GOS 1170010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091140009634
Annotathon code: GOS_1170010
Sample :
  • GPS :41°5'28n; 71°36'8w
  • North American East Coast: Block Island, NY - USA
  • Coastal (-1m, 11°C, 0.1-0.8 microns)
Authors
Team : COMSATSISB
Username : Mehreen
Annotated on : 2010-01-15 07:01:35
  • ishfaq mehreen

Synopsis

  • Taxonomy: Dethiobacter alkaliphilus (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 427926
    Kingdom: Bacteria - Phylum: Firmicutes - Class: - Order:
    Bacteria; Firmicutes; Dethiobacter;

Genomic Sequence

>JCVI_READ_1091140009634 GOS_1170010 Genomic DNA
TTATTTAAAAAAGTTGAAAACATAAAATATGAAGTTCCAGATCAAAATACAATAATAGTTTCTGGTATTGATAAGGCTTTAGTTGGAGAGGTATCTGCAA
ACATAAGAGCTATTAAGCCTCCAGAGCCATATAAGGGTAAAGGTATTCGTTACAAAGATGAATATGTTCGAAGAAAAGCAGGTAAAGCTGCTGTGACAGC
AGGAGCGTAAGATGGTTATGAAAACAAAGAATCCTAGAATTAAAAGAAAAATTAGAATAAGAAAAAAAATTTATGGAACTGCTACAAAGCCAAGATTGGC
TGTGTTTAAAAGTAATAAAAATATTTATGTTCAGGCAATAGATGATTTAGGTCAAAGCACGATAGCAACAGCCAGTACTTTATCTAGTGAACTTAAGAAT
CAGAATTTAACTGTAGAGATCTCAAAAAAAGTTGGAGAAAAATTAGGTGAAGCACTTAATGAAATTGGTGTCAAAGAAGCAGTTTTTGATAGAGGCGGAT
ATATTTATCATGGAAGAGTACAAGCTGTAGCTGAAGGCATAAGAGAAAAAGGAATTAAGTTTTAATGGTTGAATCAGAATTACAAGAGAGTGTTATTCAC
ATAAACAGAGTGGCCAAAGTTGTTAAAGGTGGTAGGAACTTTGCTTTTACAGCCTTGGTAGCTGTTGGGGATGGAAATGGTAGTGCCGGTATAGGTTATG
GAAAAGGTTCAGAAGTTCCTCTAGCTATACAGAAAGCAATTGAAAATGCAAAAAAGGATATACATCAAATTCCTATGGCAGGCTCAACAATAGTTCATAC
AATTACAGGAGAACATGGCTCATCAAAAGTTCTTCTTAAGCCAGCTTCTCCAGGAACAGGTATTATTGCAGGAGGTGCTGCAAGAGAGGTATTACAAGTC
GCAGGAATTAAAGATATTCTTG

Translation

[565 - 921/922]   direct strand
>GOS_1170010 Translation [565-921   direct strand]
MVESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGI
IAGGAAREVLQVAGIKDIL

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

i conclude with srong evidences that my sequence is coding and for that i have following evidences like:

1) presence of longest ORF with start codon ATG present at position 565 present on direct strand..

2) presence of good homologs with very low e-value also supports it to be coding.

3) presence of protien domains that are Ribosomal_S5 $Ribosomal_S5_C by two softwares that is INTERPROSCAN and pfam is also a very strong evidence of it to be coding.


Some members of this family are thought to possess RNA binding domain towards their N terminus$ other is structural constituent of ribosome respectively and are involved in protein synthesis.




Phylogenetic tree also show great homology of sequence with the best homolog of BLASTp and so it is tought that sequence belong to the group of g-proteobacteria and kingdom is bacteria.


so from all this it is concluded that sequence is coding.


ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 30 AA / 'atg' initiation / 'standard(1)'genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 30 AA / 'atg' initiation / 'standard(1)'genetic code



RESULTS ANALYSIS

I obtained 3 ORF on direct strand in reading frame 1 and no ORF found reverse strand in any of the reading frames . i selected ORF of direct strand strand in reading frame 1 because it is the longest strand, it also contains start codon at the start . so as it fulfilled all the requirements of perfect ORF, so this is coding ORF and i proceed further analysis with this ORF.



ORF RESULTS:

1)On Direct strand:
>ORF number 1 in reading frame 1 on the direct strand extends from base 565 to base 921.
ATGGTTGAATCAGAATTACAAGAGAGTGTTATTCACATAAACAGAGTGGCCAAAGTTGTT
AAAGGTGGTAGGAACTTTGCTTTTACAGCCTTGGTAGCTGTTGGGGATGGAAATGGTAGT
GCCGGTATAGGTTATGGAAAAGGTTCAGAAGTTCCTCTAGCTATACAGAAAGCAATTGAA
AATGCAAAAAAGGATATACATCAAATTCCTATGGCAGGCTCAACAATAGTTCATACAATT
ACAGGAGAACATGGCTCATCAAAAGTTCTTCTTAAGCCAGCTTCTCCAGGAACAGGTATT
ATTGCAGGAGGTGCTGCAAGAGAGGTATTACAAGTCGCAGGAATTAAAGATATTCTT

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MVESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIE
NAKKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL

>ORF number 1 in reading frame 2 on the direct strand extends from base 212 to base 565.
ATGGTTATGAAAACAAAGAATCCTAGAATTAAAAGAAAAATTAGAATAAGAAAAAAAATT
TATGGAACTGCTACAAAGCCAAGATTGGCTGTGTTTAAAAGTAATAAAAATATTTATGTT
CAGGCAATAGATGATTTAGGTCAAAGCACGATAGCAACAGCCAGTACTTTATCTAGTGAA
CTTAAGAATCAGAATTTAACTGTAGAGATCTCAAAAAAAGTTGGAGAAAAATTAGGTGAA
GCACTTAATGAAATTGGTGTCAAAGAAGCAGTTTTTGATAGAGGCGGATATATTTATCAT
GGAAGAGTACAAGCTGTAGCTGAAGGCATAAGAGAAAAAGGAATTAAGTTTTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MVMKTKNPRIKRKIRIRKKIYGTATKPRLAVFKSNKNIYVQAIDDLGQSTIATASTLSSE
LKNQNLTVEISKKVGEKLGEALNEIGVKEAVFDRGGYIYHGRVQAVAEGIREKGIKF*

>ORF number 2 in reading frame 2 on the direct strand extends from base 815 to base 922.
ATGGCTCATCAAAAGTTCTTCTTAAGCCAGCTTCTCCAGGAACAGGTATTATTGCAGGAG
GTGCTGCAAGAGAGGTATTACAAGTCGCAGGAATTAAAGATATTCTTG

>Translation of ORF number 2 in reading frame 2 on the direct strand.
MAHQKFFLSQLLQEQVLLQEVLQERYYKSQELKIFL

No ORFs were found in reading frame 3.


2)Indirect strand:

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

phylogeny.fr \"A la Carte" Mode \ default parameters except Run Work flow _ "step by step " \



RESULTS ANALYSIS


i do MSA of my sequence with 15 ingroup and 5 outgroup sequences to find alignment so that i can infer a tree from it. using phylogeny.fr .


Parameters used

Minimum Number Of Sequences For A Conserved Position: 11

Minimum Number Of Sequences For A Flanking Position: 18

Maximum Number Of Contiguous Nonconserved Positions: 8

Minimum Length Of A Block: 10

Allowed Gap Positions: None

Use Similarity Matrices: Yes


Flank positions of the 2 selected block(s)

Flanks: [51 114] [117 162]


New number of positions in input.fasta-gb: 110 (50% of the original 220 positions)

                          
CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


g.p.gi|888      -------------------------------------MATSGEASGEGLREKLISINRVA
g.p.gi|712      ----------------------------------MANHNQENS-QQSDMAEKLIAVNRVS
gi21672753      -------------------------------------MANIEKKNNSELQEKLITVNRVS
h.G.Gram+g      ----------------------------------MARNKQDNA-AVPELQERVVYINRVS
h.G.Gram+       MPGRQRRDGGNGPAGQNSNGPEGRDNRRGGGDRRGGGDRRDNA-AEKNQLERVVAINRVS
r.s.GOS_11      ------------------------------------------M-VESELQESVIHINRVA
gi16777125      ------------------------MKADSNSEEGGILLALIDA-ANLELKERVVSINRVS
gi11456782      -------------------------------------MIDKEQ-AAPEMIEKVVTIRRVA
gi51894193      -------------------------------------MARNEN-VQGELKEKMVDLRRVA
gi22749917      -------------------------------------MANFEK-QDDGFKERVVFINRVA
gi16983045      -------------------------------------MGRIDA-SKMEISEKVVFINRCA
gi21966650      -------------------------------------MAKIDA-SKLELTEKVVHIARVA
gi89893234      -------------------------------------MAKIDA-SKLELTEKVVHIARVA
gi22517565      -------------------------------------MDKFDP-NKVELTEKVVKINRVA
gi12597540      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi25600531      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi28141936      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi25851365      -------------------------------------MAAIDP-NKLELSEKIVYINRVA
gi12153465      -------------------------------------MARIDY-SNLDLKEKVVFINRVA
gi16762948      -------------------------------------MARIDA-SGLELQEKVVYINRVA
gi13429811      -------------------------------------MARIDA-SKLELTEKVVYINRVA
                                                                  * :: : * :

g.p.gi|888      KVVKGGRQFGFTALTVVGDGQGSVGFGYGKAREVPLAIQKAMEKARKSMRKAHLN-GATL
g.p.gi|712      KVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKAHRNIVTIDLK-GTTL
gi21672753      KTVKGGRIFSFTALTVVGNGEGRVGFGYGKAREVPAAIQKAMEKARRNMVTIPLV-NKTL
h.G.Gram+g      KVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIAIKKGVEDAKKNMFSVPLTAEKTL
h.G.Gram+       KVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEEARKGFFRVPMI-GSTI
r.s.GOS_11      KVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKKDIHQIPMA-GSTI
gi16777125      KTVKGGRIFKFAALVVVGDGNGTVGFGLGKAGEVPDAIRKGIEDAKKNLHKIALK-GTTI
gi11456782      KVVKGGRRFSFSALVVVGDGEGKVGTGKGKATEVPEAIRKAIENAKKNMLSVPLIDGRTI
gi51894193      KTVKGGRRMSFSAVVVVGDGNGRVGAGLGKAAEIPEAVRKGTEDAKKHMIKIPLN-GTTI
gi22749917      KVVKGGRRFSFSALVVVGDENGKVGMGMGKAAEVPEAIRKGVEDAKKNLITVPMK-GSTI
gi16983045      KVVKGGRRFSFSALVVVGDGAGHVGFGLGKATEVPEAIRKGIEDGKKNLIQVPLA-GTTI
gi21966650      KVVKGGRRFSFSALVVVGDGHGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLI-GTTI
gi89893234      KVVKGGRRFSFSALVVVGDGQGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLI-GTTI
gi22517565      KVVKGGRRFSFSALVAVGDGNGHVGTGMGKAGEVPEAIRKAIEDAKKNMIEVPLV-GTTI
gi12597540      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi25600531      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi28141936      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi25851365      KVVKGGRRFSFSALVVVGDGNGHVGAGLGKAGEVPEAIRKGIEDAKKHLIRIPLS-GTTI
gi12153465      KVVKGGRRFSFSALVVVGDGNGYVGAGLGKAAEVPEAIRKGVEDAKKNLIKVPIV-GTTI
gi16762948      KVVKGGRRFSFSALVVVGDGKGHVGFGLGKAGEVPEAIRKGVEDAKKNLIVVPVV-GTTI
gi13429811      KVVKGGRRFSFSALVVVGDGNGHVGAGLGKAAEVPEAIRKGIEDAKKNMIKVPLN-GTTI
                *.***** : ::*:. **:  * .* * **. *:* *:.*. *.... :    :    *:

g.p.gi|888      QYPVTANHGASKVFMQPASEGTGIIAGGAMRAVFEVVGVQDVLAKTIGSRNPVNVVRATI
g.p.gi|712      QHVITGKHSGSKVFMKPASEGTGIIAGGAMRAVLEVAGVQNVLSKAYGSTNPINVVRATV
gi21672753      QHSLKGSHTGSNIFMKPASDGTGIIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATM
h.G.Gram+g      PHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELAGVTDCFAKSLGTDNVMNVVKATA
h.G.Gram+       THPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGIHDILAKSLGSDNAINVVHATV
r.s.GOS_11      VHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL-----------------
gi16777125      PHEIIGAYGAGRVLMKPAPEGTGVIAGGPVRAVLETAGIKDIRTKCLRSNNPCNVVSATI
gi11456782      PHEILGIFGAGQVLLKPASEGTGVIAGGPVRAVLEAAGIKDILTKSLGSDNATNIVHATM
gi51894193      PHEVIGRFGAGKVLLKPASPGTGVIAGGAVRAVLEAAGVRDILTKSLGSNNAANQVLATL
gi22749917      PHEIIGIFGAGRVLLKPAAPGTGVIAGGPVRAVLELAGVKDILTKSQGTSNPNNVVRATL
gi16983045      THEVLGRYGAGKVLLRPASPGTGVIAGGPVRAVLELAGVRDILTKSLGSNNANNMVRATI
gi21966650      PHAILGNYGAGSVLLKPAAKGTGVIAGGAVRAVLEVAGVSDILTKSLGSANPHNMVNATM
gi89893234      PHAILGNYGAGSVLLKPATKGTGVIAGGAVRAVLEAAGVSDILTKSLGSANPHNMVNATM
gi22517565      PHTVTGVYGAGRVLLKPASEGTGVIAGGPVRAVLELAGVRDILTKSLGSANAINVVNATM
gi12597540      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi25600531      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi28141936      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi25851365      PHEVIGRFGAGRVLLKPASAGTGVIAGGPVRAILELGGVRDILTKSLGSNNANNMVHATM
gi12153465      PHEVIGEFGAGKVLLKPASEGTGVIAGGPVRAVLELAGIHDILTKSLGSSNANNMVRATI
gi16762948      PHPALGVFGAGRVLLKPASKGTGVIAGGPVRAVLELAGIHDILTKSLGSNNANNMVRATM
gi13429811      THQIQGRFGAGKVLMKPAAKGTGVIAGGPVRAILELAGVRDILTKSLGTNNANNMVNATM
                 :   .   .. :::.**  ***:****. * :::  *: :                   

g.p.gi|888      KALACSSAPEQVAAKRGKQVEEIL--S-------------
g.p.gi|712      SALVNMHSPEGMAAKRGKRVDEIL--G-------------
gi21672753      NGLTNMKSPEMIAAKRNKLIEDIL--G-------------
h.G.Gram+g      EGLKSMESPEQVSERRGMSVSKIY--GWKEKN--------
h.G.Gram+       AALKQLQRPEEVAARRGLPLEDVAPAGMLRARAQAAGGAR
r.s.GOS_11      ----------------------------------------
gi16777125      QGLCALRDAEKVAAIRGKSVKDII--G-------------
gi11456782      EGLRSLKRVEDVARQRGKTIDEIM--N-------------
gi51894193      AGLRQLKSAEEVAKLRGKPVEQIL--G-------------
gi22749917      EGLKLLKNAADVAALRGKTVEELL--G-------------
gi16983045      DALKQLKTRDEVARNRGKDVKELRTGG-------------
gi21966650      AALKSLKRAEDVARLRGKTVEEIL--G-------------
gi89893234      AALKSLKRAEDVAKLRGKTVEEIL--G-------------
gi22517565      EGLTSLKRAEEVAKLRGKTVEELL--G-------------
gi12597540      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi25600531      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi28141936      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi25851365      AAIESLKTPEEVARSRGKTLEELL--S-------------
gi12153465      EGLKQLKRAEDVAALRGKTVQELL--G-------------
gi16762948      EGLRSLKRAEEVAKLRGKTVEEIT--G-------------
gi13429811      EGLKQLKTPEEVARLRGKTVEELL--G-------------
                                                        

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 21
Alignment assumed to be: Protein
New number of positions: 110 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
g.p._gi|8881274  -------------------------------------MATSGEASGEGLREKLISINRVA
g.p._gi|7127817  ----------------------------------MANHNQENS-QQSDMAEKLIAVNRVS
gi21672753       -------------------------------------MANIEKKNNSELQEKLITVNRVS
h.G.Gram+gi|257  ----------------------------------MARNKQDNA-AVPELQERVVYINRVS
h.G.Gram+]gi|54  MPGRQRRDGGNGPAGQNSNGPEGRDNRRGGGDRRGGGDRRDNA-AEKNQLERVVAINRVS
r.s.GOS_1170010  ------------------------------------------M-VESELQESVIHINRVA
gi167771250      ------------------------MKADSNSEEGGILLALIDA-ANLELKERVVSINRVS
gi114567824      -------------------------------------MIDKEQ-AAPEMIEKVVTIRRVA
gi51894193       -------------------------------------MARNEN-VQGELKEKMVDLRRVA
gi227499178      -------------------------------------MANFEK-QDDGFKERVVFINRVA
gi169830453      -------------------------------------MGRIDA-SKMEISEKVVFINRCA
gi219666507      -------------------------------------MAKIDA-SKLELTEKVVHIARVA
gi89893234       -------------------------------------MAKIDA-SKLELTEKVVHIARVA
gi225175657      -------------------------------------MDKFDP-NKVELTEKVVKINRVA
gi125975401      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi256005312      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi281419363      -------------------------------------MQRIDA-SVLDLKEKVVNIGRVT
gi258513657      -------------------------------------MAAIDP-NKLELSEKIVYINRVA
gi121534651      -------------------------------------MARIDY-SNLDLKEKVVFINRVA
gi167629484      -------------------------------------MARIDA-SGLELQEKVVYINRVA
gi134298110      -------------------------------------MARIDA-SKLELTEKVVYINRVA
                                                                   ##########


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
g.p._gi|8881274  KVVKGGRQFGFTALTVVGDGQGSVGFGYGKAREVPLAIQKAMEKARKSMRKAHLN-GATL
g.p._gi|7127817  KVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKAHRNIVTIDLK-GTTL
gi21672753       KTVKGGRIFSFTALTVVGNGEGRVGFGYGKAREVPAAIQKAMEKARRNMVTIPLV-NKTL
h.G.Gram+gi|257  KVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIAIKKGVEDAKKNMFSVPLTAEKTL
h.G.Gram+]gi|54  KVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEEARKGFFRVPMI-GSTI
r.s.GOS_1170010  KVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKKDIHQIPMA-GSTI
gi167771250      KTVKGGRIFKFAALVVVGDGNGTVGFGLGKAGEVPDAIRKGIEDAKKNLHKIALK-GTTI
gi114567824      KVVKGGRRFSFSALVVVGDGEGKVGTGKGKATEVPEAIRKAIENAKKNMLSVPLIDGRTI
gi51894193       KTVKGGRRMSFSAVVVVGDGNGRVGAGLGKAAEIPEAVRKGTEDAKKHMIKIPLN-GTTI
gi227499178      KVVKGGRRFSFSALVVVGDENGKVGMGMGKAAEVPEAIRKGVEDAKKNLITVPMK-GSTI
gi169830453      KVVKGGRRFSFSALVVVGDGAGHVGFGLGKATEVPEAIRKGIEDGKKNLIQVPLA-GTTI
gi219666507      KVVKGGRRFSFSALVVVGDGHGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLI-GTTI
gi89893234       KVVKGGRRFSFSALVVVGDGQGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLI-GTTI
gi225175657      KVVKGGRRFSFSALVAVGDGNGHVGTGMGKAGEVPEAIRKAIEDAKKNMIEVPLV-GTTI
gi125975401      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi256005312      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi281419363      KVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIV-NTTI
gi258513657      KVVKGGRRFSFSALVVVGDGNGHVGAGLGKAGEVPEAIRKGIEDAKKHLIRIPLS-GTTI
gi121534651      KVVKGGRRFSFSALVVVGDGNGYVGAGLGKAAEVPEAIRKGVEDAKKNLIKVPIV-GTTI
gi167629484      KVVKGGRRFSFSALVVVGDGKGHVGFGLGKAGEVPEAIRKGVEDAKKNLIVVPVV-GTTI
gi134298110      KVVKGGRRFSFSALVVVGDGNGHVGAGLGKAAEVPEAIRKGIEDAKKNMIKVPLN-GTTI
                 ######################################################  ####


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
g.p._gi|8881274  QYPVTANHGASKVFMQPASEGTGIIAGGAMRAVFEVVGVQDVLAKTIGSRNPVNVVRATI
g.p._gi|7127817  QHVITGKHSGSKVFMKPASEGTGIIAGGAMRAVLEVAGVQNVLSKAYGSTNPINVVRATV
gi21672753       QHSLKGSHTGSNIFMKPASDGTGIIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATM
h.G.Gram+gi|257  PHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELAGVTDCFAKSLGTDNVMNVVKATA
h.G.Gram+]gi|54  THPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGIHDILAKSLGSDNAINVVHATV
r.s.GOS_1170010  VHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL-----------------
gi167771250      PHEIIGAYGAGRVLMKPAPEGTGVIAGGPVRAVLETAGIKDIRTKCLRSNNPCNVVSATI
gi114567824      PHEILGIFGAGQVLLKPASEGTGVIAGGPVRAVLEAAGIKDILTKSLGSDNATNIVHATM
gi51894193       PHEVIGRFGAGKVLLKPASPGTGVIAGGAVRAVLEAAGVRDILTKSLGSNNAANQVLATL
gi227499178      PHEIIGIFGAGRVLLKPAAPGTGVIAGGPVRAVLELAGVKDILTKSQGTSNPNNVVRATL
gi169830453      THEVLGRYGAGKVLLRPASPGTGVIAGGPVRAVLELAGVRDILTKSLGSNNANNMVRATI
gi219666507      PHAILGNYGAGSVLLKPAAKGTGVIAGGAVRAVLEVAGVSDILTKSLGSANPHNMVNATM
gi89893234       PHAILGNYGAGSVLLKPATKGTGVIAGGAVRAVLEAAGVSDILTKSLGSANPHNMVNATM
gi225175657      PHTVTGVYGAGRVLLKPASEGTGVIAGGPVRAVLELAGVRDILTKSLGSANAINVVNATM
gi125975401      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi256005312      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi281419363      PHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGIKDIRTKSLGSNNPINMVHATI
gi258513657      PHEVIGRFGAGRVLLKPASAGTGVIAGGPVRAILELGGVRDILTKSLGSNNANNMVHATM
gi121534651      PHEVIGEFGAGKVLLKPASEGTGVIAGGPVRAVLELAGIHDILTKSLGSSNANNMVRATI
gi167629484      PHPALGVFGAGRVLLKPASKGTGVIAGGPVRAVLELAGIHDILTKSLGSNNANNMVRATM
gi134298110      THQIQGRFGAGKVLMKPAAKGTGVIAGGPVRAILELAGVRDILTKSLGTNNANNMVNATM
                 ##########################################                  


                        190       200       210       220
                 =========+=========+=========+=========+
g.p._gi|8881274  KALACSSAPEQVAAKRGKQVEEIL--S-------------
g.p._gi|7127817  SALVNMHSPEGMAAKRGKRVDEIL--G-------------
gi21672753       NGLTNMKSPEMIAAKRNKLIEDIL--G-------------
h.G.Gram+gi|257  EGLKSMESPEQVSERRGMSVSKIY--GWKEKN--------
h.G.Gram+]gi|54  AALKQLQRPEEVAARRGLPLEDVAPAGMLRARAQAAGGAR
r.s.GOS_1170010  ----------------------------------------
gi167771250      QGLCALRDAEKVAAIRGKSVKDII--G-------------
gi114567824      EGLRSLKRVEDVARQRGKTIDEIM--N-------------
gi51894193       AGLRQLKSAEEVAKLRGKPVEQIL--G-------------
gi227499178      EGLKLLKNAADVAALRGKTVEELL--G-------------
gi169830453      DALKQLKTRDEVARNRGKDVKELRTGG-------------
gi219666507      AALKSLKRAEDVARLRGKTVEEIL--G-------------
gi89893234       AALKSLKRAEDVAKLRGKTVEEIL--G-------------
gi225175657      EGLTSLKRAEEVAKLRGKTVEELL--G-------------
gi125975401      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi256005312      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi281419363      EGLSRLKTAEEVAKLRNKTVEEIL--G-------------
gi258513657      AAIESLKTPEEVARSRGKTLEELL--S-------------
gi121534651      EGLKQLKRAEDVAALRGKTVQELL--G-------------
gi167629484      EGLRSLKRAEEVAKLRGKTVEEIT--G-------------
gi134298110      EGLKQLKTPEEVARLRGKTVEELL--G-------------
                                                         





Parameters used
Minimum Number Of Sequences For A Conserved Position: 11
Minimum Number Of Sequences For A Flanking Position: 18
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 2 selected block(s)
Flanks: [51  114]  [117  162]  

New number of positions in input.fasta-gb:  110  (50% of the original 220 positions)





Protein Domains

PROTOCOL

a)InterProScan / default parameters at EMBL-EBI

b)Pfam / default parameters



RESULTS ANALYSIS


A protein domain is a part of protein sequence and structure that can evolve, function, and exist independently of the rest of the protein chain.


with Interproscan i found 2 domain in my ORF with very good e-value and that is Ribosomal_S5 $Ribosomal_S5_C and Some members of this family are thought to possess RNA binding domain towards their N terminus$ other is structural constituent of ribosome respectively


I found similar results with pfam also with very high e-value so its confirmed that my ORF contain this domains Ribosomal_S5 $Ribosomal_S5_C.

as with both pfam and interproscan i go same domain so this is strong evidence that ORF is coding.

RAW RESULTS


Sequence_1	296005D1AB744D93	118	PatternScan	PS00585	RIBOSOMAL_S5	22	54	NA	T	09-Jan-2010	IPR018192	Ribosomal protein S5, N-terminal, conserved site	
Sequence_1	296005D1AB744D93	118	ProfileScan	PS50881	S5_DSRBD	5	68	23.201	T	09-Jan-2010	IPR013810	Ribosomal protein S5, N-terminal	Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)
Sequence_1	296005D1AB744D93	118	superfamily	SSF54768	dsRNA-binding domain-like	4	72	9.5e-22	T	09-Jan-2010	NULL	NULL	
Sequence_1	296005D1AB744D93	118	superfamily	SSF54211	Ribosomal protein S5 domain 2-like	73	118	6.2e-14	T	09-Jan-2010	IPR020568	Ribosomal protein S5 domain 2-type fold	
Sequence_1	296005D1AB744D93	118	HMMPanther	PTHR13718	RIBOSOMAL S SUBUNIT	2	118	1.8e-45	T	09-Jan-2010	IPR000851	Ribosomal protein S5	Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)
Sequence_1	296005D1AB744D93	118	HMMPfam	PF00333	Ribosomal_S5	4	70	1.5e-30	T	09-Jan-2010	IPR013810	Ribosomal protein S5, N-terminal	Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)
Sequence_1	296005D1AB744D93	118	HMMPfam	PF03719	Ribosomal_S5_C	79	118	3.1e-21	T	09-Jan-2010	IPR005324	Ribosomal protein S5, C-terminal	Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)
Sequence_1	296005D1AB744D93	118	Gene3D	G3DSA:3.30.160.20	no description	1	67	1.2e-18	T	09-Jan-2010	IPR014720	Double-stranded RNA-binding-like	Molecular Function: RNA binding (GO:0003723), Cellular Component: intracellular (GO:0005622)
Sequence_1	296005D1AB744D93	118	Gene3D	G3DSA:3.30.230.10	no description	68	118	1.9e-12	T	09-Jan-2010	IPR014721	Ribosomal protein S5 domain 2-type fold, subgroup	


P-fam Results:

Ribosomal_S5: domain 1 of 1, from 5 to 71: score 111.7, E = 2.3e-30
                   *->dLeekVldinrVsKvtkgGRrfrFrAlVVVGDknGhVGlGiGKAkEV
                      +L+e V+ inrV+Kv+kgGR f F+AlV+VGD+nG  G G+GK +EV
       query     5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEV 51   

                   peAIrKAiedAKknlieVpr<-*
                   p AI+KAie AKk +  +p    
       query    52 PLAIQKAIENAKKDIHQIPM    71   

Ribosomal_S5_C: domain 1 of 1, from 80 to 119: score 24.9, E = 1.5e-05
                   *->vdGkcgsveVlLrPAprGtGivAGgvvravLElAGvkDiltksyGkS
                      ++G++gs++VlL+PA++GtGi+AGg++r+vL++AG+kDil       
       query    80    ITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL------- 119  

                   rnpiNfvkATfdALkklksaldvpalrg<-*
                                                  
       query

Phylogeny

PROTOCOL

Phylogeny.fr / PhyML method / bootstrap / default substitution model / out group: high_GC_Gram+,g-protobacteria and enterobacteria



RESULTS ANALYSIS


The tree obtained showed an anomalous classification of in-groups and out-groups.

