EIHFRLMNYVHT
gi|3449668      ----------RANKN-------------------------IQFRTRHFD-------DIDK
gi|6604819      RVMKWGNEESVKNTS-------------------------LQFVTRDFS-------IEDR
gi|2378021      RVMGWGDEESIKDTR-------------------------LQFVTRDFS-------VTDR
gi|7173368      NGTALAGAFSFGKEP--------------------FKN--IEFVVRD-------MSLSDR
gi|2065620      KPFTSGSNPVLHKIA-------------------GFPN--IELATRGFD-------LSVR
gi|1342931      STIAPAGSKMYPQLA---------SNAWPLLGTQSLKDIGIEVVMRDFS-------LGDR
gi|1706979      LTHKAVRRILRSKHD------------------PAFRN--IDFATRDFG-------MNER
gi|2542488      LTQKAIRRLLRDKRD------------------PAFKN--IEFATRDFS-------MAER
gi|1720632      DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|1713177      DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|1706975      DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|9430957      SVIARHIPSVWQLAA--------------------LKN--VEFMTRDFD-------LPSR
gi|1754885      GGAMQEIAKAIRNHA---------------LRDKALTN--VEFATRDFD-------LGER
gi|1706912      AVLGALPGALKPLKN-------------------------IEFATRDFD-------LRER
                                                          .  .              

gi|1139688      GTI---PEALLGFS----------------------------------------------
gi|1942917      DASKWAYQQLGTTL----------------------------------------------
gi|2398168      LEI---HSNLSRYL----------------------------------------------
gi|1706995      ADAA--HALADEEF----------------------------------------------
gi|9177754      QAV---KGLLAADI----------------------------------------------
gi|1720603      GDV---DALIDAPL----------------------------------------------
GOS_118102      KDV---KKLLAANI----------------------------------------------
gi|7806384      KDV---ISLMTAPL----------------------------------------------
gi|2540001      -GV---VDKVQASV----------------------------------------------
gi|1070229      KDV---HESLAHEP----------------------------------------------
gi|1720656      KAV---HDSLAGEP----------------------------------------------
gi|1713213      KAV---HESLVGEP----------------------------------------------
gi|1160532      GEQ---VRLVNGRL----------------------------------------------
gi|2542382      GEQ---VRLVNGRL----------------------------------------------
gi|1071041      GEQ---VRLVNGRL----------------------------------------------
gi|2188941      GEQ---VRLVNGRL----------------------------------------------
gi|2542440      GEQ---VRLVNGRL----------------------------------------------
gi|1560028      GEQ---VRLVNGRL----------------------------------------------
gi|2517920      RKV---NHSFEDTE----------------------------------------------
gi|2550682      AAQGLYEEYRDGKLVKTAIGVVSKVTGLNSNGPVNDVDDLRIALFDKLFAKVKEEVKGTE
gi|3449668      N-----AYILPNLV----------------------------------------------
gi|6604819      VEIAW-QLEIGALD----------------------------------------------
gi|2378021      VETAW-RLAMQALD----------------------------------------------
gi|7173368      VEIAW-QVAMRSTD----------------------------------------------
gi|2065620      SEIVG-RISGYGTM----------------------------------------------
gi|1342931      SEIMYREALLRGSG----------------------------------------------
gi|1706979      AEIAW-RTATDSKY----------------------------------------------
gi|2542488      AEIAW-RTVTDSQY----------------------------------------------
gi|1720632      AEIAW-HTFWHGKD----------------------------------------------
gi|1713177      AEIAW-HTFWHGKD----------------------------------------------
gi|1706975      AEIAW-HTFWHGKD----------------------------------------------
gi|9430957      LEIAF-RTSLFGAD----------------------------------------------
gi|1754885      AEIAW-RTWTQGKD----------------------------------------------
gi|1706912      AEIAW-RTWMSGPH----------------------------------------------
                                                                            

gi|1139688      ------------------------------------------------------------
gi|1942917      ------------------------------------------------------------
gi|2398168      ------------------------------------------------------------
gi|1706995      ------------------------------------------------------------
gi|9177754      ------------------------------------------------------------
gi|1720603      ------------------------------------------------------------
GOS_118102      ------------------------------------------------------------
gi|7806384      ------------------------------------------------------------
gi|2540001      ------------------------------------------------------------
gi|1070229      ------------------------------------------------------------
gi|1720656      ------------------------------------------------------------
gi|1713213      ------------------------------------------------------------
gi|1160532      ------------------------------------------------------------
gi|2542382      ------------------------------------------------------------
gi|1071041      ------------------------------------------------------------
gi|2188941      ------------------------------------------------------------
gi|2542440      ------------------------------------------------------------
gi|1560028      ------------------------------------------------------------
gi|2517920      ------------------------------------------------------------
gi|2550682      PVHLIDQVKGSVTSRLEKLGGLKDDLESIWDLFFNFNLFRNYVNCMNYYFLLRNEKKYPN
gi|3449668      ------------------------------------------------------------
gi|6604819      ------------------------------------------------------------
gi|2378021      ------------------------------------------------------------
gi|7173368      ------------------------------------------------------------
gi|2065620      ------------------------------------------------------------
gi|1342931      ------------------------------------------------------------
gi|1706979      ------------------------------------------------------------
gi|2542488      ------------------------------------------------------------
gi|1720632      ------------------------------------------------------------
gi|1713177      ------------------------------------------------------------
gi|1706975      ------------------------------------------------------------
gi|9430957      ------------------------------------------------------------
gi|1754885      ------------------------------------------------------------
gi|1706912      ------------------------------------------------------------
                                                                            

gi|1139688      --------SDGLHVHQSDEWQLL-------------------------------------
gi|1942917      --------QTKVEKLREYGGAQV------------------ADATTALMAWLNGATLDSL
gi|2398168      --------PDSKRDL--SEAATM------------------IAV----------GTHHQK
gi|1706995      --------KPQDGILPTNERPLM------------------TDY----------PTHHQK
gi|9177754      --------AEEDRPD----SSWL------------------SPVDESALLWNY-PTHHQK
gi|1720603      --------KEEDPPSTHSESVDY------------------YLVNEKNLLEDY-PTHHQK
GOS_118102      --------EEEDAPS---------------------------------------------
gi|7806384      --------KEEDEPSTHSDKGDW------------------GYVDEKNLLEDY-ATHHQK
gi|2540001      --------KDEPIKPSQQGGAVL------------------GVFDEQTLIEKY-ATHHQK
gi|1070229      --------GKRDNLE------DF------------------GLEKL--------ATDHQK
gi|1720656      --------GKRDFTE------VL------------------GLEKV--------ATDHQK
gi|1713213      --------GKRDFTEVL------------------------GLEKV--------ATDHQK
gi|1160532      --------QSLIHLLRADGNDDL------------------GIGQLLVLTQF--ASHHQK
gi|2542382      --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|1071041      --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|2188941      --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|2542440      --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|1560028      --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|2517920      --------LPDGKGTLTDGSYDF------------------ALKKF--------KSHHQK
gi|2550682      TMAFMRLRNQEDYKNRKQKVSFLPREINPAIFPKDFPFEDKGLSALTKDVLRFTPTHHQK
gi|3449668      --------RNGASTMHAAATSKF-------------------------------PSHHQK
gi|6604819      --------QDRSRKNKIMSTSAM------------------FLA----------PTHHQK
gi|2378021      --------QDRSTKNKVMSTGAM------------------FLA----------PTHHQK
gi|7173368      --------KDRPTWNKIMTTVGM------------------TSI----------PTHHQK
gi|2065620      --------DGWSGGTKATTSAAM------------------GGE----------PSHHQK
gi|1342931      --------KGPTHTA----IGAY------------------GAE----------PSHHQK
gi|1706979      --------GDRTKNAKIQNAAAM------------------GLA----------PSHHQK
gi|2542488      --------SKRNVNSKIQNGFAM------------------GLG----------PSHHQK
gi|1720632      --------RDRDVLTRAQNSASM------------------GLAE---------PTHHQK
gi|1713177      --------RDRDVMTRAQNSASM------------------GLAE---------PTHHQK
gi|1706975      --------RDRDVMTRAQNSASM------------------GLAE---------PTHHQK
gi|9430957      --------KQRGAGNKAAGGAAM------------------GLAA---------PTHHQK
gi|1754885      --------TGRSTFTKDANAAAM------------------AGE----------PSHHQK
gi|1706912      ----------GDPKLRDVNTAAM------------------TAE----------PSHHQK
                                                                            

gi|1139688      --------------------IFSIEEYGEYFDDEQA------------------------
gi|1942917      PPSLLQNTA-----DTIQAFVMRLVLALQAEGSQRK------------------------
gi|2398168      PILIDYEPATGGRPRNVCGYVMGLNSVTDYWDTTAH------------------------
gi|1706995      PIVIDYDYNNG---YKAVGYVMGLNSVTDYWDTTKH------------------------
gi|9177754      PVLIDYAHDGG---SKAVGFVMGLNSVTDFWDTAEHKIETGLRETGARSTW---------
gi|1720603      PILIDYSYDEG---SKAVGYVMGLNSVTDYWDRTDH------------------------
GOS_118102      ------------------------------------------------------------
gi|7806384      PILIDYAQPYEG--KNAVGYVMGLNSVTDYWDRTAH------------------------
gi|2540001      PILIDYDHADG---EHAVGYVMGLNSVTDYWDDAQH------------------------
gi|1070229      TILIDYDHEGG---TQAVGYVMGLNSVTDYWDTQQH------------------------
gi|1720656      TILIDYEYEGG---AHAVGYVMGLNSVTDYWDTQQH------------------------
gi|1713213      TILIDYEYEGG---AHAVGYVMGLNSVTDYWDTQQH------------------------
gi|1160532      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|2542382      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|1071041      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|2188941      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|2542440      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|1560028      MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|2517920      TVLIDYEDP-----DLAVGFVLEHNMVDNYWDDSNH------------------------
gi|2550682      SVMIDYTDP-----KSAVGFVMGHNMLDRYWDTSDHYALPDEYKTYTTSRKGPGEVVELE
gi|3449668      TVLIDYEHP-----ESALGFVMGHNMLDAYWDRDDH------------------------
gi|6604819      MVLVDYEKP-----ELAVGFVMGHNTLDAYWDKDDH------------------------
gi|2378021      MVLVDYEQP-----DLAVGFVMGHNTLDAYWDKDDH------------------------
gi|7173368      MVLVDYETP-----NKAVGFVMGHNSLDAYWDNDDH------------------------
gi|2065620      MVLVDYDDS-----DLATGFVMGHNMLDQYWDTDKH------------------------
gi|1342931      TVLIDYEAP-----ALALGFVMGHNTLDAYWDDDSH------------------------
gi|1706979      MVLVDYAHP-----EIATGFVMGHNTLDEYWDISSH------------------------
gi|2542488      MVLIDYEDP-----ELATGFVMGHNTLDEYWDTSRH------------------------
gi|1720632      MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|1713177      MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|1706975      MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|9430957      MVLVDYEVP-----NKAVGYVMGHNMLDPYWDTDDH------------------------
gi|1754885      MVLVDYEMP-----ERAVGFVMGHNTLDAYWDRDDH------------------------
gi|1706912      MVLVDYEVP-----EQAIGFVMGHNTLDEYWDRDDH------------------------
                                                                            

gi|1139688      --------------------------------------------------DDFFQHLVGL
gi|1942917      -QCYANLEKLGKLLPAGGKCPDS-------------------SVQPRMPWHDVHCRIEGP
gi|2398168      ----AFNDPRRELSPNGYTYYDE-------------------VRWHRKPYRDYAIRVQGE
gi|1706995      ----AIDDSLRELLASKTLEAEQ------AHEQATLDQAPTKGYKHVRPYQDYACRLYGP
gi|9177754      ---EGEIDHEYRSDFGGGDPGEA----------QKVAAIHGGNYTSIRPYQDYACRVVGP
gi|1720603      ----AIDDPLREEWVGSYVSDEL---KHEQETQDPQGPLSTAAYRHVNPYQDYGCRLVGK
GOS_118102      ------------------------------------------------------------
gi|7806384      ----EIDDPLREAWVPSYVNDEH---KHEQETQDPTGPLSTAPYKQVNPYQDYATRIVGK
gi|2540001      ----LFDSHLREQDFSTQAELKAAEEKGIRTDAIVQTALKAGQPISRKPFQDYACRIHGP
gi|1070229      ----LFNDPRRGEGWEGANDSQP----------------------GLKPYQDYASRIRGE
gi|1720656      ----LFNDPRRGESWEGANDVQP----------------------GLKPYQDYASRIRGE
gi|1713213      ----LFNDPRRGESWEGANDVQP----------------------GLKPYQDYTSRIRGE
gi|1160532      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|2542382      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|1071041      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|2188941      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|2542440      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|1560028      ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|2517920      --------SLKTTLPNKGKNSPT-------------------------PLQDVSSIVTGQ
gi|2550682      KLENIEESQMRGRDPSAGAFFGT-------------------------PRQDISCKLTGK
gi|3449668      -------HYVQQE-PHLGRNGAT-------------------------ARHDISSRLTGP
gi|6604819      -------AYERKT-SQAGRNGAT-------------------------PRQDISSRVTGP
gi|2378021      -------AYERQT-AQKGRNGTT-------------------------PRQDISSRVTGP
gi|7173368      --------SAARMHAQFGRNGAT-------------------------PRQDISSRVTGP
gi|2065620      -------SYQAMA-PSKGRNGPY-------------------------PWQDISSRVTGP
gi|1342931      -------SYVKKS-PDRGRNGET-------------------------PRQDMSARIAGP
gi|1706979      -------GHVRMH-PQMGRNGFL-------------------------PRQDISARVTGP
gi|2542488      -------SHVRMH-SKMGRNGFL-------------------------PRQDISARVTGQ
gi|1720632      -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|1713177      -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|1706975      -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|9430957      -------SAAKMPWGYLGRNGAT-------------------------PRHDISSRVTGP
gi|1754885      -------GYTRMH-PQMGRNDHH-------------------------PRQDMSSRVTGP
gi|1706912      -------TYLRQA-PRMGRNGLH-------------------------PRQDMSAKVTGP
                                                                            

gi|1139688      RSELIQGNWRLVY-----------------------FMW---------------------
gi|1942917      SVYDLSRNFVRRWNGVALQYERSDGKTVD-------ALLRHLGIAARLKAPRIGAAHRPV
gi|2398168      ALHCLNRNFVQGWDSAAGVQVIPGPAGRFFPANG--AGAFSAKLA---------AQRQAV
gi|1706995      ALKRVYDNFALDWNHYA-------------------PDTHRMPEL----------TEIPS
gi|9177754      ALRRLHENFENGWNAFAP------------------SQWKTSAKD---------GDSLPP
gi|1720603      ALKRVHQNFERGWNLFAP------------------AQWKTKELA-----------TLPS
GOS_118102      ------------------------------------------------------------
gi|7806384      ALKRLHQNFERGWNVFAP------------------PAWQTTELK-----------ALPA
gi|2540001      ALQDVWINFARAWNRATALPPLMVPFQRNRPPAPKQPAPLNTALN---------PSRLSQ
gi|1070229      ALVAVSKNFTDAWNRAKGQG----------------ANLSRTHDF----------KKVPP
gi|1720656      ALVAVSKNFIDAWNRAKGKG----------------ANVSRTHDF----------KKVPP
gi|1713213      ALVAVSKNFIDAWNRAKGKG----------------ANVSRTHDF----------KKVPP
gi|1160532      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|2542382      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|1071041      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|2188941      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|2542440      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|1560028      VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|2517920      VLWDINHNFCQSWDRQNN------------------KQWGKDPVDIGITGKRQSFTRDHY
gi|2550682      VLYDIDANFVQGWNKAIED-----------------NGYYQNRMDKIEPVERVKREQFKP
gi|3449668      VLVHVNHNFVAGWDKATGEN----------------LTGKRAHLE-----------LKHF
gi|6604819      ILKYLNENFCEAWKKETKVD----------------LLPAREHIA------------DQL
gi|2378021      ILEYLNQNFCEAWEKETKVD----------------LLTARKHIA------------DKL
gi|7173368      ILEYLNHNFTQAWQHETGVD----------------LLPARRHVA------------DQL
gi|2065620      ILQYLNKNFCEAWDDATGQK----------------LAKSREHLA----------GIHKI
gi|1342931      ILEHLNVNFCRAWQHSTKED----------------LLAKRMPLA------------KQL
gi|1706979      ILTDLNKNFCQAWDATTGQQ----------------LEKQRESVK------------EPL
gi|2542488      ILIDLNENFCQAWDATTGQR----------------LEKQRKSAK------------TPV
gi|1720632      VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|1713177      VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|1706975      VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|9430957      ILQYLNDNFCEAWDRETGAG----------------LGKARKPAA------------AGL
gi|1754885      ILQYLNRNFCQAWSDATGQQ----------------LEAGRAVIA------------SQL
gi|1706912      ILDCLNRNFCQAWDDATGQN----------------LTHARAALA----------GRLTL
                                                                            

gi|1139688      ------------LKAFDCNDELE-----------E------------IPLIQYDFEHLSE
gi|1942917      RSKAQPGS----CWVQVLRSAPKKMRVAEAAGEADKTT-----PSVAESSCLSAMLKNIE
gi|2398168      QAKDIPRPLGARCRVQIQRTQPE-----------S--D---------DGTILKGYTLASA
gi|1706995      NIQKVPGNA--NHAVQIVRTHPR-----------D--K---------DKTIKELYIHASS
gi|9177754      KIPTLAKDP--AQRVQIVRTQAA-----------E--G---------EKTIKKLYFQATS
gi|1720603      KIPSLPDDP--AQRAQIVRTQPH-----------E--R---------EKTIKRVYFQATS
GOS_118102      -------------------THSD-----------D--G---------D------------
gi|7806384      GITSLPDDP--AYRVQIVRTQPH-----------E--H---------EKTIKSLYYQASS
gi|2540001      PVETSAASH--VARLQIVRTQPE-----------E--AYQGEENTAYDQSIKLAYMHAAS
gi|1070229      GLTKNIGTP--CQRAQIARTQPE-----------E--K---------DKSIKALYIQATS
gi|1720656      GLTQNLGTP--CQRAQVVRTQPE-----------E--K---------DKSIKALYEQATS
gi|1713213      GLTQNLGAP--CQRAQVVRTQPE-----------E--K---------DKSIKALYEQATS
gi|1160532      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|2542382      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKGLG
gi|1071041      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|2188941      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|2542440      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|1560028      LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|2517920      QPNPSLVDDSKLVMAQIVRTYDQ-----------P--N---------IEDIMKVYLKNIK
gi|2550682      QNVEKDDSQTELLYAQVLRTQPE-----------Y--Q---------EENILALYNQNFK
gi|3449668      TPRPNLGSR---AMAQIARTQSQTRPKGKVKDELT------------VQDIKHLYLNAVN
gi|6604819      KARKACGIP---LMAQILRTHSQ-----------GAVA---------VRNIEKLYLKAVN
gi|2378021      KGRREYGTP---LMAQILRTHSQ-----------S--N---------VRDIEKLYLKAVN
gi|7173368      KPRKGHGPR---LIAQVLRTQPQ-----------E--N---------KRDIKEMYLKAAG
gi|2065620      RNDAPDDVS---VMAQIVRTQSE-----------K--N---------KREIQVMYLNAVN
gi|1342931      KLSTTAGTP---VMAQINRTQSQ-----------E--G---------VRNIKSLYLQAVR
gi|1706979      LRCSKDDIA---VRAQILRTQPQV----------EKGG---------VKDIERLYLQAVN
gi|2542488      LRCSKDDLP---VMAQILRTQPQVEKRDPEKREPEKKG---------VKDIERLYLQAVN
gi|1720632      RIDPGGDTR---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAVN
gi|1713177      RIDPGGDTR---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAVN
gi|1706975      RIDPGGDTP---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAAN
gi|9430957      RMLPSLGDK---VMAQVLRTHSQ-----------N--G---------KQDIEEMYLQAVN
gi|1754885      KLRRDFDTP---VMAQILRTQSQ-----------H--G---------KRDIEAMYLQAVN
gi|1706912      RRDPKNGTP---VMAQIVRTQSQ-----------F--GKNGKGSKDATKDISALYLQAVN
                                                                            