The metagenomic sequence is a close relative of g-proteobacteria (out group)

RAW RESULTS

                                                                           -------0.2------
 
                                     +----g-proteobacteria_gi_71278175_ref_YP_267368.1_ribosomal_protein_S
                            +--------+
                            |        +------------enterobacteriagi_21672753_ref_NP_660820.1_30S_ribosomal_protein
        +-------------------+
        |                   +--------------g-proteobacteria_gi_88812740_ref_ZP_01127986.1_Ribosomal_protein
 +------+
 |      +-----------------raw_sequence_GOS_1170010_Translation_565-921_direct_strand
 |
 |
 |   +--------------------high_GC_Gram+_gi_54022758_ref_YP_117000.1_30S_ribosomal_protein
 |   |
 +---+      +----------------high_GC_Gram+gi_257791907_ref_YP_003182513.1_ribosomal_protein_S
     |      |
     +------+      +--------------------firmicutesgi_167771250_ref_ZP_02443303.1_hypothetical_protein_AN
            |      |
            |      |  +-------firmicutesgi_227499178_ref_ZP_03929313.1_30S_ribosomal_protein_S
            +------+  |
                   |  |              +firmicutesgi_125975401_ref_YP_001039311.1_SSU_ribosomal_protein
                   |  |              |
                   +--+              |firmicutesgi_256005312_ref_ZP_05430278.1_ribosomal_protein_S5_Cl
                      |    +---------+
                      |    |         +firmicutesgi_281419363_ref_ZP_06250378.1_ribosomal_protein_S5_Cl
                      |    |
                      +----+
                           |+----firmicutesgi_121534651_ref_ZP_01666472.1_ribosomal_protein_S5_Th
                           ||
                           ||    +------------firmicutesgi_51894193_ref_YP_076884.1_30S_ribosomal_protein_S5_S
                           ++  +-+
                            |  | +-----firmicutesgi_258513657_ref_YP_003189879.1_ribosomal_protein_S5_D
                            |  |
                            +--+---------firmicutesgi_169830453_ref_YP_001716435.1_ribosomal_protein_S5_C
                               |
                               | +-----firmicutesgi_134298110_ref_YP_001111606.1_30S_ribosomal_protein
                               | |
                               | |               +firmicutesgi_219666507_ref_YP_002456942.1_ribosomal_protein_S5_D
                               +-+ +-------------+
                                 | |             |
                                 | |             +--firmicutesgi_89893234_ref_YP_516721.1_30S_ribosomal_protein_S5_D
                                 +-+
                                   |    +---------------firmicutesgi_114567824_ref_YP_754978.1_ribosomal_protein_S5_Synt
                                   |+---+
                                   ++   +-----firmicutesgi_225175657_ref_ZP_03729651.1_ribosomal_protein_S5_De
                                    |
                                    +---------firmicutesgi_167629484_ref_YP_001679983.1_30S_ribosomal_protein

Taxonomy report

PROTOCOL


1) BLASTp vs SWISSPROT/ NCBI default parameters

2) BLASTp versus NR / NCBI default parameters apart from "Max target sequences_1000"



RESULTS ANALYSIS:


Score E

Sequences producing significant alignments: (Bits) Value



ingroups:(firmicutes)


ref|ZP_03729651.1| ribosomal protein S5 [Dethiobacter alkalip... 154 2e-36

ref|YP_754978.1| ribosomal protein S5 [Syntrophomonas wolfei ... 137 5e-31 Gene info

ref|YP_001111606.1| 30S ribosomal protein S5 [Desulfotomaculu... 147 4e-34 Gene info

ref|YP_001716435.1| ribosomal protein S5 [Candidatus Desulfor... 149 6e-35 Gene info

ref|ZP_01666472.1| ribosomal protein S5 [Thermosinus carboxyd... 146 5e-34

ref|ZP_03929313.1| 30S ribosomal protein S5 [Acidaminococcus ... 146 8e-34

ref|YP_003189879.1| ribosomal protein S5 [Desulfotomaculum ac... 143 5e-33 Gene info

ref|YP_002456942.1| ribosomal protein S5 [Desulfitobacterium ... 143 6e-33 Gene info

ref|YP_516721.1| 30S ribosomal protein S5 [Desulfitobacterium... 142 2e-32 Gene info

ref|ZP_02443303.1| hypothetical protein ANACOL_02608 [Anaerot... 141 2e-32

ref|YP_001039311.1| SSU ribosomal protein S5P [Clostridium th... 141 2e-32 Gene info

ref|YP_001679983.1| 30S ribosomal protein s5 [Heliobacterium ... 140 3e-32 Gene info

ref|YP_076884.1| 30S ribosomal protein S5 [Symbiobacterium th... 141 3e-32 Gene info


outgroups:(high_GC_Gram+,g-proteobacteria,enterobacteria)

ref|YP_003182513.1| ribosomal protein S5 [Eggerthella lenta D... 149 8e-35

ref|YP_117000.1| 30S ribosomal protein S5 [Nocardia farcinica... 149 8e-35 Gene info

ref|ZP_01127986.1| Ribosomal protein S5 [Nitrococcus mobilis ... 145 1e-33

ref|YP_267368.1| ribosomal protein S5 [Colwellia psychrerythr... 147 5e-34 Gene info

ref|NP_660820.1| 30S ribosomal protein S5 [Buchnera aphidicol... 140 3e-32 Gene info





result is:
Lineage Report

root
. Bacteria            [bacteria]
. . Firmicutes          [firmicutes]
. . . Clostridia          [firmicutes]
. . . . Clostridiales       [firmicutes]
. . . . . Syntrophomonadaceae [firmicutes]
. . . . . . Dethiobacter alkaliphilus AHT 1 ----------------------------------  154  2 hits [firmicutes]             ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1] >gi|
. . . . . . Syntrophomonas wolfei subsp. wolfei str. Goettingen ..............  137  3 hits [firmicutes]             ribosomal protein S5 [Syntrophomonas wolfei subsp. wolfei s
. . . . . Candidatus Desulforudis audaxviator MP104C -------------------------  149  2 hits [firmicutes]             ribosomal protein S5 [Candidatus Desulforudis audaxviator M
. . . . . Pelotomaculum thermopropionicum SI .................................  148  3 hits [firmicutes]             30S ribosomal protein S5 [Pelotomaculum thermopropionicum S
. . . . . Desulfotomaculum reducens MI-1 .....................................  147  3 hits [firmicutes]             30S ribosomal protein S5 [Desulfotomaculum reducens MI-1] >
. . . . . Thermosinus carboxydivorans Nor1 ...................................  146  2 hits [firmicutes]             ribosomal protein S5 [Thermosinus carboxydivorans Nor1] >gi
. . . . . Acidaminococcus sp. D21 ............................................  146  2 hits [firmicutes]             30S ribosomal protein S5 [Acidaminococcus sp. D21] >gi|2269
. . . . . Desulfotomaculum acetoxidans DSM 771 ...............................  143  2 hits [firmicutes]             ribosomal protein S5 [Desulfotomaculum acetoxidans DSM 771]
. . . . . Desulfitobacterium hafniense DCB-2 .................................  143  3 hits [firmicutes]             ribosomal protein S5 [Desulfitobacterium hafniense DCB-2] >
. . . . . Desulfitobacterium hafniense Y51 ...................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Desulfitobacterium hafniense Y51]
. . . . . Anaerotruncus colihominis DSM 17241 ................................  141  2 hits [firmicutes]             hypothetical protein ANACOL_02608 [Anaerotruncus colihomini
. . . . . Clostridium thermocellum ATCC 27405 ................................  141  3 hits [firmicutes]             SSU ribosomal protein S5P [Clostridium thermocellum ATCC 27
. . . . . Clostridium thermocellum DSM 2360 ..................................  141  2 hits [firmicutes]             SSU ribosomal protein S5P [Clostridium thermocellum ATCC 27
. . . . . Clostridium thermocellum JW20 ......................................  141  2 hits [firmicutes]             SSU ribosomal protein S5P [Clostridium thermocellum ATCC 27
. . . . . Symbiobacterium thermophilum IAM 14863 .............................  141  2 hits [firmicutes]             30S ribosomal protein S5 [Symbiobacterium thermophilum IAM 
. . . . . Symbiobacterium thermophilum .......................................  141  1 hit  [firmicutes]             30S ribosomal protein S5 [Symbiobacterium thermophilum IAM 
. . . . . Heliobacterium modesticaldum Ice1 ..................................  140  3 hits [firmicutes]             30S ribosomal protein s5 [Heliobacterium modesticaldum Ice1
. . . . . Clostridium cellulovorans 743B .....................................  139  2 hits [firmicutes]             ribosomal protein S5 [Clostridium cellulovorans 743B] >gi|2
. . . . . Clostridium hiranonis DSM 13275 ....................................  139  2 hits [firmicutes]             hypothetical protein CLOHIR_01594 [Clostridium hiranonis DS
. . . . . Finegoldia magna ATCC 53516 ........................................  138  2 hits [firmicutes]             ribosomal protein S5 [Finegoldia magna ATCC 53516] >gi|2278
. . . . . Finegoldia magna ATCC 29328 ........................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Finegoldia magna ATCC 29328] >gi|
. . . . . Clostridium methylpentosum DSM 5476 ................................  138  2 hits [firmicutes]             hypothetical protein CLOSTMETH_00171 [Clostridium methylpen
. . . . . Clostridium acetobutylicum ATCC 824 ................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium acetobutylicum ATCC 8
. . . . . Clostridium acetobutylicum .........................................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium acetobutylicum ATCC 8
. . . . . Clostridium carboxidivorans P7 .....................................  136  2 hits [firmicutes]             ribosomal protein S5 [Clostridium carboxidivorans P7] >gi|2
. . . . . Clostridium kluyveri DSM 555 .......................................  136  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium kluyveri DSM 555] >gi
. . . . . Clostridium kluyveri NBRC 12016 ....................................  136  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium kluyveri DSM 555] >gi
. . . . . Clostridium bartlettii DSM 16795 ...................................  136  2 hits [firmicutes]             hypothetical protein CLOBAR_00111 [Clostridium bartlettii D
. . . . . Anaerocellum thermophilum DSM 6725 .................................  136  3 hits [firmicutes]             ribosomal protein S5 [Anaerocellum thermophilum DSM 6725] >
. . . . . Veillonella dispar ATCC 17748 ......................................  135  2 hits [firmicutes]             hypothetical protein VEIDISOL_00475 [Veillonella dispar ATC
. . . . . Veillonella parvula DSM 2008 .......................................  135  2 hits [firmicutes]             hypothetical protein VEIDISOL_00475 [Veillonella dispar ATC
. . . . . Veillonella parvula ATCC 17745 .....................................  135  2 hits [firmicutes]             hypothetical protein VEIDISOL_00475 [Veillonella dispar ATC
. . . . . Selenomonas sputigena ATCC 35185 ...................................  135  2 hits [firmicutes]             ribosomal protein S5 [Selenomonas sputigena ATCC 35185] >gi
. . . . . Clostridium botulinum D str. 1873 ..................................  135  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum D str. 1873] >g
. . . . . Ruminococcus flavefaciens FD-1 .....................................  135  1 hit  [firmicutes]             30S ribosomal protein S5 [Ruminococcus flavefaciens FD-1]
. . . . . Clostridium beijerinckii NCIMB 8052 ................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium beijerinckii NCIMB 80
. . . . . Clostridium botulinum B str. Eklund 17B ............................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium botulinum B str. Eklu
. . . . . Clostridium botulinum E3 str. Alaska E43 ...........................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium botulinum B str. Eklu
. . . . . Clostridium botulinum E1 str. 'BoNT E Beluga' ......................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium botulinum B str. Eklu
. . . . . Parvimonas micra ATCC 33270 ........................................  135  2 hits [firmicutes]             hypothetical protein PEPMIC_01618 [Parvimonas micra ATCC 33
. . . . . Clostridium butyricum 5521 .........................................  134  2 hits [firmicutes]             ribosomal protein S5 [Clostridium butyricum 5521] >gi|23766
. . . . . Clostridium butyricum E4 str. BoNT E BL5262 ........................  134  2 hits [firmicutes]             ribosomal protein S5 [Clostridium butyricum 5521] >gi|23766
. . . . . Anaerofustis stercorihominis DSM 17244 .............................  134  2 hits [firmicutes]             hypothetical protein ANASTE_02066 [Anaerofustis stercorihom
. . . . . Clostridium botulinum C str. Eklund ................................  134  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum C str. Eklund] 
. . . . . Clostridium novyi NT ...............................................  134  3 hits [firmicutes]             30S ribosomal protein S5 [Clostridium novyi NT] >gi|1714608
. . . . . Clostridium papyrosolvens DSM 2782 .................................  134  2 hits [firmicutes]             ribosomal protein S5 [Clostridium papyrosolvens DSM 2782] >
. . . . . Clostridium sp. 7_2_43FAA ..........................................  133  2 hits [firmicutes]             ribosomal protein S5 [Clostridium sp. 7_2_43FAA] >gi|226911
. . . . . Clostridium cellulolyticum H10 .....................................  133  2 hits [firmicutes]             ribosomal protein S5 [Clostridium cellulolyticum H10] >gi|2
. . . . . Clostridium difficile 630 ..........................................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-32g58 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-66c26 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile CIP 107932 ...................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-63q42 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile ATCC 43255 ...................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-76w55 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-97b34 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-37x79 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile QCD-23m63 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile CD196 ........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium difficile R20291 .......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium difficile 630] >gi|14
. . . . . Clostridium leptum DSM 753 .........................................  132  2 hits [firmicutes]             hypothetical protein CLOLEP_01019 [Clostridium leptum DSM 7
. . . . . Clostridium perfringens str. 13 ....................................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens ATCC 13124 .................................  130  3 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens SM101 ......................................  130  3 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens E str. JGS1987 .............................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens B str. ATCC 3626 ...........................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens CPE str. F4969 .............................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens NCTC 8239 ..................................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens C str. JGS1495 .............................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens D str. JGS1721 .............................  130  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Clostridium perfringens ............................................  130  1 hit  [firmicutes]             30S ribosomal protein S5 [Clostridium perfringens str. 13] 
. . . . . Peptoniphilus lacrimalis 315-B .....................................  130  2 hits [firmicutes]             ribosomal protein S5 [Peptoniphilus lacrimalis 315-B] >gi|2
. . . . . Mitsuokella multacida DSM 20544 ....................................  130  2 hits [firmicutes]             ribosomal protein S5 [Mitsuokella multacida DSM 20544] >gi|
. . . . . Anaerococcus tetradius ATCC 35098 ..................................  129  2 hits [firmicutes]             ribosomal protein S5 [Anaerococcus tetradius ATCC 35098] >g
. . . . . Anaerococcus prevotii DSM 20548 ....................................  129  2 hits [firmicutes]             ribosomal protein S5 [Anaerococcus prevotii DSM 20548] >gi|
. . . . . Alkaliphilus oremlandii OhILAs .....................................  128  3 hits [firmicutes]             ribosomal protein S5 [Alkaliphilus oremlandii OhILAs] >gi|1
. . . . . Clostridium botulinum A str. ATCC 3502 .............................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum A str. ATCC 19397 ............................  128  3 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum A str. Hall ..................................  128  3 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum F str. Langeland .............................  128  3 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum NCTC 2916 ....................................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum Bf ...........................................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium sporogenes ATCC 15579 ..................................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum A2 str. Kyoto ................................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum Ba4 str. 657 .................................  128  2 hits [firmicutes]             ribosomal protein S5 [Clostridium botulinum A str. ATCC 350
. . . . . Clostridium botulinum B1 str. Okra .................................  128  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium botulinum B1 str. Okr
. . . . . Clostridium botulinum A3 str. Loch Maree ...........................  128  2 hits [firmicutes]             30S ribosomal protein S5 [Clostridium botulinum B1 str. Okr
. . . . . Dialister invisus DSM 15470 ........................................  128  2 hits [firmicutes]             ribosomal protein S5 [Dialister invisus DSM 15470] >gi|2604
. . . . . Selenomonas noxia ATCC 43541 .......................................  128  1 hit  [firmicutes]             30S ribosomal protein S5 [Selenomonas noxia ATCC 43541]
. . . . . Alkaliphilus metalliredigens QYMF ..................................  126  3 hits [firmicutes]             ribosomal protein S5 [Alkaliphilus metalliredigens QYMF] >g
. . . . . Selenomonas flueggei ATCC 43531 ....................................  126  2 hits [firmicutes]             30S ribosomal protein S5 [Selenomonas flueggei ATCC 43531] 
. . . . Moorella thermoacetica ATCC 39073 ------------------------------------  148  3 hits [firmicutes]             30S ribosomal protein S5 [Moorella thermoacetica ATCC 39073
. . . . Halothermothrix orenii H 168 .........................................  147  2 hits [firmicutes]             ribosomal protein S5 [Halothermothrix orenii H 168] >gi|219
. . . . Ammonifex degensii KC4 ...............................................  143  2 hits [firmicutes]             ribosomal protein S5 [Ammonifex degensii KC4] >gi|260865496
. . . . Carboxydothermus hydrogenoformans Z-2901 .............................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Carboxydothermus hydrogenoformans
. . . . Natranaerobius thermophilus JW/NM-WN-LF ..............................  138  3 hits [firmicutes]             SSU ribosomal protein S5P [Natranaerobius thermophilus JW/N
. . . . Thermoanaerobacter italicus Ab9 ......................................  136  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter italicus Ab9] >gi|
. . . . Thermoanaerobacter mathranii subsp. mathranii str. A3 ................  136  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter italicus Ab9] >gi|
. . . . Caldicellulosiruptor saccharolyticus DSM 8903 ........................  136  3 hits [firmicutes]             ribosomal protein S5 [Caldicellulosiruptor saccharolyticus 
. . . . Thermoanaerobacter pseudethanolicus ATCC 33223 .......................  134  3 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacter sp. X514 ..........................................  134  3 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacter brockii subsp. finnii Ako-1 .......................  134  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacter sp. X513 ..........................................  134  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacter sp. X561 ..........................................  134  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacter ethanolicus CCSD1 .................................  134  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter pseudethanolicus A
. . . . Thermoanaerobacterium thermosaccharolyticum DSM 571 ..................  132  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacterium thermosaccharol
. . . . Thermoanaerobacter tengcongensis MB4 .................................  131  2 hits [firmicutes]             ribosomal protein S5 [Thermoanaerobacter tengcongensis MB4]
. . . . Thermoanaerobacter tengcongensis .....................................  131  1 hit  [firmicutes]             ribosomal protein S5 [Thermoanaerobacter tengcongensis MB4]
. . . . Coprothermobacter proteolyticus DSM 5265 .............................  127  2 hits [firmicutes]             ribosomal protein S5 [Coprothermobacter proteolyticus DSM 5
. . . Paenibacillus larvae subsp. larvae BRL-230010 --------------------------  148  1 hit  [firmicutes]             30S ribosomal protein S5 [Paenibacillus larvae subsp. larva
. . . Bacillus sp. NRRL B-14911 ..............................................  145  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus sp. NRRL B-14911] >gi|89
. . . Geobacillus sp. Y412MC10 ...............................................  143  2 hits [firmicutes]             ribosomal protein S5 [Geobacillus sp. Y412MC10] >gi|2612859
. . . Bacillus coagulans 36D1 ................................................  143  2 hits [firmicutes]             ribosomal protein S5 [Bacillus coagulans 36D1] >gi|22932660
. . . Eubacterium dolichum DSM 3991 ..........................................  143  2 hits [firmicutes]             hypothetical protein EUBDOL_00549 [Eubacterium dolichum DSM
. . . Bacillus halodurans C-125 ..............................................  143  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus halodurans C-125] >gi|73
. . . Bacillus halodurans ....................................................  143  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus halodurans C-125] >gi|73
. . . Exiguobacterium sp. AT1b ...............................................  142  2 hits [firmicutes]             ribosomal protein S5 [Exiguobacterium sp. AT1b] >gi|2294687
. . . Bacillus mycoides DSM 2048 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus mycoides DSM 2048] >gi|2
. . . Bacillus cereus BDRD-ST196 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus mycoides DSM 2048] >gi|2
. . . Bacillus cereus AH621 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus mycoides DSM 2048] >gi|2
. . . Bacillus pseudomycoides DSM 12442 ......................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus pseudomycoides DSM 12442
. . . Bacillus mycoides Rock3-17 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus pseudomycoides DSM 12442
. . . Bacillus mycoides Rock1-4 ..............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus pseudomycoides DSM 12442
. . . Bacillus weihenstephanensis KBAB4 ......................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus weihenstephanensis KBAB4
. . . Bacillus cereus AH603 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus weihenstephanensis KBAB4
. . . Paenibacillus sp. JDR-2 ................................................  142  2 hits [firmicutes]             ribosomal protein S5 [Paenibacillus sp. JDR-2] >gi|24754725
. . . Bacillus cereus ATCC 14579 .............................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus cereus ATCC 14579] >gi|1
. . . Bacillus thuringiensis str. Al Hakam ...................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus cereus ATCC 14579] >gi|1
. . . Bacillus pumilus SAFR-032 ..............................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus pumilus SAFR-032] >gi|19
. . . Bacillus pumilus ATCC 7061 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus pumilus SAFR-032] >gi|19
. . . Bacillus licheniformis ATCC 14580 ......................................  142  5 hits [firmicutes]             30S ribosomal protein S5 [Bacillus licheniformis ATCC 14580
. . . Bacillus anthracis str. Ames ...........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus ATCC 10987 .............................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. 'Ames Ancestor' ................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus G9241 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. Sterne .........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ....................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus E33L ...................................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A2012 ..........................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A0465 ..........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A0389 ..........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A0174 ..........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis Tsiankovskii-I ......................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus W ......................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus NVH0597-99 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH1134 .................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH187 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus B4264 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus G9842 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH820 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Q1 .....................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus 03BB102 ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. CDC 684 ........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis IBL 4222 ........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis IBL 200 .........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ....................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ...............  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar berliner ATCC 10792 .....................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 .....................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 ...................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar pakistani str. T13001 ...................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar sotto str. T04001 .......................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 ...............  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis Bt407 ...........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ...................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH1273 .................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH1272 .................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH1271 .................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus AH676 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus F65185 .................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock4-18 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock4-2 ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock3-44 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock3-42 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock3-29 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock3-28 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock1-15 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus Rock1-3 ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus 95/8201 ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus BDRD-Cer4 ..............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus BDRD-ST26 ..............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus BDRD-ST24 ..............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus m1550 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus ATCC 4342 ..............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus R309803 ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus MM3 ....................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus 172560W ................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus BGSC 6E1 ...............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus ATCC 10876 .............................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus cereus m1293 ..................................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A0248 ..........................................  142  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. CNEVA-9066 .....................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. A1055 ..........................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. Western North America USA6153 ..................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. Kruger B .......................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. Vollum .........................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis str. Australia 94 ...................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus anthracis (anthrax) ...........................................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus thuringiensis serovar konkukian ...............................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus anthracis str. Ames] >gi
. . . Bacillus amyloliquefaciens FZB42 .......................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus amyloliquefaciens FZB42]
. . . Bacillus subtilis subsp. subtilis str. 168 .............................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 .......................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis
. . . Bacillus subtilis subsp. subtilis str. JH642 ...........................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis
. . . Bacillus subtilis subsp. subtilis str. SMY .............................  142  1 hit  [firmicutes]             30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis
. . . Bacillus subtilis ......................................................  142  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis
. . . Bacillus selenitireducens MLS10 ........................................  142  2 hits [firmicutes]             ribosomal RNA adenine methylase transferase [Bacillus selen
. . . Geobacillus sp. Y4.1MC1 ................................................  141  2 hits [firmicutes]             ribosomal protein S5 [Geobacillus sp. Y4.1MC1] >gi|25527712
. . . Geobacillus thermodenitrificans NG80-2 .................................  141  3 hits [firmicutes]             ribosomal protein S5 [Geobacillus thermodenitrificans NG80-
. . . Geobacillus sp. G11MC16 ................................................  141  2 hits [firmicutes]             ribosomal protein S5 [Geobacillus thermodenitrificans NG80-
. . . Bacillus sp. B14905 ....................................................  141  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus sp. B14905] >gi|16983001
. . . Lysinibacillus sphaericus C3-41 ........................................  141  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus sp. B14905] >gi|16983001
. . . Geobacillus sp. WCH70 ..................................................  141  3 hits [firmicutes]             ribosomal protein S5 [Geobacillus sp. WCH70] >gi|259495309|
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...........  141  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus saprophyticus subs
. . . Bacillus sp. SG-1 ......................................................  141  2 hits [firmicutes]             30S ribosomal protein S5 [Bacillus sp. SG-1] >gi|148848131|
. . . Staphylococcus capitis SK14 ............................................  140  2 hits [firmicutes]             ribosomal protein S5 [Staphylococcus capitis SK14] >gi|2224
. . . Anoxybacillus flavithermus WK1 .........................................  140  3 hits [firmicutes]             Ribosomal protein S5 [Anoxybacillus flavithermus WK1] >gi|2
. . . Paenibacillus sp. oral taxon 786 str. D14 ..............................  140  2 hits [firmicutes]             30S ribosomal protein S5 [Paenibacillus sp. oral taxon 786 
. . . Eubacterium biforme DSM 3989 ...........................................  140  2 hits [firmicutes]             hypothetical protein EUBIFOR_01035 [Eubacterium biforme DSM
. . . Bacillus clausii KSM-K16 ...............................................  140  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus clausii KSM-K16] >gi|739
. . . Geobacillus kaustophilus HTA426 ........................................  140  2 hits [firmicutes]             30S ribosomal protein S5 [Geobacillus kaustophilus HTA426] 
. . . Geobacillus sp. Y412MC52 ...............................................  140  2 hits [firmicutes]             30S ribosomal protein S5 [Geobacillus kaustophilus HTA426] 
. . . Geobacillus sp. Y412MC61 ...............................................  140  2 hits [firmicutes]             30S ribosomal protein S5 [Geobacillus kaustophilus HTA426] 
. . . Geobacillus kaustophilus ...............................................  140  1 hit  [firmicutes]             30S ribosomal protein S5 [Geobacillus kaustophilus HTA426] 
. . . Geobacillus stearothermophilus .........................................  140  4 hits [firmicutes]             RecName: Full=30S ribosomal protein S5; Short=BS5; AltName:
. . . Bacillus cytotoxicus NVH 391-98 ........................................  139  3 hits [firmicutes]             30S ribosomal protein S5 [Bacillus cereus subsp. cytotoxis 
. . . Staphylococcus carnosus subsp. carnosus TM300 ..........................  139  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus carnosus subsp. ca
. . . Staphylococcus epidermidis ATCC 12228 ..................................  139  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 1
. . . Staphylococcus epidermidis RP62A .......................................  139  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 1
. . . Staphylococcus epidermidis W23144 ......................................  139  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 1
. . . Staphylococcus epidermidis BCM-HMP0060 .................................  139  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 1
. . . Staphylococcus epidermidis SK135 .......................................  139  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 1
. . . Staphylococcus warneri L37603 ..........................................  139  2 hits [firmicutes]             ribosomal protein S5 [Staphylococcus warneri L37603] >gi|23
. . . Staphylococcus haemolyticus JCSC1435 ...................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus haemolyticus JCSC1
. . . Staphylococcus hominis SK119 ...........................................  138  2 hits [firmicutes]             ribosomal protein S5 [Staphylococcus hominis SK119] >gi|228
. . . Staphylococcus aureus subsp. aureus Mu50 ...............................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus N315 ...............................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus MW2 ................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus MRSA252 ............................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus MSSA476 ............................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus COL ................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus RF122 ............................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 .....................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ..........................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus JH9 ................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus JH1 ................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus Mu3 ................................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 .....................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus str. JKD6008 .......................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus str. JKD6009 .......................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus MN8 ................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus TCH60 ..............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus TCH70 ..............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 ......................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus TCH130 .............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus Mu50-omega .........................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus 55/2053 ............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus 65-1322 ............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus 68-397 .............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus E1410 ..............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus M876 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9781 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9763 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9719 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9635 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9299 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A8115 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A6300 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A6224 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A5948 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A5937 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus D30 ..............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus 930918-3 .........................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus ED98 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A8117 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus C160 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus Btn1260 ............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus WW2703/97 ..........................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus WBG10049 ...........................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus M899 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus D139 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus C427 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A9765 ............................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus C101 ...............................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus A10102 ...........................................  138  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus USA300 .............................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus TW20 ...............................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus H19 ................................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus ST398 ..............................  138  1 hit  [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Staphylococcus aureus subsp. aureus str. Newman ........................  138  3 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus aureus subsp. aure
. . . Brevibacillus brevis NBRC 100599 .......................................  137  2 hits [firmicutes]             30S ribosomal protein S5 [Brevibacillus brevis NBRC 100599]
. . . Macrococcus caseolyticus JCSC5402 ......................................  137  2 hits [firmicutes]             30S ribosomal protein S5 [Macrococcus caseolyticus JCSC5402
. . . Exiguobacterium sibiricum 255-15 .......................................  136  2 hits [firmicutes]             ribosomal protein S5 [Exiguobacterium sibiricum 255-15] >gi
. . . Staphylococcus epidermidis M23864:W1 ...................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Staphylococcus epidermidis M23864
. . . Streptococcus suis 05ZYH33 .............................................  135  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Streptococcus suis 98HAH33 .............................................  135  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Streptococcus suis 89/1591 .............................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Streptococcus suis SC84 ................................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Streptococcus suis P1/7 ................................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Streptococcus suis BM407 ...............................................  135  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus suis 05ZYH33] >gi|1
. . . Holdemania filiformis DSM 12042 ........................................  135  2 hits [firmicutes]             hypothetical protein HOLDEFILI_01379 [Holdemania filiformis
. . . Alicyclobacillus acidocaldarius LAA1 ...................................  135  2 hits [firmicutes]             ribosomal protein S5 [Alicyclobacillus acidocaldarius LAA1]
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ..........  135  2 hits [firmicutes]             ribosomal protein S5 [Alicyclobacillus acidocaldarius LAA1]
. . . Streptococcus gordonii str. Challis substr. CH1 ........................  134  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus gordonii str. Chall
. . . Streptococcus sp. 2_1_36FAA ............................................  134  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus gordonii str. Chall
. . . Streptococcus gordonii str. Challis ....................................  134  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus gordonii str. Chall
. . . Oceanobacillus iheyensis HTE831 ........................................  134  2 hits [firmicutes]             30S ribosomal protein S5 [Oceanobacillus iheyensis HTE831] 
. . . Oceanobacillus iheyensis ...............................................  134  1 hit  [firmicutes]             30S ribosomal protein S5 [Oceanobacillus iheyensis HTE831] 
. . . Streptococcus uberis 0140J .............................................  134  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus uberis 0140J] >gi|2
. . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ..................  134  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus dysgalactiae subsp.
. . . Streptococcus sp. M143 .................................................  134  2 hits [firmicutes]             ribosomal protein S5 [Streptococcus sp. M143] >gi|270279545
. . . Streptococcus sanguinis SK36 ...........................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus sanguinis SK36] >gi
. . . Streptococcus pyogenes M1 GAS ..........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS8232 ........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS315 .........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes SSI-1 ...........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS10394 .......................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes M49 591 .........................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS6180 ........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS5005 ........................................  133  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS9429 ........................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS10270 .......................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS2096 ........................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes MGAS10750 .......................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes str. Manfredo ...................................  133  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes serotype M3 .....................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes serotype M18 ....................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes serotype M1 .....................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes serotype M6 .....................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes serotype M28 ....................................  133  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS] >g
. . . Listeria monocytogenes EGD-e ...........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes str. 4b F2365 ...................................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes str. 4b H7858 ...................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes str. 1/2a F6854 .................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...........................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes HCC23 ...........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes Finland 1988 ....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL R2-561 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes Clip80459 .......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J1-194 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL N3-165 ......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes 10403S ..........................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL R2-503 ......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL N1-017 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J2-071 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes J0161 ...........................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes J2818 ...........................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes HPB2262 .........................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes F6900 ...........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J2-064 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J1-208 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J2-003 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes LO28 ............................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes FSL J1-175 ......................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria monocytogenes .................................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria monocytogenes EGD-e] >gi
. . . Listeria innocua Clip11262 .............................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Listeria innocua Clip11262] >gi|2
. . . Listeria innocua .......................................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria innocua Clip11262] >gi|2
. . . Streptococcus equi subsp. zooepidemicus MGCS10565 ......................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus equi subsp. zooepid
. . . Streptococcus equi subsp. zooepidemicus ................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus equi subsp. zooepid
. . . Streptococcus equi subsp. equi 4047 ....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus equi subsp. zooepid
. . . Streptococcus pneumoniae TIGR4 .........................................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae R6 ............................................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae D39 ...........................................  132  3 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP3-BS71 ......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP6-BS73 ......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP9-BS68 ......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP11-BS70 .....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP14-BS69 .....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP18-BS74 .....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP19-BS75 .....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP23-BS72 .....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CDC1873-00 ....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CDC1087-00 ....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae SP195 .........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CDC0288-04 ....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CDC3059-06 ....................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae MLV-016 .......................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae Hungary19A-6 ..................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CGSP14 ........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae G54 ...........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae ATCC 700669 ...................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae JJA ...........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae P1031 .........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae 70585 .........................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae Taiwan19F-14 ..................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CCRI 1974 .....................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae CCRI 1974M2 ...................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae TCH8431/19A ...................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Streptococcus pneumoniae ...............................................  132  1 hit  [firmicutes]             30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4] >
. . . Listeria grayi DSM 20601 ...............................................  132  2 hits [firmicutes]             30S ribosomal protein S5 [Listeria grayi DSM 20601] >gi|229
. . . Gemella haemolysans ATCC 10379 .........................................  131  2 hits [firmicutes]             ribosomal protein S5 [Gemella haemolysans ATCC 10379] >gi|2
. . . Enterococcus casseliflavus EC30 ........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus casseliflavus EC30] >gi|
. . . Enterococcus gallinarum EG2 ............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus casseliflavus EC30] >gi|
. . . Enterococcus casseliflavus EC10 ........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus casseliflavus EC30] >gi|
. . . Enterococcus casseliflavus EC20 ........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus casseliflavus EC30] >gi|
. . . Enterococcus faecalis V583 .............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis TX0104 ...........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis TX1322 ...........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis ATCC 29200 .......................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis TUSoD Ef11 .......................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis T1 ...............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis T2 ...............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis ATCC 4200 ........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis T3 ...............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis T8 ...............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis DS5 ..............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis Merz96 ...........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis HIP11704 .........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis JH1 ..............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis E1Sol ............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis Fly1 .............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis D6 ...............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis CH188 ............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis AR01/DG ..........................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis T11 ..............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis X98 ..............................................  129  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis ..................................................  129  1 hit  [firmicutes]             ribosomal protein S5 [Enterococcus faecalis V583] >gi|22752
. . . Enterococcus faecalis HH22 .............................................  128  2 hits [firmicutes]             ribosomal protein S5 [Enterococcus faecalis HH22] >gi|22717
. . . Enterococcus faecium DO ................................................  127  3 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium TX1330 ............................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,230,933 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,231,502 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,231,501 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,141,733 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,231,410 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium 1,231,408 .........................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium Com12 .............................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium Com15 .............................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium C68 ...............................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Enterococcus faecium TC 6 ..............................................  127  2 hits [firmicutes]             Ribosomal protein S5, bacterial and organelle form [Enteroc
. . . Oenococcus oeni PSU-1 ..................................................  127  3 hits [firmicutes]             SSU ribosomal protein S5P [Oenococcus oeni PSU-1] >gi|12227
. . . Lactobacillus brevis ATCC 367 ..........................................  126  3 hits [firmicutes]             30S ribosomal protein S5 [Lactobacillus brevis ATCC 367] >g
. . Eggerthella lenta DSM 2243 -----------------------------------------------  149  2 hits [high GC Gram+]          ribosomal protein S5 [Eggerthella lenta DSM 2243] >gi|25747
. . Nocardia farcinica IFM 10152 .............................................  149  2 hits [high GC Gram+]          30S ribosomal protein S5 [Nocardia farcinica IFM 10152] >gi
. . Nocardia farcinica .......................................................  149  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Nocardia farcinica IFM 10152] >gi
. . Cryptobacterium curtum DSM 15641 .........................................  149  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Cryptobacterium curtum DSM 15641
. . Rhodococcus jostii RHA1 ..................................................  148  3 hits [high GC Gram+]          30S ribosomal protein S5 [Rhodococcus jostii RHA1] >gi|2263
. . Rhodococcus opacus B4 ....................................................  148  3 hits [high GC Gram+]          30S ribosomal protein S5 [Rhodococcus jostii RHA1] >gi|2263
. . Corynebacterium efficiens YS-314 .........................................  148  4 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
. . Corynebacterium efficiens ................................................  148  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
. . Slackia exigua ATCC 700122 ...............................................  147  2 hits [high GC Gram+]          ribosomal protein S5 [Slackia exigua ATCC 700122] >gi|26912
. . Propionibacterium acnes KPA171202 ........................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Propionibacterium acnes KPA171202
. . Propionibacterium acnes SK137 ............................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Propionibacterium acnes KPA171202
. . Propionibacterium acnes ..................................................  147  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Propionibacterium acnes KPA171202
. . Propionibacterium acnes J139 .............................................  147  2 hits [high GC Gram+]          ribosomal protein S5 [Propionibacterium acnes J139] >gi|282
. . Rhodococcus erythropolis PR4 .............................................  147  3 hits [high GC Gram+]          30S ribosomal protein S5 [Rhodococcus erythropolis PR4] >gi
. . Rhodococcus erythropolis SK121 ...........................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Rhodococcus erythropolis PR4] >gi
. . Mycobacterium sp. MCS ....................................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium sp. MCS] >gi|119867
. . Mycobacterium sp. KMS ....................................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium sp. MCS] >gi|119867
. . Mycobacterium sp. JLS ....................................................  147  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium sp. MCS] >gi|119867
. . Corynebacterium matruchotii ATCC 33806 ...................................  147  2 hits [high GC Gram+]          hypothetical protein CORMATOL_00468 [Corynebacterium matruc
. . Corynebacterium matruchotii ATCC 14266 ...................................  147  2 hits [high GC Gram+]          hypothetical protein CORMATOL_00468 [Corynebacterium matruc
. . Colwellia psychrerythraea 34H ............................................  147  3 hits [g-proteobacteria]       ribosomal protein S5 [Colwellia psychrerythraea 34H] >gi|91
. . Tsukamurella paurometabola DSM 20162 .....................................  146  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Tsukamurella paurometabola DSM 2
. . Mycobacterium tuberculosis H37Rv .........................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis CDC1551 .......................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium bovis AF2122/97 ............................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium bovis BCG str. Pasteur 1173P2 ..............................  146  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis H37Ra .........................................  146  4 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis 94_M4241A .....................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis T92 ...........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis EAS054 ........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis T85 ...........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis GM 1503 .......................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis T17 ...........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium bovis BCG str. Tokyo 172 ...................................  146  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis KZN 1435 ......................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis C .............................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis str. Haarlem ..................................  146  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis '98-R604 INH-RIF-EM' ..........................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis CPHL_A ........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis T46 ...........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis K85 ...........................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium bovis ......................................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Mycobacterium tuberculosis ...............................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
. . Corynebacterium glutamicum ATCC 13032 ....................................  146  4 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium glutamicum ATCC 1
. . Corynebacterium glutamicum R .............................................  146  3 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium glutamicum ATCC 1
. . Corynebacterium glutamicum ...............................................  146  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium glutamicum ATCC 1
. . Mycobacterium tuberculosis KZN 605 .......................................  145  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis KZN 60
. . Nitrococcus mobilis Nb-231 ...............................................  145  2 hits [g-proteobacteria]       Ribosomal protein S5 [Nitrococcus mobilis Nb-231] >gi|88789
. . Mycobacterium smegmatis str. MC2 155 .....................................  145  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium smegmatis str. MC2 
. . Mycobacterium marinum M ..................................................  145  3 hits [high GC Gram+]          30S ribosomal protein S5, RpsE [Mycobacterium marinum M] >g
. . Corynebacterium genitalium ATCC 33030 ....................................  145  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium genitalium ATCC 3
. . Thioalkalivibrio sp. HL-EbGR7 ............................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Thioalkalivibrio sp. HL-EbGR7] >g
. . Thermobifida fusca YX ....................................................  145  3 hits [high GC Gram+]          30S ribosomal protein S5 [Thermobifida fusca YX] >gi|912078
. . Marinobacter algicola DG893 ..............................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Marinobacter algicola DG893] >gi|
. . Mycobacterium ulcerans Agy99 .............................................  144  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium ulcerans Agy99] >gi
. . Mycobacterium tuberculosis F11 ...........................................  144  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium tuberculosis F11] >
. . Halorhodospira halophila SL1 .............................................  144  3 hits [g-proteobacteria]       ribosomal protein S5 [Halorhodospira halophila SL1] >gi|171
. . Corynebacterium diphtheriae NCTC 13129 ...................................  144  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium diphtheriae NCTC 
. . Corynebacterium diphtheriae ..............................................  144  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium diphtheriae NCTC 
. . Teredinibacter turnerae T7901 ............................................  144  2 hits [g-proteobacteria]       ribosomal protein S5 [Teredinibacter turnerae T7901] >gi|23
. . Corynebacterium urealyticum DSM 7109 .....................................  143  3 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium urealyticum DSM 7
. . Anaeromyxobacter dehalogenans 2CP-C ......................................  143  3 hits [d-proteobacteria]       SSU ribosomal protein S5P [Anaeromyxobacter dehalogenans 2C
. . Anaeromyxobacter sp. K ...................................................  143  2 hits [d-proteobacteria]       ribosomal protein S5 [Anaeromyxobacter sp. K] >gi|220917138
. . Anaeromyxobacter dehalogenans 2CP-1 ......................................  143  2 hits [d-proteobacteria]       ribosomal protein S5 [Anaeromyxobacter sp. K] >gi|220917138
. . Psychromonas ingrahamii 37 ...............................................  143  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Psychromonas ingrahamii 37] >gi|1
. . Legionella longbeachae D-4968 ............................................  143  2 hits [g-proteobacteria]       ribosomal protein S5 [Legionella longbeachae D-4968] >gi|26
. . Corynebacterium jeikeium ATCC 43734 ......................................  143  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium jeikeium ATCC 437
. . Corynebacterium jeikeium K411 ............................................  143  3 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium jeikeium K411] >g
. . Gemmatimonas aurantiaca T-27 .............................................  142  2 hits [bacteria]               30S ribosomal protein S5 [Gemmatimonas aurantiaca T-27] >gi
. . Anaeromyxobacter sp. Fw109-5 .............................................  142  3 hits [d-proteobacteria]       ribosomal protein S5 [Anaeromyxobacter sp. Fw109-5] >gi|171
. . Corynebacterium glucuronolyticum ATCC 51867 ..............................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium glucuronolyticum 
. . Corynebacterium glucuronolyticum ATCC 51866 ..............................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium glucuronolyticum 
. . Mycobacterium avium 104 ..................................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium avium 104] >gi|2547
. . Mycobacterium avium subsp. avium ATCC 25291 ..............................  142  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium avium 104] >gi|2547
. . Arthrobacter aurescens TC1 ...............................................  142  3 hits [high GC Gram+]          ribosomal protein S5 [Arthrobacter aurescens TC1] >gi|17170
. . Mycobacterium kansasii ATCC 12478 ........................................  142  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium kansasii ATCC 12478]
. . Corynebacterium lipophiloflavum DSM 44291 ................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium lipophiloflavum D
. . Haliangium ochraceum DSM 14365 ...........................................  142  2 hits [d-proteobacteria]       ribosomal protein S5 [Haliangium ochraceum DSM 14365] >gi|2
. . Corynebacterium amycolatum SK46 ..........................................  142  2 hits [high GC Gram+]          ribosomal protein S5 [Corynebacterium amycolatum SK46] >gi|
. . Mycobacterium intracellulare ATCC 13950 ..................................  142  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium intracellulare ATCC
. . Mobiluncus mulieris ATCC 35243 ...........................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mobiluncus mulieris ATCC 35243] >
. . Mobiluncus mulieris 28-1 .................................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mobiluncus mulieris ATCC 35243] >
. . Mycobacterium avium subsp. paratuberculosis K-10 .........................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium avium subsp. paratu
. . Mycobacterium avium subsp. paratuberculosis ..............................  142  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium avium subsp. paratu
. . Mycobacterium vanbaalenii PYR-1 ..........................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium vanbaalenii PYR-1] 
. . Mobiluncus curtisii ATCC 43063 ...........................................  142  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mobiluncus curtisii ATCC 43063] >
. . Frankia alni ACN14a ......................................................  142  3 hits [high GC Gram+]          30S ribosomal protein S5 [Frankia alni ACN14a] >gi|12304485
. . Frankia sp. EuI1c ........................................................  142  2 hits [high GC Gram+]          ribosomal protein S5 [Frankia sp. EuI1c] >gi|270732243|gb|E
. . Frankia sp. CcI3 .........................................................  142  3 hits [high GC Gram+]          30S ribosomal protein S5 [Frankia sp. CcI3] >gi|123724245|s
. . Frankia sp. EAN1pec ......................................................  142  3 hits [high GC Gram+]          30S ribosomal protein S5 [Frankia sp. EAN1pec] >gi|22670334
. . Slackia heliotrinireducens DSM 20476 .....................................  142  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Slackia heliotrinireducens DSM 2
. . Corynebacterium aurimucosum ATCC 700975 ..................................  142  4 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium aurimucosum ATCC 
. . Mycobacterium gilvum PYR-GCK .............................................  141  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium gilvum PYR-GCK] >gi
. . Microscilla marina ATCC 23134 ............................................  141  2 hits [CFB group bacteria]     ribosomal protein S5 [Microscilla marina ATCC 23134] >gi|12
. . Marinobacter sp. ELB17 ...................................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Marinobacter sp. ELB17] >gi|12662
. . Marinobacter aquaeolei VT8 ...............................................  141  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Marinobacter aquaeolei VT8] >gi|1
. . Corynebacterium kroppenstedtii DSM 44385 .................................  141  3 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium kroppenstedtii DS
. . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ..................  141  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Nocardiopsis dassonvillei subsp.
. . Thermomonospora curvata DSM 43183 ........................................  141  2 hits [high GC Gram+]          ribosomal protein S5 [Thermomonospora curvata DSM 43183] >g
. . Acidothermus cellulolyticus 11B ..........................................  141  3 hits [high GC Gram+]          SSU ribosomal protein S5P [Acidothermus cellulolyticus 11B]
. . Marinomonas sp. MWYL1 ....................................................  141  2 hits [g-proteobacteria]       ribosomal protein S5 [Marinomonas sp. MWYL1] >gi|150839178|
. . Desulfuromonas acetoxidans DSM 684 .......................................  141  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfuromonas acetoxidans DSM 684] >
. . marine actinobacterium PHSC20C1 ..........................................  141  2 hits [high GC Gram+]          30S ribosomal protein S5 [marine actinobacterium PHSC20C1] 
. . Corynebacterium striatum ATCC 6940 .......................................  140  2 hits [high GC Gram+]          30S ribosomal protein S5 [Corynebacterium striatum ATCC 694
. . Leifsonia xyli subsp. xyli str. CTCB07 ...................................  140  2 hits [high GC Gram+]          30S ribosomal protein S5 [Leifsonia xyli subsp. xyli str. C
. . Leifsonia xyli subsp. xyli ...............................................  140  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Leifsonia xyli subsp. xyli str. C
. . Buchnera aphidicola str. Sg (Schizaphis graminum) ........................  140  2 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. Sg (Schi
. . Buchnera aphidicola (Schizaphis graminum) ................................  140  1 hit  [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. Sg (Schi
. . Hahella chejuensis KCTC 2396 .............................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Hahella chejuensis KCTC 2396] >gi
. . Stigmatella aurantiaca DW4/3-1 ...........................................  140  2 hits [d-proteobacteria]       ribosomal protein S5 [Stigmatella aurantiaca DW4/3-1] >gi|1
. . Pseudoalteromonas atlantica T6c ..........................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudoalteromonas atlantica T6c] 
. . Psychromonas sp. CNPT3 ...................................................  140  2 hits [g-proteobacteria]       Ribosomal protein S5 [Psychromonas sp. CNPT3] >gi|90309488|
. . Alkalilimnicola ehrlichii MLHE-1 .........................................  140  3 hits [g-proteobacteria]       SSU ribosomal protein S5P [Alkalilimnicola ehrlichii MLHE-1
. . Gordonia bronchialis DSM 43247 ...........................................  140  2 hits [high GC Gram+]          ribosomal protein S5 [Gordonia bronchialis DSM 43247] >gi|2
. . Saccharophagus degradans 2-40 ............................................  140  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Saccharophagus degradans 2-40] >g
. . Sorangium cellulosum 'So ce 56' ..........................................  140  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Sorangium cellulosum 'So ce 56'] 
. . Clavibacter michiganensis subsp. michiganensis NCPPB 382 .................  140  2 hits [high GC Gram+]          30S ribosomal protein S5 [Clavibacter michiganensis subsp. 
. . Herpetosiphon aurantiacus ATCC 23779 .....................................  140  2 hits [GNS bacteria]           ribosomal protein S5 [Herpetosiphon aurantiacus ATCC 23779]
. . Arthrobacter sp. FB24 ....................................................  139  3 hits [high GC Gram+]          SSU ribosomal protein S5P [Arthrobacter sp. FB24] >gi|17185
. . Stackebrandtia nassauensis DSM 44728 .....................................  139  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Stackebrandtia nassauensis DSM 4
. . Clavibacter michiganensis subsp. sepedonicus .............................  139  2 hits [high GC Gram+]          30S ribosomal protein S5 [Clavibacter michiganensis subsp. 
. . Roseiflexus sp. RS-1 .....................................................  139  3 hits [GNS bacteria]           ribosomal protein S5 [Roseiflexus sp. RS-1] >gi|172048079|s
. . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........  139  3 hits [enterobacteria]         hypothetical protein WGLp560 [Wigglesworthia glossinidia en
. . Rhodobacterales bacterium HTCC2255 .......................................  139  1 hit  [a-proteobacteria]       30S ribosomal subunit protein S5 [alpha proteobacterium HTC
. . Glaciecola sp. HTCC2999 ..................................................  139  1 hit  [g-proteobacteria]       30S ribosomal subunit protein S5 [alpha proteobacterium HTC
. . Escherichia coli .........................................................  139 30 hits [enterobacteria]         Chain B, Fitting Of Components With Known Structure Into An
. . Thermus thermophilus .....................................................  139  1 hit  [bacteria]               Chain D, Partial Model For 30s Ribosomal Subunit >gi|698085
. . Buchnera aphidicola str. APS (Acyrthosiphon pisum) .......................  139  2 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................  139  2 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................  139  2 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum) ......................  139  1 hit  [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Buchnera aphidicola (Acyrthosiphon pisum) ................................  139  1 hit  [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Buchnera sp. .............................................................  139  1 hit  [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. APS (Acy
. . Actinomyces urogenitalis DSM 15434 .......................................  139  2 hits [high GC Gram+]          ribosomal protein S5 [Actinomyces urogenitalis DSM 15434] >
. . Plesiocystis pacifica SIR-1 ..............................................  139  2 hits [d-proteobacteria]       ribosomal protein S5 [Plesiocystis pacifica SIR-1] >gi|1498
. . Alteromonas macleodii 'Deep ecotype' .....................................  139  3 hits [g-proteobacteria]       30S ribosomal subunit protein S5 [Alteromonas macleodii 'De
. . Alteromonas macleodii ATCC 27126 .........................................  139  1 hit  [g-proteobacteria]       30S ribosomal subunit protein S5 [Alteromonas macleodii 'De
. . Streptomyces albus J1074 .................................................  139  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Streptomyces albus J1074]
. . Shewanella benthica KT99 .................................................  139  2 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella benthica KT99] >gi|1613274
. . Proteus mirabilis HI4320 .................................................  139  2 hits [enterobacteria]         30S ribosomal protein S5 [Proteus mirabilis HI4320] >gi|227
. . Proteus mirabilis ATCC 29906 .............................................  139  2 hits [enterobacteria]         30S ribosomal protein S5 [Proteus mirabilis HI4320] >gi|227
. . Chromohalobacter salexigens DSM 3043 .....................................  138  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Chromohalobacter salexigens DSM 3
. . Alcanivorax sp. DG881 ....................................................  138  2 hits [g-proteobacteria]       ribosomal protein S5 [Alcanivorax sp. DG881] >gi|196193924|
. . Providencia stuartii ATCC 25827 ..........................................  138  2 hits [enterobacteria]         hypothetical protein PROSTU_04330 [Providencia stuartii ATC
. . Providencia rettgeri DSM 1131 ............................................  138  1 hit  [enterobacteria]         hypothetical protein PROSTU_04330 [Providencia stuartii ATC
. . Actinomyces coleocanis DSM 15436 .........................................  138  2 hits [high GC Gram+]          30S ribosomal protein S5 [Actinomyces coleocanis DSM 15436]
. . Providencia alcalifaciens DSM 30120 ......................................  138  2 hits [enterobacteria]         hypothetical protein PROVALCAL_00030 [Providencia alcalifac
. . Providencia rustigianii DSM 4541 .........................................  138  2 hits [enterobacteria]         hypothetical protein PROVALCAL_00030 [Providencia alcalifac
. . Mycobacterium leprae TN ..................................................  138  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium leprae TN] >gi|2212
. . Mycobacterium leprae Br4923 ..............................................  138  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium leprae TN] >gi|2212
. . Mycobacterium leprae .....................................................  138  3 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium leprae TN] >gi|2212
. . Renibacterium salmoninarum ATCC 33209 ....................................  138  2 hits [high GC Gram+]          SSU ribosomal protein S5P [Renibacterium salmoninarum ATCC 
. . Roseiflexus castenholzii DSM 13941 .......................................  138  2 hits [GNS bacteria]           ribosomal protein S5 [Roseiflexus castenholzii DSM 13941] >
. . Edwardsiella ictaluri 93-146 .............................................  138  2 hits [enterobacteria]         30S ribosomal protein S5 (BS5) [Edwardsiella ictaluri 93-14
. . Buchnera aphidicola str. Cc (Cinara cedri) ...............................  138  3 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. Cc (Cina
. . Buchnera aphidicola (Cinara cedri) .......................................  138  1 hit  [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. Cc (Cina
. . Cellvibrio japonicus Ueda107 .............................................  138  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Cellvibrio japonicus Ueda107] >gi
. . Photobacterium damselae subsp. damselae CIP 102761 .......................  138  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Photobacterium damselae su
. . Mycobacterium abscessus ATCC 19977 .......................................  138  2 hits [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium abscessus ATCC 1997
. . Mycobacterium abscessus ..................................................  138  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Mycobacterium abscessus ATCC 1997
. . Proteus penneri ATCC 35198 ...............................................  138  2 hits [enterobacteria]         hypothetical protein PROPEN_03408 [Proteus penneri ATCC 351
. . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  138  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Legionella pneumophila subsp. pne
. . Legionella pneumophila str. Lens .........................................  138  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Legionella pneumophila subsp. pne
. . Legionella pneumophila str. Paris ........................................  138  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Legionella pneumophila subsp. pne
. . Legionella pneumophila str. Corby ........................................  138  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Legionella pneumophila subsp. pne
. . Sphaerobacter thermophilus DSM 20745 .....................................  138  2 hits [GNS bacteria]           ribosomal protein S5 [Sphaerobacter thermophilus DSM 20745]
. . Actinomyces odontolyticus ATCC 17982 .....................................  138  2 hits [high GC Gram+]          hypothetical protein ACTODO_00329 [Actinomyces odontolyticu
. . marine gamma proteobacterium HTCC2148 ....................................  138  2 hits [g-proteobacteria]       ribosomal protein S5 [marine gamma proteobacterium HTCC2148
. . Actinomyces sp. oral taxon 848 str. F0332 ................................  137  2 hits [high GC Gram+]          ribosomal protein S5 [Actinomyces sp. oral taxon 848 str. F
. . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Photorhabdus luminescens subsp. l
. . Photorhabdus luminescens subsp. laumondii ................................  137  1 hit  [enterobacteria]         30S ribosomal protein S5 [Photorhabdus luminescens subsp. l
. . Arthrobacter chlorophenolicus A6 .........................................  137  2 hits [high GC Gram+]          ribosomal protein S5 [Arthrobacter chlorophenolicus A6] >gi
. . Dickeya zeae Ech1591 .....................................................  137  2 hits [enterobacteria]         ribosomal protein S5 [Dickeya zeae Ech1591] >gi|271502229|r
. . Dickeya dadantii Ech586 ..................................................  137  2 hits [enterobacteria]         ribosomal protein S5 [Dickeya zeae Ech1591] >gi|271502229|r
. . Pectobacterium atrosepticum SCRI1043 .....................................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  137  1 hit  [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  137  1 hit  [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Pectobacterium wasabiae WPP163 ...........................................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Pectobacterium atrosepticum ..............................................  137  1 hit  [enterobacteria]         30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1
. . Alcanivorax borkumensis SK2 ..............................................  137  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Alcanivorax borkumensis SK2] >gi|
. . Citrobacter sp. 30_2 .....................................................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Citrobacter sp. 30_2] >gi|2269092
. . Erwinia pyrifoliae Ep1/96 ................................................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Erwinia pyrifoliae Ep1/96] >gi|22
. . Erwinia pyrifoliae DSM 12163 .............................................  137  1 hit  [enterobacteria]         30S ribosomal protein S5 [Erwinia pyrifoliae Ep1/96] >gi|22
. . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  137  3 hits [enterobacteria]         30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneu
. . Klebsiella pneumoniae NTUH-K2044 .........................................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneu
. . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneu
. . Denitrovibrio acetiphilus DSM 12809 ......................................  137  2 hits [bacteria]               SSU ribosomal protein S5P [Denitrovibrio acetiphilus DSM 12
. . Streptosporangium roseum DSM 43021 .......................................  137  2 hits [high GC Gram+]          Ribosomal protein S5-like protein [Streptosporangium roseum
. . uncultured marine gamma proteobacterium EB000-45B06 ......................  137  1 hit  [g-proteobacteria]       ribosomal protein S5 [uncultured marine gamma proteobacteri
. . uncultured marine bacterium 562 ..........................................  137  1 hit  [bacteria]               ribosomal protein S5 [uncultured marine gamma proteobacteri
. . Sodalis glossinidius str. 'morsitans' ....................................  137  3 hits [enterobacteria]         30S ribosomal protein S5 [Sodalis glossinidius str. 'morsit
. . Shewanella pealeana ATCC 700345 ..........................................  137  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella pealeana ATCC 700345] 
. . Shewanella halifaxensis HAW-EB4 ..........................................  137  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella pealeana ATCC 700345] 
. . Buchnera aphidicola (Baizongia pistaciae) ................................  137  1 hit  [enterobacteria]         RecName: Full=30S ribosomal protein S5
. . Aggregatibacter actinomycetemcomitans D11S-1 .............................  137  2 hits [g-proteobacteria]       ribosomal protein S5 [Aggregatibacter actinomycetemcomitans
. . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  137  2 hits [enterobacteria]         30S ribosomal protein S5 [Buchnera aphidicola str. Bp (Baiz
. . Shewanella woodyi ATCC 51908 .............................................  137  2 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella woodyi ATCC 51908] >gi|169
. . Shewanella piezotolerans WP3 .............................................  137  2 hits [g-proteobacteria]       Ribosomal protein S5 [Shewanella piezotolerans WP3] >gi|212
. . uncultured marine gamma proteobacterium EBAC20E09 ........................  137  1 hit  [g-proteobacteria]       predicted ribosomal protein S5 [uncultured marine gamma pro
. . Verrucomicrobium spinosum DSM 4136 .......................................  137  1 hit  [verrucomicrobia]        ribosomal protein S5 [Verrucomicrobium spinosum DSM 4136]
. . Pelobacter carbinolicus DSM 2380 .........................................  137  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Pelobacter carbinolicus DSM 2380]
. . Shewanella sediminis HAW-EB3 .............................................  137  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella sediminis HAW-EB3] >gi
. . Streptomyces sp. SPB74 ...................................................  137  2 hits [high GC Gram+]          30S ribosomal protein S5 [Streptomyces sp. SPB74] >gi|25667
. . Streptomyces sp. SPB78 ...................................................  137  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Streptomyces sp. SPB74] >gi|25667
. . Psychrobacter arcticus 273-4 .............................................  136  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Psychrobacter arcticus 273-4] >gi
. . Psychrobacter cryohalolentis K5 ..........................................  136  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Psychrobacter arcticus 273-4] >gi
. . Shewanella loihica PV-4 ..................................................  136  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella loihica PV-4] >gi|1718
. . Campylobacterales bacterium GD 1 .........................................  136  2 hits [e-proteobacteria]       ribosomal protein S5 [Campylobacterales bacterium GD 1] >gi
. . Geobacter bemidjiensis Bem ...............................................  136  2 hits [d-proteobacteria]       ribosomal protein S5 [Geobacter bemidjiensis Bem] >gi|25370
. . Geobacter sp. M21 ........................................................  136  2 hits [d-proteobacteria]       ribosomal protein S5 [Geobacter bemidjiensis Bem] >gi|25370
. . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  136  3 hits [g-proteobacteria]       ribosomal protein S5 [Aeromonas hydrophila subsp. hydrophil
. . Shigella dysenteriae Sd197 ...............................................  136  3 hits [enterobacteria]         30S ribosomal protein S5 [Shigella dysenteriae Sd197] >gi|9
. . Photorhabdus asymbiotica .................................................  136  2 hits [enterobacteria]         30S ribosomal subunit protein S5 [Photorhabdus asymbiotica]
. . Myxococcus xanthus DK 1622 ...............................................  136  3 hits [d-proteobacteria]       ribosomal protein S5 [Myxococcus xanthus DK 1622] >gi|12337
. . Dickeya dadantii Ech703 ..................................................  136  2 hits [enterobacteria]         ribosomal protein S5 [Dickeya dadantii Ech703] >gi|24212993
. . Photobacterium profundum 3TCK ............................................  136  2 hits [g-proteobacteria]       putative ribosomal subunit protein S5 [Photobacterium profu
. . Shewanella denitrificans OS217 ...........................................  136  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella denitrificans OS217] >
. . Shewanella frigidimarina NCIMB 400 .......................................  136  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella denitrificans OS217] >
. . Beggiatoa sp. PS .........................................................  136  2 hits [g-proteobacteria]       Ribosomal protein S5 [Beggiatoa sp. PS] >gi|152071224|gb|ED
. . Photobacterium profundum SS9 .............................................  136  2 hits [g-proteobacteria]       putative ribosomal subunit protein S5 [Photobacterium profu
. . Photobacterium profundum .................................................  136  1 hit  [g-proteobacteria]       putative ribosomal subunit protein S5 [Photobacterium profu
. . Pasteurella dagmatis ATCC 43325 ..........................................  136  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Pasteurella dagmatis ATCC 43325] 
. . Aggregatibacter aphrophilus NJ8700 .......................................  136  2 hits [g-proteobacteria]       ribosomal protein S5 [Aggregatibacter aphrophilus NJ8700] >
. . Shewanella oneidensis MR-1 ...............................................  135  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella oneidensis MR-1] >gi|1
. . Shewanella sp. MR-4 ......................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella oneidensis MR-1] >gi|1
. . Shewanella sp. MR-7 ......................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella oneidensis MR-1] >gi|1
. . Shewanella sp. ANA-3 .....................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella oneidensis MR-1] >gi|1
. . Shewanella oneidensis ....................................................  135  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Shewanella oneidensis MR-1] >gi|1
. . Aeromonas salmonicida subsp. salmonicida A449 ............................  135  3 hits [g-proteobacteria]       ribosomal protein S5 [Aeromonas salmonicida subsp. salmonic
. . Enhydrobacter aerosaccus SK60 ............................................  135  2 hits [g-proteobacteria]       ribosomal protein S5 [Enhydrobacter aerosaccus SK60] >gi|25
. . Allochromatium vinosum DSM 180 ...........................................  135  2 hits [g-proteobacteria]       ribosomal protein S5 [Allochromatium vinosum DSM 180] >gi|2
. . Haemophilus somnus 129PT .................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus somnus 129PT] >gi|170
. . Haemophilus somnus 2336 ..................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus somnus 129PT] >gi|170
. . Pantoea sp. At-9b ........................................................  135  2 hits [enterobacteria]         ribosomal protein S5 [Pantoea sp. At-9b] >gi|258531038|gb|E
. . Campylobacter gracilis RM3268 ............................................  135  2 hits [e-proteobacteria]       ribosomal protein S5 [Campylobacter gracilis RM3268] >gi|25
. . Pseudoalteromonas haloplanktis TAC125 ....................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudoalteromonas haloplanktis TA
. . Photobacterium sp. SKA34 .................................................  135  2 hits [g-proteobacteria]       putative ribosomal subunit protein S5 [Photobacterium sp. S
. . Photobacterium angustum S14 ..............................................  135  2 hits [g-proteobacteria]       putative ribosomal subunit protein S5 [Photobacterium sp. S
. . Enterobacter cancerogenus ATCC 35316 .....................................  135  1 hit  [enterobacteria]         30S ribosomal subunit protein S5 [Enterobacter cancerogenus
. . Escherichia coli O157:H7 str. EC4206 .....................................  135  2 hits [enterobacteria]         ribosomal protein S5 [Escherichia coli O157:H7 str. EC4206]
. . Escherichia coli K-12 ....................................................  135  8 hits [enterobacteria]         Chain E, Ternary Complex-Bound E.Coli 70s Ribosome. This En
. . Escherichia coli O157:H7 EDL933 ..........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. Sakai ......................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli str. K-12 substr. MG1655 ................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella flexneri 2a str. 301 ............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli CFT073 ..................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella flexneri 2a str. 2457T ..........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella sonnei Ss046 ....................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella boydii Sb227 ....................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli str. K-12 substr. W3110 .................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli UTI89 ...................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli 536 .....................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella flexneri 5 str. 8401 ............................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli APEC O1 .................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Citrobacter koseri ATCC BAA-895 ..........................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli E24377A .................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli HS ......................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli ATCC 8739 ...............................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli str. K-12 substr. DH10B .................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli SMS-3-5 .................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia albertii TW07627 .............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella boydii CDC 3083-94 ..............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4196 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4113 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli 53638 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4076 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4486 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC869 ......................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli F11 .....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli E22 .....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli E110019 .................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella dysenteriae 1012 ................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli 101-1 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Klebsiella pneumoniae 342 ................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4045 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4042 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. EC4115 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli SE11 ....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O127:H6 str. E2348/69 ...................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. TW14588 ....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia fergusonii ATCC 35469 ........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli IAI1 ....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli S88 .....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli ED1a ....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli 55989 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli IAI39 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli UMN026 ..................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli 83972 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia sp. 3_2_53FAA ................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli BW2952 ..................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia sp. 1_1_43 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. TW14359 ....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella sp. D9 ..........................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia sp. 4_1_40B ..................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O103:H2 str. 12009 ......................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O26:H11 str. 11368 ......................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O111:H- str. 11128 ......................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. FRIK2000 ...................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 str. FRIK966 ....................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Klebsiella variicola At-22 ...............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O6 ......................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli O157:H7 .................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhimurium ..................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhi ........................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella flexneri ........................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica ......................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli DH1 .....................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Escherichia coli SE15 ....................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Shigella flexneri 2002017 ................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Citrobacter rodentium ICC168 .............................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933] 
. . Idiomarina baltica OS145 .................................................  135  2 hits [g-proteobacteria]       Ribosomal protein S5 [Idiomarina baltica OS145] >gi|8569302
. . Escherichia coli BL21(DE3) ...............................................  135  4 hits [enterobacteria]         ribosomal protein S5 [Escherichia coli BL21(DE3)] >gi|24237
. . Pseudoalteromonas tunicata D2 ............................................  135  2 hits [g-proteobacteria]       30S ribosomal subunit protein S5 [Pseudoalteromonas tunicat
. . Salmonella enterica subsp. enterica serovar Typhi str. AG3 ...............  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Salmonella enterica subsp. enteri
. . Acidimicrobium ferrooxidans DSM 10331 ....................................  135  2 hits [high GC Gram+]          ribosomal protein S5 [Acidimicrobium ferrooxidans DSM 10331
. . Grimontia hollisae CIP 101886 ............................................  135  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Grimontia hollisae CIP 101
. . Pasteurella multocida subsp. multocida str. Pm70 .........................  135  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Pasteurella multocida subsp. mult
. . Pasteurella multocida ....................................................  135  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Pasteurella multocida subsp. mult
. . Desulfonatronospira thiodismutans ASO3-1 .................................  135  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfonatronospira thiodismutans ASO
. . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  135  2 hits [g-proteobacteria]       ribosomal protein S5 [Mannheimia haemolytica serotype A2 st
. . Mannheimia haemolytica serotype A2 str. OVINE ............................  135  2 hits [g-proteobacteria]       ribosomal protein S5 [Mannheimia haemolytica serotype A2 st
. . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  135  1 hit  [g-proteobacteria]       COG0098: Ribosomal protein S5 [Actinobacillus pleuropneumon
. . Actinobacillus pleuropneumoniae L20 ......................................  135  3 hits [g-proteobacteria]       COG0098: Ribosomal protein S5 [Actinobacillus pleuropneumon
. . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  135  2 hits [g-proteobacteria]       COG0098: Ribosomal protein S5 [Actinobacillus pleuropneumon
. . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  135  2 hits [g-proteobacteria]       COG0098: Ribosomal protein S5 [Actinobacillus pleuropneumon
. . Nitratiruptor sp. SB155-2 ................................................  135  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Nitratiruptor sp. SB155-2] >gi|17
. . Shewanella sp. W3-18-1 ...................................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella sp. W3-18-1] >gi|12455
. . Shewanella putrefaciens 200 ..............................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella sp. W3-18-1] >gi|12455
. . Shewanella putrefaciens CN-32 ............................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella sp. W3-18-1] >gi|12455
. . Cronobacter sakazakii ATCC BAA-894 .......................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Enterobacter sakazakii ATCC BAA-8
. . Cronobacter turicensis ...................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Enterobacter sakazakii ATCC BAA-8
. . Cronobacter turicensis z3032 .............................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Enterobacter sakazakii ATCC BAA-8
. . Shewanella amazonensis SB2B ..............................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Shewanella amazonensis SB2B] >gi|
. . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................  135  3 hits [g-proteobacteria]       ribosomal protein S5 [Baumannia cicadellinicola str. Hc (Ho
. . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  135  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio vulgaris str. 'Miya
. . Erwinia tasmaniensis Et1/99 ..............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Erwinia tasmaniensis Et1/99] >gi|
. . Congregibacter litoralis KT71 ............................................  135  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Congregibacter litoralis KT71] >g
. . Nocardioides sp. JS614 ...................................................  135  3 hits [high GC Gram+]          SSU ribosomal protein S5P [Nocardioides sp. JS614] >gi|1717
. . Yersinia pestis KIM 10 ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Microtus str. 91001 ...............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pseudotuberculosis IP 32953 .....................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis Antiqua ..................................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis Nepal516 .................................................  135  5 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis Pestoides F ..............................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis CA88-4125 ................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pseudotuberculosis IP 31758 .....................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis Angola ...................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Orientalis str. F1991016 ..........................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Orientalis str. IP275 .............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Antiqua str. E1979001 .............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Antiqua str. B42003004 ............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pseudotuberculosis YPIII ........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pseudotuberculosis PB1/+ ........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis CO92 .....................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis Pestoides A ..............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Orientalis str. PEXU2 .............................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis biovar Orientalis str. India 195 .........................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia frederiksenii ATCC 33641 ........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis KIM D27 ..................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis ..........................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pseudotuberculosis ..............................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis D106004 ..................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia pestis D182038 ..................................................  135  1 hit  [enterobacteria]         30S ribosomal protein S5 [Yersinia pestis KIM] >gi|45440084
. . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia enterocolitica subsp. en
. . Yersinia rohdei ATCC 43380 ...............................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia enterocolitica subsp. en
. . Yersinia kristensenii ATCC 33638 .........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia enterocolitica subsp. en
. . Yersinia intermedia ATCC 29909 ...........................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Yersinia enterocolitica subsp. en
. . gamma proteobacterium NOR5-3 .............................................  135  2 hits [g-proteobacteria]       ribosomal protein S5 [gamma proteobacterium NOR5-3] >gi|219
. . Serratia proteamaculans 568 ..............................................  135  3 hits [enterobacteria]         30S ribosomal protein S5 [Serratia proteamaculans 568] >gi|
. . Serratia odorifera 4Rx13 .................................................  135  2 hits [enterobacteria]         30S ribosomal protein S5 [Serratia proteamaculans 568] >gi|
. . Yersinia bercovieri ATCC 43970 ...........................................  135  2 hits [enterobacteria]         hypothetical protein yberc0001_2690 [Yersinia bercovieri AT
. . Yersinia mollaretii ATCC 43969 ...........................................  135  2 hits [enterobacteria]         hypothetical protein yberc0001_2690 [Yersinia bercovieri AT
. . Yersinia aldovae ATCC 35236 ..............................................  135  2 hits [enterobacteria]         hypothetical protein yaldo0001_31940 [Yersinia aldovae ATCC
. . Yersinia ruckeri ATCC 29473 ..............................................  135  2 hits [enterobacteria]         hypothetical protein yruck0001_27940 [Yersinia ruckeri ATCC
. . Actinobacillus succinogenes 130Z .........................................  135  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Actinobacillus succinogenes 130Z]
. . Kocuria rhizophila DC2201 ................................................  134  2 hits [high GC Gram+]          30S ribosomal protein S5 [Kocuria rhizophila DC2201] >gi|18
. . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................  134  2 hits [enterobacteria]         30S ribosomal subunit protein S5 [Candidatus Hamiltonella d
. . Enterobacter sp. 638 .....................................................  134  3 hits [enterobacteria]         30S ribosomal protein S5 [Enterobacter sp. 638] >gi|1890454
. . Idiomarina loihiensis L2TR ...............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Idiomarina loihiensis L2TR] >gi|7
. . Idiomarina loihiensis ....................................................  134  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Idiomarina loihiensis L2TR] >gi|7
. . Alteromonadales bacterium TW-7 ...........................................  134  2 hits [g-proteobacteria]       30S ribosomal subunit protein S5 [Alteromonadales bacterium
. . Thermanaerovibrio acidaminovorans DSM 6589 ...............................  134  2 hits [bacteria]               ribosomal protein S5 [Thermanaerovibrio acidaminovorans DSM
. . marine gamma proteobacterium HTCC2143 ....................................  134  2 hits [g-proteobacteria]       ribosomal protein S5 [marine gamma proteobacterium HTCC2143
. . Haemophilus influenzae Rd KW20 ...........................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae R2866 .............................................  134  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae R2846 .............................................  134  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 86-028NP ..........................................  134  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 22.1-21 ...........................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae R3021 .............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 3655 ..............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae PittAA ............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae PittHH ............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae PittII ............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 22.4-21 ...........................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae PittEE ............................................  134  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae PittGG ............................................  134  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 6P18H1 ............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae 7P49H1 ............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae RdAW ..............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae NT127 .............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Haemophilus influenzae ...................................................  134  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus influenzae Rd KW20] >
. . Chloroherpeton thalassium ATCC 35110 .....................................  134  3 hits [green sulfur bacteria]  ribosomal protein S5 [Chloroherpeton thalassium ATCC 35110]
. . Shewanella baltica OS155 .................................................  134  3 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella baltica OS155] >gi|1529987
. . Shewanella baltica OS185 .................................................  134  3 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella baltica OS155] >gi|1529987
. . Shewanella baltica OS195 .................................................  134  3 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella baltica OS155] >gi|1529987
. . Shewanella baltica OS223 .................................................  134  3 hits [g-proteobacteria]       ribosomal protein S5 [Shewanella baltica OS155] >gi|1529987
. . Aliivibrio salmonicida LFI1238 ...........................................  134  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Aliivibrio salmonicida LFI1238] >
. . Vibrio coralliilyticus ATCC BAA-450 ......................................  134  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Vibrio coralliilyticus ATC
. . Thioalkalivibrio sp. K90mix ..............................................  134  2 hits [g-proteobacteria]       ribosomal protein S5 [Thioalkalivibrio sp. K90mix] >gi|2246
. . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................  134  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio desulfuricans subsp
. . Haemophilus parasuis 29755 ...............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus parasuis 29755] >gi|2
. . Haemophilus parasuis SH0165 ..............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus parasuis 29755] >gi|2
. . Sulfurimonas denitrificans DSM 1251 ......................................  134  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Sulfurimonas denitrificans DSM 12
. . Haemophilus ducreyi 35000HP ..............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus ducreyi 35000HP] >gi|
. . Haemophilus ducreyi ......................................................  134  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Haemophilus ducreyi 35000HP] >gi|
. . Opitutaceae bacterium TAV2 ...............................................  134  2 hits [verrucomicrobia]        Ribosomal protein S5-like protein [Opitutaceae bacterium TA
. . Arcobacter butzleri RM4018 ...............................................  134  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Arcobacter butzleri RM4018] >gi|1
. . Tolumonas auensis DSM 9187 ...............................................  134  3 hits [g-proteobacteria]       ribosomal protein S5 [Tolumonas auensis DSM 9187] >gi|25949
. . Actinobacillus minor 202 .................................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Actinobacillus minor 202] >gi|240
. . Actinobacillus minor NM305 ...............................................  134  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Actinobacillus minor 202] >gi|240
. . Rothia mucilaginosa ATCC 25296 ...........................................  133  2 hits [high GC Gram+]          30S ribosomal protein S5 [Rothia mucilaginosa ATCC 25296] >
. . Rothia mucilaginosa DY-18 ................................................  133  2 hits [high GC Gram+]          30S ribosomal protein S5 [Rothia mucilaginosa ATCC 25296] >
. . Desulfohalobium retbaense DSM 5692 .......................................  133  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfohalobium retbaense DSM 5692] >
. . Mannheimia succiniciproducens MBEL55E ....................................  133  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Mannheimia succiniciproducens MBE
. . Lawsonia intracellularis PHE/MN1-00 ......................................  133  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Lawsonia intracellularis PHE/MN1-
. . Nitrosococcus oceani ATCC 19707 ..........................................  133  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Nitrosococcus oceani ATCC 19707] 
. . Desulfobacterium autotrophicum HRM2 ......................................  133  2 hits [d-proteobacteria]       RpsE [Desulfobacterium autotrophicum HRM2] >gi|223693391|gb
. . Vibrio fischeri ES114 ....................................................  133  3 hits [g-proteobacteria]       30S ribosomal subunit protein S5 [Vibrio fischeri ES114] >g
. . Vibrio fischeri MJ11 .....................................................  133  3 hits [g-proteobacteria]       30S ribosomal subunit protein S5 [Vibrio fischeri ES114] >g
. . Brachyspira murdochii DSM 12563 ..........................................  133  2 hits [spirochetes]            SSU ribosomal protein S5P [Brachyspira murdochii DSM 12563]
. . Campylobacter curvus 525.92 ..............................................  133  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter curvus 525.92] >gi|
. . Methylibium petroleiphilum PM1 ...........................................  133  3 hits [b-proteobacteria]       SSU ribosomal protein S5P [Methylibium petroleiphilum PM1] 
. . Acidithiobacillus caldus ATCC 51756 ......................................  132  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Acidithiobacillus caldus A
. . Vibrio metschnikovii CIP 69.14 ...........................................  132  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Vibrio metschnikovii CIP 6
. . Mannheimia haemolytica PHL213 ............................................  132  2 hits [g-proteobacteria]       ribosomal protein S5 [Mannheimia haemolytica PHL213] >gi|15
. . Syntrophobacter fumaroxidans MPOB ........................................  132  3 hits [d-proteobacteria]       ribosomal protein S5 [Syntrophobacter fumaroxidans MPOB] >g
. . Rubrobacter xylanophilus DSM 9941 ........................................  132  3 hits [high GC Gram+]          SSU ribosomal protein S5P [Rubrobacter xylanophilus DSM 994
. . Vibrio furnissii CIP 102972 ..............................................  132  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Vibrio furnissii CIP 10297
. . Dictyoglomus turgidum DSM 6724 ...........................................  132  2 hits [bacteria]               ribosomal protein S5 [Dictyoglomus turgidum DSM 6724] >gi|2
. . Vibrio shilonii AK1 ......................................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio shilonii AK1] >gi|14883377
. . Vibrio parahaemolyticus RIMD 2210633 .....................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio harveyi ATCC BAA-1116 .............................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio parahaemolyticus K5030 ............................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio parahaemolyticus AN-5034 ..........................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio parahaemolyticus Peru-466 .........................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio parahaemolyticus AQ4037 ...........................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio harveyi 1DA3 ......................................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio parahaemolyticus ..................................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210
. . Vibrio alginolyticus 12G01 ...............................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio alginolyticus 12G01] >gi|2
. . Vibrio parahaemolyticus 16 ...............................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio alginolyticus 12G01] >gi|2
. . Vibrio sp. Ex25 ..........................................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio alginolyticus 12G01] >gi|2
. . Vibrio alginolyticus 40B .................................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio alginolyticus 12G01] >gi|2
. . Brachyspira hyodysenteriae WA1 ...........................................  132  2 hits [spirochetes]            30S ribosomal protein S5 [Brachyspira hyodysenteriae WA1] >
. . Wolinella succinogenes DSM 1740 ..........................................  132  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Wolinella succinogenes DSM 1740] 
. . Wolinella succinogenes ...................................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Wolinella succinogenes DSM 1740] 
. . Escherichia coli B str. REL606 ...........................................  132  2 hits [enterobacteria]         30S ribosomal protein S5 [Escherichia coli B str. REL606] >
. . Dictyoglomus thermophilum H-6-12 .........................................  132  2 hits [bacteria]               ribosomal protein S5 [Dictyoglomus thermophilum H-6-12] >gi
. . Vibrio orientalis CIP 102891 .............................................  132  2 hits [g-proteobacteria]       SSU ribosomal protein S5p (S2e) [Vibrio orientalis CIP 1028
. . Campylobacter hominis ATCC BAA-381 .......................................  132  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter hominis ATCC BAA-38
. . Pseudomonas aeruginosa PAO1 ..............................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa PACS2 .............................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa UCBPP-PA14 ........................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa PA7 ...............................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa LESB58 ............................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa C3719 .............................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Pseudomonas aeruginosa ...................................................  132  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1] >gi|
. . Azotobacter vinelandii DJ ................................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Azotobacter vinelandii DJ] >gi|25
. . Campylobacter jejuni subsp. jejuni CG8421 ................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni subsp. jejun
. . Pseudomonas mendocina ymp ................................................  132  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas mendocina ymp] >gi|17
. . Chlorobium luteolum DSM 273 ..............................................  132  3 hits [green sulfur bacteria]  30S ribosomal protein S5 [Chlorobium luteolum DSM 273] >gi|
. . gamma proteobacterium HTCC2207 ...........................................  132  2 hits [g-proteobacteria]       30S ribosomal protein S5 [marine gamma proteobacterium HTCC
. . Campylobacter jejuni RM1221 ..............................................  132  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter coli RM2228 ................................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni CF93-6 ................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni 260.94 ................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni HB93-13 ...............................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni 84-25 .................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni 81-176 ................................  132  4 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni CG8486 ................................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. doylei 269.97 ................................  132  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni 81116 .................................  132  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni subsp. jejuni NCTC 11168 ............................  132  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter jejuni .....................................................  132  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter jejuni RM1221] >gi|
. . Campylobacter rectus RM3267 ..............................................  132  2 hits [e-proteobacteria]       ribosomal protein S5 [Campylobacter rectus RM3267] >gi|2553
. . Campylobacter showae RM3277 ..............................................  132  2 hits [e-proteobacteria]       ribosomal protein S5 [Campylobacter rectus RM3267] >gi|2553
. . Campylobacter concisus 13826 .............................................  132  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter concisus 13826] >gi
. . Chlorobium phaeovibrioides DSM 265 .......................................  132  3 hits [green sulfur bacteria]  30S ribosomal protein S5 [Prosthecochloris vibrioformis DSM
. . Victivallis vadensis ATCC BAA-548 ........................................  131  2 hits [bacteria]               ribosomal protein S5 [Victivallis vadensis ATCC BAA-548] >g
. . Desulfococcus oleovorans Hxd3 ............................................  131  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfococcus oleovorans Hxd3] >gi|15
. . Chlorobaculum parvum NCIB 8327 ...........................................  131  3 hits [green sulfur bacteria]  ribosomal protein S5 [Chlorobaculum parvum NCIB 8327] >gi|2
. . Vibrio vulnificus CMCP6 ..................................................  131  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio vulnificus CMCP6] >gi|3767
. . Vibrio vulnificus YJ016 ..................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio vulnificus CMCP6] >gi|3767
. . Vibrio vulnificus ........................................................  131  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio vulnificus CMCP6] >gi|3767
. . Pseudomonas fluorescens Pf0-1 ............................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas fluorescens Pf0-1] >g
. . Chlorobium tepidum TLS ...................................................  131  2 hits [green sulfur bacteria]  30S ribosomal protein S5 [Chlorobium tepidum TLS] >gi|26399
. . Chlorobaculum tepidum ....................................................  131  1 hit  [green sulfur bacteria]  30S ribosomal protein S5 [Chlorobium tepidum TLS] >gi|26399
. . Pseudomonas fluorescens Pf-5 .............................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas fluorescens Pf-5] >gi
. . Chlorobium ferrooxidans DSM 13031 ........................................  131  2 hits [green sulfur bacteria]  ribosomal protein S5 [Chlorobium ferrooxidans DSM 13031] >g
. . Pseudomonas putida KT2440 ................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas putida KT2440] >gi|14
. . Pseudomonas putida F1 ....................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas putida KT2440] >gi|14
. . Pseudomonas putida GB-1 ..................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas putida KT2440] >gi|14
. . Pseudomonas putida W619 ..................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas putida KT2440] >gi|14
. . Prosthecochloris aestuarii DSM 271 .......................................  131  3 hits [green sulfur bacteria]  ribosomal protein S5 [Prosthecochloris aestuarii DSM 271] >
. . Pseudomonas fluorescens SBW25 ............................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas fluorescens SBW25] >g
. . Bermanella marisrubri ....................................................  131  2 hits [g-proteobacteria]       ribosomal protein S5 [Oceanobacter sp. RED65] >gi|94426916|
. . Helicobacter bilis ATCC 43879 ............................................  131  2 hits [e-proteobacteria]       ribosomal protein S5 [Helicobacter bilis ATCC 43879] >gi|22
. . Hoeflea phototrophica DFL-43 .............................................  131  2 hits [a-proteobacteria]       30S ribosomal protein S5 [Hoeflea phototrophica DFL-43] >gi
. . Desulfomicrobium baculatum DSM 4028 ......................................  131  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfomicrobium baculatum DSM 4028] 
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ................  131  2 hits [spirochetes]            30S ribosomal protein S5 [Leptospira biflexa serovar Patoc 
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .................  131  2 hits [spirochetes]            30S ribosomal protein S5 [Leptospira biflexa serovar Patoc 
. . Desulfovibrio salexigens DSM 2638 ........................................  131  3 hits [d-proteobacteria]       ribosomal protein S5 [Desulfovibrio salexigens DSM 2638] >g
. . Pseudomonas syringae pv. tomato str. DC3000 ..............................  131  2 hits [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Pseudomonas syringae pv. syringae B728a ..................................  131  3 hits [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Pseudomonas syringae pv. tomato T1 .......................................  131  2 hits [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Pseudomonas syringae pv. oryzae str. 1_6 .................................  131  1 hit  [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  131  1 hit  [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Pseudomonas syringae pv. tomato ..........................................  131  1 hit  [g-proteobacteria]       ribosomal protein S5 [Pseudomonas syringae pv. tomato str. 
. . Chloroflexus aggregans DSM 9485 ..........................................  131  3 hits [GNS bacteria]           ribosomal protein S5 [Chloroflexus aggregans DSM 9485] >gi|
. . Pseudomonas entomophila L48 ..............................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas entomophila L48] >gi|
. . Chlorobium phaeobacteroides BS1 ..........................................  131  3 hits [green sulfur bacteria]  ribosomal protein S5 [Chlorobium phaeobacteroides BS1] >gi|
. . Desulfovibrio vulgaris str. Hildenborough ................................  131  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio vulgaris subsp. vul
. . Desulfovibrio vulgaris DP4 ...............................................  131  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio vulgaris subsp. vul
. . Desulfovibrio vulgaris RCH1 ..............................................  131  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio vulgaris subsp. vul
. . Vibrio splendidus 12B01 ..................................................  131  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio splendidus 12B01] >gi|2187
. . Vibrio splendidus LGP32 ..................................................  131  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio splendidus 12B01] >gi|2187
. . Stenotrophomonas maltophilia R551-3 ......................................  131  3 hits [g-proteobacteria]       ribosomal protein S5 [Stenotrophomonas maltophilia R551-3] 
. . Vibrionales bacterium SWAT-3 .............................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrionales bacterium SWAT-3] >gi
. . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae V52 ......................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae O395 .....................................................  130  4 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae 1587 .....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae MAK 757 ..................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae NCTC 8457 ................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae MZO-2 ....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae 623-39 ...................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae MZO-3 ....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae M66-2 ....................................................  130  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae BX 330286 ................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae B33 ......................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae TMA 21 ...................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae RC9 ......................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae TM 11079-80 ..............................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae bv. albensis VL426 .......................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae 12129(1) .................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae MJ-1236 ..................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae AM-19226 .................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae MO10 .....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholera CIRS 101 ..................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio mimicus VM573 .....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio mimicus VM603 .....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio sp. RC341 .........................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio mimicus VM223 .....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio mimicus MB-451 ....................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio sp. RC586 .........................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Vibrio cholerae ..........................................................  130  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor 
. . Campylobacter upsaliensis RM3195 .........................................  130  2 hits [e-proteobacteria]       ribosomal protein S5 [Campylobacter upsaliensis RM3195] >gi
. . Campylobacter fetus subsp. fetus 82-40 ...................................  130  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter fetus subsp. fetus 
. . Campylobacter fetus subsp. venerealis str. Azul-94 .......................  130  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter fetus subsp. fetus 
. . Campylobacter lari RM2100 ................................................  130  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Campylobacter lari RM2100] >gi|22
. . Geobacter sp. FRC-32 .....................................................  130  2 hits [d-proteobacteria]       ribosomal protein S5 [Geobacter sp. FRC-32] >gi|221565977|g
. . Halothiobacillus neapolitanus c2 .........................................  130  2 hits [g-proteobacteria]       ribosomal protein S5 [Halothiobacillus neapolitanus c2] >gi
. . Geobacter sulfurreducens PCA .............................................  130  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Geobacter sulfurreducens PCA] >gi
. . Geobacter sulfurreducens .................................................  130  1 hit  [d-proteobacteria]       30S ribosomal protein S5 [Geobacter sulfurreducens PCA] >gi
. . Helicobacter cinaedi CCUG 18818 ..........................................  130  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter cinaedi CCUG 18818]
. . Stenotrophomonas sp. SKA14 ...............................................  130  2 hits [g-proteobacteria]       ribosomal protein S5 [Stenotrophomonas sp. SKA14] >gi|21972
. . Stenotrophomonas maltophilia K279a .......................................  130  3 hits [g-proteobacteria]       putative 30S ribosomal subunit protein S5 [Stenotrophomonas
. . Chlorobium phaeobacteroides DSM 266 ......................................  130  3 hits [green sulfur bacteria]  30S ribosomal protein S5 [Chlorobium phaeobacteroides DSM 2
. . Chloroflexus aurantiacus J-10-fl .........................................  130  3 hits [GNS bacteria]           ribosomal protein S5 [Chloroflexus aurantiacus J-10-fl] >gi
. . Chloroflexus sp. Y-400-fl ................................................  130  3 hits [GNS bacteria]           ribosomal protein S5 [Chloroflexus aurantiacus J-10-fl] >gi
. . Pelodictyon phaeoclathratiforme BU-1 .....................................  130  3 hits [green sulfur bacteria]  ribosomal protein S5 [Pelodictyon phaeoclathratiforme BU-1]
. . Sulfurospirillum deleyianum DSM 6946 .....................................  130  2 hits [e-proteobacteria]       ribosomal protein S5 [Sulfurospirillum deleyianum DSM 6946]
. . Thermobaculum terrenum ATCC BAA-798 ......................................  130  2 hits [bacteria]               ribosomal protein S5 [Thermobaculum terrenum ATCC BAA-798] 
. . Chlorobium chlorochromatii CaD3 ..........................................  130  3 hits [green sulfur bacteria]  30S ribosomal protein S5 [Chlorobium chlorochromatii CaD3] 
. . Xanthomonas albilineans ..................................................  130  1 hit  [g-proteobacteria]       probable 30s ribosomal protein s5 [Xanthomonas albilineans]
. . Dehalococcoides sp. VS ...................................................  130  2 hits [GNS bacteria]           ribosomal protein S5 [Dehalococcoides sp. VS] >gi|270153750
. . Dehalococcoides ethenogenes 195 ..........................................  130  3 hits [GNS bacteria]           30S ribosomal protein S5 [Dehalococcoides ethenogenes 195] 
. . Bifidobacterium catenulatum DSM 16992 ....................................  130  2 hits [high GC Gram+]          hypothetical protein BIFCAT_01523 [Bifidobacterium catenula
. . Bifidobacterium pseudocatenulatum DSM 20438 ..............................  130  2 hits [high GC Gram+]          hypothetical protein BIFCAT_01523 [Bifidobacterium catenula
. . Acinetobacter baumannii ATCC 17978 .......................................  130  2 hits [g-proteobacteria]       RecName: Full=30S ribosomal protein S5
. . Bacteroides capillosus ATCC 29799 ........................................  130  2 hits [CFB group bacteria]     hypothetical protein BACCAP_02893 [Bacteroides capillosus A
. . Acinetobacter calcoaceticus RUH2202 ......................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter calcoaceticus RUH22
. . Bifidobacterium dentium ATCC 27678 .......................................  130  2 hits [high GC Gram+]          hypothetical protein BIFDEN_00331 [Bifidobacterium dentium 
. . Bifidobacterium dentium Bd1 ..............................................  130  2 hits [high GC Gram+]          hypothetical protein BIFDEN_00331 [Bifidobacterium dentium 
. . Desulfatibacillum alkenivorans AK-01 .....................................  130  2 hits [d-proteobacteria]       ribosomal protein S5 [Desulfatibacillum alkenivorans AK-01]
. . Chthoniobacter flavus Ellin428 ...........................................  130  2 hits [verrucomicrobia]        ribosomal protein S5 [Chthoniobacter flavus Ellin428] >gi|1
. . Acinetobacter baumannii SDF ..............................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii AYE ..............................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii ACICU ............................................  130  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii AB0057 ...........................................  130  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii AB307-0294 .......................................  130  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter sp. ATCC 27244 .............................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii AB900 ............................................  130  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter sp. RUH2624 ................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii ATCC 19606 .......................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter baumannii ..................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter baumannii SDF] >gi|
. . Acinetobacter sp. ADP1 ...................................................  130  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter sp. ADP1] >gi|26237
. . Acinetobacter junii SH205 ................................................  130  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Acinetobacter sp. ADP1] >gi|26237
. . Desulfovibrio magneticus RS-1 ............................................  130  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfovibrio magneticus RS-1] >g
. . Reinekea blandensis MED297 ...............................................  129  2 hits [g-proteobacteria]       ribosomal protein S5 [Reinekea sp. MED297] >gi|88776039|gb|
. . Helicobacter hepaticus ATCC 51449 ........................................  129  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter hepaticus ATCC 51449
. . Helicobacter hepaticus ...................................................  129  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter hepaticus ATCC 51449
. . Helicobacter pylori 51 ...................................................  129  1 hit  [e-proteobacteria]       ribosomal protein S5 [Helicobacter pylori 51]
. . Chlorobium limicola DSM 245 ..............................................  129  3 hits [green sulfur bacteria]  ribosomal protein S5 [Chlorobium limicola DSM 245] >gi|2267
. . Psychrobacter sp. PRwf-1 .................................................  129  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Psychrobacter sp. PRwf-1] >gi|226
. . Dehalococcoides sp. CBDB1 ................................................  129  3 hits [GNS bacteria]           30S ribosomal protein S5 [Dehalococcoides sp. CBDB1] >gi|14
. . Dehalococcoides sp. BAV1 .................................................  129  2 hits [GNS bacteria]           30S ribosomal protein S5 [Dehalococcoides sp. CBDB1] >gi|14
. . Dehalococcoides sp. GT ...................................................  129  2 hits [GNS bacteria]           30S ribosomal protein S5 [Dehalococcoides sp. CBDB1] >gi|14
. . Helicobacter pylori 98-10 ................................................  129  2 hits [e-proteobacteria]       hypothetical protein HP9810_899g56 [Helicobacter pylori 98-
. . Helicobacter pylori J99 ..................................................  129  3 hits [e-proteobacteria]       hypothetical protein HP9810_899g56 [Helicobacter pylori 98-
. . Helicobacter pylori ......................................................  129  1 hit  [e-proteobacteria]       hypothetical protein HP9810_899g56 [Helicobacter pylori 98-
. . Methylacidiphilum infernorum V4 ..........................................  129  2 hits [verrucomicrobia]        Ribosomal protein S5 [Methylacidiphilum infernorum V4] >gi|
. . Helicobacter pylori 26695 ................................................  129  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori HPAG1 ................................................  129  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori Shi470 ...............................................  129  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori HPKX_438_AG0C1 .......................................  129  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori P12 ..................................................  129  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori B38 ..................................................  129  2 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Helicobacter pylori 52 ...................................................  129  1 hit  [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter pylori J99] >gi|1564
. . Kangiella koreensis DSM 16069 ............................................  129  2 hits [g-proteobacteria]       ribosomal protein S5 [Kangiella koreensis DSM 16069] >gi|25
. . Leptothrix cholodnii SP-6 ................................................  129  3 hits [b-proteobacteria]       ribosomal protein S5 [Leptothrix cholodnii SP-6] >gi|226703
. . Syntrophus aciditrophicus SB .............................................  129  3 hits [d-proteobacteria]       SSU ribosomal protein S5P [Syntrophus aciditrophicus SB] >g
. . Geobacter uraniireducens Rf4 .............................................  129  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Geobacter uraniireducens Rf4] >gi
. . gamma proteobacterium NOR51-B ............................................  129  2 hits [g-proteobacteria]       ribosomal protein S5 [gamma proteobacterium NOR51-B] >gi|21
. . uncultured Termite group 1 bacterium phylotype Rs-D17 ....................  129  2 hits [bacteria]               30S ribosomal protein S5 [uncultured Termite group 1 bacter
. . Helicobacter pylori G27 ..................................................  129  2 hits [e-proteobacteria]       ribosomal protein S5 [Helicobacter pylori G27] >gi|21703205
. . Helicobacter pylori B128 .................................................  129  2 hits [e-proteobacteria]       ribosomal protein S5 [Helicobacter pylori G27] >gi|21703205
. . Bifidobacterium animalis subsp. lactis AD011 .............................  129  3 hits [high GC Gram+]          ribosomal protein S5 [Bifidobacterium animalis subsp. lacti
. . Bifidobacterium animalis subsp. lactis HN019 .............................  129  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium animalis subsp. l
. . Bifidobacterium animalis subsp. lactis Bl-04 .............................  129  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium animalis subsp. l
. . Bifidobacterium animalis subsp. lactis DSM 10140 .........................  129  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium animalis subsp. l
. . marine gamma proteobacterium HTCC2080 ....................................  129  2 hits [g-proteobacteria]       30S ribosomal protein S5 [marine gamma proteobacterium HTCC
. . Xylella fastidiosa Dixon .................................................  129  2 hits [g-proteobacteria]       Ribosomal protein S5, bacterial and organelle form [Xylella
. . Xylella fastidiosa subsp. sandyi Ann-1 ...................................  129  4 hits [g-proteobacteria]       Ribosomal protein S5, bacterial and organelle form [Xylella
. . Xylella fastidiosa M12 ...................................................  129  3 hits [g-proteobacteria]       Ribosomal protein S5, bacterial and organelle form [Xylella
. . Pseudomonas syringae pv. phaseolicola 1448A ..............................  129  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas syringae pv. phaseoli
. . Planctomyces limnophilus DSM 3776 ........................................  129  2 hits [planctomycetes]         SSU ribosomal protein S5P [Planctomyces limnophilus DSM 377
. . Candidatus Cloacamonas acidaminovorans ...................................  129  2 hits [bacteria]               30S ribosomal subunit protein S5 [Candidatus Cloacamonas ac
. . Helicobacter acinonychis str. Sheeba .....................................  129  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter acinonychis str. She
. . Geobacter metallireducens GS-15 ..........................................  128  3 hits [d-proteobacteria]       30S ribosomal protein S5 [Geobacter metallireducens GS-15] 
. . Xylella fastidiosa 9a5c ..................................................  128  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xylella fastidiosa 9a5c] >gi|2639
. . Xylella fastidiosa .......................................................  128  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Xylella fastidiosa 9a5c] >gi|2639
. . Bifidobacterium longum NCC2705 ...........................................  128  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum NCC2705] >
. . Bifidobacterium longum DJO10A ............................................  128  4 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum NCC2705] >
. . Bifidobacterium longum subsp. infantis CCUG 52486 ........................  128  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum NCC2705] >
. . Bifidobacterium longum ...................................................  128  1 hit  [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum NCC2705] >
. . Bifidobacterium longum subsp. infantis ATCC 15697 ........................  128  3 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum DJO10A] >g
. . Bifidobacterium longum subsp. infantis ATCC 55813 ........................  128  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium longum DJO10A] >g
. . Desulfotalea psychrophila LSv54 ..........................................  128  2 hits [d-proteobacteria]       30S ribosomal protein S5 [Desulfotalea psychrophila LSv54] 
. . Desulfotalea psychrophila ................................................  128  1 hit  [d-proteobacteria]       30S ribosomal protein S5 [Desulfotalea psychrophila LSv54] 
. . Methylophilales bacterium HTCC2181 .......................................  128  2 hits [b-proteobacteria]       30S ribosomal protein S5 [Methylophilales bacterium HTCC218
. . Geobacter lovleyi SZ .....................................................  128  3 hits [d-proteobacteria]       ribosomal protein S5 [Geobacter lovleyi SZ] >gi|226703349|s
. . Dethiosulfovibrio peptidovorans DSM 11002 ................................  128  2 hits [bacteria]               SSU ribosomal protein S5P [Dethiosulfovibrio peptidovorans 
. . Mesoplasma florum L1 .....................................................  127  2 hits [mycoplasmas]            30S ribosomal protein S5 [Mesoplasma florum L1] >gi|7391907
. . Mesoplasma florum ........................................................  127  1 hit  [mycoplasmas]            30S ribosomal protein S5 [Mesoplasma florum L1] >gi|7391907
. . Pseudomonas stutzeri A1501 ...............................................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Pseudomonas stutzeri A1501] >gi|1
. . Chelativorans sp. BNC1 ...................................................  127  3 hits [a-proteobacteria]       30S ribosomal protein S5 [Mesorhizobium sp. BNC1] >gi|12296
. . Thermomicrobium roseum DSM 5159 ..........................................  127  2 hits [GNS bacteria]           ribosomal protein S5 [Thermomicrobium roseum DSM 5159] >gi|
. . Thermodesulfovibrio yellowstonii DSM 11347 ...............................  127  2 hits [bacteria]               ribosomal protein S5 [Thermodesulfovibrio yellowstonii DSM 
. . Bifidobacterium angulatum DSM 20098 ......................................  127  2 hits [high GC Gram+]          hypothetical protein BIFANG_03521 [Bifidobacterium angulatu
. . Leptotrichia hofstadii F0254 .............................................  127  2 hits [fusobacteria]           hypothetical protein GCWU000323_02792 [Leptotrichia hofstad
. . Xylella fastidiosa Temecula1 .............................................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xylella fastidiosa Temecula1] >gi
. . Xylella fastidiosa M23 ...................................................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xylella fastidiosa Temecula1] >gi
. . Methylococcus capsulatus str. Bath .......................................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Methylococcus capsulatus str. Bat
. . Methylococcus capsulatus .................................................  127  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Methylococcus capsulatus str. Bat
. . Rhodothermus marinus DSM 4252 ............................................  127  2 hits [CFB group bacteria]     ribosomal protein S5 [Rhodothermus marinus DSM 4252] >gi|26
. . Acholeplasma laidlawii PG-8A .............................................  127  2 hits [mycoplasmas]            small subunit ribosomal protein S5 [Acholeplasma laidlawii 
. . Meiothermus ruber DSM 1279 ...............................................  127  2 hits [bacteria]               SSU ribosomal protein S5P [Meiothermus ruber DSM 1279] >gi|
. . Leptotrichia buccalis C-1013-b ...........................................  127  2 hits [fusobacteria]           ribosomal protein S5 [Leptotrichia buccalis DSM 1135] >gi|2
. . gamma proteobacterium HTCC5015 ...........................................  127  2 hits [g-proteobacteria]       ribosomal protein S5 [gamma proteobacterium HTCC5015] >gi|1
. . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas axonopodis pv. citri str. 306 ................................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas oryzae pv. oryzae KACC10331 ..................................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas campestris pv. campestris str. 8004 ..........................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas oryzae pv. oryzicola BLS256 ..................................  127  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas oryzae pv. oryzae PXO99A .....................................  127  3 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas campestris pv. campestris str. B100 ..........................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas campestris pv. campestris ....................................  127  2 hits [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas axonopodis pv. citri .........................................  127  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Xanthomonas oryzae pv. oryzae ............................................  127  1 hit  [g-proteobacteria]       30S ribosomal protein S5 [Xanthomonas campestris pv. campes
. . Bifidobacterium gallicum DSM 20093 .......................................  127  2 hits [high GC Gram+]          ribosomal protein S5 [Bifidobacterium gallicum DSM 20093] >
. . Bifidobacterium adolescentis ATCC 15703 ..................................  127  3 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium adolescentis ATCC
. . Bifidobacterium adolescentis L2-32 .......................................  127  2 hits [high GC Gram+]          30S ribosomal protein S5 [Bifidobacterium adolescentis ATCC
. . Leptospira interrogans serovar Copenhageni ...............................  127  1 hit  [spirochetes]            RecName: Full=30S ribosomal protein S5
. . Helicobacter winghamensis ATCC BAA-430 ...................................  127  2 hits [e-proteobacteria]       ribosomal protein S5 [Helicobacter winghamensis ATCC BAA-43
. . Leptospira interrogans ...................................................  126  1 hit  [spirochetes]            RecName: Full=30S ribosomal protein S5
. . Leptospira interrogans serovar Lai str. 56601 ............................  126  2 hits [spirochetes]            30S ribosomal protein S5 [Leptospira interrogans serovar La
. . Thermus aquaticus Y51MC23 ................................................  126  2 hits [bacteria]               ribosomal protein S5 [Thermus aquaticus Y51MC23] >gi|218244
. . Atopobium parvulum DSM 20469 .............................................  126  2 hits [high GC Gram+]          ribosomal protein S5 [Atopobium parvulum DSM 20469] >gi|257
. . Helicobacter canadensis MIT 98-5491 ......................................  126  3 hits [e-proteobacteria]       30S ribosomal protein S5 [Helicobacter canadensis MIT 98-54
. . Akkermansia muciniphila ATCC BAA-835 .....................................  126  2 hits [verrucomicrobia]        ribosomal protein S5 [Akkermansia muciniphila ATCC BAA-835]
. . Maricaulis maris MCS10 ...................................................  126  3 hits [a-proteobacteria]       30S ribosomal protein S5 [Maricaulis maris MCS10] >gi|12231
. . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ...........  126  2 hits [spirochetes]            30S ribosomal protein S5 [Leptospira interrogans serovar Co
. . Parvibaculum lavamentivorans DS-1 ........................................  126  3 hits [a-proteobacteria]       ribosomal protein S5 [Parvibaculum lavamentivorans DS-1] >g
. . Micrococcus luteus NCTC 2665 .............................................  126  3 hits [high GC Gram+]          SSU ribosomal protein S5P [Micrococcus luteus NCTC 2665] >g
. . Coxiella burnetii CbuG_Q212 ..............................................  126  2 hits [g-proteobacteria]       SSU ribosomal protein S5P [Coxiella burnetii CbuG_Q212] >gi
. synthetic construct --------------------------------------------------------  135  1 hit  [other sequences]        ribosomal protein S5 [synthetic construct