gi|1139688      EVQTFAALYDIPLAW---------------------VKALA-------------------
gi|1942917      GASHFIYIEGQFFQSDYGSTMIGNEEADGGAPVSGPMHALMDVKGSPGYQKYAAQLGILG
gi|2398168      NALNYIYMENQYFQL---------------SEWPRLLKDVR--------KRYRR-AMQEA
gi|1706995      WARNYIYMENQYFFY---------------PTFAQKLKSIR--------QDHWKAWAEKS
gi|9177754      IARNYIYIENQYFFY---------------PEFARHLKNER--------RKFCRAWARLA
gi|1720603      FARNYIYMENQYFFY---------------PEFARHVKEER--------QKFHDAWSKLA
GOS_118102      ------------FYY---------------------------------------------
gi|7806384      FARNYIYMENQYFFY---------------PEFARYLKLQR--------KNFHDAWEKLA
gi|2540001      NARRYIYIENQYFFY---------------EPWAEQLKTQR--------QSYLQAHQN-V
gi|1070229      FARNYIYIENQYFQY---------------TEWPTKLKELR--------TEFLS-CSQAA
gi|1720656      FARSYIYVENQYFQY---------------TEWPKKLKELR--------TQFLS-CSQAA
gi|1713213      FARSYIYVENQYFQY---------------TEWPKKLKELR--------TQFLS-CSQAA
gi|1160532      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|2542382      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|1071041      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|2188941      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|2542440      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|1560028      NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|2517920      QTTSYIYTENQYFRF---------------PPLVREFISHW--------ETIKN-NGRTE
gi|2550682      MATSYIYFENQYFRF---------------PPFAEALRDSC--------KERKN-FAERF
gi|3449668      HACQYIYIENQYFRW---------------VNFAEATKQAV--------KNQLA-FGRDP
gi|6604819      NTTQFIYIENQYFRW---------------PPLAEKIKSVV--------QNLLD-CGRDL
gi|2378021      NTSQFIYIENQYFRW---------------PPLAEKIKSVV--------QNLLD-GGRDL
gi|7173368      NANSFMYLENQYFRW---------------PPLAEKIKENV--------LRQFA-EGRSL
gi|2065620      NATQCIFIQNQYFRW---------------NDLALKIKDVA--------KAHAK-AGRDF
gi|1342931      NATKFIYIENQYFRW---------------PDLADEIKSAV--------KKQFG-QGRDI
gi|1706979      NTTNFIYIENQYFRF---------------PPLAEKLTKLV--------KAYQA-GGRKT
gi|2542488      NATNFIYIENQYFRF---------------PPLAEKLTELV--------KSYQA-GGRKT
gi|1720632      NATQHVFIENQYFRW---------------VPLAERIKAVA--------VQQQK-WGRDS
gi|1713177      NATQHVFIENQYFRW---------------VPLAEKIKAVA--------VQQQK-WGRDS
gi|1706975      NATQHVFIENQYFRW---------------VPLAEKIKAVA--------VQQQK-WGRDS
gi|9430957      NATQFIYIENQYFRF---------------KPLADKINEAV--------KKQIQ-WGRDP
gi|1754885      NTTNFVYIENQYFRF---------------PPLADKIKEAA--------KAQFG-AGRDQ
gi|1706912      NTTKFVYIENQYFRY---------------MPVADKLRKNV--------NAQIA-GGRNP
                            :                                               

gi|1139688      ------------MVLNEQPSHQAKQAQFQFDTWLHNLTDAEKDTLLRTLFEQGLLTRHQA
gi|1942917      VPPGQIYKSLKWSQIDDVQRDIRGGGADFVNDLKRVMATQAQIAGFSALGPSQKSLKNPI
gi|2398168      GAAPSDMAPLHMFVVIPQPER--GQMVPSTYDTVGTLGAGAQMGEYDKKVQ-GERKRRQA
gi|1706995      GRPSSEMGILYMFIVIPHPED--DGMIPRTYDMLTELGASDPTANNPAMSNQR-------
gi|9177754      KKPMTAVPNLHLFIVIPHPED--DGMVPRTFDTLTELGKSDAMPAQAGYVDEGKADQQ--
gi|1720603      DKPQSDAPILHLFVVTPHPQD--PGMIPRTYDTLAELGHANAMKGQGDLVSAG-------
GOS_118102      ------------------------------------------------------------
gi|7806384      NKPQQDAPVLHLFVVTPHPQD--PGMIPRTYDMMAELGHGDAMKGQHDLVVAG-------
gi|2540001      KNPCQNVGLLHLMVVIPQPEN--AGMVPRTYDTIKALGHGDAMPGQQAAVTA--------
gi|1070229      GRSPADVPNLHVMAVIPTPER--PQMVPRTHDTVKVLGYGTSMPNQDKAVEDELARNRQQ
gi|1720656      GKSPVDIPNLHVLVVIPTPER--AQMVPRTHDTVKVLGHGTSMPNQDKAIEDELARNRQQ
gi|1713213      GKSPVDIPNLHVLVVIPTPER--AQMVPRTHDTVKVLGHGTSMPNQDKAIEDELARNRQQ
gi|1160532      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|2542382      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|1071041      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|2188941      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|2542440      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|1560028      GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|2517920      G-------PIHWFTVTNSSDEGIGAGTYTTNEMFKLLGKQDVMPGVARNIKLNELETQLG
gi|2550682      GIDASEMQPLCVFVVTNSSKEGLGPGMINTERMLASLGRRDVMPTVARERILEQAGYGNA
gi|3449668      GQHG----PVYLMVVTNDNAEGMGLGVKNTYKMLDALGKRSQMPTLARSSINEQVKQAER
gi|6604819      EVDG----PVYLFVVTNSSNEGMGDGSVNTFRMLKQLGRPELLPGVARAERHDELMDELY
gi|2378021      KKHG----PIYLFVVTNSSEEGMGDGSVNTFRMLKHLGRPELLPGVAQAERHDELMDELY
gi|7173368      IEHG----PLYLFVVTNSTKEGMGDGTINTYRMLRQLGRPELMPEVTRYERDKELEAQVA
gi|2065620      GRDG----SIYLFVITNSSDDAVGNGTVRTYQMLESLGCGNSMPGVAQLQRSDDYAAQQK
gi|1342931      AKHG----SVHLFVVTNSSDEGMGLGAGTTYDMLNALGRADTMPNVARIETAKSLGKQAT
gi|1706979      --------PLYLFVVTNSSDDGIGLGTVSTYHMLNALGRADALPGVSKLERAD----DLE
gi|2542488      --------PLYLFVVTNSSDDGIGVGTVSTYHMLNALGRADVLPGVAKLERADELEKQ--
gi|1720632      GKHG----MVYLFVITNSTDAAVGTGTLTTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|1713177      GKHG----MVYLFVITNSTDAAVSTGTLNTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|1706975      GKHG----MVYLFVITNSTDAAVSTGTLNTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|9430957      GQHG----AIHLFVITNSSDEGMGDGTVNTYRMLNALGRAEVIPGVAKLEQEDVRQADLQ
gi|1754885      GKHG----SLHLFVVTNSNDDGIGLGTVNTYRMLEALGRADTLPGVATLEREDARQASLG
gi|1706912      AKHG----VVYLFVITNSNDDGIGLGTVSTYQMLDALGYGDRMPGIEKLERNDQLAQQEQ
                                                                            

gi|1139688      LALTRK--------------------------ESANTDETYQYWLTPDL--------ITP
gi|1942917      CKALGDRITRAIYDGKPFHVYMVLPVH-----PEGTLDTINIMTQQHLTMQSLVFGSHSL
gi|2398168      GAGGSGGLVGASADTVPMDAQAQLQEL-----GIKPLVAMLLTFDSANQAKSIRVKARDS
gi|1706995      -----------TYDKENPRPQDY--------------PDAKTVSYKRDT--------GVG
gi|9177754      -----------------YGNHSTQATY-----TTTFTDESGEPVSIART--------HPV
gi|1720603      --------------------------------------KTAQVYKNAQG--------DNT
GOS_118102      ------------------------------------------------------------
gi|7806384      --------------------------------------KTKQQYKDREG--------KNT
gi|2540001      -------------------------------------PVKSSFLKTSEQ--------EIA
gi|1070229      QATWDAYVKRQKASGARIDPDYYPAPL-----SPAAQSAKDLGDKASLT--------KSL
gi|1720656      QATWDAYVKRQKASGARIDPDLYPAPL-----SPVAQSAKDLGDKASLS--------KSL
gi|1713213      QATWDAYVKRQKASGARIDPDLYPAPL-----SPVAQSAKDLGDKASLS--------KSL
gi|1160532      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|2542382      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|1071041      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|2188941      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|2542440      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|1560028      LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|2517920      MAKRSEVRLYNESMKAPTAEGKAVAAA-----EFEKNQQEIQRIEKEIG--------EIK
gi|2550682      IQRMFPNLSADSIWRKILPDFILPPPPLKPIEGLNDREVKERELAEKVK--------KTK
gi|3449668      EVQIGEN-------------------------------QNAKRTSKPLS--------DLP
gi|6604819      AAKQEELLATQKAA-------AFNQVH-----GIDHTERAARIYEPLKN--------KLA
gi|2378021      AAKQEELLATQKAA-------AFNQIH-----GIDHTERAARIYEPLKT--------KLA
gi|7173368      QA-------KERYDTAKGKITIIEGTY-----GRSFNPAMSKLWEPQRK--------AAE
gi|2065620      DLEAQLAAQQSIQHKFAAQGVDI---------NAASLQGAMNFYQDNMA--------KQQ
gi|1342931      AAQLQLNNASGPEEK-----------------------QKAQAKLDSVR--------RQA
gi|1706979      KQYEAALEAKKAADQAYERAQHVPVNP-----FSNSAQYAVNNLVATQL--------DAT
gi|2542488      --YKEALKVKERADKAFESAKRVPVDP-----FTSSVQYAMNNITAAHL--------DAV
gi|1720632      KQFADVVSKQQDAGQEYLGALQM---Q-----GMANTPATTQAVGQAKQ--------KVD
gi|1713177      KQFADVVSKQQDAGQEYLGALQMQ--------GMANTPATTQAVAQAKQ--------KVD
gi|1706975      KQFADVVSKQQDAGQEYLGALQIQ--------GMANTSATTQAVAQAKQ--------KVD
gi|9430957      RQYDAARAQAREAQGAVARVYQF---------THLGDAYVQKLLARAEE--------KLQ
gi|1754885      KQRAQAIDQQNQANQVIEDANAF---L-----KTEDTASTRQWLADAQQ--------KLK
gi|1706912      ALEKQLADEQAASKHAMMQGADFSHMQ-----GLANYLQDGQARQSELQ-------QKLE
                                                                            

gi|1139688      YIQQAQSQLQQ----------EQAEALAKK------------------------------
gi|1942917      VNRIRRALLAMKYVRERKMEVKRARDAAESAKIEDL--------NRNIRQGEWQKYLTLL
gi|2398168      EAQDAQAGVE-----------EKARGHADD--------------VNPEN-----------
gi|1706995      PVISEIKVLDH----------PSVQELAST--------------Y------GIKVSIAR-
gi|9177754      LDRPSLETLE-----------RTL---------------------------GLKVSVAR-
gi|1720603      FHPQSLKELQ-----------DTM---------------------------GLKVSIAR-
GOS_118102      ------------------------------------------------------------
gi|7806384      FHPQSWKELA-----------ETI---------------------------GLKVSIAR-
gi|2540001      AHAAQVKT-------------PTLDKEGVL--------------IQDGKSLRMKVLIAK-
gi|1070229      DQMGIRALVGSLWSFDYNWRSSKLNTETEK--------------KQARWDDYVKKQQAKG
gi|1720656      DQMGIRALIGSLWTFDSNWRSSTLSTETAK--------------QQARWDEYVKKQQAKG
gi|1713213      DQMGIRALIGSLWTFDSNWRSSTLSTETAK--------------QQARWDEYVKKQQAKG
gi|1160532      LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEAPGLKVVVAT-
gi|2542382      LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|1071041      LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|2188941      LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|2542440      LGAQEIPGLA-----------KNTGEDDKP--------------YQLVEVPGLKVVVAT-
gi|1560028      LGAQEIPGLA-----------KNTGEDDKP--------------YQLVEVPGLKVVVAT-
gi|2517920      AKQHEEQKTQEAGKAGPTKKEGELNQIESSELGQEEPNLTKELGYEISDTPGIKAHICT-
gi|2550682      NTEELRKILK-----------EDLEKE------------------------GIKVHICT-
gi|3449668      ERRKKLAALKQ----------EQAEANQGK--------------FVDGDIPGLKTHVCSL
gi|6604819      EARAKVARLEQ----------EMPEKDAEI--------------VTPSEIEGLKIHICT-
gi|2378021      EARAKVERLEQ----------EMPGKDAEP--------------ITPSEIRGLKMHICT-
gi|7173368      AAEAEYRALKA----------KLPADKAKP--------------LTVPGTEGLKVLICT-
gi|2065620      ELQQALNELKRK---------KQLNAHIDPD-------------APPLDIEGLKVQVCT-
gi|1342931      QINDDMKTL-----------------------------------ILPQEIRGLKVHLCT-
gi|1706979      EATQRANDLKV----------QLEKARTED--------------PQKFNIPGLKVHICT-
gi|2542488      EAAQRVSELKV----------QLEKARTEN--------------PEKLNIPGLKVHICT-
gi|1720632      QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|1713177      QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|1706975      QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|9430957      QARAKQAEVK-----------AQMKAPPNA--------------VLPAPIDGLKVHICT-
gi|1754885      RATAKRAELEA----------EMKKTLPKT--------------IQSVKIDGLEVHICT-
gi|1706912      QTRQEQRRTASVSA-------DGLTKDGDL--------------VPPQDMPGMKVLVCT-
                                                                            

gi|1139688      -LAIEKAEKEK---------------------------------MLTDIY------NQRE
gi|1942917      NLRNWDVLHGR--------------------PVTEQIYVHSKLLIADDRVVVLGSANIND
gi|2398168      -LSDFNITPRR----------------------YREIYIHSKLMIVDDVYLTLGSANLNA
gi|1706995      -LRASGPIPGH-------------------DMAYREIYIHSKLMIVDDVFITMGSANMNQ
gi|9177754      -LCTSDSVEGK--------------------MAYREIYIHSKLMIIDDVFLTLGSANLNQ
gi|1720603      -LRTSGMVNNQ--------------------MAYREIYIHSKLMLIDDVFVTVGSANMNQ
GOS_118102      ---------------------------------------------VDE------------
gi|7806384      -LRTSGMVGGQ--------------------MAYREIYIHSKLMIIDDVFVTLGSANMNQ
gi|2540001      -MATANPPGGK-------------------LGSSRDIYIHSKLMLVDDNFMTLGSANLNL
gi|1070229      ELPDPDLAPML------------PLPAQSFAARYREIYIHSKLLMIDDSFFTLGSANLNL
gi|1720656      ELPDPDLAPML------------PLPTQSIAARYREIYIHSKLLLIDDSFFTLGSANLNL
gi|1713213      ELPDPDLAPML------------PLPTQSIAARYREIYIHSKLLLIDDSFFTLGSANLNL
gi|1160532      -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|2542382      -LATSDPAPGSPPPARLSAEAEAALGAPLLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|1071041      -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|2188941      -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|2542440      -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|1560028      -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|2517920      -LM-PKDENGK----------YVHTYKKNGKDTPAEVYVHSKVTIMDDVFTVISSANLNT
gi|2550682      -LVAED---------------------------WEEIYIHSKLCLINDTFATLGSANINT
gi|3449668      -VSMTGYQQGQ---------------------PWQYVYIHAKLMMIDDTFMTLGSANINL
gi|6604819      -LVAPDSPPND----------------------WMDVYVHSKLMIVDDVFTTIGSANINT
gi|2378021      -LVAPDSPPDD----------------------WMDVYIHSKLMIIDDVFTTIGSANINT
gi|7173368      -LVASDSPPEK----------------------WMDIYIHSKLMIIDDVFTTLGSSNINT
gi|2065620      -LVAPDSPGGN----------------------WLPVYVHAKLMTIDDAFMTIGSANVNL
gi|1342931      -LVAPDSPPTN----------------------WMPVYIHSKIMIVDDVFLTHGSANINR
gi|1706979      -LVPPDTPKGR---------------------PWDEVYIHSKLMIIDDVFVTHGSANVNL
gi|2542488      -LVPPDTPKGK---------------------PWDEVYIHSKLMIIDDVFVTHGSANVNL
gi|1720632      -LVAPDSPPGK----------------------WEPVYVHAKLMTIDDTFTTIGSANINT
gi|1713177      -LVAPDSPPGK----------------------WEPVYVHAKLMTIDDTFTTIGSANINT
gi|1706975      -LVAPDSPPGK----------------------WEPVYVHAKLMTVDDTFTTIGSANINT
gi|9430957      -LVAPDSPPDK----------------------WQDVYIHAKLMIVDDVFMTLGSANINT
gi|1754885      -LVAPDSPPNN----------------------WDYVYVHAKLMIVDDVFMTLGSANINT
gi|1706912      -LVAPDMPAGK---------------------EWDYVYIHQKLMIVDDVFTTHGSANVNR
                                                               :            

gi|1139688      HSWQQAQEQANRTCASG----------------YDEAARYLHQLFEAYQF--KAD-----
gi|1942917      RSQLGDRDSELAVVIHDDKAMSVRLDGQLVQPVGTFAHGLRKALWKKHFGLMGGVAPATE
gi|2398168      RSM--AADSELNMCTEE----------------YAFTKAARKRVWGNLAG--GDLDGKDC
gi|1706995      RSM--TADSEINIGATG----------------LDYAAPLRERIFKLHSG--GDISGSGD
gi|9177754      RSM--SVDSEINIAATG----------------AEHAARLRGDVFGLHSG--GDIKGDGG
gi|1720603      RSM--SVDSEINIAATG----------------HEWTSKLRGRVFSLLSG--GATSGSGD
GOS_118102      ---------------------------------QNLLEDIRR------------------
gi|7806384      RSM--SVDSEINFGATG----------------LDWASKLRGRVFPLLSG--GATQGSGD
gi|2540001      RSM--AADSEINVATDS----------------IPHNRELRKRIWSLQTG--GLYDGGNA
gi|1070229      RSM--AVDAEINVGTDD----------------RAKSEDLRKRVWKLHTG--NAADCNPS
gi|1720656      RSM--AVDAEINIGTDD----------------PAKSEDLRKRVWKLHTG--NAADCNPA
gi|1713213      RSM--AVDAEINIGTDD----------------PAKSEDLRKRVWKLHTG--NAADCNPA
gi|1160532      RSM--HGDSELGIAQPN----------------PDLARAMREELWGAHVG--RLAETT--
gi|2542382      RSM--HGDSELGIAQPN----------------PDLARAMREELWGAHVG--RLAETT--
gi|1071041      RSM--HSDSELGIAQPN----------------PDLARAMREELWGLHAY--EVAATT--
gi|2188941      RSM--HGDSELGIAQPN----------------PDLARAMREELWGLHAY--EVAATT--
gi|2542440      RSM--HGDSELGIAQPN----------------PDLARAMREELWELHAQ--KVAATT--
gi|1560028      RSM--HGDSELGVAQPN----------------PDLARAMREELWELHAQ--KVATTT--
gi|2517920      RSM--QVDTELGIIMEC----------------ADVAEGLRKRLWDLHTN--KNSAANPD
gi|2550682      RSM--QIDSELNVAVES----------------QPASHKIRHETWGWHTN--GNEEMNPG
gi|3449668      RSM--VCDSEINVCHCQ----------------PDITRAARQHLWNMHTV--GQGNTADA
gi|6604819      RSM--QVDTELNICVED----------------PSVTKPLREHLFDLHIG--KKISGLDT
gi|2378021      RSM--QVDTELNICVED----------------PTVTKPLREHLFDIHTG--ETKTEPGI
gi|7173368      RSM--EVDSELNICVED----------------PAVTKPLRKHLWSIHTD--SEGSG-DD
gi|2065620      RSM--NVDSELNICHEN----------------SVVTKSLRQRLWSMHAG--DKGAQEDF
gi|1342931      RSM--EVDSELNICHEH----------------MGVTQPLRRRLWAMHTG--GVEEGASD
gi|1706979      RSM--EVDSELNIFHES----------------MRVTQPLREKLWRIHAG--DKGVGAKD
gi|2542488      RSM--EVDSELNICHES----------------MRVTQPLREKLWRIHVG--DDGIGSKD
gi|1720632      RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GRGAQ-DD
gi|1713177      RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GRGAQDDP
gi|1706975      RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GKGAQDDP
gi|9430957      RSM--EGDSELNICHEN----------------EAVTRPLRRKLWHDHTK--GMGDH-DD
gi|1754885      RSM--QVDSELNICHEH----------------SGVTAPLRKRLWNIHTK--GMGAQEDV
gi|1706912      RSM--EVDSELNICHEH----------------GGATRALRKQLWALHTN--DLGAQDDI
                                                                            

gi|1139688      ---------NVAFEQRFKRFVVTNNSRKALLN---------RLSDLL-------------
gi|1942917      LGLPSILDGPGDLDT-WQAVQRVAQTNAEAYDKAFPYVPRSKSRSSVWPTWDDSNGKLRG
gi|2398168      TRMET----ADTHEK-WLTRMNTNKENRIKNL---------GPESNSLI-----------
gi|1706995      FKEI-----PNVFED-WNRRMAKNRNVWKSGT--------AALKGFLLP-----------
gi|9177754      REAM-----PSVFGD-WESYMQKNYNKCKEGN--------EKLKGFLVK-----------
gi|1720603      RNRV-----PVVFDI-WEGRMKDNRDIQKAGT--------ENLQGFILP-----------
GOS_118102      ------------------------------------------------------------
gi|7806384      RDQV-----PVVYDD-WEKRMHENLIAKMKGN---------PMQGFILP-----------
gi|2540001      YSDSM----DDTFEK-WKKLAERNARHIEKNE---------RFEGFIVA-----------
gi|1070229      SLTPLAM--SKAFRN-WVQLLRANELARKKGD---------APTGFLHP-----------
gi|1720656      SLTPKAM--AKTFIN-WVQLLRANEIARKKGD---------APTGFLHP-----------
gi|1713213      SLTPKAM--AKTFIN-WVQLLRANEIARKKGD---------APTGFLHP-----------
gi|1160532      ---------EKNFEL-WNQKMDDNWKAQVADE---------PFTSHLLR-----------
gi|2542382      ---------EKNFEL-WNQKMDDNWKAQVADE---------PFTSHLLR-----------
gi|1071041      ---------KDNFEL-WNQTMDKNWKQQRNDE---------PLTSHLLR-----------
gi|2188941      ---------KDNFEL-WNQTMDKNWKQQRNDE---------PLTSHLLR-----------
gi|2542440      ---------EKNFKL-WNQKMDANWRQQRKDE---------PLVANLLR-----------
gi|1560028      ---------EKNFKL-WNQKMDANWRQQRKDE---------PLVANLLR-----------
gi|2517920      DMHDYEVA-EGAFKE-WQRLINENKKNMGDKS----------PKCALRE-----------
gi|2550682      VQLVDPNISGKTFLS-WAEVLDQNKSAKETKQ---------KRLMPLLE-----------
gi|3449668      SKPQPL---ADVYDR-WERIMKANQKNRQSKR---------APIAPLVK-----------
gi|6604819      ---------TETYQK-WQEAIDKNKSRRTKGMQDTQVTTPDGPIASLVE-----------
gi|2378021      ---------ASIYQQ-WQAIIETNKTNRILNKQKNDAVKLQGPVASLVE-----------
gi|7173368      I--------ETAFST-WSRIASFNAANRKNKE------NTNRPTHSLTE-----------
gi|2065620      ---------FKSFMA-WHDIVEQNKVNKTKNL---------PPEKSLVK-----------
gi|1342931      S--------AGNAATAWEHIIKLNASNQKRGQ---------PPIASLVG-----------
gi|1706979      KNGRLNA--KSAFKG-WGEVILNNQDLKSEGG---------APCASLVE-----------
gi|2542488      KNGRLNA--ESAFKG-WDEIITKNQELRSGGD---------APRASLVE-----------
gi|1720632      P--------QAAFKN-WELLINNNADFQKAGD--------QSPAASLVG-----------
gi|1713177      ---------QEAFKN-WELLINNNADFQKAGD--------QSPAASLVG-----------
gi|1706975      ---------QEAFKN-WELLINNNADFQRAGD--------QSPAASLVG-----------
gi|9430957      P--------AEAFKQ-WGKIIRRNADNRNNGN---------APESSLIE-----------
gi|1754885      ---------TEAFDQ-WDRIIVENAKNERNKL---------PPCASLVG-----------
gi|1706912      ---------PEAYKQ-WSRVIFRNTQNQGNKL---------PPVASVVG-----------
                                                                            

gi|1139688      ------------------------------------------------------------
gi|1942917      YMPFNERFWREERPRDDSFTWDAKQILSESTPSGVRGFIVALPVMWTLGENNDSKMNLTT
gi|2398168      -------HPFEDPRGVPFVKFA--------------------------------------
gi|1706995      -------FEDHRATGTMHAQVTIPSTSDTSALT---------------------------
gi|9177754      -------FEDKRSTSTKHAMNTVAPSTNGQTALT--------------------------
gi|1720603      -------FIDRRAETVLHAQIDVPSSTNASRTV---------------------------
GOS_118102      ------------------------------------------------------------
gi|7806384      -------FEDRRANTILHAQIDPPPSSDIPRTV---------------------------
gi|2540001      -------FKDERVAKDR---VG--------------------------------------
gi|1070229      -------FHDDRVTGIR---LS--------------------------------------
gi|1720656      -------FHDERATGVR---LS--------------------------------------
gi|1713213      -------FHDERETGVR---LS--------------------------------------
gi|1160532      -------FWDVTTPYSQNLTVD--------------------------------------
gi|2542382      -------FWDVTTPYSQNLTVD--------------------------------------
gi|1071041      -------FWDVITPYSPSFTVD--------------------------------------
gi|2188941      -------FWDVITPYSPSFTVD--------------------------------------
gi|2542440      -------FWDVVTPYSPGLTVD--------------------------------------
gi|1560028      -------FWDVVTPYSPGLTVD--------------------------------------
gi|2517920      -------FYRADPTVSR---SD--------------------------------------
gi|2550682      -------FDLTNKNRVYTQDLD--------------------------------------
gi|3449668      -------FSNDTSSTKD---LD--------------------------------------
gi|6604819      -------FLQESSARKN---LD--------------------------------------
gi|2378021      -------FLQETKSRKN---WD--------------------------------------
gi|7173368      -------FYRDSKKRSN---LD--------------------------------------
gi|2065620      -------FVRTSAKRTY---AD--------------------------------------
gi|1342931      -------FKWTSTKRTR---LD--------------------------------------
gi|1706979      -------FYRDSPSRSN---LD--------------------------------------
gi|2542488      -------FYRDNPSRSY---LD--------------------------------------
gi|1720632      -------FMRTSNKITR---SD--------------------------------------
gi|1713177      -------FMRTSNKITR---SD--------------------------------------
gi|1706975      -------FMRTSNKITR---SD--------------------------------------
gi|9430957      -------FSRKDPKRTY---KD--------------------------------------
gi|1754885      -------FMRESDKRSY---LD--------------------------------------
gi|1706912      -------FLRTSPKRTY---AD--------------------------------------
                                                                            

gi|1139688      -------------------------------
gi|1942917      LAHVESEDEVNRERQTASRSPSQSGQADAYS
gi|2398168      -------------------------------
gi|1706995      -------------------------------
gi|9177754      -------------------------------
gi|1720603      -------------------------------
GOS_118102      -------------------------------
gi|7806384      -------------------------------
gi|2540001      -------------------------------
gi|1070229      -------------------------------
gi|1720656      -------------------------------
gi|1713213      -------------------------------
gi|1160532      -------------------------------
gi|2542382      -------------------------------
gi|1071041      -------------------------------
gi|2188941      -------------------------------
gi|2542440      -------------------------------
gi|1560028      -------------------------------
gi|2517920      -------------------------------
gi|2550682      -------------------------------
gi|3449668      -------------------------------
gi|6604819      -------------------------------
gi|2378021      -------------------------------
gi|7173368      -------------------------------
gi|2065620      -------------------------------
gi|1342931      -------------------------------
gi|1706979      -------------------------------
gi|2542488      -------------------------------
gi|1720632      -------------------------------
gi|1713177      -------------------------------
gi|1706975      -------------------------------
gi|9430957      -------------------------------
gi|1754885      -------------------------------
gi|1706912






Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 34
Alignment assumed to be: Protein
New number of positions: 12 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  -------------------------------------MSEYQYYKFER-----LDGYLDA
gi|194291793|re  ---------------MGAPDKQVYQIVGGDQKAAKTATSAPGCFVHGK-----DVFSEPV
gi|239816830|re  ----------MADLSKLLDEIQRPEVSHVDMI-KRRSKGTLQWFLEKD-----HKTHPIH
gi|170699527|re  -------------MADSILKSQNPTSVAIDEQ-SRAAKSSAQWLLEKR-----KDIAPIT
gi|91777541|ref  ---------------MSNLKTQNPVDVAITEV-GGQAQGSVQWLLEKK---TCPDAPEIT
gi|172060379|re  -------------MAKLPLESHNAMDVAIDEA-GRIAKGTVQWLLEKD----VDDDVMPT
GOS_1181020_Tra  SRYRRTSNNKEKNVAQLPLETHNPVDVAVDEA-GRAAQGTVQWLLEKN----VDKDVMPT
gi|78063844|ref  -------------MAQLPLESHNAVDVAVDEA-GRAAQGTVQWLLEKN----VDEDVKPT
gi|254000137|re  ------------MKPHDPYKTHNRVTAPLDKE-TCEVTASFQWLLEKS------RSHPIT
gi|107022962|re  ---------------MSDTNTQNKSKAPIDVD-KRQAVASAQWFLEKQ----ADYYAPPY
gi|172065698|re  ---------------MSDTNTQNKSKAPVDVS-TRQSVASAQWFLEKN----ETYYAPPY
gi|171321395|re  ---------------MSDTNTQNKSKAPVDVS-TRQSVASAQWFLEKN----ETYYAPPY
gi|116053236|re  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|254238204|re  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|107104185|re  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|218894188|re  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|254244030|re  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|15600282|ref  -----------------MSDLYKPQTLKLYAQQAGSVRLTLDWFANKA-------FYPPR
gi|251792084|re  -------------------MSQNKQQISTTEG-KLCATVNFNWFLKDAEKFENGTQSEPV
gi|255068222|re  -----------MPNDPKTQSKSKPKNGQMPIT-QKKSTVAESWFVGKG----GNKNVPSA
gi|34496689|ref  --------------MSQPLAKHKPRQHNVDPSQHQTTRTSTPWFLADDHPVGYKPEFHEV
gi|66048194|ref  -------------------MTTPSITTPVATGKNMSCNINLPWFVQDT-------EYRPA
gi|237802136|re  -------------------MTTPSITTPVATSKNMSCNINLPWFVQGT-------EYCPA
gi|71733687|ref  -------------------MTTPLITTPVATSKNMSCNINLPWFVQGT-------EYCPT
gi|206562019|re  -----------------MANINKSITTPIAQNHTSSAMACLPWFVCNS-------EYSPS
gi|134293146|re  ------------------------------------------------------------
gi|170697911|re  ------------------MSQPAAITVPIAQSFGNAATLTLPHFVQGA-------EYKPR
gi|254248890|re  ------------------MSQSAPINVPIARSCGNTATLTLPHYVQDA-------EYGPR
gi|172063204|re  ------------MANSSPASDAFVATTPIALNHTNNGTVTFRWFVQKT-------EYNPA
gi|171317799|re  ------------MANSSPASNAFIATTPIALNHTNSGTVTFRWFVQKT-------EYNPA
gi|170697592|re  ------------MANSSPASNVFVATTPIALNHTNSGTVTFRWFVQKT-------EYNPA
gi|94309572|ref  -------------------MTQPFITVPIALSCTRSATITLPWFVQCT-------EYNPA
gi|17548851|ref  -------------------MANKPIVTPLALSRTRTATLTLPWFVQHT-------EYDSA
gi|170691203|re  ------------------MTKQQSITVPVALSSTRSATVPSPWFVQNT-------EYNPA
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  KARQ----------------ALRTISSRADITATSFQ--VYY------------------
gi|194291793|re  KGNAVQFFVTGTEYFDNVARAIEGAQSSVFITGWQVNFDVVL------------------
gi|239816830|re  DNNALQFFMCGQEGFAAIEKDILAAGSSIDLVLWGFDPGMELTRSRNT------------
gi|170699527|re  YENHLEFLVCGEEGFANIANDLKLAKGSVNLCCWGFDPGMELIREKGETK----------
gi|91777541|ref  EGNDLQFFICGQEGFGQLSKDLRAAKSTVDIVCWGFDPGMEVERTGEA------------
gi|172060379|re  TGNKLEFFVCGEEGFRAIATDILAAKSTVDICCWGFDPGMELVRGDGPACWIGDPQVN-M
GOS_1181020_Tra  TGNDMRFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGK
gi|78063844|ref  LGNDLKFFVCGEEGFRSIATDLMGAQGTVDICCWGFDPGMEIWRGAESPKGIGVPKVDGK
gi|254000137|re  EGNRIETLICGQEGFGRIAQDIEHARGSLCIVCWGFDPGMALVRGEGQANYP--------
gi|107022962|re  EKNNIDVFICGEDAFTQIAADLKAAKHSVEIICWGFDPGMELIR-KGTV-----------
gi|172065698|re  AKNNLDVFICGEDAFKQIAADLKAAKHSVEIICWGFDPGMELIRNGSV------------
gi|171321395|re  EKNNLDVFICGEDAFKQIAADLKAAKHSVEIICWGFDPGMELIRNGSV------------
gi|116053236|re  AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|254238204|re  AGVHIKPLINGQAAFDAVHAAMEAARQSIDIITWGFDPAMRFKR----------------
gi|107104185|re  AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|218894188|re  AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|254244030|re  AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|15600282|ref  AGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR----------------
gi|251792084|re  PATF-KALVNGKEAFEELHDRIANAQHSIDIAIWGFQPSMHFKRDG--------------
gi|255068222|re  EQATFLSLVNGEVAFGELYDSIEKAKKSVEIVCWGFQPSMYFKRGVN-------------
gi|34496689|ref  NATF-EPLINGERAFGAIYDAILAAKHSVDIVCWGFQPSMYFKRGAGAPPIQYYLQQPQL
gi|66048194|ref  EATF-EPLVNGERAFGAVYDAIMAAKHSVEIICWGFQPSMYFKRGA--------------
gi|237802136|re  EATF-EPLVNGERAFGAVYDAIMAAKHSVEIACWGFQPSMYFKRGD--------------
gi|71733687|ref  EATF-EPLVNGERAFGAVYDAIMKAEQSVEIICWGFQPSMYFKRGD--------------
gi|206562019|re  AAGF-RPLVNGRDAFAAVYKAIADAKHSIDIICWGFQPSMYFLRDG--------------
gi|134293146|re  ----MRPTVNGKEAFGALYDAICNAKHSIDYVCWGFQPSMYFKRDG--------------
gi|170697911|re  NATH-CPLVNGEEAFGAVYDAIASAQHSVDIVCWGFQPSMYFKRGSSG------------
gi|254248890|re  YATH-YPLVNGEEAFGAVYDAISAAQHSVDMVCWGFQPSMYFKRGASG------------
gi|172063204|re  AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|171317799|re  AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|170697592|re  AATF-RPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFKRDG--------------
gi|94309572|ref  PATF-KPLVNGETAFRDIYDAIFLAVKSVDIICWGFQPSMFFKRGAGG------------
gi|17548851|ref  QATF-RPLVNGEEAFGAVYDAIAAAKHSIDIICWGFQPSMYFKRGSGA------------
gi|170691203|re  PATY-LPLVNGEAAFGAVFDAIRQAEHSIDILCWGFQPSMYFRRGGDA------------
                                         ############                        