BLAST

PROTOCOL

1) BLASTp vs SWISSPROT/ NCBI default parameters

2) BLASTp versus NR / NCBI default parameters apart from "Max target sequences_1000


RESULTS ANALYSIS


I do BLASTp using swissprot and NR of my translated sequence to find that if there exists true homologs of my sequence or not. so with BLASTp and with NR i got very good with the ribosomal protein S5 superfamily. i got approx 1000 hits of which the first hit is best homolog of my sequence with very good e-value that is 2e-36. Best homolog information is


blast results:

Score E

Sequences producing significant alignments: (Bits) Value


ref|ZP_03729651.1| ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1] 154 2e-36


so as we get best homology so this is also a strong evidence that sequence is coding.

blast results:
                                                           Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_03729651.1|  ribosomal protein S5 [Dethiobacter alkalip...   154    2e-36
ref|YP_001716435.1|  ribosomal protein S5 [Candidatus Desulfor...   149    6e-35 
ref|YP_003182513.1|  ribosomal protein S5 [Eggerthella lenta D...   149    8e-35
ref|YP_117000.1|  30S ribosomal protein S5 [Nocardia farcinica...   149    8e-35 
ref|YP_003151356.1|  SSU ribosomal protein S5P [Cryptobacteriu...   149    9e-35 
ref|ZP_02330659.1|  30S ribosomal protein S5 [Paenibacillus la...   148    1e-34
ref|YP_001210886.1|  30S ribosomal protein S5 [Pelotomaculum t...   148    2e-34 
ref|YP_706085.1|  30S ribosomal protein S5 [Rhodococcus jostii...   148    2e-34 
ref|NP_737162.1|  30S ribosomal protein S5 [Corynebacterium ef...   148    2e-34 
ref|YP_431268.1|  30S ribosomal protein S5 [Moorella thermoace...   148    2e-34 
ref|ZP_06160972.1|  ribosomal protein S5 [Slackia exigua ATCC ...   147    2e-34
ref|YP_002507890.1|  ribosomal protein S5 [Halothermothrix ore...   147    2e-34 
ref|YP_056528.1|  30S ribosomal protein S5 [Propionibacterium ...   147    3e-34 
ref|ZP_06264523.1|  ribosomal protein S5 [Propionibacterium ac...   147    3e-34
ref|YP_002765317.1|  30S ribosomal protein S5 [Rhodococcus ery...   147    3e-34 
ref|YP_001111606.1|  30S ribosomal protein S5 [Desulfotomaculu...   147    4e-34 
ref|YP_638202.1|  30S ribosomal protein S5 [Mycobacterium sp. ...   147    5e-34 
ref|ZP_03709653.1|  hypothetical protein CORMATOL_00468 [Coryn...   147    5e-34
ref|YP_267368.1|  ribosomal protein S5 [Colwellia psychrerythr...   147    5e-34 
ref|ZP_01666472.1|  ribosomal protein S5 [Thermosinus carboxyd...   146    5e-34
ref|ZP_04025758.1|  SSU ribosomal protein S5P [Tsukamurella pa...   146    7e-34
ref|NP_215235.1|  30S ribosomal protein S5 [Mycobacterium tube...   146    8e-34 
ref|ZP_03929313.1|  30S ribosomal protein S5 [Acidaminococcus ...   146    8e-34
ref|NP_599779.1|  30S ribosomal protein S5 [Corynebacterium gl...   146    8e-34 
ref|ZP_01173197.1|  30S ribosomal protein S5 [Bacillus sp. NRR...   145    9e-34
ref|ZP_05327555.1|  30S ribosomal protein S5 [Mycobacterium tu...   145    1e-33
ref|ZP_01127986.1|  Ribosomal protein S5 [Nitrococcus mobilis ...   145    1e-33
ref|YP_885854.1|  30S ribosomal protein S5 [Mycobacterium smeg...   145    1e-33 
ref|YP_001849365.1|  30S ribosomal protein S5, RpsE [Mycobacte...   145    2e-33 
ref|ZP_05708027.1|  30S ribosomal protein S5 [Corynebacterium ...   145    2e-33
ref|YP_002514374.1|  30S ribosomal protein S5 [Thioalkalivibri...   145    2e-33 
ref|YP_290685.1|  30S ribosomal protein S5 [Thermobifida fusca...   145    2e-33 
ref|ZP_01894426.1|  30S ribosomal protein S5 [Marinobacter alg...   144    2e-33
ref|YP_904922.1|  30S ribosomal protein S5 [Mycobacterium ulce...   144    2e-33 
ref|YP_001286680.1|  30S ribosomal protein S5 [Mycobacterium t...   144    2e-33 
ref|YP_001002419.1|  ribosomal protein S5 [Halorhodospira halo...   144    4e-33 
ref|NP_938903.1|  30S ribosomal protein S5 [Corynebacterium di...   144    4e-33 
ref|YP_003072524.1|  ribosomal protein S5 [Teredinibacter turn...   144    4e-33 
ref|YP_003189879.1|  ribosomal protein S5 [Desulfotomaculum ac...   143    5e-33 
ref|YP_003245745.1|  ribosomal protein S5 [Geobacillus sp. Y41...   143    5e-33 
ref|ZP_04431246.1|  ribosomal protein S5 [Bacillus coagulans 3...   143    5e-33
ref|ZP_02076758.1|  hypothetical protein EUBDOL_00549 [Eubacte...   143    5e-33
ref|YP_001799745.1|  30S ribosomal protein S5 [Corynebacterium...   143    5e-33 
ref|YP_465137.1|  SSU ribosomal protein S5P [Anaeromyxobacter ...   143    6e-33 
ref|YP_002456942.1|  ribosomal protein S5 [Desulfitobacterium ...   143    6e-33 
ref|YP_003239452.1|  ribosomal protein S5 [Ammonifex degensii ...   143    6e-33 
ref|NP_241017.1|  30S ribosomal protein S5 [Bacillus haloduran...   143    6e-33 
ref|YP_002134307.1|  ribosomal protein S5 [Anaeromyxobacter sp...   143    6e-33 
ref|YP_944789.1|  30S ribosomal protein S5 [Psychromonas ingra...   143    6e-33 
ref|ZP_06186550.1|  ribosomal protein S5 [Legionella longbeach...   143    7e-33
ref|ZP_05847126.1|  30S ribosomal protein S5 [Corynebacterium ...   143    7e-33
ref|YP_251589.1|  30S ribosomal protein S5 [Corynebacterium je...   143    7e-33 
ref|YP_002760402.1|  30S ribosomal protein S5 [Gemmatimonas au...   142    8e-33 
ref|YP_001379115.1|  ribosomal protein S5 [Anaeromyxobacter sp...   142    8e-33 
ref|ZP_03917405.1|  30S ribosomal protein S5 [Corynebacterium ...   142    9e-33
ref|YP_883583.1|  30S ribosomal protein S5 [Mycobacterium aviu...   142    9e-33 
ref|YP_002885987.1|  ribosomal protein S5 [Exiguobacterium sp....   142    9e-33 
ref|ZP_04166862.1|  30S ribosomal protein S5 [Bacillus mycoide...   142    9e-33
ref|YP_948641.1|  ribosomal protein S5 [Arthrobacter aurescens...   142    9e-33 
ref|ZP_04149326.1|  30S ribosomal protein S5 [Bacillus pseudom...   142    9e-33
ref|YP_001643019.1|  30S ribosomal protein S5 [Bacillus weihen...   142    9e-33 
ref|YP_003014356.1|  ribosomal protein S5 [Paenibacillus sp. J...   142    1e-32 
ref|NP_830028.1|  30S ribosomal protein S5 [Bacillus cereus AT...   142    1e-32 
ref|YP_001485379.1|  30S ribosomal protein S5 [Bacillus pumilu...   142    1e-32 
ref|ZP_04746385.1|  30S ribosomal protein S5 [Mycobacterium ka...   142    1e-32
ref|YP_077417.1|  30S ribosomal protein S5 [Bacillus lichenifo...   142    1e-32 
ref|ZP_03979904.1|  30S ribosomal protein S5 [Corynebacterium ...   142    1e-32
ref|YP_003268380.1|  ribosomal protein S5 [Haliangium ochraceu...   142    1e-32 
ref|ZP_03393235.1|  ribosomal protein S5 [Corynebacterium amyc...   142    1e-32
ref|ZP_05223381.1|  30S ribosomal protein S5 [Mycobacterium in...   142    1e-32
ref|ZP_03994295.1|  30S ribosomal protein S5 [Mobiluncus mulie...   142    1e-32
ref|NP_963118.1|  30S ribosomal protein S5 [Mycobacterium aviu...   142    1e-32 
ref|YP_952179.1|  30S ribosomal protein S5 [Mycobacterium vanb...   142    1e-32 
ref|YP_361101.1|  30S ribosomal protein S5 [Carboxydothermus h...   142    1e-32 
ref|NP_842695.1|  30S ribosomal protein S5 [Bacillus anthracis...   142    1e-32 
ref|ZP_03922736.1|  30S ribosomal protein S5 [Mobiluncus curti...   142    1e-32
ref|YP_001419812.1|  30S ribosomal protein S5 [Bacillus amylol...   142    1e-32 
ref|NP_388014.1|  30S ribosomal protein S5 [Bacillus subtilis ...   142    1e-32 
ref|YP_711357.1|  30S ribosomal protein S5 [Frankia alni ACN14...   142    2e-32 
ref|YP_516721.1|  30S ribosomal protein S5 [Desulfitobacterium...   142    2e-32 
ref|ZP_06238246.1|  ribosomal protein S5 [Frankia sp. EuI1c] >...   142    2e-32
ref|YP_479712.1|  30S ribosomal protein S5 [Frankia sp. CcI3] ...   142    2e-32 
ref|YP_001510282.1|  30S ribosomal protein S5 [Frankia sp. EAN...   142    2e-32 
ref|YP_003144688.1|  SSU ribosomal protein S5P [Slackia heliot...   142    2e-32 
ref|YP_002833968.1|  30S ribosomal protein S5 [Corynebacterium...   142    2e-32 
ref|ZP_02171782.1|  ribosomal RNA adenine methylase transferas...   142    2e-32
ref|YP_001136284.1|  30S ribosomal protein S5 [Mycobacterium g...   141    2e-32 
ref|ZP_05373261.1|  ribosomal protein S5 [Geobacillus sp. Y4.1...   141    2e-32
ref|ZP_02443303.1|  hypothetical protein ANACOL_02608 [Anaerot...   141    2e-32
ref|ZP_01688526.1|  ribosomal protein S5 [Microscilla marina A...   141    2e-32
ref|ZP_01737773.1|  30S ribosomal protein S5 [Marinobacter sp....   141    2e-32
ref|YP_958020.1|  30S ribosomal protein S5 [Marinobacter aquae...   141    2e-32 
ref|YP_001124254.1|  ribosomal protein S5 [Geobacillus thermod...   141    2e-32 
ref|YP_002907057.1|  30S ribosomal protein S5 [Corynebacterium...   141    2e-32 
ref|ZP_01726080.1|  30S ribosomal protein S5 [Bacillus sp. B14...   141    2e-32
ref|ZP_04331898.1|  SSU ribosomal protein S5P [Nocardiopsis da...   141    2e-32
ref|YP_002948334.1|  ribosomal protein S5 [Geobacillus sp. WCH...   141    2e-32 
ref|YP_003301869.1|  ribosomal protein S5 [Thermomonospora cur...   141    2e-32 
ref|YP_872083.1|  SSU ribosomal protein S5P [Acidothermus cell...   141    2e-32 
ref|YP_001343089.1|  ribosomal protein S5 [Marinomonas sp. MWY...   141    2e-32 
ref|YP_300770.1|  30S ribosomal protein S5 [Staphylococcus sap...   141    2e-32 
ref|ZP_01313241.1|  ribosomal protein S5 [Desulfuromonas aceto...   141    2e-32
ref|YP_001039311.1|  SSU ribosomal protein S5P [Clostridium th...   141    2e-32 
ref|ZP_01862481.1|  30S ribosomal protein S5 [Bacillus sp. SG-...   141    3e-32
ref|YP_076884.1|  30S ribosomal protein S5 [Symbiobacterium th...   141    3e-32 
ref|ZP_01129332.1|  30S ribosomal protein S5 [marine actinobac...   141    3e-32
ref|ZP_03935284.1|  30S ribosomal protein S5 [Corynebacterium ...   140    3e-32
ref|YP_062838.1|  30S ribosomal protein S5 [Leifsonia xyli sub...   140    3e-32 
ref|ZP_03612400.1|  ribosomal protein S5 [Staphylococcus capit...   140    3e-32
ref|NP_660820.1|  30S ribosomal protein S5 [Buchnera aphidicol...   140    3e-32 
ref|YP_001679983.1|  30S ribosomal protein s5 [Heliobacterium ...   140    3e-32 
ref|YP_437270.1|  30S ribosomal protein S5 [Hahella chejuensis...   140    3e-32 
ref|ZP_01463313.1|  ribosomal protein S5 [Stigmatella aurantia...   140    3e-32
ref|YP_002314491.1|  Ribosomal protein S5 [Anoxybacillus flavi...   140    4e-32 
ref|YP_660586.1|  30S ribosomal protein S5 [Pseudoalteromonas ...   140    4e-32 
ref|ZP_01217480.1|  Ribosomal protein S5 [Psychromonas sp. CNP...   140    4e-32
ref|ZP_04854516.1|  30S ribosomal protein S5 [Paenibacillus sp...   140    4e-32
ref|YP_741319.1|  SSU ribosomal protein S5P [Alkalilimnicola e...   140    4e-32 
ref|YP_003274766.1|  ribosomal protein S5 [Gordonia bronchiali...   140    5e-32 
ref|ZP_03488453.1|  hypothetical protein EUBIFOR_01035 [Eubact...   140    5e-32
ref|YP_173671.1|  30S ribosomal protein S5 [Bacillus clausii K...   140    5e-32 
ref|YP_526450.1|  30S ribosomal protein S5 [Saccharophagus deg...   140    5e-32 
ref|YP_001618596.1|  30S ribosomal protein S5 [Sorangium cellu...   140    6e-32 
ref|YP_145976.1|  30S ribosomal protein S5 [Geobacillus kausto...   140    6e-32 
sp|P02357.1|RS5_BACST  RecName: Full=30S ribosomal protein S5;...   140    6e-32
ref|YP_001223346.1|  30S ribosomal protein S5 [Clavibacter mic...   140    6e-32 
ref|YP_001547689.1|  ribosomal protein S5 [Herpetosiphon auran...   140    6e-32 
ref|YP_001373490.1|  30S ribosomal protein S5 [Bacillus cereus...   139    6e-32 
ref|YP_832438.1|  SSU ribosomal protein S5P [Arthrobacter sp. ...   139    6e-32 
ref|ZP_04484450.1|  SSU ribosomal protein S5P [Stackebrandtia ...   139    7e-32
ref|YP_001709081.1|  30S ribosomal protein S5 [Clavibacter mic...   139    7e-32 
ref|YP_001275525.1|  ribosomal protein S5 [Roseiflexus sp. RS-...   139    7e-32 
pdb|1PKP|A  Chain A, The Structure Of Ribosomal Protein S5 Rev...   139    7e-32 
ref|NP_871563.1|  hypothetical protein WGLp560 [Wigglesworthia...   139    7e-32 
ref|ZP_01448414.1|  30S ribosomal subunit protein S5 [alpha pr...   139    8e-32
ref|ZP_04805847.1|  ribosomal protein S5 [Clostridium cellulov...   139    8e-32
ref|YP_002634809.1|  30S ribosomal protein S5 [Staphylococcus ...   139    8e-32 
pdb|1EG0|B  Chain B, Fitting Of Components With Known Structur...   139    8e-32 
pdb|1QD7|D  Chain D, Partial Model For 30s Ribosomal Subunit >...   139    9e-32 
ref|NP_240314.1|  30S ribosomal protein S5 [Buchnera aphidicol...   139    9e-32 
ref|ZP_03293644.1|  hypothetical protein CLOHIR_01594 [Clostri...   139    9e-32
ref|ZP_03927446.1|  ribosomal protein S5 [Actinomyces urogenit...   139    9e-32
ref|ZP_01910633.1|  ribosomal protein S5 [Plesiocystis pacific...   139    9e-32
ref|NP_765361.1|  30S ribosomal protein S5 [Staphylococcus epi...   139    1e-31 
ref|YP_002125263.1|  30S ribosomal subunit protein S5 [Alterom...   139    1e-31 
ref|ZP_04702563.1|  30S ribosomal protein S5 [Streptomyces alb...   139    1e-31
ref|ZP_02159821.1|  ribosomal protein S5 [Shewanella benthica ...   139    1e-31
ref|YP_002152957.1|  30S ribosomal protein S5 [Proteus mirabil...   139    1e-31 
ref|ZP_04677220.1|  ribosomal protein S5 [Staphylococcus warne...   139    1e-31
ref|YP_572499.1|  30S ribosomal protein S5 [Chromohalobacter s...   138    1e-31 
ref|ZP_05041462.1|  ribosomal protein S5 [Alcanivorax sp. DG88...   138    1e-31
ref|ZP_02962228.1|  hypothetical protein PROSTU_04330 [Provide...   138    2e-31
ref|YP_252734.1|  30S ribosomal protein S5 [Staphylococcus hae...   138    2e-31 
ref|ZP_04059344.1|  ribosomal protein S5 [Staphylococcus homin...   138    2e-31
ref|ZP_03924878.1|  30S ribosomal protein S5 [Actinomyces cole...   138    2e-31
ref|NP_372757.1|  30S ribosomal protein S5 [Staphylococcus aur...   138    2e-31 
ref|ZP_04019624.1|  ribosomal protein S5 [Finegoldia magna ATC...   138    2e-31
ref|ZP_03317126.1|  hypothetical protein PROVALCAL_00030 [Prov...   138    2e-31
ref|NP_302248.1|  30S ribosomal protein S5 [Mycobacterium lepr...   138    2e-31 
ref|YP_001333169.1|  30S ribosomal protein S5 [Staphylococcus ...   138    2e-31 
ref|YP_001625293.1|  SSU ribosomal protein S5P [Renibacterium ...   138    2e-31 
ref|YP_001434060.1|  ribosomal protein S5 [Roseiflexus castenh...   138    2e-31 
ref|YP_002934940.1|  30S ribosomal protein S5 (BS5) [Edwardsie...   138    2e-31 
ref|YP_802871.1|  30S ribosomal protein S5 [Buchnera aphidicol...   138    2e-31 
ref|YP_001981225.1|  30S ribosomal protein S5 [Cellvibrio japo...   138    2e-31 
ref|YP_001691480.1|  30S ribosomal protein S5 [Finegoldia magn...   138    2e-31 
ref|ZP_06156726.1|  SSU ribosomal protein S5p (S2e) [Photobact...   138    2e-31
ref|YP_001704524.1|  30S ribosomal protein S5 [Mycobacterium a...   138    2e-31 
ref|YP_001916398.1|  SSU ribosomal protein S5P [Natranaerobius...   138    2e-31 
ref|ZP_03805017.1|  hypothetical protein PROPEN_03408 [Proteus...   138    2e-31
ref|YP_094390.1|  30S ribosomal protein S5 [Legionella pneumop...   138    2e-31 
ref|YP_003319311.1|  ribosomal protein S5 [Sphaerobacter therm...   138    2e-31 
ref|ZP_03705460.1|  hypothetical protein CLOSTMETH_00171 [Clos...   138    2e-31
ref|NP_349715.1|  30S ribosomal protein S5 [Clostridium acetob...   138    2e-31 
ref|ZP_02043489.1|  hypothetical protein ACTODO_00329 [Actinom...   138    2e-31
ref|ZP_05096661.1|  ribosomal protein S5 [marine gamma proteob...   138    2e-31
ref|ZP_06162843.1|  ribosomal protein S5 [Actinomyces sp. oral...   137    2e-31
ref|NP_931871.1|  30S ribosomal protein S5 [Photorhabdus lumin...   137    3e-31 
ref|YP_002488725.1|  ribosomal protein S5 [Arthrobacter chloro...   137    3e-31 
ref|YP_003002709.1|  ribosomal protein S5 [Dickeya zeae Ech159...   137    3e-31 
ref|YP_052101.1|  30S ribosomal protein S5 [Pectobacterium atr...   137    3e-31 
ref|YP_002769719.1|  30S ribosomal protein S5 [Brevibacillus b...   137    3e-31 
ref|YP_692134.1|  30S ribosomal protein S5 [Alcanivorax borkum...   137    3e-31 
ref|ZP_04559119.1|  30S ribosomal protein S5 [Citrobacter sp. ...   137    3e-31
ref|YP_002650338.1|  30S ribosomal protein S5 [Erwinia pyrifol...   137    4e-31 
ref|YP_001337356.1|  30S ribosomal protein S5 [Klebsiella pneu...   137    4e-31 
ref|ZP_03908020.1|  SSU ribosomal protein S5P [Denitrovibrio a...   137    4e-31
ref|YP_003336845.1|  Ribosomal protein S5-like protein [Strept...   137    4e-31 
gb|AAR05296.1|  ribosomal protein S5 [uncultured marine gamma ...   137    4e-31
ref|YP_455941.1|  30S ribosomal protein S5 [Sodalis glossinidi...   137    4e-31 
ref|YP_002559615.1|  30S ribosomal protein S5 [Macrococcus cas...   137    4e-31 
ref|YP_001500065.1|  30S ribosomal protein S5 [Shewanella peal...   137    4e-31 
sp|Q89A82.2|RS5_BUCBP  RecName: Full=30S ribosomal protein S5       137    4e-31
ref|YP_003255194.1|  ribosomal protein S5 [Aggregatibacter act...   137    4e-31 
ref|NP_778051.1|  30S ribosomal protein S5 [Buchnera aphidicol...   137    5e-31 
ref|YP_754978.1|  ribosomal protein S5 [Syntrophomonas wolfei ...   137    5e-31 
ref|YP_001763018.1|  ribosomal protein S5 [Shewanella woodyi A...   137    5e-31 
ref|YP_002311371.1|  Ribosomal protein S5 [Shewanella piezotol...   137    5e-31 
gb|AAS73101.1|  predicted ribosomal protein S5 [uncultured mar...   137    5e-31
ref|ZP_02929379.1|  ribosomal protein S5 [Verrucomicrobium spi...   137    5e-31
ref|YP_356147.1|  30S ribosomal protein S5 [Pelobacter carbino...   137    5e-31 
ref|YP_001476032.1|  30S ribosomal protein S5 [Shewanella sedi...   137    5e-31 
ref|ZP_04991440.1|  30S ribosomal protein S5 [Streptomyces sp....   137    5e-31
ref|YP_263803.1|  30S ribosomal protein S5 [Psychrobacter arct...   136    5e-31 
ref|ZP_05393502.1|  ribosomal protein S5 [Clostridium carboxid...   136    6e-31
ref|YP_001092306.1|  30S ribosomal protein S5 [Shewanella loih...   136    6e-31 
ref|ZP_05072213.1|  ribosomal protein S5 [Campylobacterales ba...   136    6e-31
ref|YP_001393643.1|  30S ribosomal protein S5 [Clostridium klu...   136    6e-31 
ref|YP_002137767.1|  ribosomal protein S5 [Geobacter bemidjien...   136    6e-31 
ref|YP_854860.1|  ribosomal protein S5 [Aeromonas hydrophila s...   136    6e-31 
ref|YP_404948.1|  30S ribosomal protein S5 [Shigella dysenteri...   136    6e-31 
ref|YP_003043028.1|  30S ribosomal subunit protein S5 [Photorh...   136    6e-31 
ref|ZP_05334482.1|  ribosomal protein S5 [Thermoanaerobacter i...   136    6e-31
ref|YP_631515.1|  ribosomal protein S5 [Myxococcus xanthus DK ...   136    6e-31 
ref|YP_002986057.1|  ribosomal protein S5 [Dickeya dadantii Ec...   136    6e-31 
ref|ZP_02210572.1|  hypothetical protein CLOBAR_00111 [Clostri...   136    7e-31
ref|ZP_01222935.1|  putative ribosomal subunit protein S5 [Pho...   136    7e-31
ref|YP_561207.1|  30S ribosomal protein S5 [Shewanella denitri...   136    7e-31 
ref|YP_001181039.1|  ribosomal protein S5 [Caldicellulosirupto...   136    7e-31 
ref|YP_001812617.1|  ribosomal protein S5 [Exiguobacterium sib...   136    8e-31 
ref|ZP_02001241.1|  Ribosomal protein S5 [Beggiatoa sp. PS] >g...   136    8e-31
ref|YP_128578.1|  putative ribosomal subunit protein S5 [Photo...   136    8e-31 
ref|YP_002573595.1|  ribosomal protein S5 [Anaerocellum thermo...   136    8e-31 
pdb|2GY9|E  Chain E, Structure Of The 30s Subunit Of A Pre-Tra...   136    9e-31 
ref|ZP_05921129.1|  30S ribosomal protein S5 [Pasteurella dagm...   136    9e-31
ref|YP_003008577.1|  ribosomal protein S5 [Aggregatibacter aph...   136    9e-31 
ref|NP_715888.1|  30S ribosomal protein S5 [Shewanella oneiden...   135    9e-31 
ref|ZP_04817454.1|  30S ribosomal protein S5 [Staphylococcus e...   135    9e-31
ref|ZP_04599066.1|  hypothetical protein VEIDISOL_00475 [Veill...   135    9e-31
ref|YP_001143759.1|  ribosomal protein S5 [Aeromonas salmonici...   135    9e-31 
ref|ZP_05898156.1|  ribosomal protein S5 [Selenomonas sputigen...   135    9e-31
ref|ZP_05619338.1|  ribosomal protein S5 [Enhydrobacter aerosa...   135    9e-31
ref|ZP_04774454.1|  ribosomal protein S5 [Allochromatium vinos...   135    9e-31
ref|YP_718283.1|  30S ribosomal protein S5 [Haemophilus somnus...   135    9e-31 
ref|ZP_05732255.1|  ribosomal protein S5 [Pantoea sp. At-9b] >...   135    9e-31
ref|ZP_05623815.1|  ribosomal protein S5 [Campylobacter gracil...   135    9e-31
ref|YP_341292.1|  30S ribosomal protein S5 [Pseudoalteromonas ...   135    9e-31 
ref|ZP_01162648.1|  putative ribosomal subunit protein S5 [Pho...   135    1e-30
ref|ZP_05970631.1|  30S ribosomal subunit protein S5 [Enteroba...   135    1e-30
ref|ZP_03248016.1|  ribosomal protein S5 [Escherichia coli O15...   135    1e-30
pdb|3FIH|E  Chain E, Ternary Complex-Bound E.Coli 70s Ribosome...   135    1e-30 
ref|ZP_04863477.1|  ribosomal protein S5 [Clostridium botulinu...   135    1e-30
ref|NP_289864.1|  30S ribosomal protein S5 [Escherichia coli O...   135    1e-30 
ref|ZP_01044191.1|  Ribosomal protein S5 [Idiomarina baltica O...   135    1e-30
ref|YP_003034704.1|  ribosomal protein S5 [Escherichia coli BL...   135    1e-30 
ref|ZP_01136103.1|  30S ribosomal subunit protein S5 [Pseudoal...   135    1e-30
ref|ZP_03407542.1|  30S ribosomal protein S5 [Salmonella enter...   135    1e-30
ref|YP_003109056.1|  ribosomal protein S5 [Acidimicrobium ferr...   135    1e-30 
pdb|1P6G|E  Chain E, Real Space Refined Coordinates Of The 30s...   135    1e-30 
ref|ZP_06143303.1|  30S ribosomal protein S5 [Ruminococcus fla...   135    1e-30
ref|YP_001307314.1|  30S ribosomal protein S5 [Clostridium bei...   135    1e-30 
pdb|3E1A|S  Chain S, Structure Of The 30s Subunit And The Trna...   135    1e-30 
gb|AAV39592.1|  ribosomal protein S5 [synthetic construct]          135    1e-30
ref|YP_001884490.1|  30S ribosomal protein S5 [Clostridium bot...   135    1e-30 
ref|ZP_06051176.1|  SSU ribosomal protein S5p (S2e) [Grimontia...   135    1e-30
ref|ZP_02094850.1|  hypothetical protein PEPMIC_01618 [Parvimo...   135    1e-30
ref|NP_246337.1|  30S ribosomal protein S5 [Pasteurella multoc...   135    1e-30 
ref|ZP_03736732.1|  ribosomal protein S5 [Desulfonatronospira ...   135    1e-30
ref|ZP_05989257.1|  ribosomal protein S5 [Mannheimia haemolyti...   135    1e-30
ref|ZP_00204534.1|  COG0098: Ribosomal protein S5 [Actinobacil...   135    1e-30
ref|YP_001355711.1|  30S ribosomal protein S5 [Nitratiruptor s...   135    1e-30 
ref|YP_001197459.1|  30S ribosomal protein S5 [Streptococcus s...   135    1e-30 
ref|YP_961580.1|  30S ribosomal protein S5 [Shewanella sp. W3-...   135    1e-30 
ref|YP_001436169.1|  30S ribosomal protein S5 [Enterobacter sa...   135    1e-30 
ref|YP_926111.1|  30S ribosomal protein S5 [Shewanella amazone...   135    1e-30 
ref|YP_588793.1|  ribosomal protein S5 [Baumannia cicadellinic...   135    1e-30 
ref|YP_002434525.1|  30S ribosomal protein S5 [Desulfovibrio v...   135    1e-30 
ref|YP_001909058.1|  30S ribosomal protein S5 [Erwinia tasmani...   135    1e-30 
ref|ZP_03634098.1|  hypothetical protein HOLDEFILI_01379 [Hold...   135    1e-30
ref|ZP_01102072.1|  30S ribosomal protein S5 [Congregibacter l...   135    2e-30
ref|YP_925073.1|  SSU ribosomal protein S5P [Nocardioides sp. ...   135    2e-30 
ref|NP_671300.1|  30S ribosomal protein S5 [Yersinia pestis KI...   135    2e-30 
ref|YP_001008051.1|  30S ribosomal protein S5 [Yersinia entero...   135    2e-30 
ref|ZP_05128986.1|  ribosomal protein S5 [gamma proteobacteriu...   135    2e-30
ref|YP_001480748.1|  30S ribosomal protein S5 [Serratia protea...   135    2e-30 
ref|ZP_03494166.1|  ribosomal protein S5 [Alicyclobacillus aci...   135    2e-30
ref|ZP_04627209.1|  hypothetical protein yberc0001_2690 [Yersi...   135    2e-30
ref|ZP_04619952.1|  hypothetical protein yaldo0001_31940 [Yers...   135    2e-30
ref|ZP_04615549.1|  hypothetical protein yruck0001_27940 [Yers...   135    2e-30
ref|YP_001343787.1|  30S ribosomal protein S5 [Actinobacillus ...   135    2e-30 
ref|YP_001854485.1|  30S ribosomal protein S5 [Kocuria rhizoph...   134    2e-30 
ref|YP_001451218.1|  30S ribosomal protein S5 [Streptococcus g...   134    2e-30 
ref|YP_002924592.1|  30S ribosomal subunit protein S5 [Candida...   134    2e-30 
ref|YP_001178442.1|  30S ribosomal protein S5 [Enterobacter sp...   134    2e-30 
ref|YP_156280.1|  30S ribosomal protein S5 [Idiomarina loihien...   134    2e-30 
ref|NP_691057.1|  30S ribosomal protein S5 [Oceanobacillus ihe...   134    2e-30 
ref|ZP_01614314.1|  30S ribosomal subunit protein S5 [Alteromo...   134    2e-30
ref|YP_003317681.1|  ribosomal protein S5 [Thermanaerovibrio a...   134    3e-30 
ref|ZP_01618193.1|  ribosomal protein S5 [marine gamma proteob...   134    3e-30
ref|ZP_02950096.1|  ribosomal protein S5 [Clostridium butyricu...   134    3e-30
ref|YP_002561457.1|  30S ribosomal protein S5 [Streptococcus u...   134    3e-30 
ref|ZP_02862839.1|  hypothetical protein ANASTE_02066 [Anaerof...   134    3e-30
ref|NP_438954.1|  30S ribosomal protein S5 [Haemophilus influe...   134    3e-30 
ref|YP_001996016.1|  ribosomal protein S5 [Chloroherpeton thal...   134    3e-30 
ref|YP_001052487.1|  ribosomal protein S5 [Shewanella baltica ...   134    3e-30 
ref|YP_002261869.1|  30S ribosomal protein S5 [Aliivibrio salm...   134    3e-30 
ref|ZP_05888376.1|  SSU ribosomal protein S5p (S2e) [Vibrio co...   134    3e-30
ref|YP_002995835.1|  30S ribosomal protein S5 [Streptococcus d...   134    4e-30 
ref|ZP_02622432.1|  ribosomal protein S5 [Clostridium botulinu...   134    4e-30
ref|ZP_03689637.1|  ribosomal protein S5 [Thioalkalivibrio sp....   134    4e-30
ref|YP_388732.1|  30S ribosomal protein S5 [Desulfovibrio desu...   134    4e-30 
ref|ZP_02478101.1|  30S ribosomal protein S5 [Haemophilus para...   134    4e-30
ref|YP_392819.1|  30S ribosomal protein S5 [Sulfurimonas denit...   134    4e-30 
ref|YP_001664396.1|  ribosomal protein S5 [Thermoanaerobacter ...   134    4e-30 
ref|NP_874290.1|  30S ribosomal protein S5 [Haemophilus ducrey...   134    4e-30 
ref|ZP_03726229.1|  Ribosomal protein S5-like protein [Opituta...   134    4e-30
ref|YP_001489703.1|  30S ribosomal protein S5 [Arcobacter butz...   134    4e-30 
ref|YP_877215.1|  30S ribosomal protein S5 [Clostridium novyi ...   134    4e-30 
ref|ZP_06198232.1|  ribosomal protein S5 [Streptococcus sp. M1...   134    4e-30
ref|YP_002891332.1|  ribosomal protein S5 [Tolumonas auensis D...   134    4e-30 
ref|ZP_03612201.1|  30S ribosomal protein S5 [Actinobacillus m...   134    4e-30
ref|ZP_05495994.1|  ribosomal protein S5 [Clostridium papyroso...   134    4e-30
ref|YP_001034136.1|  30S ribosomal protein S5 [Streptococcus s...   133    5e-30 
ref|ZP_05367936.1|  30S ribosomal protein S5 [Rothia mucilagin...   133    5e-30
ref|YP_003198910.1|  ribosomal protein S5 [Desulfohalobium ret...   133    5e-30 
ref|ZP_05129543.1|  ribosomal protein S5 [Clostridium sp. 7_2_...   133    5e-30
ref|YP_089223.1|  30S ribosomal protein S5 [Mannheimia succini...   133    5e-30 
ref|YP_595350.1|  30S ribosomal protein S5 [Lawsonia intracell...   133    5e-30 
ref|YP_344295.1|  30S ribosomal protein S5 [Nitrosococcus ocea...   133    5e-30 
ref|YP_002604838.1|  RpsE [Desulfobacterium autotrophicum HRM2...   133    5e-30 
ref|YP_203637.1|  30S ribosomal subunit protein S5 [Vibrio fis...   133    6e-30 
ref|NP_268477.1|  30S ribosomal protein S5 [Streptococcus pyog...   133    6e-30 
ref|ZP_04049100.1|  SSU ribosomal protein S5P [Brachyspira mur...   133    6e-30
emb|CAA11205.1|  ribosomal protein S5 [Salmonella typhimurium]      133    6e-30
ref|YP_002505133.1|  ribosomal protein S5 [Clostridium cellulo...   133    6e-30 
ref|YP_001409137.1|  30S ribosomal protein S5 [Campylobacter c...   133    7e-30 
ref|YP_001022614.1|  SSU ribosomal protein S5P [Methylibium pe...   133    7e-30 
ref|ZP_05292840.1|  SSU ribosomal protein S5p (S2e) [Acidithio...   132    8e-30
ref|YP_001086554.1|  30S ribosomal protein S5 [Clostridium dif...   132    8e-30 
ref|ZP_05881030.1|  SSU ribosomal protein S5p (S2e) [Vibrio me...   132    8e-30
ref|ZP_04978862.1|  ribosomal protein S5 [Mannheimia haemolyti...   132    8e-30
ref|ZP_02079575.1|  hypothetical protein CLOLEP_01019 [Clostri...   132    9e-30
ref|YP_845694.1|  ribosomal protein S5 [Syntrophobacter fumaro...   132    9e-30 
ref|NP_466138.1|  30S ribosomal protein S5 [Listeria monocytog...   132    9e-30 
ref|YP_644894.1|  SSU ribosomal protein S5P [Rubrobacter xylan...   132    9e-30 
ref|ZP_05879859.1|  SSU ribosomal protein S5p (S2e) [Vibrio fu...   132    1e-29
ref|YP_002352892.1|  ribosomal protein S5 [Dictyoglomus turgid...   132    1e-29 
ref|ZP_01870587.1|  30S ribosomal protein S5 [Vibrio shilonii ...   132    1e-29
ref|NP_796653.1|  30S ribosomal protein S5 [Vibrio parahaemoly...   132    1e-29 
ref|ZP_01262860.1|  30S ribosomal protein S5 [Vibrio alginolyt...   132    1e-29
ref|YP_002722302.1|  30S ribosomal protein S5 [Brachyspira hyo...   132    1e-29 
ref|NP_907827.1|  30S ribosomal protein S5 [Wolinella succinog...   132    1e-29 
ref|YP_003046339.1|  30S ribosomal protein S5 [Escherichia col...   132    1e-29 
ref|YP_002250718.1|  ribosomal protein S5 [Dictyoglomus thermo...   132    1e-29 
ref|NP_472093.1|  30S ribosomal protein S5 [Listeria innocua C...   132    1e-29 
ref|ZP_05942975.1|  SSU ribosomal protein S5p (S2e) [Vibrio or...   132    1e-29
ref|YP_002122469.1|  30S ribosomal protein S5 [Streptococcus e...   132    1e-29 
ref|NP_344767.1|  30S ribosomal protein S5 [Streptococcus pneu...   132    1e-29 
ref|YP_001405714.1|  30S ribosomal protein S5 [Campylobacter h...   132    1e-29 
ref|NP_252936.1|  30S ribosomal protein S5 [Pseudomonas aerugi...   132    1e-29 
ref|YP_002797868.1|  30S ribosomal protein S5 [Azotobacter vin...   132    1e-29 
ref|ZP_03222474.1|  30S ribosomal protein S5 [Campylobacter je...   132    1e-29
gb|AAB59115.1|  spc ORF1; S5 [Bacillus subtilis]                    132    1e-29
ref|YP_001189371.1|  30S ribosomal protein S5 [Pseudomonas men...   132    2e-29 
ref|YP_374129.1|  30S ribosomal protein S5 [Chlorobium luteolu...   132    2e-29 
ref|ZP_01225504.1|  30S ribosomal protein S5 [marine gamma pro...   132    2e-29
ref|YP_179828.1|  30S ribosomal protein S5 [Campylobacter jeju...   132    2e-29 
ref|ZP_03608786.1|  ribosomal protein S5 [Campylobacter rectus...   132    2e-29
ref|YP_001467703.1|  30S ribosomal protein S5 [Campylobacter c...   132    2e-29 
ref|YP_001129787.1|  30S ribosomal protein S5 [Prosthecochlori...   132    2e-29 
ref|ZP_04444907.1|  30S ribosomal protein S5 [Listeria grayi D...   132    2e-29
ref|ZP_05337139.1|  ribosomal protein S5 [Thermoanaerobacteriu...   132    2e-29
ref|ZP_06245185.1|  ribosomal protein S5 [Victivallis vadensis...   131    2e-29
ref|YP_001528612.1|  ribosomal protein S5 [Desulfococcus oleov...   131    2e-29 
ref|YP_001997821.1|  ribosomal protein S5 [Chlorobaculum parvu...   131    2e-29 
ref|NP_759725.1|  30S ribosomal protein S5 [Vibrio vulnificus ...   131    2e-29 
ref|YP_350790.1|  30S ribosomal protein S5 [Pseudomonas fluore...   131    2e-29 
ref|NP_663046.1|  30S ribosomal protein S5 [Chlorobium tepidum...   131    2e-29 
ref|YP_262633.1|  30S ribosomal protein S5 [Pseudomonas fluore...   131    2e-29 
ref|ZP_01386382.1|  ribosomal protein S5 [Chlorobium ferrooxid...   131    2e-29
ref|NP_623814.1|  ribosomal protein S5 [Thermoanaerobacter ten...   131    2e-29 
ref|NP_742637.1|  30S ribosomal protein S5 [Pseudomonas putida...   131    2e-29 
ref|YP_002016704.1|  ribosomal protein S5 [Prosthecochloris ae...   131    2e-29 
ref|YP_002875005.1|  30S ribosomal protein S5 [Pseudomonas flu...   131    2e-29 
ref|ZP_01307501.1|  ribosomal protein S5 [Oceanobacter sp. RED...   131    2e-29
ref|ZP_04581699.1|  ribosomal protein S5 [Helicobacter bilis A...   131    2e-29
ref|ZP_02167895.1|  30S ribosomal protein S5 [Hoeflea phototro...   131    2e-29
ref|ZP_04776297.1|  ribosomal protein S5 [Gemella haemolysans ...   131    2e-29
ref|YP_003159249.1|  ribosomal protein S5 [Desulfomicrobium ba...   131    2e-29 
ref|YP_001839327.1|  30S ribosomal protein S5 [Leptospira bifl...   131    2e-29 
ref|YP_002990804.1|  ribosomal protein S5 [Desulfovibrio salex...   131    3e-29 
ref|NP_790490.1|  ribosomal protein S5 [Pseudomonas syringae p...   131    3e-29 
ref|YP_002464303.1|  ribosomal protein S5 [Chloroflexus aggreg...   131    3e-29 
ref|YP_606270.1|  30S ribosomal protein S5 [Pseudomonas entomo...   131    3e-29 
ref|YP_001960664.1|  ribosomal protein S5 [Chlorobium phaeobac...   131    3e-29 
ref|YP_010539.1|  30S ribosomal protein S5 [Desulfovibrio vulg...   131    3e-29 
ref|ZP_00993277.1|  30S ribosomal protein S5 [Vibrio splendidu...   131    3e-29
ref|YP_002027161.1|  ribosomal protein S5 [Stenotrophomonas ma...   131    3e-29 
ref|ZP_01816660.1|  30S ribosomal protein S5 [Vibrionales bact...   130    3e-29
ref|NP_232207.1|  30S ribosomal protein S5 [Vibrio cholerae O1...   130    3e-29 
ref|ZP_00371268.1|  ribosomal protein S5 [Campylobacter upsali...   130    3e-29
ref|YP_891261.1|  30S ribosomal protein S5 [Campylobacter fetu...   130    3e-29 
ref|YP_002574693.1|  30S ribosomal protein S5 [Campylobacter l...   130    3e-29 
ref|YP_002539050.1|  ribosomal protein S5 [Geobacter sp. FRC-3...   130    3e-29 
ref|YP_003262250.1|  ribosomal protein S5 [Halothiobacillus ne...   130    4e-29 
ref|NP_953883.1|  30S ribosomal protein S5 [Geobacter sulfurre...   130    4e-29 
ref|NP_563304.1|  30S ribosomal protein S5 [Clostridium perfri...   130    4e-29 
ref|ZP_03658272.1|  30S ribosomal protein S5 [Helicobacter cin...   130    4e-29
ref|ZP_05135568.1|  ribosomal protein S5 [Stenotrophomonas sp....   130    4e-29
ref|ZP_06291114.1|  ribosomal protein S5 [Peptoniphilus lacrim...   130    4e-29
ref|YP_001970806.1|  putative 30S ribosomal subunit protein S5...   130    4e-29 
ref|YP_912818.1|  30S ribosomal protein S5 [Chlorobium phaeoba...   130    4e-29 
ref|YP_001635984.1|  ribosomal protein S5 [Chloroflexus aurant...   130    4e-29 
ref|YP_002017256.1|  ribosomal protein S5 [Pelodictyon phaeocl...   130    4e-29 
ref|YP_003305001.1|  ribosomal protein S5 [Sulfurospirillum de...   130    4e-29 
ref|YP_003322471.1|  ribosomal protein S5 [Thermobaculum terre...   130    4e-29
ref|YP_380128.1|  30S ribosomal protein S5 [Chlorobium chloroc...   130    4e-29 
emb|CBA15060.1|  probable 30s ribosomal protein s5 [Xanthomona...   130    5e-29
ref|YP_003329916.1|  ribosomal protein S5 [Dehalococcoides sp....   130    5e-29 
ref|YP_181235.1|  30S ribosomal protein S5 [Dehalococcoides et...   130    5e-29 
ref|ZP_03324722.1|  hypothetical protein BIFCAT_01523 [Bifidob...   130    5e-29
sp|A3M967.2|RS5_ACIBT  RecName: Full=30S ribosomal protein S5       130    5e-29
ref|ZP_05404929.2|  ribosomal protein S5 [Mitsuokella multacid...   130    5e-29
ref|ZP_02037279.1|  hypothetical protein BACCAP_02893 [Bactero...   130    5e-29
ref|ZP_06057992.1|  30S ribosomal protein S5 [Acinetobacter ca...   130    5e-29
ref|ZP_02917063.1|  hypothetical protein BIFDEN_00331 [Bifidob...   130    6e-29
ref|YP_002431063.1|  ribosomal protein S5 [Desulfatibacillum a...   130    6e-29 
ref|ZP_03127339.1|  ribosomal protein S5 [Chthoniobacter flavu...   130    6e-29
ref|YP_001706103.1|  30S ribosomal protein S5 [Acinetobacter b...   130    6e-29 
ref|YP_047708.1|  30S ribosomal protein S5 [Acinetobacter sp. ...   130    6e-29 
ref|YP_002952614.1|  30S ribosomal protein S5 [Desulfovibrio m...   130    6e-29 
ref|ZP_01116742.1|  ribosomal protein S5 [Reinekea sp. MED297]...   129    6e-29
gb|ABO13461.2|  30S ribosomal protein S5 [Acinetobacter bauman...   129    7e-29 
ref|NP_860926.1|  30S ribosomal protein S5 [Helicobacter hepat...   129    7e-29 
gb|ACX98387.1|  ribosomal protein S5 [Helicobacter pylori 51]       129    7e-29
ref|ZP_03931200.1|  ribosomal protein S5 [Anaerococcus tetradi...   129    7e-29
ref|YP_001944215.1|  ribosomal protein S5 [Chlorobium limicola...   129    7e-29 
ref|YP_001279348.1|  30S ribosomal protein S5 [Psychrobacter s...   129    7e-29 
ref|YP_307572.1|  30S ribosomal protein S5 [Dehalococcoides sp...   129    7e-29 
ref|ZP_03439048.1|  hypothetical protein HP9810_899g56 [Helico...   129    7e-29
ref|YP_001939353.1|  Ribosomal protein S5 [Methylacidiphilum i...   129    7e-29 
ref|NP_223940.1|  30S ribosomal protein S5 [Helicobacter pylor...   129    8e-29 
ref|YP_003145642.1|  ribosomal protein S5 [Kangiella koreensis...   129    8e-29 
ref|YP_001792951.1|  ribosomal protein S5 [Leptothrix cholodni...   129    8e-29 
ref|YP_460366.1|  SSU ribosomal protein S5P [Syntrophus acidit...   129    8e-29 
ref|YP_001229862.1|  30S ribosomal protein S5 [Geobacter urani...   129    8e-29 
ref|ZP_04956861.1|  ribosomal protein S5 [gamma proteobacteriu...   129    8e-29
ref|YP_001956043.1|  30S ribosomal protein S5 [uncultured Term...   129    9e-29 
ref|YP_003153299.1|  ribosomal protein S5 [Anaerococcus prevot...   129    1e-28 
ref|YP_002266865.1|  ribosomal protein S5 [Helicobacter pylori...   129    1e-28 
ref|YP_002469257.1|  ribosomal protein S5 [Bifidobacterium ani...   129    1e-28 
ref|ZP_02963330.1|  30S ribosomal protein S5 [Bifidobacterium ...   129    1e-28
ref|ZP_05646199.1|  ribosomal protein S5 [Enterococcus casseli...   129    1e-28
ref|NP_814021.1|  ribosomal protein S5 [Enterococcus faecalis ...   129    1e-28 
ref|ZP_01625026.1|  30S ribosomal protein S5 [marine gamma pro...   129    1e-28
ref|ZP_00652773.1|  Ribosomal protein S5, bacterial and organe...   129    1e-28
ref|YP_276689.1|  30S ribosomal protein S5 [Pseudomonas syring...   129    1e-28 
ref|ZP_04425298.1|  SSU ribosomal protein S5P [Planctomyces li...   129    1e-28
ref|YP_001741191.1|  30S ribosomal subunit protein S5 [Candida...   129    1e-28 
ref|YP_664003.1|  30S ribosomal protein S5 [Helicobacter acino...   129    1e-28 
ref|YP_383610.1|  30S ribosomal protein S5 [Geobacter metallir...   128    1e-28 
ref|NP_298459.1|  30S ribosomal protein S5 [Xylella fastidiosa...   128    1e-28 
ref|NP_696750.1|  30S ribosomal protein S5 [Bifidobacterium lo...   128    2e-28 
ref|YP_001512067.1|  ribosomal protein S5 [Alkaliphilus oremla...   128    2e-28 
ref|YP_001255945.1|  ribosomal protein S5 [Clostridium botulin...   128    2e-28 
ref|YP_001955667.1|  30S ribosomal protein S5 [Bifidobacterium...   128    2e-28 
ref|YP_001783104.1|  30S ribosomal protein S5 [Clostridium bot...   128    2e-28 
ref|YP_064878.1|  30S ribosomal protein S5 [Desulfotalea psych...   128    2e-28 
ref|ZP_01552665.1|  30S ribosomal protein S5 [Methylophilales ...   128    2e-28
ref|YP_001951604.1|  ribosomal protein S5 [Geobacter lovleyi S...   128    2e-28 
ref|ZP_04339693.1|  SSU ribosomal protein S5P [Dethiosulfovibr...   128    2e-28
ref|ZP_03985917.1|  ribosomal protein S5 [Enterococcus faecali...   128    2e-28
ref|ZP_05733504.1|  ribosomal protein S5 [Dialister invisus DS...   128    2e-28
ref|ZP_06003854.1|  30S ribosomal protein S5 [Selenomonas noxi...   128    2e-28
ref|YP_053380.1|  30S ribosomal protein S5 [Mesoplasma florum ...   127    2e-28 
ref|YP_001171340.1|  30S ribosomal protein S5 [Pseudomonas stu...   127    3e-28 
ref|YP_674221.1|  30S ribosomal protein S5 [Mesorhizobium sp. ...   127    3e-28 
ref|YP_002522185.1|  ribosomal protein S5 [Thermomicrobium ros...   127    3e-28 
ref|YP_002249228.1|  ribosomal protein S5 [Thermodesulfovibrio...   127    3e-28 
ref|ZP_04448505.1|  hypothetical protein BIFANG_03521 [Bifidob...   127    3e-28
ref|ZP_05902840.1|  hypothetical protein GCWU000323_02792 [Lep...   127    3e-28
ref|ZP_00604248.1|  Ribosomal protein S5, bacterial and organe...   127    3e-28
ref|YP_810218.1|  SSU ribosomal protein S5P [Oenococcus oeni P...   127    3e-28 
ref|NP_778684.1|  30S ribosomal protein S5 [Xylella fastidiosa...   127    3e-28 
ref|YP_114771.1|  30S ribosomal protein S5 [Methylococcus caps...   127    3e-28 
ref|YP_003290144.1|  ribosomal protein S5 [Rhodothermus marinu...   127    3e-28 
ref|YP_001620106.1|  small subunit ribosomal protein S5 [Achol...   127    3e-28 
ref|ZP_04038329.1|  SSU ribosomal protein S5P [Meiothermus rub...   127    4e-28
ref|YP_003163167.1|  ribosomal protein S5 [Leptotrichia buccal...   127    4e-28 
ref|ZP_05062754.1|  ribosomal protein S5 [gamma proteobacteriu...   127    4e-28
ref|NP_636298.1|  30S ribosomal protein S5 [Xanthomonas campes...   127    4e-28 
ref|ZP_05966146.1|  ribosomal protein S5 [Bifidobacterium gall...   127    5e-28
ref|YP_002247317.1|  ribosomal protein S5 [Coprothermobacter p...   127    5e-28 
ref|YP_909201.1|  30S ribosomal protein S5 [Bifidobacterium ad...   127    5e-28 
sp|Q72NH8.2|RS5_LEPIC  RecName: Full=30S ribosomal protein S5       127    5e-28
ref|ZP_04583486.1|  ribosomal protein S5 [Helicobacter wingham...   127    5e-28
sp|Q9XD19.2|RS5_LEPIN  RecName: Full=30S ribosomal protein S5       126    6e-28
ref|YP_795779.1|  30S ribosomal protein S5 [Lactobacillus brev...   126    6e-28 
ref|NP_710937.1|  30S ribosomal protein S5 [Leptospira interro...   126    6e-28 
ref|ZP_03495625.1|  ribosomal protein S5 [Thermus aquaticus Y5...   126    6e-28
ref|YP_001322192.1|  ribosomal protein S5 [Alkaliphilus metall...   126    6e-28 
ref|ZP_04659898.1|  30S ribosomal protein S5 [Selenomonas flue...   126    7e-28
ref|YP_003180163.1|  ribosomal protein S5 [Atopobium parvulum ...   126    7e-28
ref|ZP_03655908.1|  30S ribosomal protein S5 [Helicobacter can...   126    7e-28
ref|YP_001877543.1|  ribosomal protein S5 [Akkermansia mucinip...   126    7e-28 
ref|YP_757008.1|  30S ribosomal protein S5 [Maricaulis maris M...   126    7e-28 
ref|YP_002772.1|  30S ribosomal protein S5 [Leptospira interro...   126    7e-28 
ref|YP_001414018.1|  ribosomal protein S5 [Parvibaculum lavame...   126    8e-28 
ref|YP_002957741.1|  SSU ribosomal protein S5P [Micrococcus lu...   126    8e-28 
ref|YP_002304169.1|  SSU ribosomal protein S5P [Coxiella burne...   126    8e-28 
ref|NP_878507.1|  30S ribosomal subunit protein S5 [Candidatus...   126    8e-28 
ref|YP_396362.1|  30S ribosomal protein S5 [Lactobacillus sake...   126    9e-28 
ref|NP_819299.1|  SSU ribosomal protein S5P [Coxiella burnetii...   126    9e-28 
ref|YP_033818.1|  30S ribosomal protein S5 [Bartonella hensela...   126    9e-28 
ref|YP_002218975.1|  ribosomal protein S5 [Acidithiobacillus f...   126    9e-28 
ref|YP_989014.1|  30S ribosomal protein S5 [Bartonella bacilli...   125    9e-28 
ref|ZP_05709485.1|  ribosomal protein S5 [Desulfurivibrio alka...   125    1e-27
ref|YP_002285116.1|  SSU ribosomal protein S5p (S2e) [Streptoc...   125    1e-27 
ref|ZP_03647048.1|  30S ribosomal protein S5 [Bifidobacterium ...   125    1e-27
ref|ZP_05737939.1|  30S ribosomal protein S5 [Granulicatella a...   125    1e-27
ref|ZP_05105476.1|  ribosomal protein S5 [Methylophaga thiooxi...   125    1e-27
ref|ZP_03939997.1|  30S ribosomal protein S5 [Lactobacillus br...   125    1e-27
ref|ZP_03296781.1|  hypothetical protein COLSTE_00666 [Collins...   125    1e-27
ref|ZP_05361003.1|  ribosomal protein S5 [Acinetobacter radior...   125    1e-27
ref|YP_003310741.1|  ribosomal protein S5 [Sebaldella termitid...   125    1e-27 
ref|ZP_04808491.1|  30S ribosomal protein S5 [Helicobacter pul...   125    1e-27
ref|ZP_06063886.1|  30S ribosomal protein S5 [Acinetobacter jo...   125    1e-27
ref|ZP_01914843.1|  30S ribosomal protein S5 [Limnobacter sp. ...   125    1e-27
ref|ZP_02178344.1|  ribosomal protein S05 [Hydrogenivirga sp. ...   125    1e-27
ref|YP_005280.1|  30S ribosomal protein S5 [Thermus thermophil...   125    1e-27 
ref|YP_900386.1|  30S ribosomal protein S5 [Pelobacter propion...   125    1e-27 
ref|ZP_01548563.1|  30S ribosomal protein S5 [Stappia aggregat...   125    1e-27
ref|YP_796961.1|  30S ribosomal protein S5 [Leptospira borgpet...   125    1e-27 
ref|ZP_05852180.1|  30S ribosomal protein S5 [Granulicatella e...   125    1e-27
ref|ZP_04577862.1|  small subunit ribosomal protein S5 [Oxalob...   125    1e-27
ref|YP_001359631.1|  30S ribosomal protein S5 [Sulfurovum sp. ...   125    1e-27 
ref|YP_003249485.1|  ribosomal protein S5 [Fibrobacter succino...   125    2e-27 
ref|NP_385479.1|  30S ribosomal protein S5 [Sinorhizobium meli...   125    2e-27 
ref|YP_001817100.1|  ribosomal protein S5 [Opitutus terrae PB9...   125    2e-27 
ref|ZP_05116322.1|  ribosomal protein S5 [Labrenzia alexandrii...   125    2e-27
ref|ZP_04580012.1|  small subunit ribosomal protein S5 [Oxalob...   125    2e-27
ref|ZP_04035700.1|  SSU ribosomal protein S5P [Meiothermus sil...   125    2e-27
ref|YP_001370518.1|  30S ribosomal protein S5 [Ochrobactrum an...   125    2e-27 
ref|YP_001210134.1|  30S ribosomal protein S5 [Dichelobacter n...   125    2e-27 
ref|ZP_04946819.1|  Ribosomal protein S5 [Burkholderia dolosa ...   125    2e-27
ref|ZP_06266583.1|  ribosomal protein S5 [Pyramidobacter pisco...   124    2e-27
ref|ZP_02404796.1|  ribosomal protein S5 [Burkholderia pseudom...   124    2e-27
ref|ZP_02867750.1|  hypothetical protein CLOSPI_01586 [Clostri...   124    2e-27
ref|ZP_06070519.1|  ribosomal protein S5 [Acinetobacter lwoffi...   124    2e-27
ref|ZP_05500063.1|  ribosomal protein S5 [Thiomonas intermedia...   124    2e-27
ref|YP_001859040.1|  ribosomal protein S5 [Burkholderia phymat...   124    2e-27 
ref|ZP_04904924.1|  30S ribosomal protein S5 [Burkholderia pse...   124    3e-27
ref|YP_443555.1|  30S ribosomal protein S5 [Burkholderia thail...   124    3e-27 
ref|YP_109790.1|  30S ribosomal protein S5 [Burkholderia pseud...   124    3e-27 
ref|ZP_06297360.1|  ribosomal protein S5 [Burkholderia sp. CCG...   124    3e-27
ref|YP_277722.1|  30S ribosomal subunit protein S5 [Candidatus...   124    3e-27 
ref|ZP_02886840.1|  ribosomal protein S5 [Burkholderia gramini...   124    3e-27
ref|ZP_04446080.1|  hypothetical protein COLINT_02804 [Collins...   124    3e-27
ref|ZP_06197339.1|  30S ribosomal protein S5 [Pediococcus acid...   124    3e-27
ref|YP_784589.1|  30S ribosomal protein S5 [Bordetella avium 1...   124    3e-27 
ref|YP_002910180.1|  Ribosomal protein S5 [Burkholderia glumae...   124    3e-27 
ref|YP_782479.1|  30S ribosomal protein S5 [Rhodopseudomonas p...   124    3e-27 
ref|YP_533290.1|  30S ribosomal protein S5 [Rhodopseudomonas p...   124    3e-27 
gb|ADB14074.1|  ribosomal protein S5 [Gardnerella vaginalis 40...   124    3e-27
ref|YP_761512.1|  30S ribosomal protein S5 [Hyphomonas neptuni...   124    3e-27 
ref|NP_789163.1|  30S ribosomal protein S5 [Tropheryma whipple...   124    3e-27 
ref|YP_003050095.1|  ribosomal protein S5 [Methylovorus sp. SI...   124    3e-27 
ref|ZP_03936920.1|  30S ribosomal protein S5 [Gardnerella vagi...   124    3e-27
ref|NP_969740.1|  30S ribosomal protein S5 [Bdellovibrio bacte...   124    3e-27 
ref|ZP_06011669.1|  ribosomal protein S5 [Leptotrichia goodfel...   124    4e-27
ref|ZP_05980669.1|  ribosomal protein S5 [Subdoligranulum vari...   124    4e-27
ref|ZP_04449588.1|  hypothetical protein GCWU000282_00817 [Cat...   124    4e-27
ref|NP_787666.1|  30S ribosomal protein S5 [Tropheryma whipple...   124    4e-27 
ref|ZP_05083914.1|  ribosomal protein S5 [Pseudovibrio sp. JE0...   124    4e-27
sp|Q83I62.2|RS5_TROW8  RecName: Full=30S ribosomal protein S5       124    4e-27
pdb|1I94|E  Chain E, Crystal Structures Of The Small Ribosomal...   124    4e-27 
sp|Q83G02.2|RS5_TROWT  RecName: Full=30S ribosomal protein S5       124    4e-27
ref|YP_007427.1|  30S ribosomal protein S5 [Candidatus Protoch...   124    4e-27 
ref|ZP_05339841.1|  ribosomal protein S5 [Sideroxydans lithotr...   124    4e-27
ref|YP_367710.1|  30S ribosomal protein S5 [Burkholderia sp. 3...   124    4e-27 
ref|ZP_02380143.1|  ribosomal protein S5 [Burkholderia ubonens...   124    4e-27
ref|YP_001609842.1|  30S ribosomal protein S5 [Bartonella trib...   124    4e-27 
ref|YP_002972218.1|  30S ribosomal protein S5 [Bartonella grah...   124    4e-27 
ref|YP_560654.1|  30S ribosomal protein S5 [Burkholderia xenov...   124    4e-27 
ref|YP_622613.1|  30S ribosomal protein S5 [Burkholderia cenoc...   124    5e-27 
ref|ZP_01289943.1|  Ribosomal protein S5:Ribosomal protein S5-...   123    5e-27
ref|ZP_05314224.1|  ribosomal protein S5 [Nitrosomonas sp. AL2...   123    5e-27
ref|YP_002890293.1|  ribosomal protein S5 [Thauera sp. MZ1T] >...   123    5e-27 
ref|YP_002608004.1|  ribosomal protein S5 [Nautilia profundico...   123    5e-27 
ref|NP_354907.2|  30S ribosomal protein S5 [Agrobacterium tume...   123    5e-27 
ref|ZP_03946851.1|  ribosomal protein S5 [Atopobium vaginae DS...   123    5e-27
ref|YP_002360897.1|  ribosomal protein S5 [Methylocella silves...   123    6e-27 
ref|ZP_02428056.1|  hypothetical protein CLORAM_01449 [Clostri...   123    6e-27
gb|AAD40600.1|AF115283_19  ribosomal protein S5 [Leptospira in...   123    6e-27
ref|ZP_03568647.1|  ribosomal protein S5 [Atopobium rimae ATCC...   123    6e-27
ref|ZP_05616007.1|  ribosomal protein S5 [Faecalibacterium pra...   123    7e-27
ref|ZP_02186078.1|  ribosomal protein S5 [Carnobacterium sp. A...   123    7e-27
gb|EEZ80750.1|  ribosomal protein S5 [uncultured SUP05 cluster...   123    7e-27
ref|ZP_02357316.1|  30S ribosomal protein S5 [Burkholderia okl...   123    7e-27
ref|ZP_02090122.1|  hypothetical protein FAEPRAM212_00359 [Fae...   123    7e-27
dbj|BAA06592.1|  ribosomal protein S5 [Acyrthosiphon kondoi en...   123    7e-27
ref|YP_003168664.1|  ribosomal protein S5 [Candidatus Accumuli...   123    7e-27 
ref|YP_001633552.1|  30S ribosomal protein S5 [Bordetella petr...   123    8e-27 
ref|ZP_03347550.1|  30S ribosomal protein S5 [Salmonella enter...   123    8e-27
sp|P46183.2|RS5_BUCAK  RecName: Full=30S ribosomal protein S5       123    8e-27
ref|YP_456701.1|  30S ribosomal protein S5 [Aster yellows witc...   122    8e-27 
ref|YP_525444.1|  30S ribosomal protein S5 [Rhodoferax ferrire...   122    8e-27 
ref|YP_804881.1|  30S ribosomal protein S5 [Pediococcus pentos...   122    8e-27 
ref|YP_003132319.1|  SSU ribosomal protein S5P [Saccharomonosp...   122    8e-27 
ref|ZP_04939905.1|  Ribosomal protein S5 [Burkholderia cenocep...   122    8e-27
ref|YP_002825743.1|  ribosomal protein S5 [Rhizobium sp. NGR23...   122    1e-26 
ref|NP_950469.1|  30S ribosomal protein S5 [Onion yellows phyt...   122    1e-26 
emb|CAJ73735.1|  strongly similar to 30S ribosomal protein S5 ...   122    1e-26
ref|YP_002549340.1|  30s ribosomal protein S5 [Agrobacterium v...   122    1e-26 
ref|NP_772023.1|  30S ribosomal protein S5 [Bradyrhizobium jap...   122    1e-26 
ref|ZP_05427959.1|  ribosomal protein S5 [Eubacterium saphenum...   122    1e-26
ref|YP_002288687.1|  ribosomal protein S5 [Oligotropha carboxi...   122    1e-26 
ref|ZP_01772327.1|  Hypothetical protein COLAER_01331 [Collins...   122    1e-26
gb|EFC06209.1|  ribosomal protein S5 [Bulleidia extructa W1219]     122    1e-26
ref|ZP_03890930.1|  SSU ribosomal protein S5P [Geodermatophilu...   122    1e-26
ref|NP_882142.1|  30S ribosomal protein S5 [Bordetella pertuss...   122    1e-26 
ref|YP_001832500.1|  ribosomal protein S5 [Beijerinckia indica...   122    2e-26 
ref|YP_001154856.1|  30S ribosomal protein S5 [Polynucleobacte...   122    2e-26 
ref|ZP_05082191.1|  ribosomal protein S5 [beta proteobacterium...   122    2e-26
ref|YP_032429.1|  30S ribosomal protein S5 [Bartonella quintan...   122    2e-26 
ref|ZP_05471896.1|  30S ribosomal protein S5 [Anaerococcus vag...   121    2e-26
ref|YP_003047799.1|  ribosomal protein S5 [Methylotenera mobil...   121    2e-26 
ref|ZP_05377371.1|  ribosomal protein S5 [Hyphomicrobium denit...   121    2e-26
pdb|3FIC|E  Chain E, T. Thermophilus 70s Ribosome In Complex W...   121    2e-26 
pdb|1PNS|E  Chain E, Crystal Structure Of A Streptomycin Depen...   121    2e-26 
ref|ZP_04761579.1|  ribosomal protein S5 [Acidovorax delafield...   121    2e-26
ref|YP_283565.1|  30S ribosomal protein S5 [Dechloromonas arom...   121    2e-26 
ref|YP_001797009.1|  ribosomal protein S5 [Polynucleobacter ne...   121    2e-26 
ref|ZP_00945193.1|  SSU ribosomal protein S5P [Ralstonia solan...   121    2e-26
ref|YP_001562070.1|  30S ribosomal protein S5 [Delftia acidovo...   121    3e-26 
ref|YP_002260951.1|  30s ribosomal protein s5 [Ralstonia solan...   121    3e-26 
ref|YP_576844.1|  30S ribosomal protein S5 [Nitrobacter hambur...   121    3e-26 
ref|YP_001355084.1|  30S ribosomal protein S5 [Janthinobacteri...   120    3e-26 
ref|ZP_02692522.1|  ribosomal protein S5-like protein [Epulopi...   120    3e-26
ref|YP_001101379.1|  30S ribosomal protein S5 [Herminiimonas a...   120    3e-26 
ref|NP_295836.1|  30S ribosomal protein S5 [Deinococcus radiod...   120    3e-26 
ref|ZP_01059703.1|  30S ribosomal protein S5 [Leeuwenhoekiella...   120    3e-26
ref|ZP_03381709.1|  30S ribosomal protein S5 [Salmonella enter...   120    3e-26
ref|ZP_03288756.1|  hypothetical protein CLONEX_00946 [Clostri...   120    3e-26
ref|ZP_01968901.1|  hypothetical protein RUMTOR_02482 [Ruminoc...   120    4e-26
ref|YP_984726.1|  30S ribosomal protein S5 [Acidovorax sp. JS4...   120    4e-26 
ref|NP_539691.1|  30S ribosomal protein S5 [Brucella melitensi...   120    4e-26 
ref|NP_521123.1|  30S ribosomal protein S5 [Ralstonia solanace...   120    4e-26 
ref|ZP_05634933.1|  SSU ribosomal protein S5P [Fusobacterium u...   120    4e-26
ref|YP_807664.1|  ribosomal protein S5 [Lactobacillus casei AT...   120    4e-26 
ref|YP_001219040.1|  30S ribosomal protein S5 [Candidatus Vesi...   120    4e-26 
ref|YP_605314.1|  30S ribosomal protein S5 [Deinococcus geothe...   120    4e-26 
ref|ZP_04744462.1|  ribosomal protein S5 [Roseburia intestinal...   120    4e-26
ref|ZP_03964026.1|  ribosomal protein S5 [Lactobacillus paraca...   120    4e-26
ref|YP_002252318.1|  30S ribosomal protein S5 [Ralstonia solan...   120    4e-26 
ref|YP_390582.1|  ribosomal protein S5 [Thiomicrospira crunoge...   120    4e-26 
ref|ZP_03540926.1|  ribosomal protein S5 [Comamonas testostero...   120    4e-26
ref|ZP_01225661.1|  ribosomal protein S5 [Aurantimonas mangano...   120    4e-26
ref|ZP_02533123.1|  30S ribosomal protein S5 [Endoriftia perse...   120    5e-26
ref|NP_214129.1|  ribosomal protein S05 [Aquifex aeolicus VF5]...   120    5e-26 
ref|NP_840505.1|  30S ribosomal protein S5 [Nitrosomonas europ...   120    5e-26 
ref|YP_317994.1|  30S ribosomal protein S5 [Nitrobacter winogr...   120    5e-26 
ref|ZP_01437409.1|  30S ribosomal protein S5 [Fulvimarina pela...   120    5e-26
ref|ZP_03212260.1|  Ribosomal protein S5 [Lactobacillus rhamno...   120    5e-26
ref|ZP_02179331.1|  hypothetical protein HG1285_03864 [Hydroge...   120    5e-26
ref|ZP_04441450.1|  ribosomal protein S5 [Lactobacillus rhamno...   120    5e-26
ref|YP_826341.1|  SSU ribosomal protein S5P [Solibacter usitat...   120    5e-26 
ref|YP_001259136.1|  30S ribosomal protein S5 [Brucella ovis A...   120    5e-26 
ref|YP_001824329.1|  30S ribosomal protein S5 [Streptomyces gr...   120    6e-26 
ref|ZP_04695531.1|  30S ribosomal protein S5 [Streptomyces ros...   120    6e-26
ref|ZP_05457669.1|  30S ribosomal protein S5 [Brucella ceti M4...   120    6e-26
ref|ZP_01876556.1|  30S ribosomal protein S5 [Lentisphaera ara...   120    6e-26
ref|YP_980581.1|  30S ribosomal protein S5 [Polaromonas naphth...   120    6e-26 