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ---------------------------------TYSDLKAEPS-------------TLML
gi|194291793|re  -----------------------------TGKKTLWNCLRTAV--R------NGASVYVM
gi|239816830|re  ----------W------------------PRGTTYGDLLVRKA--G------EGVKVRML
gi|170699527|re  ----------W------------------PRGQTYGQLLEEVA--N---KG---VTVRLM
gi|91777541|ref  ----------W------------------PRDLRYGDLLEQLA--K---AE---VRVRLL
gi|172060379|re  PFVP----GTW------------------PRGTVYGALLEEIT--Q---RKDNPVTVRLL
GOS_1181020_Tra  PLPTKPAAGGW------------------PRGIVYGALLEEIT--Q---RKDNPVTVRLL
gi|78063844|ref  PYSPTPADGLW------------------PRGIVYGALLEEIT--Q---RKDNPVTVRLL
gi|254000137|re  ----------W------------------ANGLPYGELLRRKA--A------EGVQIRLL
gi|107022962|re  ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|172065698|re  ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|171321395|re  ----------W------------------PRGDTWGGLLRDVA--AGKFNNGKPVQVRLL
gi|116053236|re  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|254238204|re  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|107104185|re  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|218894188|re  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|254244030|re  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|15600282|ref  -----------------------------PDGPRIGELLQTKG--R------EGVQARVL
gi|251792084|re  ------------------------------KSPCIGDLLIQKA--L------EGKKVRIL
gi|255068222|re  -----------------------------LAGAPIGELLMEKFI-Q------NNVDVKIL
gi|34496689|ref  PPLTADNIDKIADDMAGKLPFTRRKLHPKDKIMPIGELLEMKS--L------EGVKVRIL
gi|66048194|ref  -----------------------------TCSLCIGELLALKA--Q------EGVQVKIL
gi|237802136|re  -----------------------------TCSLCIGELLALKA--Q------EGVQVKVL
gi|71733687|ref  -----------------------------TSSLCIGQLLAMKA--D------KGVKVRIL
gi|206562019|re  ------------------------------TGKRIGELLEQKG--K------EGVKVRLL
gi|134293146|re  -----------------------------GKSLRIGDLLIQQA--K------QGVKVRIL
gi|170697911|re  -----------------------------QGSLSIGELLLERA--K------HNVKVRLL
gi|254248890|re  -----------------------------QGSLSIGELLLERA--R------HNVKIRLL
gi|172063204|re  ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|171317799|re  ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|170697592|re  ------------------------------QGVGIGELLRQKG--E------AGVKVRLL
gi|94309572|ref  -----------------------------QGTKCIGELLEDVG--K------RGVKVRLL
gi|17548851|ref  -----------------------------QDTLPIGDLLEAMG--K------RGVKVRLL
gi|170691203|re  -----------------------------HGSPSIGELLEFKGLEK------PGIKIRLL
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  KYFDI-------------------------------------------GF----------
gi|194291793|re  PWMSPKVGVDTGDLETALTVIQLNAGLPSPRAFVLPAVSQCDQP----GA----------
gi|239816830|re  LWFDN----------------------------LVVNKAAGNVP----DF----------
gi|170699527|re  VWYDE----------------------------T-ASAKQNNVP----GY----------
gi|91777541|ref  LWFDP----------------------------R-ASRKQNSMP----GY----------
gi|172060379|re  IWFDP----------------------------R-ASRKQNSMP----GF----------
GOS_1181020_Tra  IWFDP----------------------------R-GSRKQNSMP----GF----------
gi|78063844|ref  IWFDP----------------------------R-GSRKQNSMP----GF----------
gi|254000137|re  VWYNS----------------------------S-GSSVQNNLV----GY----------
gi|107022962|re  SWYGV----------------------------I-GSTLSNNMP----GY----------
gi|172065698|re  SWYGF----------------------------I-GSLGSNNMP----GH----------
gi|171321395|re  SWYGF----------------------------I-GSLGSNNMP----GH----------
gi|116053236|re  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|254238204|re  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|107104185|re  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|218894188|re  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|254244030|re  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|15600282|ref  VWSNQ----------------------------L-ARLKENTIPGAGVGG----------
gi|251792084|re  VWSLP--------------------------GSI-QTFAEANL-----GN----------
gi|255068222|re  CWQTN--------------------------PFATEKFLEDNTP----GRSTLLFMHEYL
gi|34496689|ref  TWNDP----------------------------I-SQIPEVMNP----GY----------
gi|66048194|ref  CWSDS--------------------------THM-AQFLENPTP----GD----------
gi|237802136|re  CWSDS--------------------------THM-AQAMENTTP----GD----------
gi|71733687|ref  CWSDS--------------------------AHVTAAFSENMTP----GR----------
gi|206562019|re  CWRDP--------------------------FYM-AELSENNMP----GN----------
gi|134293146|re  CWLDS--------------------------AWV-AQFSEQEAP----EY----------
gi|170697911|re  VWGDK--------------------------FHV-AQFLENMMP----GG----------
gi|254248890|re  VWGDK--------------------------AHV-AQFLENMMP----GG----------
gi|172063204|re  VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|171317799|re  VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|170697592|re  VWRDP--------------------------AFV-SELSENNMP----GN----------
gi|94309572|ref  CWGGQ----------------------------VLGLPEINNRF----GP----------
gi|17548851|ref  VWSDS--------------------------LHL-AQFFENMTP----GN----------
gi|170691203|re  VWSDS--------------------------LHV-ASFSEDMMP----GN----------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ------------------------------------------------------------
gi|194291793|re  --------------LGIAFSHHQKLVVIDNKFAYVGGIDLAYGRRDDG---KYS--LKAE
gi|239816830|re  --PVFWAPTSFSKTSRTTWP-------------------EGAGSYDDRSNSAWV--LTDR
gi|170699527|re  --------------SDTGHN---------------PITHLPAFLVGTSKS-PYD--SKDR
gi|91777541|ref  -----------TDVPVSLAT-------------------SPIQRMVQGDD-PYG--NPVR
gi|172060379|re  -----------TDVPVSGWT-------------------SPVQKKVQQAP-PYK--NAKR
GOS_1181020_Tra  -----------TDIPVSGWT-------------------SPIQKKVQQRP-PYA--NSER
gi|78063844|ref  -----------TDVPVSGWT-------------------SPIQKTVQQEA-PYA--NAKR
gi|254000137|re  ---VATGNTPPGGTLTSTWD----------------------ERNPNAKTPKPL--ADVR
gi|107022962|re  --------------SGGRLT-------YEQKMAREVGKAGGIYVQLGNAPQPLT-PQDRR
gi|172065698|re  --------------SSGRLN-------YEEKMAMMVGAGGGIYLPTGKPPQP-QTPQERR
gi|171321395|re  --------------SSGRLN-------YEEKMAMMVGAGGGIYLPTGKPPQPQT-PQERR
gi|116053236|re  --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|254238204|re  --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|107104185|re  --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|218894188|re  --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|254244030|re  --------------SGGTWA--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|15600282|ref  --------------SGGTWV--------GSGVASGSAVDNEVLRLEQRRQHNLN--LIAR
gi|251792084|re  --------------KPGVWL----------------------------NKVEGV--TSEQ
gi|255068222|re  AYEHFLDFILEPDNIYSHFEKLEKEKFLEPKVAMHKMGSRERHKFYRGKRSH----SVEQ
gi|34496689|ref  ----------------------------------------------NVKRGDNE--NFLQ
gi|66048194|ref  --------------NVSNWIPGLDDFFHASAVTKGLGLDSVNKTIEGRRTQAEQNRNEEQ
gi|237802136|re  --------------NVSNWIPGLDDFFHATSISKGLGFDSTTRKLEEFRAKGAQDRDKDQ
gi|71733687|ref  -------------------------------------------NLASVMD-DLR--NETQ
gi|206562019|re  ------DFITPLKRALPKWV---------------------YDHVSMLGR-DYQ--TDEE
gi|134293146|re  ----------------------------------------NLKRFVTQNE------DTQQ
gi|170697911|re  -------------------------------------------RFSHLPD-NR---NSAQ
gi|254248890|re  -------------------------------------------RFSHKPDNR----NSAQ
gi|172063204|re  --------------DIATDV-------------KQRLPDSAYETFSMMSR-DYQ--TDQQ
gi|171317799|re  --------------DIATDV-------------KQRLPDSAYEKFSMMSR-DYQ--TDQQ
gi|170697592|re  --------------DIATDV-------------KQRLPDSAYEKFSMMSR-DYQ--TDQQ
gi|94309572|ref  ------------------------------------EPNMPHRPAAHMRPRPHP--SRHA
gi|17548851|ref  ----------------------------------------NVASYRSDTR------NSTQ
gi|170691203|re  ---------------------------------------HGIFGLAGAAS-DGR--TRAQ
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  --YYADWGS---------------------------------------------------
gi|194291793|re  GRQGSEFYNSCVPAIHSLSSVEQTAYLTRAELVAACFDNKAGRAAQFFLSAPMKPLAGAM
gi|239816830|re  SNYCKQWWEDA-------------------------------------------------
gi|170699527|re  QQYCIEWWKTH-------------------------------------------------
gi|91777541|ref  HDWCKAWWKRH----------------------------------------------GLE
gi|172060379|re  TQYCIDWWNRN-----------------------------------------------LP
GOS_1181020_Tra  TQWCIDWWNRN-----------------------------------------------LP
gi|78063844|ref  TQWCIDWWKRN-----------------------------------------------LP
gi|254000137|re  QDYCIHWWRDA-------------------------------------------------
gi|107022962|re  EDFNARWYDDA-------------------------------------------------
gi|172065698|re  EDFNARWYDDA-------------------------------------------------
gi|171321395|re  EDFNARWYDDA-------------------------------------------------
gi|116053236|re  QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|254238204|re  QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|107104185|re  QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|218894188|re  QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|254244030|re  QQEALERSERLHREGRLPSFDPRGAAHARARIAELEAEN-----------AEIQRTLDSS
gi|15600282|ref  QQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAEN-----------AEIQRTLDSS
gi|251792084|re  VDYDRWWYEAI----QGELDEVIVNAKTDGIVHVWEAHE-----------IEKHEKLVEF
gi|255068222|re  RRFDWAWYDAVEGYNTITSDEEFHKTMEEFQSLHDEFHG-----------LGMGAVGFVL
gi|34496689|ref  ECYDIGWHQDI-------------------------------------------------
gi|66048194|ref  IQIDKMWYRQV-------------------RLAYTGAET-----------GPIEIGQRFF
gi|237802136|re  IEIDKLWYRQV-------------------RLAYTGAET-----------GVIELGQRFF
gi|71733687|ref  HAIDWEWYRRA------------------------TKST-----------LGNRSLLLDR
gi|206562019|re  RVFDINWYQRA-----NLNNVTNPVSHSVTDRIIEDTVN-----------LPLNVVAALS
gi|134293146|re  RAYDRNWYYCA-----------------------------------------RQPRGTQR
gi|170697911|re  REFDAWWYEMV----------------KMDKKNQGGTEW-----------TGVGIAPIPV
gi|254248890|re  REFDAWWYEMV----------------KMDKKNQMGTEW-----------TGVSIAPVPV
gi|172063204|re  RKIDEEWYRRA------------------------NLHN-----------VTLSLPAGPR
gi|171317799|re  RKIDQEWYRRA------------------------NLHN-----------VSLNLPAGPR
gi|170697592|re  RKIDEEWYRRA------------------------NLHN-----------VSLNLPAGPR
gi|94309572|ref  EDFDRWWYWSV---------------------AQKDPRR-----------LTFRNVVMDP
gi|17548851|ref  REFDQLWYWRA----------------------NLNNVT-----------KGSAAKWLMP
gi|170691203|re  QEFDQLWYRRA------------------------NLNNVTRTSAETRVNPLSKAKSTAT
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ----------------------------------------IDVYIK-----------LPA
gi|194291793|re  DAYSSASDKIKDVNK-------------QISDWWVTSDVVPEFVRKAQDKVIDAAQETAA
gi|239816830|re  -----LAGRFKN----------------------------LEVRLRR----------GSP
gi|170699527|re  ---RPKGNCSGTNKH-------------------------LLVTFRS----------VDS
gi|91777541|ref  NDRIDPRKALYPDH--------------------------LQIVLRG----------IEK
gi|172060379|re  DGESKRSGILTKNPR-------------------------LQIVLRS----------IAS
GOS_1181020_Tra  DGESKGSGILTKNQR-------------------------LRIVLRG----------ISN
gi|78063844|ref  DGESKRSGILTQNQR-------------------------LRIVLRS----------ISS
gi|254000137|re  --------TTGRIPN-------------------------LTVRCRD-------------
gi|107022962|re  -----FAGRLPN----------------------------LSLRTRD----------GSS
gi|172065698|re  -----FAGRLAN----------------------------LSIRTRD----------GSS
gi|171321395|re  -----FAGRLAN----------------------------LSIRTRD----------GSS
gi|116053236|re  EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|254238204|re  EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|107104185|re  EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|218894188|re  EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|254244030|re  EAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|15600282|ref  GAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQN--VEFRTRDFE---QTARPVMN
gi|251792084|re  TKSPKRTNLIYKNRK--------------------VAPQNEDFKPRI---------LPDG
gi|255068222|re  RVKKSVGTGIDEFKE---FFDTHLLPDWIKELRDGWRN--MRFGIRE-EIHFRLMNYVHT
gi|34496689|ref  ----------RANKN-------------------------IQFRTRHFD-------DIDK
gi|66048194|ref  RVMKWGNEESVKNTS-------------------------LQFVTRDFS-------IEDR
gi|237802136|re  RVMGWGDEESIKDTR-------------------------LQFVTRDFS-------VTDR
gi|71733687|ref  NGTALAGAFSFGKEP--------------------FKN--IEFVVRD-------MSLSDR
gi|206562019|re  KPFTSGSNPVLHKIA-------------------GFPN--IELATRGFD-------LSVR
gi|134293146|re  STIAPAGSKMYPQLA---------SNAWPLLGTQSLKDIGIEVVMRDFS-------LGDR
gi|170697911|re  LTHKAVRRILRSKHD------------------PAFRN--IDFATRDFG-------MNER
gi|254248890|re  LTQKAIRRLLRDKRD------------------PAFKN--IEFATRDFS-------MAER
gi|172063204|re  DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|171317799|re  DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|170697592|re  DVYIAAKGALYQKEA--------------------FKN--IDFATRGFS-------AVNR
gi|94309572|ref  SVIARHIPSVWQLAA--------------------LKN--VEFMTRDFD-------LPSR
gi|17548851|ref  GGAMQEIAKAIRNHA---------------LRDKALTN--VEFATRDFD-------LGER
gi|170691203|re  AVLGALPGALKPLKN-------------------------IEFATRDFD-------LRER
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  GTI---PEALLGFS----------------------------------------------
gi|194291793|re  DASKWAYQQLGTTL----------------------------------------------
gi|239816830|re  LEI---HSNLSRYL----------------------------------------------
gi|170699527|re  ADAA--HALADEEF----------------------------------------------
gi|91777541|ref  QAV---KGLLAADI----------------------------------------------
gi|172060379|re  GDV---DALIDAPL----------------------------------------------
GOS_1181020_Tra  KDV---KKLLAANI----------------------------------------------
gi|78063844|ref  KDV---ISLMTAPL----------------------------------------------
gi|254000137|re  -GV---VDKVQASV----------------------------------------------
gi|107022962|re  KDV---HESLAHEP----------------------------------------------
gi|172065698|re  KAV---HDSLAGEP----------------------------------------------
gi|171321395|re  KAV---HESLVGEP----------------------------------------------
gi|116053236|re  GEQ---VRLVNGRL----------------------------------------------
gi|254238204|re  GEQ---VRLVNGRL----------------------------------------------
gi|107104185|re  GEQ---VRLVNGRL----------------------------------------------
gi|218894188|re  GEQ---VRLVNGRL----------------------------------------------
gi|254244030|re  GEQ---VRLVNGRL----------------------------------------------
gi|15600282|ref  GEQ---VRLVNGRL----------------------------------------------
gi|251792084|re  RKV---NHSFEDTE----------------------------------------------
gi|255068222|re  AAQGLYEEYRDGKLVKTAIGVVSKVTGLNSNGPVNDVDDLRIALFDKLFAKVKEEVKGTE
gi|34496689|ref  N-----AYILPNLV----------------------------------------------
gi|66048194|ref  VEIAW-QLEIGALD----------------------------------------------
gi|237802136|re  VETAW-RLAMQALD----------------------------------------------
gi|71733687|ref  VEIAW-QVAMRSTD----------------------------------------------
gi|206562019|re  SEIVG-RISGYGTM----------------------------------------------
gi|134293146|re  SEIMYREALLRGSG----------------------------------------------
gi|170697911|re  AEIAW-RTATDSKY----------------------------------------------
gi|254248890|re  AEIAW-RTVTDSQY----------------------------------------------
gi|172063204|re  AEIAW-HTFWHGKD----------------------------------------------
gi|171317799|re  AEIAW-HTFWHGKD----------------------------------------------
gi|170697592|re  AEIAW-HTFWHGKD----------------------------------------------
gi|94309572|ref  LEIAF-RTSLFGAD----------------------------------------------
gi|17548851|ref  AEIAW-RTWTQGKD----------------------------------------------
gi|170691203|re  AEIAW-RTWMSGPH----------------------------------------------
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ------------------------------------------------------------
gi|194291793|re  ------------------------------------------------------------
gi|239816830|re  ------------------------------------------------------------
gi|170699527|re  ------------------------------------------------------------
gi|91777541|ref  ------------------------------------------------------------
gi|172060379|re  ------------------------------------------------------------
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  ------------------------------------------------------------
gi|254000137|re  ------------------------------------------------------------
gi|107022962|re  ------------------------------------------------------------
gi|172065698|re  ------------------------------------------------------------
gi|171321395|re  ------------------------------------------------------------
gi|116053236|re  ------------------------------------------------------------
gi|254238204|re  ------------------------------------------------------------
gi|107104185|re  ------------------------------------------------------------
gi|218894188|re  ------------------------------------------------------------
gi|254244030|re  ------------------------------------------------------------
gi|15600282|ref  ------------------------------------------------------------
gi|251792084|re  ------------------------------------------------------------
gi|255068222|re  PVHLIDQVKGSVTSRLEKLGGLKDDLESIWDLFFNFNLFRNYVNCMNYYFLLRNEKKYPN
gi|34496689|ref  ------------------------------------------------------------
gi|66048194|ref  ------------------------------------------------------------
gi|237802136|re  ------------------------------------------------------------
gi|71733687|ref  ------------------------------------------------------------
gi|206562019|re  ------------------------------------------------------------
gi|134293146|re  ------------------------------------------------------------
gi|170697911|re  ------------------------------------------------------------
gi|254248890|re  ------------------------------------------------------------
gi|172063204|re  ------------------------------------------------------------
gi|171317799|re  ------------------------------------------------------------
gi|170697592|re  ------------------------------------------------------------
gi|94309572|ref  ------------------------------------------------------------
gi|17548851|ref  ------------------------------------------------------------
gi|170691203|re  ------------------------------------------------------------
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  --------SDGLHVHQSDEWQLL-------------------------------------
gi|194291793|re  --------QTKVEKLREYGGAQV------------------ADATTALMAWLNGATLDSL
gi|239816830|re  --------PDSKRDL--SEAATM------------------IAV----------GTHHQK
gi|170699527|re  --------KPQDGILPTNERPLM------------------TDY----------PTHHQK
gi|91777541|ref  --------AEEDRPD----SSWL------------------SPVDESALLWNY-PTHHQK
gi|172060379|re  --------KEEDPPSTHSESVDY------------------YLVNEKNLLEDY-PTHHQK
GOS_1181020_Tra  --------EEEDAPS---------------------------------------------
gi|78063844|ref  --------KEEDEPSTHSDKGDW------------------GYVDEKNLLEDY-ATHHQK
gi|254000137|re  --------KDEPIKPSQQGGAVL------------------GVFDEQTLIEKY-ATHHQK
gi|107022962|re  --------GKRDNLE------DF------------------GLEKL--------ATDHQK
gi|172065698|re  --------GKRDFTE------VL------------------GLEKV--------ATDHQK
gi|171321395|re  --------GKRDFTEVL------------------------GLEKV--------ATDHQK
gi|116053236|re  --------QSLIHLLRADGNDDL------------------GIGQLLVLTQF--ASHHQK
gi|254238204|re  --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|107104185|re  --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|218894188|re  --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|254244030|re  --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|15600282|ref  --------QSLIHLLRADGIDDL------------------GIGQLLVLTQF--ASHHQK
gi|251792084|re  --------LPDGKGTLTDGSYDF------------------ALKKF--------KSHHQK
gi|255068222|re  TMAFMRLRNQEDYKNRKQKVSFLPREINPAIFPKDFPFEDKGLSALTKDVLRFTPTHHQK
gi|34496689|ref  --------RNGASTMHAAATSKF-------------------------------PSHHQK
gi|66048194|ref  --------QDRSRKNKIMSTSAM------------------FLA----------PTHHQK
gi|237802136|re  --------QDRSTKNKVMSTGAM------------------FLA----------PTHHQK
gi|71733687|ref  --------KDRPTWNKIMTTVGM------------------TSI----------PTHHQK
gi|206562019|re  --------DGWSGGTKATTSAAM------------------GGE----------PSHHQK
gi|134293146|re  --------KGPTHTA----IGAY------------------GAE----------PSHHQK
gi|170697911|re  --------GDRTKNAKIQNAAAM------------------GLA----------PSHHQK
gi|254248890|re  --------SKRNVNSKIQNGFAM------------------GLG----------PSHHQK
gi|172063204|re  --------RDRDVLTRAQNSASM------------------GLAE---------PTHHQK
gi|171317799|re  --------RDRDVMTRAQNSASM------------------GLAE---------PTHHQK
gi|170697592|re  --------RDRDVMTRAQNSASM------------------GLAE---------PTHHQK
gi|94309572|ref  --------KQRGAGNKAAGGAAM------------------GLAA---------PTHHQK
gi|17548851|ref  --------TGRSTFTKDANAAAM------------------AGE----------PSHHQK
gi|170691203|re  ----------GDPKLRDVNTAAM------------------TAE----------PSHHQK
                                                                             


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  --------------------IFSIEEYGEYFDDEQA------------------------
gi|194291793|re  PPSLLQNTA-----DTIQAFVMRLVLALQAEGSQRK------------------------
gi|239816830|re  PILIDYEPATGGRPRNVCGYVMGLNSVTDYWDTTAH------------------------
gi|170699527|re  PIVIDYDYNNG---YKAVGYVMGLNSVTDYWDTTKH------------------------
gi|91777541|ref  PVLIDYAHDGG---SKAVGFVMGLNSVTDFWDTAEHKIETGLRETGARSTW---------
gi|172060379|re  PILIDYSYDEG---SKAVGYVMGLNSVTDYWDRTDH------------------------
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  PILIDYAQPYEG--KNAVGYVMGLNSVTDYWDRTAH------------------------
gi|254000137|re  PILIDYDHADG---EHAVGYVMGLNSVTDYWDDAQH------------------------
gi|107022962|re  TILIDYDHEGG---TQAVGYVMGLNSVTDYWDTQQH------------------------
gi|172065698|re  TILIDYEYEGG---AHAVGYVMGLNSVTDYWDTQQH------------------------
gi|171321395|re  TILIDYEYEGG---AHAVGYVMGLNSVTDYWDTQQH------------------------
gi|116053236|re  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|254238204|re  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|107104185|re  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|218894188|re  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|254244030|re  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|15600282|ref  MVLVDYGSP------QAIGFVMGHNMHRNYWDTSAH------------------------
gi|251792084|re  TVLIDYEDP-----DLAVGFVLEHNMVDNYWDDSNH------------------------
gi|255068222|re  SVMIDYTDP-----KSAVGFVMGHNMLDRYWDTSDHYALPDEYKTYTTSRKGPGEVVELE
gi|34496689|ref  TVLIDYEHP-----ESALGFVMGHNMLDAYWDRDDH------------------------
gi|66048194|ref  MVLVDYEKP-----ELAVGFVMGHNTLDAYWDKDDH------------------------
gi|237802136|re  MVLVDYEQP-----DLAVGFVMGHNTLDAYWDKDDH------------------------
gi|71733687|ref  MVLVDYETP-----NKAVGFVMGHNSLDAYWDNDDH------------------------
gi|206562019|re  MVLVDYDDS-----DLATGFVMGHNMLDQYWDTDKH------------------------
gi|134293146|re  TVLIDYEAP-----ALALGFVMGHNTLDAYWDDDSH------------------------
gi|170697911|re  MVLVDYAHP-----EIATGFVMGHNTLDEYWDISSH------------------------
gi|254248890|re  MVLIDYEDP-----ELATGFVMGHNTLDEYWDTSRH------------------------
gi|172063204|re  MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|171317799|re  MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|170697592|re  MVLVDYEDP-----ENARGFVMGHNMLDQYWDTNDH------------------------
gi|94309572|ref  MVLVDYEVP-----NKAVGYVMGHNMLDPYWDTDDH------------------------
gi|17548851|ref  MVLVDYEMP-----ERAVGFVMGHNTLDAYWDRDDH------------------------
gi|170691203|re  MVLVDYEVP-----EQAIGFVMGHNTLDEYWDRDDH------------------------
                                                                             