ref|ZP_01857984.1|  30S ribosomal protein S5 [Planctomyces mar...   119    7e-26
ref|ZP_03305399.1|  hypothetical protein ANHYDRO_01839 [Anaero...   119    7e-26
ref|ZP_02041890.1|  hypothetical protein RUMGNA_02665 [Ruminoc...   119    7e-26
ref|ZP_05628363.1|  SSU ribosomal protein S5P [Fusobacterium s...   119    7e-26
ref|ZP_05618553.1|  SSU ribosomal protein S5P [Fusobacterium s...   119    7e-26
ref|YP_002729695.1|  ribosomal protein S5 [Sulfurihydrogenibiu...   119    8e-26 
ref|ZP_00952071.1|  30S ribosomal protein S5 [Oceanicaulis ale...   119    8e-26
ref|YP_001205122.1|  30S ribosomal protein S5 [Bradyrhizobium ...   119    9e-26 
ref|ZP_05860854.1|  ribosomal protein S5 [Jonquetella anthropi...   119    9e-26
ref|ZP_05813704.1|  ribosomal protein S5 [Mesorhizobium opport...   119    9e-26
ref|YP_002730986.1|  ribosomal protein S5 [Persephonella marin...   119    9e-26 
ref|YP_002941570.1|  ribosomal protein S5 [Kosmotoga olearia T...   119    1e-25 
ref|YP_001240960.1|  30S ribosomal protein S5 [Bradyrhizobium ...   119    1e-25 
ref|NP_102137.1|  30S ribosomal protein S5 [Mesorhizobium loti...   119    1e-25 
emb|CBG70765.1|  30S ribosomal protein S5 [Streptomyces scabie...   119    1e-25
ref|ZP_05016355.1|  30S ribosomal protein S5 [Streptomyces svi...   119    1e-25
ref|YP_001844314.1|  30S ribosomal protein S5 [Lactobacillus f...   119    1e-25 
sp|Q98N40.2|RS5_RHILO  RecName: Full=30S ribosomal protein S5       119    1e-25
ref|YP_001639650.1|  ribosomal protein S5 [Methylobacterium ex...   119    1e-25 
ref|ZP_03780566.1|  hypothetical protein CLOHYLEM_07668 [Clost...   119    1e-25
ref|YP_001924844.1|  ribosomal protein S5 [Methylobacterium po...   119    1e-25 
ref|YP_001754879.1|  ribosomal protein S5 [Methylobacterium ra...   119    1e-25 
ref|YP_001525453.1|  ribosomal protein S5 [Azorhizobium caulin...   119    1e-25 
ref|ZP_04857900.1|  conserved hypothetical protein [Ruminococc...   119    1e-25
ref|NP_420078.1|  30S ribosomal protein S5 [Caulobacter cresce...   119    1e-25 
ref|ZP_05033796.1|  ribosomal protein S5 [Brevundimonas sp. BA...   119    1e-25
ref|YP_001419656.1|  ribosomal protein S5 [Xanthobacter autotr...   119    1e-25 
ref|NP_826120.1|  30S ribosomal protein S5 [Streptomyces averm...   119    1e-25 
ref|ZP_05855174.1|  ribosomal protein S5 [Blautia hansenii DSM...   119    1e-25
gb|AAW47265.1|  S5 ribosomal protein [Streptomyces fradiae]         119    1e-25
ref|YP_003155745.1|  SSU ribosomal protein S5P [Brachybacteriu...   118    2e-25 
ref|ZP_04858601.1|  ribosomal protein S5 [Fusobacterium varium...   118    2e-25
ref|ZP_05748384.1|  30S ribosomal protein S5 [Erysipelothrix r...   118    2e-25
ref|ZP_05622090.1|  ribosomal protein S5 [Treponema vincentii ...   118    2e-25
ref|ZP_05916461.1|  30S ribosomal protein S5 [Prevotella sp. o...   118    2e-25
ref|ZP_04998509.1|  30S ribosomal protein S5 [Streptomyces sp....   118    2e-25
ref|YP_001900834.1|  ribosomal protein S5 [Ralstonia pickettii...   118    2e-25 
ref|YP_002130090.1|  30S ribosomal protein S5 [Phenylobacteriu...   118    2e-25 
ref|XP_002165059.1|  PREDICTED: hypothetical protein [Hydra ma...   118    2e-25 
ref|YP_767395.1|  30S ribosomal protein S5 [Rhizobium legumino...   118    2e-25 
ref|YP_469214.1|  30S ribosomal protein S5 [Rhizobium etli CFN...   118    2e-25 
ref|YP_445184.1|  ribosomal protein S5 [Salinibacter ruber DSM...   118    2e-25 
ref|YP_002335018.1|  ribosomal protein S5 [Thermosipho african...   118    2e-25 
emb|CAM77765.1|  30S ribosomal protein S5 [Magnetospirillum gr...   118    2e-25
ref|YP_001360458.1|  ribosomal protein S5 [Kineococcus radioto...   118    2e-25 
ref|YP_001306216.1|  ribosomal protein S5 [Thermosipho melanes...   118    2e-25 
gb|ABQ51903.1|  ribosomal protein S5 [Salinibacter ruber] >gb|...   118    2e-25
ref|YP_002497217.1|  ribosomal protein S5 [Methylobacterium no...   118    2e-25 
ref|ZP_06046822.1|  ribosomal protein S5 [Aeromicrobium marinu...   118    2e-25
ref|YP_003096508.1|  SSU ribosomal protein S5p (S2e) [Flavobac...   118    2e-25 
gb|ABQ51897.1|  ribosomal protein S5 [Salinibacter ruber] >gb|...   118    2e-25
ref|YP_001683258.1|  30S ribosomal protein S5 [Caulobacter sp....   118    2e-25 
ref|YP_002946921.1|  ribosomal protein S5 [Variovorax paradoxu...   118    2e-25 
ref|YP_002786620.1|  putative 30S ribosomal protein S5 [Deinoc...   118    2e-25 
ref|ZP_04831559.1|  ribosomal protein S5 [Gallionella ferrugin...   118    2e-25
ref|ZP_00053908.1|  COG0098: Ribosomal protein S5 [Magnetospir...   118    2e-25
ref|YP_169391.1|  30S ribosomal protein S5 [Francisella tulare...   118    2e-25 
ref|ZP_05515662.1|  30S ribosomal protein S5 [Streptomyces hyg...   118    3e-25
ref|YP_001892111.1|  30S ribosomal protein S5 [Francisella tul...   118    3e-25 
ref|YP_001677289.1|  30S ribosomal protein S5 [Francisella phi...   118    3e-25 
ref|YP_001799155.1|  30S ribosomal protein S5 [Candidatus Phyt...   117    3e-25 
ref|YP_513048.1|  30S ribosomal protein S5 [Francisella tulare...   117    3e-25 
ref|NP_784741.1|  30S ribosomal protein S5 [Lactobacillus plan...   117    3e-25 
ref|YP_001410625.1|  ribosomal protein S5 [Fervidobacterium no...   117    3e-25 
ref|YP_001567820.1|  ribosomal protein S5 [Petrotoga mobilis S...   117    3e-25 
ref|ZP_06220650.1|  ribosomal protein S5 [Micromonospora auran...   117    3e-25
ref|ZP_01733246.1|  30S ribosomal protein S5 [Flavobacteria ba...   117    3e-25
ref|YP_297366.1|  30S ribosomal protein S5 [Ralstonia eutropha...   117    3e-25 
ref|ZP_05508401.1|  30S ribosomal protein S5 [Streptomyces sp. C]   117    3e-25
ref|YP_727903.1|  30S ribosomal protein S5 [Ralstonia eutropha...   117    3e-25 
ref|ZP_05553225.1|  ribosomal protein S5 [Lactobacillus coleoh...   117    3e-25
ref|YP_997074.1|  30S ribosomal protein S5 [Verminephrobacter ...   117    3e-25 
ref|ZP_03391111.1|  ribosomal protein S5 [Capnocytophaga sputi...   117    3e-25
ref|YP_001296216.1|  30S ribosomal protein S5 [Flavobacterium ...   117    3e-25 
ref|YP_585441.1|  30S ribosomal protein S5 [Ralstonia metallid...   117    3e-25 
ref|YP_001192735.1|  30S ribosomal protein S5 [Flavobacterium ...   117    3e-25 
ref|ZP_03860010.1|  SSU ribosomal protein S5P [Kribbella flavi...   117    3e-25
ref|ZP_01965549.1|  hypothetical protein RUMOBE_03288 [Ruminoc...   117    3e-25
ref|ZP_06173133.1|  ribosomal protein S5 [Brevundimonas subvib...   117    3e-25
ref|NP_218645.1|  30S ribosomal protein S5 [Treponema pallidum...   117    3e-25 
ref|ZP_03854421.1|  ribosomal protein S5 [Chryseobacterium gle...   117    3e-25
ref|YP_003315693.1|  SSU ribosomal protein S5P [Sanguibacter k...   117    4e-25 
ref|YP_003306598.1|  ribosomal protein S5 [Streptobacillus mon...   117    4e-25 
ref|ZP_06289674.1|  ribosomal protein S5 [Prevotella timonensi...   117    4e-25
ref|ZP_03798545.1|  hypothetical protein COPCOM_00799 [Coproco...   117    4e-25
ref|ZP_04605813.1|  30S ribosomal protein S5 [Micromonospora s...   117    4e-25
ref|ZP_04585232.1|  ribosomal protein S5 [Sulfurihydrogenibium...   117    4e-25
ref|YP_002120950.1|  ribosomal protein S5 [Hydrogenobaculum sp...   117    4e-25 
ref|YP_002004389.1|  30S ribosomal protein S5 [Candidatus Phyt...   117    4e-25 
ref|ZP_05802035.1|  ribosomal protein S5 [Streptomyces flavogr...   117    4e-25
ref|YP_002296972.1|  ribosomal protein S5 [Rhodospirillum cent...   117    4e-25 
ref|YP_003060446.1|  ribosomal protein S5 [Hirschia baltica AT...   117    5e-25 
ref|ZP_03682794.1|  hypothetical protein CATMIT_01430 [Catenib...   117    5e-25
ref|YP_547354.1|  30S ribosomal protein S5 [Polaromonas sp. JS...   117    5e-25 
ref|ZP_02420574.1|  hypothetical protein ANACAC_03191 [Anaeros...   117    5e-25
ref|ZP_06267537.1|  ribosomal protein S5 [Prevotella bivia JCV...   117    5e-25
ref|ZP_05539366.1|  30S ribosomal protein S5 [Streptomyces gri...   117    5e-25
ref|ZP_05533636.1|  30S ribosomal protein S5 [Streptomyces vir...   117    5e-25
ref|YP_001108908.1|  30S ribosomal protein S5 [Saccharopolyspo...   117    5e-25 
ref|ZP_04566668.1|  SSU ribosomal protein S5P [Fusobacterium m...   117    5e-25
ref|YP_002883132.1|  ribosomal protein S5 [Beutenbergia cavern...   117    5e-25 
ref|ZP_04686450.1|  30S ribosomal protein S5 [Streptomyces gha...   117    5e-25
ref|YP_003160571.1|  ribosomal protein S5 [Jonesia denitrifica...   117    5e-25 
ref|YP_914584.1|  30S ribosomal protein S5 [Paracoccus denitri...   117    5e-25 
ref|ZP_01017763.1|  30S ribosomal protein S5 [Parvularcula ber...   117    5e-25
ref|ZP_03168865.1|  hypothetical protein RUMLAC_02568 [Ruminoc...   117    6e-25
ref|YP_003149829.1|  SSU ribosomal protein S5P [Kytococcus sed...   116    6e-25 
ref|ZP_04573136.1|  SSU ribosomal protein S5P [Fusobacterium s...   116    6e-25
ref|ZP_04768925.1|  ribosomal protein S5 [Asticcacaulis excent...   116    6e-25
ref|ZP_01046098.1|  30S ribosomal protein S5 [Nitrobacter sp. ...   116    6e-25
ref|YP_001767341.1|  ribosomal protein S5 [Methylobacterium sp...   116    6e-25 
ref|ZP_04366357.1|  SSU ribosomal protein S5P [Cellulomonas fl...   116    6e-25
ref|ZP_05013003.1|  30S ribosomal protein S5 [Streptomyces pri...   116    7e-25
ref|YP_003187477.1|  SSU ribosomal protein S5P [Acetobacter pa...   116    7e-25 
ref|YP_001734307.1|  ribosomal protein S5 [Synechococcus sp. P...   116    7e-25 
ref|YP_590319.1|  SSU ribosomal protein S5P [Candidatus Koriba...   116    7e-25 
ref|YP_427755.1|  30S ribosomal protein S5 [Rhodospirillum rub...   116    7e-25 
ref|ZP_03783329.1|  hypothetical protein RUMHYD_02796 [Blautia...   116    7e-25
ref|YP_003141278.1|  ribosomal protein S5 [Capnocytophaga ochr...   116    7e-25 
ref|NP_948572.1|  30S ribosomal protein S5 [Rhodopseudomonas p...   116    8e-25 
ref|NP_628878.1|  30S ribosomal protein S5 [Streptomyces coeli...   116    8e-25 
ref|YP_172591.1|  30S ribosomal protein S5 [Synechococcus elon...   116    8e-25 
ref|ZP_03701005.1|  ribosomal protein S5 [Flavobacteria bacter...   116    8e-25
ref|ZP_04574397.1|  SSU ribosomal protein S5P [Fusobacterium s...   116    8e-25
emb|CAX84048.1|  30S ribosomal protein S5 [uncultured bacterium]    116    9e-25
ref|YP_002754520.1|  ribosomal protein S5 [Acidobacterium caps...   116    9e-25 
ref|ZP_03628323.1|  ribosomal protein S5 [bacterium Ellin514] ...   116    9e-25
emb|CAA58136.1|  S5 ribosomal protein [Streptomyces coelicolor...   116    9e-25
ref|ZP_04602034.1|  hypothetical protein GCWU000324_01508 [Kin...   116    9e-25
ref|ZP_02431972.1|  hypothetical protein CLOSCI_02208 [Clostri...   116    9e-25
ref|ZP_05006579.1|  30S ribosomal protein S5 [Streptomyces cla...   116    1e-24
ref|ZP_04055560.1|  ribosomal protein S5 [Porphyromonas uenoni...   116    1e-24
ref|ZP_01619298.1|  30S ribosomal protein S5 [Lyngbya sp. PCC ...   115    1e-24
ref|NP_072831.1|  30S ribosomal protein S5 [Mycoplasma genital...   115    1e-24 
ref|ZP_06007292.1|  30S ribosomal protein S5 [Prevotella berge...   115    1e-24
ref|ZP_05914027.1|  ribosomal protein S5 [Brevibacterium linen...   115    1e-24
ref|YP_570294.1|  30S ribosomal protein S5 [Rhodopseudomonas p...   115    1e-24 
ref|ZP_01448671.1|  30S ribosomal protein S5 [alpha proteobact...   115    1e-24
ref|YP_485928.1|  30S ribosomal protein S5 [Rhodopseudomonas p...   115    1e-24 
ref|YP_001235049.1|  30S ribosomal protein S5 [Acidiphilium cr...   115    1e-24 
ref|ZP_00993888.1|  30S ribosomal protein S5 [Janibacter sp. H...   115    1e-24
ref|YP_001560736.1|  ribosomal protein S5 [Clostridium phytofe...   115    1e-24 
ref|YP_003194994.1|  30S ribosomal protein S5 [Robiginitalea b...   115    1e-24 
ref|YP_001160714.1|  30S ribosomal protein S5 [Salinispora tro...   115    1e-24 
ref|ZP_06287544.1|  ribosomal protein S5 [Prevotella buccalis ...   115    1e-24
ref|YP_001539070.1|  30S ribosomal protein S5 [Salinispora are...   115    1e-24 
ref|YP_903445.1|  SSU ribosomal protein S5P [Candidatus Ruthia...   115    1e-24 
ref|YP_968996.1|  30S ribosomal protein S5 [Acidovorax avenae ...   115    1e-24 
ref|ZP_05341376.1|  ribosomal protein S5 [Thalassiobium sp. R2...   115    1e-24
gb|ADB17287.1|  ribosomal protein S5 [Pirellula staleyi DSM 6068]   115    1e-24
ref|YP_003200536.1|  ribosomal protein S5 [Nakamurella multipa...   115    1e-24
ref|ZP_06211210.1|  ribosomal protein S5 [Acidovorax avenae su...   115    1e-24
ref|NP_180936.1|  ribosomal protein S5 family protein [Arabido...   115    1e-24 
ref|ZP_06253233.1|  ribosomal protein S5 [Prevotella copri DSM...   115    2e-24
ref|ZP_02234471.1|  hypothetical protein DORFOR_01342 [Dorea f...   115    2e-24
ref|ZP_01996200.1|  hypothetical protein DORLON_02206 [Dorea l...   115    2e-24
ref|YP_003121329.1|  ribosomal protein S5 [Chitinophaga pinens...   115    2e-24 
ref|YP_001883924.1|  SSU ribosomal protein S5P [Borrelia herms...   115    2e-24 
ref|ZP_01755359.1|  30S ribosomal protein S5 [Roseobacter sp. ...   115    2e-24
ref|ZP_03915824.1|  ribosomal protein S5 [Anaerococcus lactoly...   115    2e-24
ref|ZP_03968750.1|  ribosomal protein S5 [Sphingobacterium spi...   115    2e-24
ref|YP_277415.1|  ribosomal protein S5 [Emiliania huxleyi] >sp...   115    2e-24 
ref|ZP_05476829.1|  30S ribosomal protein S5 [Streptomyces sp....   115    2e-24
ref|ZP_04455481.1|  hypothetical protein GCWU000342_01502 [Shu...   115    2e-24
ref|ZP_01744004.1|  30S ribosomal protein S5 [Sagittula stella...   115    2e-24
ref|ZP_05079920.1|  ribosomal protein S5 [Rhodobacterales bact...   115    2e-24
ref|ZP_03932734.1|  30S ribosomal protein S5 [Corynebacterium ...   115    2e-24
ref|YP_002534552.1|  30S ribosomal protein S5 [Thermotoga neap...   115    2e-24 
ref|ZP_01088667.1|  30S ribosomal protein S5 [Blastopirellula ...   115    2e-24
ref|ZP_01891062.1|  30S ribosomal protein S5 [unidentified eub...   114    2e-24
ref|XP_002274092.1|  PREDICTED: hypothetical protein [Vitis vi...   114    2e-24 
ref|NP_868069.1|  30S ribosomal protein S5 [Rhodopirellula bal...   114    2e-24 
ref|ZP_03702102.1|  ribosomal protein S5 [Flavobacteria bacter...   114    2e-24
ref|ZP_01630280.1|  30S ribosomal protein S5 [Nodularia spumig...   114    3e-24
ref|YP_001930473.1|  ribosomal protein S5 [Sulfurihydrogenibiu...   114    3e-24 
ref|NP_229283.1|  ribosomal protein S5 [Thermotoga maritima MS...   114    3e-24 
ref|YP_001531652.1|  30S ribosomal protein S5 [Dinoroseobacter...   114    3e-24 
ref|YP_612266.1|  30S ribosomal protein S5 [Ruegeria sp. TM104...   114    3e-24 
ref|YP_003325241.1|  ribosomal protein S5 [Xylanimonas cellulo...   114    3e-24
ref|ZP_01054363.1|  30S ribosomal protein S5 [Roseobacter sp. ...   114    3e-24
ref|YP_864789.1|  SSU ribosomal protein S5P [Magnetococcus sp....   114    3e-24 
ref|ZP_02025619.1|  hypothetical protein EUBVEN_00872 [Eubacte...   114    3e-24
ref|YP_002222145.1|  30S ribosomal protein S5 [Borrelia dutton...   114    3e-24 
ref|ZP_04491584.1|  SSU ribosomal protein S5P [Spirosoma lingu...   114    3e-24
ref|YP_003104241.1|  ribosomal protein S5 [Actinosynnema mirum...   114    3e-24 
ref|ZP_03920282.1|  30S ribosomal protein S5 [Corynebacterium ...   114    3e-24
ref|ZP_03675273.1|  ribosomal protein S5 [Borrelia spielmanii ...   114    3e-24
ref|YP_001244899.1|  ribosomal protein S5 [Thermotoga petrophi...   114    3e-24 
ref|YP_003346825.1|  ribosomal protein S5 [Thermotoga naphthop...   114    4e-24 
ref|YP_862843.1|  30S ribosomal protein S5 [Gramella forsetii ...   114    4e-24 
ref|ZP_04062564.1|  ribosomal protein S5 [Streptococcus saliva...   114    4e-24
ref|ZP_00950111.1|  30S ribosomal protein S5 [Croceibacter atl...   114    4e-24
sp|P33105.1|RS5_MICLU  RecName: Full=30S ribosomal protein S5 ...   114    4e-24
ref|YP_508550.1|  30S ribosomal protein S5 [Jannaschia sp. CCS...   114    4e-24 
ref|ZP_06300413.1|  hypothetical protein pah_c200o095 [Parachl...   114    4e-24
ref|ZP_03990189.1|  ribosomal protein S5 [Oribacterium sinus F...   114    4e-24
ref|YP_722624.1|  30S ribosomal protein S5 [Trichodesmium eryt...   114    4e-24 
ref|ZP_05745450.1|  30S ribosomal protein S5 [Lactobacillus an...   114    5e-24
ref|ZP_03756985.1|  hypothetical protein CLOSTASPAR_00973 [Clo...   114    5e-24
ref|ZP_03960271.1|  30S ribosomal protein S5 [Lactobacillus va...   114    5e-24
ref|ZP_02160024.1|  30S ribosomal protein S5 [Kordia algicida ...   114    5e-24
ref|YP_744392.1|  30S ribosomal protein S5 [Granulibacter beth...   113    5e-24 
ref|ZP_04057069.1|  ribosomal protein S5 [Capnocytophaga gingi...   113    5e-24
ref|ZP_04666395.1|  conserved hypothetical protein [Clostridia...   113    5e-24
ref|YP_003088727.1|  ribosomal protein S5 [Dyadobacter ferment...   113    5e-24 
ref|ZP_01051154.1|  30S ribosomal protein S5 [Dokdonia donghae...   113    5e-24
ref|YP_002929799.1|  small subunit ribosomal protein S5 [Eubac...   113    5e-24 
ref|ZP_05982631.1|  ribosomal protein S5 [Neisseria cinerea AT...   113    5e-24
ref|ZP_01013302.1|  30S ribosomal protein S5 [Rhodobacterales ...   113    5e-24
ref|ZP_02919572.1|  hypothetical protein STRINF_00423 [Strepto...   113    5e-24
ref|ZP_05977755.1|  30S ribosomal protein S5 [Neisseria mucosa...   113    5e-24
ref|ZP_05347177.1|  ribosomal protein S5 [Bryantella formatexi...   113    6e-24
ref|YP_001519002.1|  30S ribosomal protein S5 [Acaryochloris m...   113    6e-24 
ref|ZP_01885776.1|  30S ribosomal protein S5 [Pedobacter sp. B...   113    6e-24
ref|ZP_05313167.1|  ribosomal protein S5 [Geobacter sp. M18] >...   113    6e-24
ref|ZP_03719611.1|  hypothetical protein NEIFLAOT_01457 [Neiss...   113    6e-24
ref|ZP_02088391.1|  hypothetical protein CLOBOL_05946 [Clostri...   113    6e-24
gb|ACZ32515.1|  ribosomal protein S5 [Chlamydophila pneumoniae...   113    6e-24
ref|YP_945493.1|  SSU ribosomal protein S5P [Borrelia turicata...   113    6e-24 
ref|XP_002509457.1|  30S ribosomal protein S5, putative [Ricin...   113    6e-24 
ref|ZP_01453614.1|  30S ribosomal protein S5 [Mariprofundus fe...   113    6e-24
ref|NP_273217.1|  30S ribosomal protein S5 [Neisseria meningit...   113    6e-24 
ref|NP_971394.1|  30S ribosomal protein S5 [Treponema denticol...   113    7e-24 
ref|ZP_06254735.1|  ribosomal protein S5 [Prevotella oris F030...   113    7e-24
ref|YP_001603618.1|  30S ribosomal protein S5 [Gluconacetobact...   113    7e-24 
ref|YP_140330.1|  30S ribosomal protein S5 [Streptococcus ther...   113    7e-24 
ref|NP_224827.1|  30S ribosomal protein S5 [Chlamydophila pneu...   113    7e-24 
ref|ZP_00788600.1|  ribosomal protein S5 [Streptococcus agalac...   113    8e-24
ref|YP_190802.1|  30S ribosomal protein S5 [Gluconobacter oxyd...   113    8e-24 
ref|YP_001272049.1|  30S ribosomal protein S5 [Lactobacillus r...   112    8e-24 
ref|ZP_00958504.1|  30S ribosomal protein S5 [Roseovarius nubi...   112    9e-24
ref|YP_003111721.1|  ribosomal protein S5 [Catenulispora acidi...   112    9e-24 
gb|EDZ39173.1|  Ribosomal protein S5 [Leptospirillum sp. Group...   112    9e-24
ref|YP_001293596.1|  ribosomal protein S5 [Rhodomonas salina] ...   112    9e-24 
ref|ZP_03014220.1|  hypothetical protein BACINT_01788 [Bactero...   112    1e-23
ref|ZP_03672600.1|  ribosomal protein S5 [Borrelia valaisiana ...   112    1e-23
ref|ZP_03773223.1|  ribosomal protein S5 [Borrelia sp. SV1] >g...   112    1e-23
ref|NP_687111.1|  30S ribosomal protein S5 [Streptococcus agal...   112    1e-23 
ref|ZP_03464068.1|  hypothetical protein BACPEC_03169 [Bactero...   112    1e-23
ref|NP_488239.1|  30S ribosomal protein S5 [Nostoc sp. PCC 712...   112    1e-23 
ref|ZP_00998116.1|  30S ribosomal protein S5 [Oceanicola batse...   112    1e-23
ref|ZP_02190859.1|  30S ribosomal protein S5 [alpha proteobact...   112    1e-23
ref|NP_758382.1|  30S ribosomal protein S5 [Mycoplasma penetra...   112    1e-23 
ref|ZP_03642001.1|  hypothetical protein BACCOPRO_00342 [Bacte...   112    1e-23
ref|NP_050785.1|  ribosomal protein S5 [Guillardia theta] >sp|...   112    1e-23 
ref|ZP_05283789.1|  30S ribosomal protein S5 [Bacteroides frag...   112    1e-23
ref|ZP_03303416.1|  hypothetical protein BACDOR_04828 [Bactero...   112    1e-23
ref|ZP_06113181.1|  small subunit ribosomal protein S5 [Clostr...   112    1e-23
gb|EAY90626.1|  hypothetical protein OsI_12226 [Oryza sativa I...   112    1e-23
ref|ZP_02690066.1|  ribosomal protein S5 [Ureaplasma parvum se...   112    1e-23
ref|ZP_01253857.1|  30S ribosomal protein S5 [Psychroflexus to...   112    2e-23
ref|NP_001050474.1|  Os03g0452300 [Oryza sativa (japonica cult...   112    2e-23 
ref|NP_078082.1|  30S ribosomal protein S5 [Ureaplasma parvum ...   112    2e-23 
ref|ZP_05052345.1|  ribosomal protein S5 [Octadecabacter antar...   112    2e-23
ref|ZP_03764329.1|  ribosomal protein S5 ['Nostoc azollae' 070...   112    2e-23
ref|ZP_06306332.1|  Ribosomal protein S5 [Raphidiopsis brookii...   112    2e-23
ref|ZP_05786434.1|  ribosomal protein S5 [Silicibacter lacusca...   112    2e-23
ref|YP_001228388.1|  30S ribosomal protein S5 [Synechococcus s...   112    2e-23 
ref|ZP_02555350.1|  ribosomal protein S5 [Ureaplasma urealytic...   112    2e-23
ref|ZP_02734646.1|  30S ribosomal protein S5 [Gemmata obscurig...   112    2e-23
ref|ZP_03716687.1|  hypothetical protein EUBHAL_01751 [Eubacte...   112    2e-23
ref|ZP_03539419.1|  ribosomal protein S5 [Borrelia garinii PBr...   111    2e-23
ref|ZP_03009486.1|  hypothetical protein BACCOP_01348 [Bactero...   111    2e-23
ref|ZP_01035113.1|  30S ribosomal protein S5 [Roseovarius sp. ...   111    2e-23
ref|YP_072938.1|  30S ribosomal protein S5 [Borrelia garinii P...   111    2e-23 
ref|YP_001867690.1|  30S ribosomal protein S5 [Nostoc punctifo...   111    2e-23 
ref|YP_001298114.1|  30S ribosomal protein S5 [Bacteroides vul...   111    2e-23 
ref|ZP_03206518.1|  hypothetical protein BACPLE_00122 [Bactero...   111    2e-23
gb|EAY55939.1|  ribosomal protein S5 [Leptospirillum rubarum]       111    2e-23
ref|ZP_05779838.1|  ribosomal protein S5 [Citreicella sp. SE45...   111    2e-23
emb|CAO89797.1|  rpsE [Microcystis aeruginosa PCC 7806]             111    2e-23
ref|ZP_05121557.1|  ribosomal protein S5 [Rhodobacteraceae bac...   111    2e-23
ref|YP_001660741.1|  30S ribosomal protein S5 [Microcystis aer...   111    2e-23 
ref|ZP_05069509.1|  ribosomal protein S5 [Candidatus Pelagibac...   111    2e-23
ref|ZP_03436338.1|  ribosomal protein S5 [Borrelia burgdorferi...   111    2e-23
ref|ZP_04389971.1|  ribosomal protein S5 [Porphyromonas endodo...   111    2e-23
ref|ZP_05100085.1|  ribosomal protein S5 [Roseobacter sp. GAI1...   111    2e-23
ref|YP_165764.1|  30S ribosomal protein S5 [Ruegeria pomeroyi ...   111    3e-23 
ref|ZP_04451373.1|  hypothetical protein GCWU000182_00658 [Abi...   111    3e-23
ref|XP_002305129.1|  predicted protein [Populus trichocarpa] >...   111    3e-23 
ref|YP_001168710.1|  30S ribosomal protein S5 [Rhodobacter sph...   111    3e-23 
ref|YP_351780.1|  30S ribosomal protein S5 [Rhodobacter sphaer...   111    3e-23 
ref|ZP_02075513.1|  hypothetical protein CLOL250_02289 [Clostr...   111    3e-23
ref|ZP_05064731.1|  ribosomal protein S5 [Octadecabacter antar...   111    3e-23
ref|ZP_03753646.1|  hypothetical protein ROSEINA2194_02067 [Ro...   111    3e-23
ref|ZP_03678373.1|  hypothetical protein BACCELL_02721 [Bacter...   111    3e-23
ref|YP_817716.1|  SSU ribosomal protein S5P [Leuconostoc mesen...   111    3e-23 
ref|YP_003136037.1|  ribosomal protein S5 [Cyanothece sp. PCC ...   111    3e-23 
ref|ZP_03087014.1|  30S ribosomal protein S5 [Borrelia burgdor...   111    3e-23
ref|ZP_02520199.1|  30S ribosomal protein S5 [candidate divisi...   110    3e-23
ref|ZP_01445801.1|  30S ribosomal protein S5 [Roseovarius sp. ...   110    3e-23
ref|NP_906003.1|  30S ribosomal protein S5 [Porphyromonas ging...   110    3e-23 
ref|YP_002370495.1|  30S ribosomal protein S5 [Cyanothece sp. ...   110    3e-23 
ref|ZP_02141239.1|  30S ribosomal protein S5 [Roseobacter lito...   110    3e-23
ref|YP_002936359.1|  ribosomal protein S5 [Eubacterium rectale...   110    3e-23 
ref|NP_440653.1|  30S ribosomal protein S5 [Synechocystis sp. ...   110    3e-23 
ref|ZP_04833862.1|  ribosomal protein S5 [Prevotella melaninog...   110    3e-23
ref|ZP_02069384.1|  hypothetical protein BACUNI_00794 [Bactero...   110    3e-23
ref|ZP_03957981.1|  30S ribosomal protein S5 [Lactobacillus ru...   110    3e-23
ref|YP_002378968.1|  30S ribosomal protein S5 [Cyanothece sp. ...   110    4e-23 
ref|ZP_02062340.1|  ribosomal protein S5 [Rickettsiella grylli...   110    4e-23
ref|ZP_02436480.1|  hypothetical protein BACSTE_02739 [Bactero...   110    4e-23
ref|YP_002888135.1|  SSU ribosomal protein S5P [Chlamydia trac...   110    4e-23 
ref|ZP_03156283.1|  ribosomal protein S5 [Cyanothece sp. PCC 7...   110    4e-23
ref|YP_101441.1|  30S ribosomal protein S5 [Bacteroides fragil...   110    4e-23 
ref|YP_001256668.1|  30S ribosomal protein S5 [Mycoplasma agal...   110    4e-23 
ref|YP_681752.1|  30S ribosomal protein S5 [Roseobacter denitr...   110    4e-23 
ref|NP_722307.1|  30S ribosomal protein S5 [Streptococcus muta...   110    4e-23 
ref|NP_212629.1|  30S ribosomal protein S5 [Borrelia burgdorfe...   110    4e-23 
ref|NP_811622.1|  30S ribosomal protein S5 [Bacteroides thetai...   110    4e-23 
ref|ZP_01880502.1|  30S ribosomal protein S5 [Roseovarius sp. ...   110    4e-23
gb|AAP81233.1|  ribosomal protein S5 [Candidatus Portiera aley...   110    4e-23
ref|YP_515814.1|  30S ribosomal protein S5 [Chlamydophila feli...   110    5e-23 
ref|ZP_03713999.1|  hypothetical protein EIKCOROL_01694 [Eiken...   110    5e-23
ref|ZP_03275639.1|  ribosomal protein S5 [Arthrospira maxima C...   110    5e-23
ref|ZP_05038916.1|  ribosomal protein S5 [Synechococcus sp. PC...   110    5e-23
ref|ZP_01958642.1|  hypothetical protein BACCAC_00219 [Bactero...   110    5e-23
gb|EES53073.1|  ribosomal protein S5 [Leptospirillum ferrodiaz...   110    5e-23
ref|ZP_01862646.1|  30S ribosomal protein S5 [Erythrobacter sp...   110    5e-23
ref|ZP_05792015.1|  small subunit ribosomal protein S5 [Butyri...   110    6e-23
ref|NP_109870.1|  30S ribosomal protein S5 [Mycoplasma pneumon...   110    6e-23 
ref|NP_876087.1|  30S ribosomal protein S5 [Prochlorococcus ma...   110    6e-23 
ref|ZP_02152921.1|  30S ribosomal protein S5 [Oceanibulbus ind...   110    6e-23
sp|Q9ST69.1|RR5_SPIOL  RecName: Full=30S ribosomal protein S5,...   110    6e-23
ref|ZP_05413695.1|  ribosomal protein S5 [Bacteroides finegold...   110    6e-23
ref|ZP_02146869.1|  30S ribosomal protein S5 [Phaeobacter gall...   110    6e-23
ref|ZP_00948486.1|  30S ribosomal protein S5 [Sulfitobacter sp...   110    6e-23
ref|ZP_05045730.1|  ribosomal protein S5 [Cyanobium sp. PCC 70...   110    6e-23
ref|ZP_02064050.1|  hypothetical protein BACOVA_01010 [Bactero...   110    6e-23
ref|NP_220027.1|  30S ribosomal protein S5 [Chlamydia trachoma...   110    7e-23 
ref|NP_680888.1|  30S ribosomal protein S5 [Thermosynechococcu...   110    7e-23 
ref|ZP_05091031.1|  ribosomal protein S5 [Ruegeria sp. R11] >g...   110    7e-23
ref|ZP_02544253.1|  ribosomal protein S5 [candidate division T...   109    7e-23
ref|ZP_03460113.1|  hypothetical protein BACEGG_02920 [Bactero...   109    7e-23
gb|AAB95404.1|  ribosomal protein S5 [Mycoplasma gallisepticum]     109    7e-23
ref|YP_002482046.1|  ribosomal protein S5 [Cyanothece sp. PCC ...   109    7e-23 
ref|YP_001929967.1|  30S ribosomal protein S5 [Porphyromonas g...   109    8e-23 