                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  --------------------------------------------------DDFFQHLVGL
gi|194291793|re  -QCYANLEKLGKLLPAGGKCPDS-------------------SVQPRMPWHDVHCRIEGP
gi|239816830|re  ----AFNDPRRELSPNGYTYYDE-------------------VRWHRKPYRDYAIRVQGE
gi|170699527|re  ----AIDDSLRELLASKTLEAEQ------AHEQATLDQAPTKGYKHVRPYQDYACRLYGP
gi|91777541|ref  ---EGEIDHEYRSDFGGGDPGEA----------QKVAAIHGGNYTSIRPYQDYACRVVGP
gi|172060379|re  ----AIDDPLREEWVGSYVSDEL---KHEQETQDPQGPLSTAAYRHVNPYQDYGCRLVGK
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  ----EIDDPLREAWVPSYVNDEH---KHEQETQDPTGPLSTAPYKQVNPYQDYATRIVGK
gi|254000137|re  ----LFDSHLREQDFSTQAELKAAEEKGIRTDAIVQTALKAGQPISRKPFQDYACRIHGP
gi|107022962|re  ----LFNDPRRGEGWEGANDSQP----------------------GLKPYQDYASRIRGE
gi|172065698|re  ----LFNDPRRGESWEGANDVQP----------------------GLKPYQDYASRIRGE
gi|171321395|re  ----LFNDPRRGESWEGANDVQP----------------------GLKPYQDYTSRIRGE
gi|116053236|re  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|254238204|re  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|107104185|re  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|218894188|re  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|254244030|re  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|15600282|ref  ----LFDDRAAGRDPGFG------------------------------PWQDISMQVQGP
gi|251792084|re  --------SLKTTLPNKGKNSPT-------------------------PLQDVSSIVTGQ
gi|255068222|re  KLENIEESQMRGRDPSAGAFFGT-------------------------PRQDISCKLTGK
gi|34496689|ref  -------HYVQQE-PHLGRNGAT-------------------------ARHDISSRLTGP
gi|66048194|ref  -------AYERKT-SQAGRNGAT-------------------------PRQDISSRVTGP
gi|237802136|re  -------AYERQT-AQKGRNGTT-------------------------PRQDISSRVTGP
gi|71733687|ref  --------SAARMHAQFGRNGAT-------------------------PRQDISSRVTGP
gi|206562019|re  -------SYQAMA-PSKGRNGPY-------------------------PWQDISSRVTGP
gi|134293146|re  -------SYVKKS-PDRGRNGET-------------------------PRQDMSARIAGP
gi|170697911|re  -------GHVRMH-PQMGRNGFL-------------------------PRQDISARVTGP
gi|254248890|re  -------SHVRMH-SKMGRNGFL-------------------------PRQDISARVTGQ
gi|172063204|re  -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|171317799|re  -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|170697592|re  -------SYVRKT-PTTGRNGLS-------------------------PWQDISAWVTGP
gi|94309572|ref  -------SAAKMPWGYLGRNGAT-------------------------PRHDISSRVTGP
gi|17548851|ref  -------GYTRMH-PQMGRNDHH-------------------------PRQDMSSRVTGP
gi|170691203|re  -------TYLRQA-PRMGRNGLH-------------------------PRQDMSAKVTGP
                                                                             


                        730       740       750       760       770       780
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  RSELIQGNWRLVY-----------------------FMW---------------------
gi|194291793|re  SVYDLSRNFVRRWNGVALQYERSDGKTVD-------ALLRHLGIAARLKAPRIGAAHRPV
gi|239816830|re  ALHCLNRNFVQGWDSAAGVQVIPGPAGRFFPANG--AGAFSAKLA---------AQRQAV
gi|170699527|re  ALKRVYDNFALDWNHYA-------------------PDTHRMPEL----------TEIPS
gi|91777541|ref  ALRRLHENFENGWNAFAP------------------SQWKTSAKD---------GDSLPP
gi|172060379|re  ALKRVHQNFERGWNLFAP------------------AQWKTKELA-----------TLPS
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  ALKRLHQNFERGWNVFAP------------------PAWQTTELK-----------ALPA
gi|254000137|re  ALQDVWINFARAWNRATALPPLMVPFQRNRPPAPKQPAPLNTALN---------PSRLSQ
gi|107022962|re  ALVAVSKNFTDAWNRAKGQG----------------ANLSRTHDF----------KKVPP
gi|172065698|re  ALVAVSKNFIDAWNRAKGKG----------------ANVSRTHDF----------KKVPP
gi|171321395|re  ALVAVSKNFIDAWNRAKGKG----------------ANVSRTHDF----------KKVPP
gi|116053236|re  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|254238204|re  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|107104185|re  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|218894188|re  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|254244030|re  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|15600282|ref  VLADLSRNFSEAWDLETPWY----------------KRWFSTPSL---------TAERDA
gi|251792084|re  VLWDINHNFCQSWDRQNN------------------KQWGKDPVDIGITGKRQSFTRDHY
gi|255068222|re  VLYDIDANFVQGWNKAIED-----------------NGYYQNRMDKIEPVERVKREQFKP
gi|34496689|ref  VLVHVNHNFVAGWDKATGEN----------------LTGKRAHLE-----------LKHF
gi|66048194|ref  ILKYLNENFCEAWKKETKVD----------------LLPAREHIA------------DQL
gi|237802136|re  ILEYLNQNFCEAWEKETKVD----------------LLTARKHIA------------DKL
gi|71733687|ref  ILEYLNHNFTQAWQHETGVD----------------LLPARRHVA------------DQL
gi|206562019|re  ILQYLNKNFCEAWDDATGQK----------------LAKSREHLA----------GIHKI
gi|134293146|re  ILEHLNVNFCRAWQHSTKED----------------LLAKRMPLA------------KQL
gi|170697911|re  ILTDLNKNFCQAWDATTGQQ----------------LEKQRESVK------------EPL
gi|254248890|re  ILIDLNENFCQAWDATTGQR----------------LEKQRKSAK------------TPV
gi|172063204|re  VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|171317799|re  VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|170697592|re  VLRYLNENFCQAWDDATGQG----------------LAEKRKGLH----------TRLKV
gi|94309572|ref  ILQYLNDNFCEAWDRETGAG----------------LGKARKPAA------------AGL
gi|17548851|ref  ILQYLNRNFCQAWSDATGQQ----------------LEAGRAVIA------------SQL
gi|170691203|re  ILDCLNRNFCQAWDDATGQN----------------LTHARAALA----------GRLTL
                                                                             


                        790       800       810       820       830       840
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ------------LKAFDCNDELE-----------E------------IPLIQYDFEHLSE
gi|194291793|re  RSKAQPGS----CWVQVLRSAPKKMRVAEAAGEADKTT-----PSVAESSCLSAMLKNIE
gi|239816830|re  QAKDIPRPLGARCRVQIQRTQPE-----------S--D---------DGTILKGYTLASA
gi|170699527|re  NIQKVPGNA--NHAVQIVRTHPR-----------D--K---------DKTIKELYIHASS
gi|91777541|ref  KIPTLAKDP--AQRVQIVRTQAA-----------E--G---------EKTIKKLYFQATS
gi|172060379|re  KIPSLPDDP--AQRAQIVRTQPH-----------E--R---------EKTIKRVYFQATS
GOS_1181020_Tra  -------------------THSD-----------D--G---------D------------
gi|78063844|ref  GITSLPDDP--AYRVQIVRTQPH-----------E--H---------EKTIKSLYYQASS
gi|254000137|re  PVETSAASH--VARLQIVRTQPE-----------E--AYQGEENTAYDQSIKLAYMHAAS
gi|107022962|re  GLTKNIGTP--CQRAQIARTQPE-----------E--K---------DKSIKALYIQATS
gi|172065698|re  GLTQNLGTP--CQRAQVVRTQPE-----------E--K---------DKSIKALYEQATS
gi|171321395|re  GLTQNLGAP--CQRAQVVRTQPE-----------E--K---------DKSIKALYEQATS
gi|116053236|re  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|254238204|re  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKGLG
gi|107104185|re  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|218894188|re  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|254244030|re  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|15600282|ref  LPLPKIATPASNSVAQICRTQPQ-----------D--D---------ERSILEHYLKALG
gi|251792084|re  QPNPSLVDDSKLVMAQIVRTYDQ-----------P--N---------IEDIMKVYLKNIK
gi|255068222|re  QNVEKDDSQTELLYAQVLRTQPE-----------Y--Q---------EENILALYNQNFK
gi|34496689|ref  TPRPNLGSR---AMAQIARTQSQTRPKGKVKDELT------------VQDIKHLYLNAVN
gi|66048194|ref  KARKACGIP---LMAQILRTHSQ-----------GAVA---------VRNIEKLYLKAVN
gi|237802136|re  KGRREYGTP---LMAQILRTHSQ-----------S--N---------VRDIEKLYLKAVN
gi|71733687|ref  KPRKGHGPR---LIAQVLRTQPQ-----------E--N---------KRDIKEMYLKAAG
gi|206562019|re  RNDAPDDVS---VMAQIVRTQSE-----------K--N---------KREIQVMYLNAVN
gi|134293146|re  KLSTTAGTP---VMAQINRTQSQ-----------E--G---------VRNIKSLYLQAVR
gi|170697911|re  LRCSKDDIA---VRAQILRTQPQV----------EKGG---------VKDIERLYLQAVN
gi|254248890|re  LRCSKDDLP---VMAQILRTQPQVEKRDPEKREPEKKG---------VKDIERLYLQAVN
gi|172063204|re  RIDPGGDTR---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAVN
gi|171317799|re  RIDPGGDTR---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAVN
gi|170697592|re  RIDPGGDTP---VMSQILRTQSQ-----------K--G---------KRDIEKLYLQAAN
gi|94309572|ref  RMLPSLGDK---VMAQVLRTHSQ-----------N--G---------KQDIEEMYLQAVN
gi|17548851|ref  KLRRDFDTP---VMAQILRTQSQ-----------H--G---------KRDIEAMYLQAVN
gi|170691203|re  RRDPKNGTP---VMAQIVRTQSQ-----------F--GKNGKGSKDATKDISALYLQAVN
                                                                             


                        850       860       870       880       890       900
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  EVQTFAALYDIPLAW---------------------VKALA-------------------
gi|194291793|re  GASHFIYIEGQFFQSDYGSTMIGNEEADGGAPVSGPMHALMDVKGSPGYQKYAAQLGILG
gi|239816830|re  NALNYIYMENQYFQL---------------SEWPRLLKDVR--------KRYRR-AMQEA
gi|170699527|re  WARNYIYMENQYFFY---------------PTFAQKLKSIR--------QDHWKAWAEKS
gi|91777541|ref  IARNYIYIENQYFFY---------------PEFARHLKNER--------RKFCRAWARLA
gi|172060379|re  FARNYIYMENQYFFY---------------PEFARHVKEER--------QKFHDAWSKLA
GOS_1181020_Tra  ------------FYY---------------------------------------------
gi|78063844|ref  FARNYIYMENQYFFY---------------PEFARYLKLQR--------KNFHDAWEKLA
gi|254000137|re  NARRYIYIENQYFFY---------------EPWAEQLKTQR--------QSYLQAHQN-V
gi|107022962|re  FARNYIYIENQYFQY---------------TEWPTKLKELR--------TEFLS-CSQAA
gi|172065698|re  FARSYIYVENQYFQY---------------TEWPKKLKELR--------TQFLS-CSQAA
gi|171321395|re  FARSYIYVENQYFQY---------------TEWPKKLKELR--------TQFLS-CSQAA
gi|116053236|re  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|254238204|re  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|107104185|re  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|218894188|re  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|254244030|re  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|15600282|ref  NATDYVYMENQYFRY---------------AGFAERLRKTA--------Q-----VRKAR
gi|251792084|re  QTTSYIYTENQYFRF---------------PPLVREFISHW--------ETIKN-NGRTE
gi|255068222|re  MATSYIYFENQYFRF---------------PPFAEALRDSC--------KERKN-FAERF
gi|34496689|ref  HACQYIYIENQYFRW---------------VNFAEATKQAV--------KNQLA-FGRDP
gi|66048194|ref  NTTQFIYIENQYFRW---------------PPLAEKIKSVV--------QNLLD-CGRDL
gi|237802136|re  NTSQFIYIENQYFRW---------------PPLAEKIKSVV--------QNLLD-GGRDL
gi|71733687|ref  NANSFMYLENQYFRW---------------PPLAEKIKENV--------LRQFA-EGRSL
gi|206562019|re  NATQCIFIQNQYFRW---------------NDLALKIKDVA--------KAHAK-AGRDF
gi|134293146|re  NATKFIYIENQYFRW---------------PDLADEIKSAV--------KKQFG-QGRDI
gi|170697911|re  NTTNFIYIENQYFRF---------------PPLAEKLTKLV--------KAYQA-GGRKT
gi|254248890|re  NATNFIYIENQYFRF---------------PPLAEKLTELV--------KSYQA-GGRKT
gi|172063204|re  NATQHVFIENQYFRW---------------VPLAERIKAVA--------VQQQK-WGRDS
gi|171317799|re  NATQHVFIENQYFRW---------------VPLAEKIKAVA--------VQQQK-WGRDS
gi|170697592|re  NATQHVFIENQYFRW---------------VPLAEKIKAVA--------VQQQK-WGRDS
gi|94309572|ref  NATQFIYIENQYFRF---------------KPLADKINEAV--------KKQIQ-WGRDP
gi|17548851|ref  NTTNFVYIENQYFRF---------------PPLADKIKEAA--------KAQFG-AGRDQ
gi|170691203|re  NTTKFVYIENQYFRY---------------MPVADKLRKNV--------NAQIA-GGRNP
                                                                             


                        910       920       930       940       950       960
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ------------MVLNEQPSHQAKQAQFQFDTWLHNLTDAEKDTLLRTLFEQGLLTRHQA
gi|194291793|re  VPPGQIYKSLKWSQIDDVQRDIRGGGADFVNDLKRVMATQAQIAGFSALGPSQKSLKNPI
gi|239816830|re  GAAPSDMAPLHMFVVIPQPER--GQMVPSTYDTVGTLGAGAQMGEYDKKVQ-GERKRRQA
gi|170699527|re  GRPSSEMGILYMFIVIPHPED--DGMIPRTYDMLTELGASDPTANNPAMSNQR-------
gi|91777541|ref  KKPMTAVPNLHLFIVIPHPED--DGMVPRTFDTLTELGKSDAMPAQAGYVDEGKADQQ--
gi|172060379|re  DKPQSDAPILHLFVVTPHPQD--PGMIPRTYDTLAELGHANAMKGQGDLVSAG-------
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  NKPQQDAPVLHLFVVTPHPQD--PGMIPRTYDMMAELGHGDAMKGQHDLVVAG-------
gi|254000137|re  KNPCQNVGLLHLMVVIPQPEN--AGMVPRTYDTIKALGHGDAMPGQQAAVTA--------
gi|107022962|re  GRSPADVPNLHVMAVIPTPER--PQMVPRTHDTVKVLGYGTSMPNQDKAVEDELARNRQQ
gi|172065698|re  GKSPVDIPNLHVLVVIPTPER--AQMVPRTHDTVKVLGHGTSMPNQDKAIEDELARNRQQ
gi|171321395|re  GKSPVDIPNLHVLVVIPTPER--AQMVPRTHDTVKVLGHGTSMPNQDKAIEDELARNRQQ
gi|116053236|re  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|254238204|re  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|107104185|re  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|218894188|re  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|254244030|re  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|15600282|ref  GVPG----DLYLFVVTNTPDS--SDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQ
gi|251792084|re  G-------PIHWFTVTNSSDEGIGAGTYTTNEMFKLLGKQDVMPGVARNIKLNELETQLG
gi|255068222|re  GIDASEMQPLCVFVVTNSSKEGLGPGMINTERMLASLGRRDVMPTVARERILEQAGYGNA
gi|34496689|ref  GQHG----PVYLMVVTNDNAEGMGLGVKNTYKMLDALGKRSQMPTLARSSINEQVKQAER
gi|66048194|ref  EVDG----PVYLFVVTNSSNEGMGDGSVNTFRMLKQLGRPELLPGVARAERHDELMDELY
gi|237802136|re  KKHG----PIYLFVVTNSSEEGMGDGSVNTFRMLKHLGRPELLPGVAQAERHDELMDELY
gi|71733687|ref  IEHG----PLYLFVVTNSTKEGMGDGTINTYRMLRQLGRPELMPEVTRYERDKELEAQVA
gi|206562019|re  GRDG----SIYLFVITNSSDDAVGNGTVRTYQMLESLGCGNSMPGVAQLQRSDDYAAQQK
gi|134293146|re  AKHG----SVHLFVVTNSSDEGMGLGAGTTYDMLNALGRADTMPNVARIETAKSLGKQAT
gi|170697911|re  --------PLYLFVVTNSSDDGIGLGTVSTYHMLNALGRADALPGVSKLERAD----DLE
gi|254248890|re  --------PLYLFVVTNSSDDGIGVGTVSTYHMLNALGRADVLPGVAKLERADELEKQ--
gi|172063204|re  GKHG----MVYLFVITNSTDAAVGTGTLTTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|171317799|re  GKHG----MVYLFVITNSTDAAVSTGTLNTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|170697592|re  GKHG----MVYLFVITNSTDAAVSTGTLNTYRMLDALGQAKSMPGVGAILQESDRQSDLR
gi|94309572|ref  GQHG----AIHLFVITNSSDEGMGDGTVNTYRMLNALGRAEVIPGVAKLEQEDVRQADLQ
gi|17548851|ref  GKHG----SLHLFVVTNSNDDGIGLGTVNTYRMLEALGRADTLPGVATLEREDARQASLG
gi|170691203|re  AKHG----VVYLFVITNSNDDGIGLGTVSTYQMLDALGYGDRMPGIEKLERNDQLAQQEQ
                                                                             


                        970       980       990      1000      1010      1020
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  LALTRK--------------------------ESANTDETYQYWLTPDL--------ITP
gi|194291793|re  CKALGDRITRAIYDGKPFHVYMVLPVH-----PEGTLDTINIMTQQHLTMQSLVFGSHSL
gi|239816830|re  GAGGSGGLVGASADTVPMDAQAQLQEL-----GIKPLVAMLLTFDSANQAKSIRVKARDS
gi|170699527|re  -----------TYDKENPRPQDY--------------PDAKTVSYKRDT--------GVG
gi|91777541|ref  -----------------YGNHSTQATY-----TTTFTDESGEPVSIART--------HPV
gi|172060379|re  --------------------------------------KTAQVYKNAQG--------DNT
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  --------------------------------------KTKQQYKDREG--------KNT
gi|254000137|re  -------------------------------------PVKSSFLKTSEQ--------EIA
gi|107022962|re  QATWDAYVKRQKASGARIDPDYYPAPL-----SPAAQSAKDLGDKASLT--------KSL
gi|172065698|re  QATWDAYVKRQKASGARIDPDLYPAPL-----SPVAQSAKDLGDKASLS--------KSL
gi|171321395|re  QATWDAYVKRQKASGARIDPDLYPAPL-----SPVAQSAKDLGDKASLS--------KSL
gi|116053236|re  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|254238204|re  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|107104185|re  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|218894188|re  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|254244030|re  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|15600282|ref  LKQVRENLHPDPYVRRGQENNIERLER-----KIEALEEKGVTPEVEQR--------LGD
gi|251792084|re  MAKRSEVRLYNESMKAPTAEGKAVAAA-----EFEKNQQEIQRIEKEIG--------EIK
gi|255068222|re  IQRMFPNLSADSIWRKILPDFILPPPPLKPIEGLNDREVKERELAEKVK--------KTK
gi|34496689|ref  EVQIGEN-------------------------------QNAKRTSKPLS--------DLP
gi|66048194|ref  AAKQEELLATQKAA-------AFNQVH-----GIDHTERAARIYEPLKN--------KLA
gi|237802136|re  AAKQEELLATQKAA-------AFNQIH-----GIDHTERAARIYEPLKT--------KLA
gi|71733687|ref  QA-------KERYDTAKGKITIIEGTY-----GRSFNPAMSKLWEPQRK--------AAE
gi|206562019|re  DLEAQLAAQQSIQHKFAAQGVDI---------NAASLQGAMNFYQDNMA--------KQQ
gi|134293146|re  AAQLQLNNASGPEEK-----------------------QKAQAKLDSVR--------RQA
gi|170697911|re  KQYEAALEAKKAADQAYERAQHVPVNP-----FSNSAQYAVNNLVATQL--------DAT
gi|254248890|re  --YKEALKVKERADKAFESAKRVPVDP-----FTSSVQYAMNNITAAHL--------DAV
gi|172063204|re  KQFADVVSKQQDAGQEYLGALQM---Q-----GMANTPATTQAVGQAKQ--------KVD
gi|171317799|re  KQFADVVSKQQDAGQEYLGALQMQ--------GMANTPATTQAVAQAKQ--------KVD
gi|170697592|re  KQFADVVSKQQDAGQEYLGALQIQ--------GMANTSATTQAVAQAKQ--------KVD
gi|94309572|ref  RQYDAARAQAREAQGAVARVYQF---------THLGDAYVQKLLARAEE--------KLQ
gi|17548851|ref  KQRAQAIDQQNQANQVIEDANAF---L-----KTEDTASTRQWLADAQQ--------KLK
gi|170691203|re  ALEKQLADEQAASKHAMMQGADFSHMQ-----GLANYLQDGQARQSELQ-------QKLE
                                                                             


                       1030      1040      1050      1060      1070      1080
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  YIQQAQSQLQQ----------EQAEALAKK------------------------------
gi|194291793|re  VNRIRRALLAMKYVRERKMEVKRARDAAESAKIEDL--------NRNIRQGEWQKYLTLL
gi|239816830|re  EAQDAQAGVE-----------EKARGHADD--------------VNPEN-----------
gi|170699527|re  PVISEIKVLDH----------PSVQELAST--------------Y------GIKVSIAR-
gi|91777541|ref  LDRPSLETLE-----------RTL---------------------------GLKVSVAR-
gi|172060379|re  FHPQSLKELQ-----------DTM---------------------------GLKVSIAR-
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  FHPQSWKELA-----------ETI---------------------------GLKVSIAR-
gi|254000137|re  AHAAQVKT-------------PTLDKEGVL--------------IQDGKSLRMKVLIAK-
gi|107022962|re  DQMGIRALVGSLWSFDYNWRSSKLNTETEK--------------KQARWDDYVKKQQAKG
gi|172065698|re  DQMGIRALIGSLWTFDSNWRSSTLSTETAK--------------QQARWDEYVKKQQAKG
gi|171321395|re  DQMGIRALIGSLWTFDSNWRSSTLSTETAK--------------QQARWDEYVKKQQAKG
gi|116053236|re  LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEAPGLKVVVAT-
gi|254238204|re  LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|107104185|re  LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|218894188|re  LGAQEIPGLA-----------KNTGEDDKP--------------YQLAEVPGLKVVVAT-
gi|254244030|re  LGAQEIPGLA-----------KNTGEDDKP--------------YQLVEVPGLKVVVAT-
gi|15600282|ref  LGAQEIPGLA-----------KNTGEDDKP--------------YQLVEVPGLKVVVAT-
gi|251792084|re  AKQHEEQKTQEAGKAGPTKKEGELNQIESSELGQEEPNLTKELGYEISDTPGIKAHICT-
gi|255068222|re  NTEELRKILK-----------EDLEKE------------------------GIKVHICT-
gi|34496689|ref  ERRKKLAALKQ----------EQAEANQGK--------------FVDGDIPGLKTHVCSL
gi|66048194|ref  EARAKVARLEQ----------EMPEKDAEI--------------VTPSEIEGLKIHICT-
gi|237802136|re  EARAKVERLEQ----------EMPGKDAEP--------------ITPSEIRGLKMHICT-
gi|71733687|ref  AAEAEYRALKA----------KLPADKAKP--------------LTVPGTEGLKVLICT-
gi|206562019|re  ELQQALNELKRK---------KQLNAHIDPD-------------APPLDIEGLKVQVCT-
gi|134293146|re  QINDDMKTL-----------------------------------ILPQEIRGLKVHLCT-
gi|170697911|re  EATQRANDLKV----------QLEKARTED--------------PQKFNIPGLKVHICT-
gi|254248890|re  EAAQRVSELKV----------QLEKARTEN--------------PEKLNIPGLKVHICT-
gi|172063204|re  QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|171317799|re  QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|170697592|re  QLKAQRAGIE-----------SQMKGPAHP--------------VMNRDYPGLKVHVCT-
gi|94309572|ref  QARAKQAEVK-----------AQMKAPPNA--------------VLPAPIDGLKVHICT-
gi|17548851|ref  RATAKRAELEA----------EMKKTLPKT--------------IQSVKIDGLEVHICT-
gi|170691203|re  QTRQEQRRTASVSA-------DGLTKDGDL--------------VPPQDMPGMKVLVCT-
                                                                             


                       1090      1100      1110      1120      1130      1140
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  -LAIEKAEKEK---------------------------------MLTDIY------NQRE
gi|194291793|re  NLRNWDVLHGR--------------------PVTEQIYVHSKLLIADDRVVVLGSANIND
gi|239816830|re  -LSDFNITPRR----------------------YREIYIHSKLMIVDDVYLTLGSANLNA
gi|170699527|re  -LRASGPIPGH-------------------DMAYREIYIHSKLMIVDDVFITMGSANMNQ
gi|91777541|ref  -LCTSDSVEGK--------------------MAYREIYIHSKLMIIDDVFLTLGSANLNQ
gi|172060379|re  -LRTSGMVNNQ--------------------MAYREIYIHSKLMLIDDVFVTVGSANMNQ
GOS_1181020_Tra  ---------------------------------------------VDE------------
gi|78063844|ref  -LRTSGMVGGQ--------------------MAYREIYIHSKLMIIDDVFVTLGSANMNQ
gi|254000137|re  -MATANPPGGK-------------------LGSSRDIYIHSKLMLVDDNFMTLGSANLNL
gi|107022962|re  ELPDPDLAPML------------PLPAQSFAARYREIYIHSKLLMIDDSFFTLGSANLNL
gi|172065698|re  ELPDPDLAPML------------PLPTQSIAARYREIYIHSKLLLIDDSFFTLGSANLNL
gi|171321395|re  ELPDPDLAPML------------PLPTQSIAARYREIYIHSKLLLIDDSFFTLGSANLNL
gi|116053236|re  -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|254238204|re  -LATSDPAPGSPPPARLSAEAEAALGAPLLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|107104185|re  -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|218894188|re  -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|254244030|re  -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|15600282|ref  -LATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINV
gi|251792084|re  -LM-PKDENGK----------YVHTYKKNGKDTPAEVYVHSKVTIMDDVFTVISSANLNT
gi|255068222|re  -LVAED---------------------------WEEIYIHSKLCLINDTFATLGSANINT
gi|34496689|ref  -VSMTGYQQGQ---------------------PWQYVYIHAKLMMIDDTFMTLGSANINL
gi|66048194|ref  -LVAPDSPPND----------------------WMDVYVHSKLMIVDDVFTTIGSANINT
gi|237802136|re  -LVAPDSPPDD----------------------WMDVYIHSKLMIIDDVFTTIGSANINT
gi|71733687|ref  -LVASDSPPEK----------------------WMDIYIHSKLMIIDDVFTTLGSSNINT
gi|206562019|re  -LVAPDSPGGN----------------------WLPVYVHAKLMTIDDAFMTIGSANVNL
gi|134293146|re  -LVAPDSPPTN----------------------WMPVYIHSKIMIVDDVFLTHGSANINR
gi|170697911|re  -LVPPDTPKGR---------------------PWDEVYIHSKLMIIDDVFVTHGSANVNL
gi|254248890|re  -LVPPDTPKGK---------------------PWDEVYIHSKLMIIDDVFVTHGSANVNL
gi|172063204|re  -LVAPDSPPGK----------------------WEPVYVHAKLMTIDDTFTTIGSANINT
gi|171317799|re  -LVAPDSPPGK----------------------WEPVYVHAKLMTIDDTFTTIGSANINT
gi|170697592|re  -LVAPDSPPGK----------------------WEPVYVHAKLMTVDDTFTTIGSANINT
gi|94309572|ref  -LVAPDSPPDK----------------------WQDVYIHAKLMIVDDVFMTLGSANINT
gi|17548851|ref  -LVAPDSPPNN----------------------WDYVYVHAKLMIVDDVFMTLGSANINT
gi|170691203|re  -LVAPDMPAGK---------------------EWDYVYIHQKLMIVDDVFTTHGSANVNR
                                                                             


                       1150      1160      1170      1180      1190      1200
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  HSWQQAQEQANRTCASG----------------YDEAARYLHQLFEAYQF--KAD-----
gi|194291793|re  RSQLGDRDSELAVVIHDDKAMSVRLDGQLVQPVGTFAHGLRKALWKKHFGLMGGVAPATE
gi|239816830|re  RSM--AADSELNMCTEE----------------YAFTKAARKRVWGNLAG--GDLDGKDC
gi|170699527|re  RSM--TADSEINIGATG----------------LDYAAPLRERIFKLHSG--GDISGSGD
gi|91777541|ref  RSM--SVDSEINIAATG----------------AEHAARLRGDVFGLHSG--GDIKGDGG
gi|172060379|re  RSM--SVDSEINIAATG----------------HEWTSKLRGRVFSLLSG--GATSGSGD
GOS_1181020_Tra  ---------------------------------QNLLEDIRR------------------
gi|78063844|ref  RSM--SVDSEINFGATG----------------LDWASKLRGRVFPLLSG--GATQGSGD
gi|254000137|re  RSM--AADSEINVATDS----------------IPHNRELRKRIWSLQTG--GLYDGGNA
gi|107022962|re  RSM--AVDAEINVGTDD----------------RAKSEDLRKRVWKLHTG--NAADCNPS
gi|172065698|re  RSM--AVDAEINIGTDD----------------PAKSEDLRKRVWKLHTG--NAADCNPA
gi|171321395|re  RSM--AVDAEINIGTDD----------------PAKSEDLRKRVWKLHTG--NAADCNPA
gi|116053236|re  RSM--HGDSELGIAQPN----------------PDLARAMREELWGAHVG--RLAETT--
gi|254238204|re  RSM--HGDSELGIAQPN----------------PDLARAMREELWGAHVG--RLAETT--
gi|107104185|re  RSM--HSDSELGIAQPN----------------PDLARAMREELWGLHAY--EVAATT--
gi|218894188|re  RSM--HGDSELGIAQPN----------------PDLARAMREELWGLHAY--EVAATT--
gi|254244030|re  RSM--HGDSELGIAQPN----------------PDLARAMREELWELHAQ--KVAATT--
gi|15600282|ref  RSM--HGDSELGVAQPN----------------PDLARAMREELWELHAQ--KVATTT--
gi|251792084|re  RSM--QVDTELGIIMEC----------------ADVAEGLRKRLWDLHTN--KNSAANPD
gi|255068222|re  RSM--QIDSELNVAVES----------------QPASHKIRHETWGWHTN--GNEEMNPG
gi|34496689|ref  RSM--VCDSEINVCHCQ----------------PDITRAARQHLWNMHTV--GQGNTADA
gi|66048194|ref  RSM--QVDTELNICVED----------------PSVTKPLREHLFDLHIG--KKISGLDT
gi|237802136|re  RSM--QVDTELNICVED----------------PTVTKPLREHLFDIHTG--ETKTEPGI
gi|71733687|ref  RSM--EVDSELNICVED----------------PAVTKPLRKHLWSIHTD--SEGSG-DD
gi|206562019|re  RSM--NVDSELNICHEN----------------SVVTKSLRQRLWSMHAG--DKGAQEDF
gi|134293146|re  RSM--EVDSELNICHEH----------------MGVTQPLRRRLWAMHTG--GVEEGASD
gi|170697911|re  RSM--EVDSELNIFHES----------------MRVTQPLREKLWRIHAG--DKGVGAKD
gi|254248890|re  RSM--EVDSELNICHES----------------MRVTQPLREKLWRIHVG--DDGIGSKD
gi|172063204|re  RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GRGAQ-DD
gi|171317799|re  RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GRGAQDDP
gi|170697592|re  RSM--EADSELNICHEH----------------GDVTKRLRQQLWNLHTG--GKGAQDDP
gi|94309572|ref  RSM--EGDSELNICHEN----------------EAVTRPLRRKLWHDHTK--GMGDH-DD
gi|17548851|ref  RSM--QVDSELNICHEH----------------SGVTAPLRKRLWNIHTK--GMGAQEDV
gi|170691203|re  RSM--EVDSELNICHEH----------------GGATRALRKQLWALHTN--DLGAQDDI
                                                                             


                       1210      1220      1230      1240      1250      1260
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ---------NVAFEQRFKRFVVTNNSRKALLN---------RLSDLL-------------
gi|194291793|re  LGLPSILDGPGDLDT-WQAVQRVAQTNAEAYDKAFPYVPRSKSRSSVWPTWDDSNGKLRG
gi|239816830|re  TRMET----ADTHEK-WLTRMNTNKENRIKNL---------GPESNSLI-----------
gi|170699527|re  FKEI-----PNVFED-WNRRMAKNRNVWKSGT--------AALKGFLLP-----------
gi|91777541|ref  REAM-----PSVFGD-WESYMQKNYNKCKEGN--------EKLKGFLVK-----------
gi|172060379|re  RNRV-----PVVFDI-WEGRMKDNRDIQKAGT--------ENLQGFILP-----------
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  RDQV-----PVVYDD-WEKRMHENLIAKMKGN---------PMQGFILP-----------
gi|254000137|re  YSDSM----DDTFEK-WKKLAERNARHIEKNE---------RFEGFIVA-----------
gi|107022962|re  SLTPLAM--SKAFRN-WVQLLRANELARKKGD---------APTGFLHP-----------
gi|172065698|re  SLTPKAM--AKTFIN-WVQLLRANEIARKKGD---------APTGFLHP-----------
gi|171321395|re  SLTPKAM--AKTFIN-WVQLLRANEIARKKGD---------APTGFLHP-----------
gi|116053236|re  ---------EKNFEL-WNQKMDDNWKAQVADE---------PFTSHLLR-----------
gi|254238204|re  ---------EKNFEL-WNQKMDDNWKAQVADE---------PFTSHLLR-----------
gi|107104185|re  ---------KDNFEL-WNQTMDKNWKQQRNDE---------PLTSHLLR-----------
gi|218894188|re  ---------KDNFEL-WNQTMDKNWKQQRNDE---------PLTSHLLR-----------
gi|254244030|re  ---------EKNFKL-WNQKMDANWRQQRKDE---------PLVANLLR-----------
gi|15600282|ref  ---------EKNFKL-WNQKMDANWRQQRKDE---------PLVANLLR-----------
gi|251792084|re  DMHDYEVA-EGAFKE-WQRLINENKKNMGDKS----------PKCALRE-----------
gi|255068222|re  VQLVDPNISGKTFLS-WAEVLDQNKSAKETKQ---------KRLMPLLE-----------
gi|34496689|ref  SKPQPL---ADVYDR-WERIMKANQKNRQSKR---------APIAPLVK-----------
gi|66048194|ref  ---------TETYQK-WQEAIDKNKSRRTKGMQDTQVTTPDGPIASLVE-----------
gi|237802136|re  ---------ASIYQQ-WQAIIETNKTNRILNKQKNDAVKLQGPVASLVE-----------
gi|71733687|ref  I--------ETAFST-WSRIASFNAANRKNKE------NTNRPTHSLTE-----------
gi|206562019|re  ---------FKSFMA-WHDIVEQNKVNKTKNL---------PPEKSLVK-----------
gi|134293146|re  S--------AGNAATAWEHIIKLNASNQKRGQ---------PPIASLVG-----------
gi|170697911|re  KNGRLNA--KSAFKG-WGEVILNNQDLKSEGG---------APCASLVE-----------
gi|254248890|re  KNGRLNA--ESAFKG-WDEIITKNQELRSGGD---------APRASLVE-----------
gi|172063204|re  P--------QAAFKN-WELLINNNADFQKAGD--------QSPAASLVG-----------
gi|171317799|re  ---------QEAFKN-WELLINNNADFQKAGD--------QSPAASLVG-----------
gi|170697592|re  ---------QEAFKN-WELLINNNADFQRAGD--------QSPAASLVG-----------
gi|94309572|ref  P--------AEAFKQ-WGKIIRRNADNRNNGN---------APESSLIE-----------
gi|17548851|ref  ---------TEAFDQ-WDRIIVENAKNERNKL---------PPCASLVG-----------
gi|170691203|re  ---------PEAYKQ-WSRVIFRNTQNQGNKL---------PPVASVVG-----------
                                                                             


                       1270      1280      1290      1300      1310      1320
                 =========+=========+=========+=========+=========+=========+
gi|113968813|re  ------------------------------------------------------------
gi|194291793|re  YMPFNERFWREERPRDDSFTWDAKQILSESTPSGVRGFIVALPVMWTLGENNDSKMNLTT
gi|239816830|re  -------HPFEDPRGVPFVKFA--------------------------------------
gi|170699527|re  -------FEDHRATGTMHAQVTIPSTSDTSALT---------------------------
gi|91777541|ref  -------FEDKRSTSTKHAMNTVAPSTNGQTALT--------------------------
gi|172060379|re  -------FIDRRAETVLHAQIDVPSSTNASRTV---------------------------
GOS_1181020_Tra  ------------------------------------------------------------
gi|78063844|ref  -------FEDRRANTILHAQIDPPPSSDIPRTV---------------------------
gi|254000137|re  -------FKDERVAKDR---VG--------------------------------------
gi|107022962|re  -------FHDDRVTGIR---LS--------------------------------------
gi|172065698|re  -------FHDERATGVR---LS--------------------------------------
gi|171321395|re  -------FHDERETGVR---LS--------------------------------------
gi|116053236|re  -------FWDVTTPYSQNLTVD--------------------------------------
gi|254238204|re  -------FWDVTTPYSQNLTVD--------------------------------------
gi|107104185|re  -------FWDVITPYSPSFTVD--------------------------------------
gi|218894188|re  -------FWDVITPYSPSFTVD--------------------------------------
gi|254244030|re  -------FWDVVTPYSPGLTVD--------------------------------------
gi|15600282|ref  -------FWDVVTPYSPGLTVD--------------------------------------
gi|251792084|re  -------FYRADPTVSR---SD--------------------------------------
gi|255068222|re  -------FDLTNKNRVYTQDLD--------------------------------------
gi|34496689|ref  -------FSNDTSSTKD---LD--------------------------------------
gi|66048194|ref  -------FLQESSARKN---LD--------------------------------------
gi|237802136|re  -------FLQETKSRKN---WD--------------------------------------
gi|71733687|ref  -------FYRDSKKRSN---LD--------------------------------------
gi|206562019|re  -------FVRTSAKRTY---AD--------------------------------------
gi|134293146|re  -------FKWTSTKRTR---LD--------------------------------------
gi|170697911|re  -------FYRDSPSRSN---LD--------------------------------------
gi|254248890|re  -------FYRDNPSRSY---LD--------------------------------------
gi|172063204|re  -------FMRTSNKITR---SD--------------------------------------
gi|171317799|re  -------FMRTSNKITR---SD--------------------------------------
gi|170697592|re  -------FMRTSNKITR---SD--------------------------------------
gi|94309572|ref  -------FSRKDPKRTY---KD--------------------------------------
gi|17548851|ref  -------FMRESDKRSY---LD--------------------------------------
gi|170691203|re  -------FLRTSPKRTY---AD--------------------------------------
                                                                             


                       1330      1340      1350
                 =========+=========+=========+=
gi|113968813|re  -------------------------------
gi|194291793|re  LAHVESEDEVNRERQTASRSPSQSGQADAYS
gi|239816830|re  -------------------------------
gi|170699527|re  -------------------------------
gi|91777541|ref  -------------------------------
gi|172060379|re  -------------------------------
GOS_1181020_Tra  -------------------------------
gi|78063844|ref  -------------------------------
gi|254000137|re  -------------------------------
gi|107022962|re  -------------------------------
gi|172065698|re  -------------------------------
gi|171321395|re  -------------------------------
gi|116053236|re  -------------------------------
gi|254238204|re  -------------------------------
gi|107104185|re  -------------------------------
gi|218894188|re  -------------------------------
gi|254244030|re  -------------------------------
gi|15600282|ref  -------------------------------
gi|251792084|re  -------------------------------
gi|255068222|re  -------------------------------
gi|34496689|ref  -------------------------------
gi|66048194|ref  -------------------------------
gi|237802136|re  -------------------------------
gi|71733687|ref  -------------------------------
gi|206562019|re  -------------------------------
gi|134293146|re  -------------------------------
gi|170697911|re  -------------------------------
gi|254248890|re  -------------------------------
gi|172063204|re  -------------------------------
gi|171317799|re  -------------------------------
gi|170697592|re  -------------------------------
gi|94309572|ref  -------------------------------
gi|17548851|ref  -------------------------------
gi|170691203|re  -------------------------------
                                                






Parameters used
Minimum Number Of Sequences For A Conserved Position: 18
Minimum Number Of Sequences For A Flanking Position: 29
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 1 selected block(s)
Flanks: [85  96]  

New number of positions in input.fasta-gb:  12  (0% of the original 1351 positions)



Protein Domains

PROTOCOL


InterOro ,default parameters at EBI


RESULTS ANALYSIS


For this ORF, ' no hits were reported', but since the homology of this a.a sequence was good, i conducted


domain analysis for this homolog.i.e the ORF obtained is a partial protein, and is short in length.So, the


domain of its homolog is taken for analysis.


I found only one domain'Phospholipae/D transphosphatidylase'


RAW RESULTS

>gi|78063844|ref|YP_373752.1| phospholipase D/transphosphatidylase [Burkholderia sp. 383]
MAQLPLESHNAVDVAVDEAGRAAQGTVQWLLEKNVDEDVKPTLGNDLKFFVCGEEGFRSIATDLMGAQGT
VDICCWGFDPGMEIWRGAESPKGIGVPKVDGKPYSPTPADGLWPRGIVYGALLEEITQRKDNPVTVRLLI
WFDPRGSRKQNSMPGFTDVPVSGWTSPIQKTVQQEAPYANAKRTQWCIDWWKRNLPDGESKRSGILTQNQ
RLRIVLRSISSKDVISLMTAPLKEEDEPSTHSDKGDWGYVDEKNLLEDYATHHQKPILIDYAQPYEGKNA
VGYVMGLNSVTDYWDRTAHEIDDPLREAWVPSYVNDEHKHEQETQDPTGPLSTAPYKQVNPYQDYATRIV
GKALKRLHQNFERGWNVFAPPAWQTTELKALPAGITSLPDDPAYRVQIVRTQPHEHEKTIKSLYYQASSF
ARNYIYMENQYFFYPEFARYLKLQRKNFHDAWEKLANKPQQDAPVLHLFVVTPHPQDPGMIPRTYDMMAE
LGHGDAMKGQHDLVVAGKTKQQYKDREGKNTFHPQSWKELAETIGLKVSIARLRTSGMVGGQMAYREIYI
HSKLMIIDDVFVTLGSANMNQRSMSVDSEINFGATGLDWASKLRGRVFPLLSGGATQGSGDRDQVPVVYD
DWEKRMHENLIAKMKGNPMQGFILPFEDRRANTILHAQIDPPPSSDIPRTV


The raw output obtained was:

YP_373752.1	5AC7A9DE65F25A4F	681	ProfileScan	PS50035	PLD	556	583	0.0	T	10-Jan-2010	IPR001736	Phospholipase D/Transphosphatidylase	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
YP_373752.1	5AC7A9DE65F25A4F	681	HMMPanther	PTHR18896:SF14	PTHR18896:SF14	558	594	2.19999900980727E-12	T	10-Jan-2010	NULL	NULL	
YP_373752.1	5AC7A9DE65F25A4F	681	HMMPanther	PTHR18896:SF14	PTHR18896:SF14	558	594	2.19999900980727E-12	T	10-Jan-2010	NULL	NULL	
YP_373752.1	5AC7A9DE65F25A4F	681	HMMSmart	SM00155	PLDc	556	583	8.599997204827182E-5	T	10-Jan-2010	IPR001736	Phospholipase D/Transphosphatidylase	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
YP_373752.1	5AC7A9DE65F25A4F	681	HMMPanther	PTHR18896	Phospholipase_D	558	594	2.19999900980727E-12	T	10-Jan-2010	IPR015679	Phospholipase D	
YP_373752.1	5AC7A9DE65F25A4F	681	Gene3D	G3DSA:3.30.870.10	G3DSA:3.30.870.10	407	596	1.29999995835437E-4	T	10-Jan-2010	NULL	NULL	
YP_373752.1	5AC7A9DE65F25A4F	681	superfamily	SSF56024	SSF56024	43	619	2.0E-11	T	10-Jan-2010	NULL	NULL	
YP_373752.1	5AC7A9DE65F25A4F	681	superfamily	SSF56024	SSF56024	357	592	7.5E-10	T	10-Jan-2010	NULL	NULL	
YP_373752.1	5AC7A9DE65F25A4F	681	HMMPfam	PF00614	PLDc	258	293	14000.0045763982	T	10-Jan-2010	IPR001736	Phospholipase D/Transphosphatidylase	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
YP_373752.1	5AC7A9DE65F25A4F	681	HMMPfam	PF00614	PLDc	556	583	0.699999989576661	T	10-Jan-2010	IPR001736	Phospholipase D/Transphosphatidylase	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)


 

Phylogeny

PROTOCOL



Phylogeny.fr / PhyML method / bootstrap / default substitution model / out group: gamma-proteobacteria + firmicutes


RESULTS ANALYSIS


The tree obtained showed an anomalous classification of in-groups and out-groups.Beta-proteobacteria was taken as in-group and gamma-proteobacteria was taken as out group, alongwith firmicutes( only one hit was found ).

As in-group sequences are mixed in the out group branch, and/or outgroup sequences are mixed within the in group branch. The metagenomic sequence is a close relative of Bulkholderia sp( beta-proteobacteria), and seems to be subjected to HGTs (Horizontal gene transfers.

RAW RESULTS
Phyml
                                                                                                    --------1------
 
                               +Burkholderia_ambifaria_MEX-5_gi_171317799  [in-group]
                               |
                               |Burkholderia_ambifaria_IOP40-10_gi_170697592  [in-group]
                               |

                               |
                               | +---Burkholderia_cenocepacia_J2315_gi_206562019 [in-group]
                               |

                               | |
                               | | +-Burkholderia_ambifaria_IOP40-10_gi_170697911 [in-group]
                               | |++
                               | ||+--Burkholderia_cenocepacia_PC184_gi_254248890  [in-group]

                               | ||
                               | ||
 +-----------------------------+ || +--Chromobacterium_violaceum_ATCC_12472_gi_34496689 |[in-group]
                             | || |
 |                             | ||++-Pseudomonas_syringae_pv._phaseolicola_1448A_gi_71733687 [out-group]

 |                             | ||||
 |                             | ||||+------Neisseria_sicca_ATCC_29256_gi_255068222 [in-group]


 |                             | |||++
 |                             | ||+ |Pseudomonas_syringae_pv._syringae_B728a_gi_66048194 [out-group]


 |                             | ||| |
 |                             | ||| +-Pseudomonas_syringae_pv._oryzae_str._1_6_gi_237802136 [out-group]
 |                             +-+||
 |                               ||+------Ralstonia_metallidurans_CH34_gi_94309572  [in-group]
 |                               ||
 |                               ||----Burkholderia_graminis_C4D1M_gi_170691203 [in-group]
 |                               ||
 |                               ||Ralstonia_solanacearum_GMI1000_gi_17548851 [in-group]
 |                               ||
 |                               ||                    +Translation_of_ORF_number_1_in_reading_frame_1_on_the_reverse_st
 |                               ||                  +-+                                           [translated protein sequence of organism]
 |                               ||                  | +Burkholderia_sp._383_gi_78063844[in-group]
 |                               ||                +-+
 |                               ||                | |
 |                               ||              +-+ +Burkholderia_ambifaria_MC40-6_gi_172060379[in-group]
 |                               ||              | |
 |                               ||              | +---Burkholderia_ambifaria_IOP40-10_gi_170699527 [in-group]
 |                               ||           +--+
 |                               ||           |  | +-----Variovorax_paradoxus_S110_gi_239816830 [in-group]
 |                               ++           |  |-+
 |                                |           |  | +--Burkholderia_xenovorans_LB400_gi_91777541 [in-group]
 |                                |  +--------+  |
 |                                |  |        |  +-------Methylotenera_sp._SIP3-4_gi_254000137 [in-group]
 |                                |  |        |
 |                                |  |        |  +Burkholderia_cenocepacia_AU_1054_gi_107022962 [in-group]
 |                                |  |        |  |
 |                                |  |        +--+Burkholderia_ambifaria_MC40-6_gi_172065698 [in-group]
 |                                |  |           |
 |                                |+-+           +Burkholderia_ambifaria_MEX-5_gi_171321395 [in-group]
 |                                || |
 |                                || |   +Pseudomonas_aeruginosa_PACS2_gi_107104185 [in-group]
 |                                || |   |
 |                                || |   |
 |                                || |   |Pseudomonas_aeruginosa_LESB58_gi_218894188 [out-group]
 |                                ++ |   |
 |                                 | +---+Pseudomonas_aeruginosa_2192_gi_254244030 [out-group]
 |                                 |     |
 |                                 |     +Pseudomonas_aeruginosa_PAO1_gi_15600282 [out-group]
 |                                 |
 |                                 +------Aggregatibacter_aphrophilus_NJ8700_gi_251792084 [out-group]
 |
 +-------------------------------------------------------Streptococcus_sanguinis_SK36_gi_125719015 [out-group]

Taxonomy report

PROTOCOL


Blastp vs NR,default NCBI parameters + '1000 max target sequences'



RESULTS ANALYSIS


In group: beta-proteobacteria


Burkholderia sp. 383 [b-proteobacteria] taxid 269483 Score e-value

ref|YP_373752.1| phospholipase D/transphosphatidylase [Bur... 454 5e-126

gb|ABB13108.1| Phospholipase D/Transphosphatidylase [Burkh... 454 5e-126


Out group:gamma-proteobacteria + firmicutes


firmicutes was taken as out-group because only one-hit was obtained for this homolog.


Pseudomonas aeruginosa PAO1 [g-proteobacteria] taxid 208964 Score e-value

ref|NP_253776.1| hypothetical protein PA5089 [Pseudomonas ... 41 0.073

gb|AAG08474.1|AE004921_11 hypothetical protein PA5089 [Pse... 41 0.073


Streptococcus sanguinis SK36 [firmicutes] taxid 388919 Score e-value

ref|YP_001036148.1| phosphatidylserine/phosphatidylglycero... 38 0.96

gb|ABN45598.1| Phosphatidylserine/phosphatidylglycerophosp... 38 0.96




lineage report

RAW RESULTS


 Bacteria                     [bacteria]
. . Proteobacteria               [proteobacteria]
. . . Betaproteobacteria           [b-proteobacteria]
. . . . Burkholderiales              [b-proteobacteria]
. . . . . Burkholderiaceae             [b-proteobacteria]
. . . . . . Burkholderia                 [b-proteobacteria]
. . . . . . . Burkholderia cepacia complex [b-proteobacteria]
. . . . . . . . Burkholderia sp. 383 --------------  454 2 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Burkholderia sp. 383]
. . . . . . . . Burkholderia ambifaria MC40-6 .....  392 6 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Burkholderia ambifari
. . . . . . . . Burkholderia ambifaria IOP40-10 ...  169 6 hits [b-proteobacteria]  phospholipase D/Transphosphatidylase [Burkholderia ambifari
. . . . . . . . Burkholderia cenocepacia AU 1054 ..  106 2 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Burkholderia cenocepa
. . . . . . . . Burkholderia cenocepacia HI2424 ...  106 2 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Burkholderia cenocepa
. . . . . . . . Burkholderia ambifaria MEX-5 ......  105 4 hits [b-proteobacteria]  phospholipase D/Transphosphatidylase [Burkholderia ambifari
. . . . . . . . Burkholderia cenocepacia PC184 ....   48 2 hits [b-proteobacteria]  hypothetical protein BCPG_03743 [Burkholderia cenocepacia P
. . . . . . . . Burkholderia cenocepacia J2315 ....   43 2 hits [b-proteobacteria]  putative phospholipase D protein [Burkholderia cenocepacia 
. . . . . . . . Burkholderia vietnamiensis G4 .....   36 2 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Burkholderia vietnami
. . . . . . . Burkholderia xenovorans LB400 -------  218 2 hits [b-proteobacteria]  putative phospholipase [Burkholderia xenovorans LB400] >gi|
. . . . . . . Burkholderia graminis C4D1M .........   41 2 hits [b-proteobacteria]  phospholipase D/Transphosphatidylase [Burkholderia graminis
. . . . . . Ralstonia solanacearum GMI1000 --------   48 2 hits [b-proteobacteria]  phospholipase protein [Ralstonia solanacearum GMI1000] >gi|
. . . . . . Ralstonia metallidurans CH34 ..........   44 2 hits [b-proteobacteria]  phospholipase D/transphosphatidylase [Ralstonia metallidura
. . . . . . Cupriavidus taiwanensis ...............   36 2 hits [b-proteobacteria]  Phospholipase D [Cupriavidus taiwanensis] >gi|193225697|emb
. . . . . Variovorax paradoxus S110 ---------------   92 2 hits [b-proteobacteria]  phospholipase D/Transphosphatidylase [Variovorax paradoxus 
. . . . Methylovorus sp. SIP3-4 -------------------  101 2 hits [b-proteobacteria]  phospholipase D/Transphosphatidylase [Methylovorus sp. SIP3
. . . . Chromobacterium violaceum ATCC 12472 ......   46 2 hits [b-proteobacteria]  phospholipase protein [Chromobacterium violaceum ATCC 12472
. . . . Neisseria sicca ATCC 29256 ................   38 2 hits [b-proteobacteria]  phospholipase D family protein [Neisseria sicca ATCC 29256]
. . . Pseudomonas syringae pv. phaseolicola 1448A -   43 2 hits [g-proteobacteria]  phospholipase D family protein [Pseudomonas syringae pv. ph
. . . Pseudomonas syringae pv. syringae B728a .....   43 2 hits [g-proteobacteria]  phospholipase D/transphosphatidylase [Pseudomonas syringae 
. . . Pseudomonas syringae pv. oryzae str. 1_6 ....   43 1 hit  [g-proteobacteria]  phospholipase D/transphosphatidylase [Pseudomonas syringae 
. . . Aggregatibacter aphrophilus NJ8700 ..........   42 2 hits [g-proteobacteria]  phospholipase D/Transphosphatidylase [Aggregatibacter aphro
. . . Pseudomonas aeruginosa 2192 .................   41 2 hits [g-proteobacteria]  hypothetical protein PA2G_04863 [Pseudomonas aeruginosa 219
. . . Pseudomonas aeruginosa PACS2 ................   41 1 hit  [g-proteobacteria]  hypothetical protein PaerPA_01005258 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa PAO1 .................   41 2 hits [g-proteobacteria]  hypothetical protein PA5089 [Pseudomonas aeruginosa PAO1] >
. . . Pseudomonas aeruginosa LESB58 ...............   41 2 hits [g-proteobacteria]  hypothetical protein PLES_54791 [Pseudomonas aeruginosa LES
. . . Pseudomonas aeruginosa UCBPP-PA14 ...........   41 2 hits [g-proteobacteria]  hypothetical protein PA14_67220 [Pseudomonas aeruginosa UCB
. . . Pseudomonas aeruginosa C3719 ................   41 2 hits [g-proteobacteria]  hypothetical protein PACG_04330 [Pseudomonas aeruginosa C37
. . . Shewanella sp. MR-4 .........................   35 2 hits [g-proteobacteria]  hypothetical protein Shewmr4_0469 [Shewanella sp. MR-4] >gi
. . Streptococcus sanguinis SK36 ------------------   38 2 hits [firmicutes]        phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
. Drosophila melanogaster -------------------------   37 4 hits [flies]             disembodied [Drosophila melanogaster] >gi|12643810|sp|Q9NGX
. Drosophila willistoni ...........................   35 2 hits [flies]             GK17776 [Drosophila willistoni] >gi|194164989|gb|EDW79890.1
. Drosophila mojavensis ...........................   35 2 hits [flies]             GI13888 [Drosophila mojavensis] >gi|193920759|gb|EDW19626.1
. Drosophila simulans .............................   35 2 hits [flies]             GD13808 [Drosophila simulans] >gi|194195577|gb|EDX09153.1| 
. Drosophila grimshawi ............................   35 2 hits [flies]             GH24982 [Drosophila grimshawi] >gi|193891544|gb|EDV90410.1|
. Drosophila pseudoobscura pseudoobscura ..........   35 2 hits [flies]             GA11350 [Drosophila pseudoobscura pseudoobscura] >gi|198150
. Drosophila sechellia ............................   35 2 hits [flies]             GM14619 [Drosophila sechellia] >gi|194128367|gb|EDW50410.1|
. Drosophila persimilis ...........................   35 2 hits [flies]             GL17063 [Drosophila persimilis] >gi|194117410|gb|EDW39453.1
. Ciona intestinalis ..............................   35 1 hit  [tunicates]         PREDICTED: similar to predicted protein [Ciona intestinalis]                   

BLAST

PROTOCOL


Blastp vs NR , default NCBI parameters + 1000 max target sequences

Blastp vs SwissProt , default parameters



RESULTS ANALYSIS


The homology was good enough with the follwoing score and e-value


Burkholderia sp. 383 [b-proteobacteria] taxid 269483

ref|YP_373752.1| phospholipase D/transphosphatidylase [Bur... 454 5e-126

gb|ABB13108.1| Phospholipase D/Transphosphatidylase [Burkh... 454 5e-126




RAW RESULTS


Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_373752.1|  phospholipase D/transphosphatidylase [Burkho...   454    5e-126 Gene info
ref|YP_001808031.1|  phospholipase D/transphosphatidylase [Bur...   392    2e-107 Gene info
ref|YP_552749.1|  putative phospholipase [Burkholderia xenovor...   218    5e-55  Gene info
ref|ZP_02890568.1|  phospholipase D/Transphosphatidylase [Burk...   169    3e-40 
ref|YP_001816410.1|  phospholipase D/transphosphatidylase [Bur...   106    3e-21  Gene info
ref|YP_621289.1|  phospholipase D/transphosphatidylase [Burkho...   106    3e-21  Gene info
ref|ZP_02910348.1|  phospholipase D/Transphosphatidylase [Burk...   105    4e-21 
ref|YP_003052200.1|  phospholipase D/Transphosphatidylase [Met...   101    7e-20  Gene info
ref|YP_002945740.1|  phospholipase D/Transphosphatidylase [Var...  92.8    3e-17  Gene info
ref|ZP_02888995.1|  phospholipase D/Transphosphatidylase [Burk...  53.1    3e-05 
ref|ZP_02906979.1|  phospholipase D/Transphosphatidylase [Burk...  51.6    8e-05 
ref|ZP_02888681.1|  phospholipase D/Transphosphatidylase [Burk...  51.6    9e-05 
ref|YP_001810855.1|  phospholipase D/transphosphatidylase [Bur...  50.4    2e-04  Gene info
ref|ZP_04942210.1|  hypothetical protein BCPG_03743 [Burkholde...  48.9    5e-04 
ref|NP_522191.1|  phospholipase protein [Ralstonia solanacearu...  48.5    8e-04  Gene info
ref|NP_900904.1|  phospholipase protein [Chromobacterium viola...  46.6    0.003  Gene info
ref|YP_582782.1|  phospholipase D/transphosphatidylase [Ralsto...  44.3    0.013  Gene info
ref|YP_272428.1|  phospholipase D family protein [Pseudomonas ...  43.9    0.017  Gene info
ref|YP_002232782.1|  putative phospholipase D protein [Burkhol...  43.9    0.019  Gene info
ref|YP_238035.1|  phospholipase D/transphosphatidylase [Pseudo...  43.5    0.021  Gene info
ref|ZP_04590597.1|  phospholipase D/transphosphatidylase [Pseu...  43.1    0.032 
ref|YP_003006804.1|  phospholipase D/Transphosphatidylase [Agg...  42.7    0.037  Gene info
ref|ZP_02882369.1|  phospholipase D/Transphosphatidylase [Burk...  42.0    0.061 
ref|ZP_04937352.1|  hypothetical protein PA2G_04863 [Pseudomon...  42.0    0.066 
ref|ZP_01368103.1|  hypothetical protein PaerPA_01005258 [Pseu...  42.0    0.072 
ref|NP_253776.1|  hypothetical protein PA5089 [Pseudomonas aer...  42.0    0.072  Gene info
ref|YP_002443057.1|  hypothetical protein PLES_54791 [Pseudomo...  42.0    0.073  Gene info
ref|YP_793559.1|  hypothetical protein PA14_67220 [Pseudomonas...  42.0    0.077  Gene info
ref|ZP_04931527.1|  hypothetical protein PACG_04330 [Pseudomon...  41.6    0.092 
ref|ZP_05320077.1|  phospholipase D family protein [Neisseria ...  38.5    0.84  
ref|YP_001036148.1|  phosphatidylserine/phosphatidylglyceropho...  38.1    0.96   Gene info
ref|NP_524810.2|  disembodied [Drosophila melanogaster] >sp|Q9...  37.7    1.4    UniGene infoGene info
ref|YP_002007700.1|  Phospholipase D [Cupriavidus taiwanensis]...  37.0    2.4    Gene info
ref|YP_001116882.1|  phospholipase D/transphosphatidylase [Bur...  36.6    2.6    Gene info
ref|XP_002068904.1|  GK17776 [Drosophila willistoni] >gb|EDW79...  35.8    4.6    Gene info
ref|XP_002009150.1|  GI13888 [Drosophila mojavensis] >gb|EDW19...  35.8    4.7    Gene info
ref|XP_002083568.1|  GD13808 [Drosophila simulans] >gb|EDX0915...  35.4    6.1    Gene info
ref|XP_001996903.1|  GH24982 [Drosophila grimshawi] >gb|EDV904...  35.4    6.1    Gene info
ref|XP_001353659.2|  GA11350 [Drosophila pseudoobscura pseudoo...  35.4    6.2    Gene info
ref|XP_002035274.1|  GM14619 [Drosophila sechellia] >gb|EDW504...  35.4    6.6    Gene info
ref|XP_002028278.1|  GL17063 [Drosophila persimilis] >gb|EDW39...  35.0    7.7    Gene info
ref|YP_732606.1|  hypothetical protein Shewmr4_0469 [Shewanell...  35.0    8.2    Gene info
ref|XP_002129486.1|  PREDICTED: similar to predicted protein [...  35.0    9.4    UniGene infoGene info


***************************************************************************
>ref|YP_373752.1| Gene info phospholipase D/transphosphatidylase [Burkholderia sp. 383]
 gb|ABB13108.1| Gene info Phospholipase D/Transphosphatidylase [Burkholderia sp. 383]
Length=681

 GENE ID: 3754765 Bcep18194_B2998 | phospholipase D/transphosphatidylase
[Burkholderia sp. 383]

 Score =  454 bits (1168),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 215/258 (83%), Positives = 231/258 (89%), Gaps = 0/258 (0%)

Query  14   VAQLPLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSI  73
            +AQLPLE+HN VDVAVDEAGRAAQGTVQWLLEKNVD+DV PT GND++FFVCGEEGFRSI
Sbjct  1    MAQLPLESHNAVDVAVDEAGRAAQGTVQWLLEKNVDEDVKPTLGNDLKFFVCGEEGFRSI  60

Query  74   AADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYG  133
            A DLMGAQGTVDICCWGFDPGMEIWRG+ESP GIGVP   GKP    PA G WPRGIVYG
Sbjct  61   ATDLMGAQGTVDICCWGFDPGMEIWRGAESPKGIGVPKVDGKPYSPTPADGLWPRGIVYG  120

Query  134  ALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSPIQKKVQQRPPYAN  193
            ALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTD+PVSGWTSPIQK VQQ  PYAN
Sbjct  121  ALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDVPVSGWTSPIQKTVQQEAPYAN  180

Query  194  SERTQWCIDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKLLAANIEEEDAPST  253
            ++RTQWCIDWW RNLPDGESK SGILT+NQRLRIVLR IS+KDV  L+ A ++EED PST
Sbjct  181  AKRTQWCIDWWKRNLPDGESKRSGILTQNQRLRIVLRSISSKDVISLMTAPLKEEDEPST  240

Query  254  HSDDGDFYYVDEQNLLED  271
            HSD GD+ YVDE+NLLED
Sbjct  241  HSDKGDWGYVDEKNLLED  258


>ref|YP_001808031.1| Gene info phospholipase D/transphosphatidylase [Burkholderia ambifaria 
MC40-6]
 gb|ACB63815.1| Gene info phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MC40-6]
Length=676

 GENE ID: 6177727 BamMC406_1327 | phospholipase D/transphosphatidylase
[Burkholderia ambifaria MC40-6]

 Score =  392 bits (1007),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 215/258 (83%), Gaps = 5/258 (1%)

Query  14   VAQLPLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSI  73
            +A+LPLE+HN +DVA+DEAGR A+GTVQWLLEK+VD DVMPTTGN + FFVCGEEGFR+I
Sbjct  1    MAKLPLESHNAMDVAIDEAGRIAKGTVQWLLEKDVDDDVMPTTGNKLEFFVCGEEGFRAI  60

Query  74   AADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYG  133
            A D++ A+ TVDICCWGFDPGME+ RG      IG P      +P  P  G WPRG VYG
Sbjct  61   ATDILAAKSTVDICCWGFDPGMELVRGDGPACWIGDPQVN---MPFVP--GTWPRGTVYG  115

Query  134  ALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSPIQKKVQQRPPYAN  193
            ALLEEITQRKDNPVTVRLLIWFDPR SRKQNSMPGFTD+PVSGWTSP+QKKVQQ PPY N
Sbjct  116  ALLEEITQRKDNPVTVRLLIWFDPRASRKQNSMPGFTDVPVSGWTSPVQKKVQQAPPYKN  175

Query  194  SERTQWCIDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKLLAANIEEEDAPST  253
            ++RTQ+CIDWWNRNLPDGESK SGILTKN RL+IVLR I++ DV  L+ A ++EED PST
Sbjct  176  AKRTQYCIDWWNRNLPDGESKRSGILTKNPRLQIVLRSIASGDVDALIDAPLKEEDPPST  235

Query  254  HSDDGDFYYVDEQNLLED  271
            HS+  D+Y V+E+NLLED
Sbjct  236  HSESVDYYLVNEKNLLED  253


>ref|YP_552749.1| Gene info putative phospholipase [Burkholderia xenovorans LB400]
 gb|ABE33399.1| Gene info Putative phospholipase [Burkholderia xenovorans LB400]
Length=684

 GENE ID: 4006904 Bxe_B2594 | putative phospholipase
[Burkholderia xenovorans LB400] (10 or fewer PubMed links)

 Score =  218 bits (556),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 149/252 (59%), Gaps = 30/252 (11%)

Query  19   LETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTT-GNDMRFFVCGEEGFRSIAADL  77
            L+T NPVDVA+ E G  AQG+VQWLLEK    D    T GND++FF+CG+EGF  ++ DL
Sbjct  4    LKTQNPVDVAITEVGGQAQGSVQWLLEKKTCPDAPEITEGNDLQFFICGQEGFGQLSKDL  63

Query  78   MGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLE  137
              A+ TVDI CWGFDPGME+ R  E+                      WPR + YG LLE
Sbjct  64   RAAKSTVDIVCWGFDPGMEVERTGEA----------------------WPRDLRYGDLLE  101

Query  138  EITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSPIQKKVQQRPPYANSERT  197
            ++ + +   V VRLL+WFDPR SRKQNSMPG+TD+PVS  TSPIQ+ VQ   PY N  R 
Sbjct  102  QLAKAE---VRVRLLLWFDPRASRKQNSMPGYTDVPVSLATSPIQRMVQGDDPYGNPVRH  158

Query  198  QWCIDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKLLAANIEEEDAPSTHSDD  257
             WC  WW R+  + +            L+IVLRGI  + VK LLAA+I EED P    D 
Sbjct  159  DWCKAWWKRHGLENDRIDPRKALYPDHLQIVLRGIEKQAVKGLLAADIAEEDRP----DS  214

Query  258  GDFYYVDEQNLL  269
                 VDE  LL
Sbjct  215  SWLSPVDESALL  226


>ref|ZP_02890568.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
 gb|EDT03832.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
Length=664

 Score =  169 bits (428),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/226 (39%), Positives = 125/226 (55%), Gaps = 32/226 (14%)

Query  19   LETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTT-GNDMRFFVCGEEGFRSIAADL  77
            L++ NP  VA+DE  RAA+ + QWLLEK   KD+ P T  N + F VCGEEGF +IA DL
Sbjct  6    LKSQNPTSVAIDEQSRAAKSSAQWLLEKR--KDIAPITYENHLEFLVCGEEGFANIANDL  63

Query  78   MGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLE  137
              A+G+V++CCWGFDPGME+ R                    +     WPRG  YG LLE
Sbjct  64   KLAKGSVNLCCWGFDPGMELIR--------------------EKGETKWPRGQTYGQLLE  103

Query  138  EITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTS-PIQKKVQQRPPYANSER  196
            E+  +    VTVRL++W+D   S KQN++PG++D   +  T  P       + PY + +R
Sbjct  104  EVANKG---VTVRLMVWYDETASAKQNNVPGYSDTGHNPITHLPAFLVGTSKSPYDSKDR  160

Query  197  TQWCIDWWNRNLPDGESKGSGILTKNQRLRIVLRGISNKDVKKLLA  242
             Q+CI+WW  + P G   G+     N+ L +  R + + D    LA
Sbjct  161  QQYCIEWWKTHRPKGNCSGT-----NKHLLVTFRSVDSADAAHALA  201

>ref|YP_001816410.1| Gene info phospholipase D/transphosphatidylase [Burkholderia ambifaria 
MC40-6]
 gb|ACB68857.1| Gene info phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MC40-6]
Length=693

 GENE ID: 6182239 BamMC406_6428 | phospholipase D/transphosphatidylase
[Burkholderia ambifaria MC40-6]

 Score =  106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 76/153 (49%), Gaps = 25/153 (16%)

Query  21   THNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGA  80
            T N     VD + R +  + QW LEKN      P   N++  F+CGE+ F+ IAADL  A
Sbjct  6    TQNKSKAPVDVSTRQSVASAQWFLEKNETYYAPPYAKNNLDVFICGEDAFKQIAADLKAA  65

Query  81   QGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEIT  140
            + +V+I CWGFDPGME+ R                          WPRG  +G LL ++ 
Sbjct  66   KHSVEIICWGFDPGMELIRNGSV----------------------WPRGDTWGGLLRDVA  103

Query  141  QRKDN---PVTVRLLIWFDPRGSRKQNSMPGFT  170
              K N   PV VRLL W+   GS   N+MPG +
Sbjct  104  AGKFNNGKPVQVRLLSWYGFIGSLGSNNMPGHS  136

>ref|YP_621289.1| Gene info phospholipase D/transphosphatidylase [Burkholderia cenocepacia 
AU 1054]
 ref|YP_840042.1| Gene info phospholipase D/transphosphatidylase [Burkholderia cenocepacia 
HI2424]
 gb|ABF76316.1| Gene info phospholipase D/Transphosphatidylase [Burkholderia cenocepacia 
AU 1054]
 gb|ABK13149.1| Gene info phospholipase D/Transphosphatidylase [Burkholderia cenocepacia 
HI2424]
Length=693

 GENE ID: 4091810 Bcen_1410 | phospholipase D/transphosphatidylase
[Burkholderia cenocepacia AU 1054]

 Score =  106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 75/153 (49%), Gaps = 25/153 (16%)

Query  21   THNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGA  80
            T N     +D   R A  + QW LEK  D    P   N++  F+CGE+ F  IAADL  A
Sbjct  6    TQNKSKAPIDVDKRQAVASAQWFLEKQADYYAPPYEKNNIDVFICGEDAFTQIAADLKAA  65

Query  81   QGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEIT  140
            + +V+I CWGFDPGME+ R                          WPRG  +G LL ++ 
Sbjct  66   KHSVEIICWGFDPGMELIRKGTV----------------------WPRGDTWGGLLRDVA  103

Query  141  QRKDN---PVTVRLLIWFDPRGSRKQNSMPGFT  170
              K N   PV VRLL W+   GS   N+MPG++
Sbjct  104  AGKFNNGKPVQVRLLSWYGVIGSTLSNNMPGYS  136


>ref|ZP_02910348.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MEX-5]
 gb|EDT38527.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MEX-5]
Length=693

 Score =  105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 76/153 (49%), Gaps = 25/153 (16%)

Query  21   THNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGA  80
            T N     VD + R +  + QW LEKN      P   N++  F+CGE+ F+ IAADL  A
Sbjct  6    TQNKSKAPVDVSTRQSVASAQWFLEKNETYYAPPYEKNNLDVFICGEDAFKQIAADLKAA  65

Query  81   QGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEIT  140
            + +V+I CWGFDPGME+ R                          WPRG  +G LL ++ 
Sbjct  66   KHSVEIICWGFDPGMELIRNGSV----------------------WPRGDTWGGLLRDVA  103

Query  141  QRKDN---PVTVRLLIWFDPRGSRKQNSMPGFT  170
              K N   PV VRLL W+   GS   N+MPG +
Sbjct  104  AGKFNNGKPVQVRLLSWYGFIGSLGSNNMPGHS  136


>ref|YP_003052200.1| Gene info phospholipase D/Transphosphatidylase [Methylovorus sp. SIP3-4]
 gb|ACT51673.1| Gene info phospholipase D/Transphosphatidylase [Methylovorus sp. SIP3-4]
Length=680

 GENE ID: 8174448 Msip34_2436 | phospholipase D/Transphosphatidylase
[Methylovorus sp. SIP3-4]

 Score =  101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 96/196 (48%), Gaps = 35/196 (17%)

Query  18   PLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADL  77
            P +THN V   +D+       + QWLLEK+    +  T GN +   +CG+EGF  IA D+
Sbjct  6    PYKTHNRVTAPLDKETCEVTASFQWLLEKSRSHPI--TEGNRIETLICGQEGFGRIAQDI  63

Query  78   MGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLE  137
              A+G++ I CWGFDPGM + RG            +G+      A   W  G+ YG LL 
Sbjct  64   EHARGSLCIVCWGFDPGMALVRG------------EGQ------ANYPWANGLPYGELLR  105

Query  138  EITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSP---IQKKVQQRPPYANS  194
               ++    V +RLL+W++  GS  QN++ G+     +G T P   +     +R P A +
Sbjct  106  ---RKAAEGVQIRLLVWYNSSGSSVQNNLVGYV---ATGNTPPGGTLTSTWDERNPNAKT  159

Query  195  E------RTQWCIDWW  204
                   R  +CI WW
Sbjct  160  PKPLADVRQDYCIHWW  175


>ref|YP_002945740.1| Gene info phospholipase D/Transphosphatidylase [Variovorax paradoxus S110]
 gb|ACS20474.1| Gene info phospholipase D/Transphosphatidylase [Variovorax paradoxus S110]
Length=691

 GENE ID: 7969717 Vapar_3860 | phospholipase D/Transphosphatidylase
[Variovorax paradoxus S110]

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 94/210 (44%), Gaps = 43/210 (20%)

Query  13   NVAQLPLETHNPVDVAVDEAGRAAQGTVQWLLEKNVDKDVMPTTGND-MRFFVCGEEGFR  71
            ++++L  E   P    VD   R ++GT+QW LEK  D    P   N+ ++FF+CG+EGF 
Sbjct  3    DLSKLLDEIQRPEVSHVDMIKRRSKGTLQWFLEK--DHKTHPIHDNNALQFFMCGQEGFA  60

Query  72   SIAADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIV  131
            +I  D++ A  ++D+  WGFDPGME+ R   +                      WPRG  
Sbjct  61   AIEKDILAAGSSIDLVLWGFDPGMELTRSRNT----------------------WPRGTT  98

Query  132  YGALLEEITQRKDNPVTVRLLIWFDPRGSRKQNSMPGFTDIPVSGWTSPIQKKVQQRPP-  190
            YG LL    ++    V VR+L+WFD     K  +     D PV    +   K  +   P 
Sbjct  99   YGDLL---VRKAGEGVKVRMLLWFDNLVVNK--AAGNVPDFPVFWAPTSFSKTSRTTWPE  153

Query  191  ------------YANSERTQWCIDWWNRNL  208
                        +  ++R+ +C  WW   L
Sbjct  154  GAGSYDDRSNSAWVLTDRSNYCKQWWEDAL  183


>ref|ZP_02888995.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
 gb|EDT05430.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
Length=661

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 49/115 (42%), Gaps = 30/115 (26%)

Query  63   FVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIWRGSESPAGIGVPTFQGKPLPTKPA  122
             V GEE F ++   +  AQ +VDI CWGF P M   RGS     + +             
Sbjct  42   LVNGEEAFGAVYDAIASAQHSVDIVCWGFQPSMYFKRGSSGQGSLSI-------------  88

Query  123  AGGWPRGIVYGALLEEITQRKDNPVTVRLLIWFDPRGSRK--QNSMPG--FTDIP  173
                      G LL E   R  + V VRLL+W D     +  +N MPG  F+ +P
Sbjct  89   ----------GELLLE---RAKHNVKVRLLVWGDKFHVAQFLENMMPGGRFSHLP  130


>ref|ZP_02906979.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MEX-5]
 gb|EDT41880.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
MEX-5]
Length=668

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 72/186 (38%), Gaps = 46/186 (24%)

Query  39   TVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIW  98
            T +W ++K        T     R  V GEE F  +   +  A+ ++DI CWGF P M   
Sbjct  28   TFRWFVQKTEYNPAAAT----FRPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFK  83

Query  99   RGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEITQRKDNPVTVRLLIWFDPR  158
            R  +   G+G+    G+ L  K  AG                      V VRLL+W DP 
Sbjct  84   RDGQ---GVGI----GELLRQKGEAG----------------------VKVRLLVWRDPA  114

Query  159  --GSRKQNSMPG---FTDIPVSGWTSPIQKKVQQRPPYANSERTQWCIDWWNR-------  206
                  +N+MPG    TD+      S  +K       Y   ++ +   +W+ R       
Sbjct  115  FVSELSENNMPGNDIATDVKQRLPDSAYEKFSMMSRDYQTDQQRKIDQEWYRRANLHNVS  174

Query  207  -NLPDG  211
             NLP G
Sbjct  175  LNLPAG  180


>ref|ZP_02888681.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
 gb|EDT05718.1|  phospholipase D/Transphosphatidylase [Burkholderia ambifaria 
IOP40-10]
Length=668

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 72/186 (38%), Gaps = 46/186 (24%)

Query  39   TVQWLLEKNVDKDVMPTTGNDMRFFVCGEEGFRSIAADLMGAQGTVDICCWGFDPGMEIW  98
            T +W ++K        T     R  V GEE F  +   +  A+ ++DI CWGF P M   
Sbjct  28   TFRWFVQKTEYNPAAAT----FRPLVNGEEAFGHVYEQISKARHSIDIICWGFQPSMMFK  83

Query  99   RGSESPAGIGVPTFQGKPLPTKPAAGGWPRGIVYGALLEEITQRKDNPVTVRLLIWFDPR  158
            R  +   G+G+    G+ L  K  AG                      V VRLL+W DP 
Sbjct  84   RDGQ---GVGI----GELLRQKGEAG----------------------VKVRLLVWRDPA  114

Query  159  --GSRKQNSMPG---FTDIPVSGWTSPIQKKVQQRPPYANSERTQWCIDWWNR-------  206
                  +N+MPG    TD+      S  +K       Y   ++ +   +W+ R       
Sbjct  115  FVSELSENNMPGNDIATDVKQRLPDSAYEKFSMMSRDYQTDQQRKIDEEWYRRANLHNVS  174

Query  207  -NLPDG  211
             NLP G
Sbjct  175  LNLPAG  180