>ref|ZP_03729651.1|  ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1]
 gb|EEG77786.1|  ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1]
Length=166

 Score =  154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 95/115 (82%), Gaps = 0/115 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            EL E V+ INRVAKVVKGGR F+F+ALVAVGDGNG  G G GK  EVP AI+KAIE+AKK
Sbjct  10   ELTEKVVKINRVAKVVKGGRRFSFSALVAVGDGNGHVGTGMGKAGEVPEAIRKAIEDAKK  69

Query  65   DIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++ ++P+ G+TI HT+TG +G+ +VLLKPAS GTG+IAGG  R VL++AG++DIL
Sbjct  70   NMIEVPLVGTTIPHTVTGVYGAGRVLLKPASEGTGVIAGGPVRAVLELAGVRDIL  124


>ref|YP_001716435.1|  ribosomal protein S5 [Candidatus Desulforudis audaxviator MP104C]
 gb|ACA58803.1|  ribosomal protein S5 [Candidatus Desulforudis audaxviator MP104C]
Length=168

 GENE ID: 6026899 Daud_0242 | ribosomal protein S5
[Candidatus Desulforudis audaxviator MP104C]

 Score =  149 bits (377),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 91/115 (79%), Gaps = 0/115 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            E+ E V+ INR AKVVKGGR F+F+ALV VGDG G  G G GK +EVP AI+K IE+ KK
Sbjct  10   EISEKVVFINRCAKVVKGGRRFSFSALVVVGDGAGHVGFGLGKATEVPEAIRKGIEDGKK  69

Query  65   DIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++ Q+P+AG+TI H + G +G+ KVLL+PASPGTG+IAGG  R VL++AG++DIL
Sbjct  70   NLIQVPLAGTTITHEVLGRYGAGKVLLRPASPGTGVIAGGPVRAVLELAGVRDIL  124


>ref|YP_003182513.1|  ribosomal protein S5 [Eggerthella lenta DSM 2243]
 gb|ACV56124.1|  ribosomal protein S5 [Eggerthella lenta DSM 2243]
Length=175

 Score =  149 bits (377),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 93/116 (80%), Gaps = 1/116 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            ELQE V++INRV+KVVKGGR FA TALV VGDGNG  G+G GK  EVP+AI+K +E+AKK
Sbjct  13   ELQERVVYINRVSKVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIAIKKGVEDAKK  72

Query  65   DIHQIPM-AGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++  +P+ A  T+ H I GE+G+ +VL+KPA+PGTG+IAGGAAR V+++AG+ D  
Sbjct  73   NMFSVPLTAEKTLPHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELAGVTDCF  128


>ref|YP_117000.1|  30S ribosomal protein S5 [Nocardia farcinica IFM 10152]
 sp|Q5Z1Q5.1|RS5_NOCFA  RecName: Full=30S ribosomal protein S5
 dbj|BAD55636.1|  putative ribosomal protein S5 [Nocardia farcinica IFM 10152]
Length=218

 GENE ID: 3111514 rpsE | 30S ribosomal protein S5 [Nocardia farcinica IFM 10152]
(10 or fewer PubMed links)

 Score =  149 bits (377),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 0/117 (0%)

Query  3    ESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENA  62
            E    E V+ INRV+KVVKGGR F+FTALV VGDGNG  G+GYGK  EVP AIQK +E A
Sbjct  45   EKNQLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEEA  104

Query  63   KKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            +K   ++PM GSTI H + GE  +  V+L+PASPGTG+IAGGAAR VL+ AGI DIL
Sbjct  105  RKGFFRVPMIGSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGIHDIL  161


>ref|YP_003151356.1|  SSU ribosomal protein S5P [Cryptobacterium curtum DSM 15641]
 gb|ACU94674.1|  SSU ribosomal protein S5P [Cryptobacterium curtum DSM 15641]
Length=173

 GENE ID: 8375190 Ccur_09830 | SSU ribosomal protein S5P
[Cryptobacterium curtum DSM 15641]

 Score =  149 bits (376),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 95/116 (81%), Gaps = 1/116 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            ELQE V++INRV+KVVKGGR F  TALV VGDGNG+ GIG GK  EVP+AI+K IE+AKK
Sbjct  13   ELQERVVYINRVSKVVKGGRRFGLTALVVVGDGNGNVGIGMGKSQEVPVAIRKGIEDAKK  72

Query  65   DIHQIPM-AGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++ ++P+ A  T+ H I G +G+ +VL+KPA+PGTG+IAGGAAR V+++AG+KD+ 
Sbjct  73   NMFKVPLTAEGTLPHEIIGTYGAGRVLIKPATPGTGVIAGGAARAVMELAGVKDVF  128


>ref|ZP_02330659.1|  30S ribosomal protein S5 [Paenibacillus larvae subsp. larvae 
BRL-230010]
Length=165

 Score =  148 bits (374),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 0/115 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            EL E V++INRVAKVVKGGR F+F+ALV VGDGNG  G G GK SEVP AI+K IE+AKK
Sbjct  9    ELTEKVVNINRVAKVVKGGRRFSFSALVVVGDGNGWVGAGIGKASEVPDAIRKGIEDAKK  68

Query  65   DIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++  IP+ G+TI H +TG  G+ +VLLKPAS GTG+IAGG  R VL++AGI DIL
Sbjct  69   NLIHIPIVGTTIPHQVTGRFGAGRVLLKPASEGTGVIAGGPVRAVLELAGIGDIL  123


>ref|YP_001210886.1|  30S ribosomal protein S5 [Pelotomaculum thermopropionicum SI]
 sp|A5D5H1.1|RS5_PELTS  RecName: Full=30S ribosomal protein S5
 dbj|BAF58517.1|  ribosomal protein S5 [Pelotomaculum thermopropionicum SI]
Length=166

 GENE ID: 5138451 rpsE | 30S ribosomal protein S5
[Pelotomaculum thermopropionicum SI] (10 or fewer PubMed links)

 Score =  148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 92/115 (80%), Gaps = 0/115 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            E  E V+ INRVAKVVKGGR F+F+AL+ VGDGNG  G G GK  EVP AI+K IE+AKK
Sbjct  10   ETTEKVVFINRVAKVVKGGRRFSFSALMVVGDGNGHVGAGLGKAGEVPEAIRKGIEDAKK  69

Query  65   DIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++ ++P+AG+TI H + GE G+ KVLLKPA+PGTG+IAGG  R +L++AG++DIL
Sbjct  70   NMIKVPLAGTTIPHEVIGEFGAGKVLLKPAAPGTGVIAGGPVRAILELAGVRDIL  124


>ref|YP_706085.1|  30S ribosomal protein S5 [Rhodococcus jostii RHA1]
 ref|YP_002783395.1|  30S ribosomal protein S5 [Rhodococcus opacus B4]
 sp|Q0S3F9.1|RS5_RHOSR  RecName: Full=30S ribosomal protein S5
 sp|C1B029.1|RS5_RHOOB  RecName: Full=30S ribosomal protein S5
 gb|ABG97927.1|  30S ribosomal protein S5 [Rhodococcus jostii RHA1]
 dbj|BAH54450.1|  30S ribosomal protein S5 [Rhodococcus opacus B4]
Length=218

 GENE ID: 4223701 rpsE | 30S ribosomal protein S5 [Rhodococcus sp. RHA1]
(10 or fewer PubMed links)

 Score =  148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (76%), Gaps = 0/112 (0%)

Query  8    ESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKKDIH  67
            E V+ INRV+KVVKGGR F+FTALV VGDGNG  G+GYGK  EVP AIQK +E A+K   
Sbjct  51   ERVVTINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEEARKSFF  110

Query  68   QIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++PM GSTI H + GE  +  V+L+PASPGTG+IAGGA R VL+ AGI DIL
Sbjct  111  RVPMIGSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAVRAVLECAGIHDIL  162


>ref|NP_737162.1|  30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
 ref|ZP_05749662.1|  30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
 sp|Q8FS52.1|RS5_COREF  RecName: Full=30S ribosomal protein S5
 dbj|BAC17362.1|  putative 30S ribosomal protein S5 [Corynebacterium efficiens 
YS-314]
 gb|EEW50187.1|  30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
Length=211

 GENE ID: 1032673 rpsE | 30S ribosomal protein S5
[Corynebacterium efficiens YS-314] (10 or fewer PubMed links)

 Score =  148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 88/117 (75%), Gaps = 0/117 (0%)

Query  3    ESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENA  62
             S+  E V+ INRV+KVVKGGR F+FTALV VGDG G  G+GYGK  EVP AIQK  E A
Sbjct  41   RSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYGKAKEVPAAIQKGAEEA  100

Query  63   KKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            +K+  ++PM G TI H + GE  +  V+LKPA+PGTG+IAGGAAR VL+ AGI+DIL
Sbjct  101  RKNFFRVPMVGGTITHPVQGEAAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDIL  157


>ref|YP_431268.1|  30S ribosomal protein S5 [Moorella thermoacetica ATCC 39073]
 sp|Q2RFR4.1|RS5_MOOTA  RecName: Full=30S ribosomal protein S5
 gb|ABC20725.1|  SSU ribosomal protein S5P [Moorella thermoacetica ATCC 39073]
Length=166

 GENE ID: 3831673 rpsE | 30S ribosomal protein S5
[Moorella thermoacetica ATCC 39073]

 Score =  148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (76%), Gaps = 0/117 (0%)

Query  3    ESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENA  62
            E +L E V+ +NRVAKVVKGGR F+F ALV VGDG G  G G GK SEVP AI+K IE+A
Sbjct  8    ELDLTEKVVSVNRVAKVVKGGRRFSFAALVVVGDGKGHVGAGLGKASEVPEAIRKGIEDA  67

Query  63   KKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            KK++ ++PM G+TI H I G  G+ KVLLKPA+PGTG+IAGG  R VL+ AGI+DIL
Sbjct  68   KKNLIKVPMVGTTIPHEIIGHFGAGKVLLKPAAPGTGVIAGGPVRAVLEAAGIRDIL  124


>ref|ZP_06160972.1|  ribosomal protein S5 [Slackia exigua ATCC 700122]
 gb|EEZ60340.1|  ribosomal protein S5 [Slackia exigua ATCC 700122]
Length=179

 Score =  147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 1/116 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            ELQE V++INRV+KVVKGGR F  TALV VGDGNG+ G+G GK  EVP+AI+K IE+AKK
Sbjct  15   ELQERVVYINRVSKVVKGGRRFGLTALVVVGDGNGTVGVGMGKSQEVPIAIRKGIEDAKK  74

Query  65   DIHQIPMA-GSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++  +P+    T+ H I GE G+ +VLLKPA+PGTG+IAGG  R V+++AG++D+L
Sbjct  75   NLFTVPLTEAKTLPHEIIGEFGAGRVLLKPATPGTGVIAGGPVRAVMELAGVQDVL  130


>ref|YP_002507890.1|  ribosomal protein S5 [Halothermothrix orenii H 168]
 gb|ACL68895.1|  ribosomal protein S5 [Halothermothrix orenii H 168]
Length=166

 GENE ID: 7313261 Hore_01340 | ribosomal protein S5
[Halothermothrix orenii H 168] (10 or fewer PubMed links)

 Score =  147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 94/115 (81%), Gaps = 0/115 (0%)

Query  5    ELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENAKK  64
            +L+E V++INRVAKVVKGGR F+F+ALV VGDGNG  G+G+GK +EVP AI+K +E+ KK
Sbjct  10   DLEERVVNINRVAKVVKGGRRFSFSALVVVGDGNGHVGVGFGKANEVPEAIRKGVEDGKK  69

Query  65   DIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            ++ ++P+  +TI H I GE G+ KVLLKPA+PGTG+IAGG  R V+++AGI DIL
Sbjct  70   NLIKVPIVNTTIPHEIVGEFGAGKVLLKPAAPGTGVIAGGPVRAVVELAGIGDIL  124


>ref|YP_056528.1|  30S ribosomal protein S5 [Propionibacterium acnes KPA171202]
 ref|ZP_03389697.1|  ribosomal protein S5 [Propionibacterium acnes SK137]
 sp|Q6A6P3.1|RS5_PROAC  RecName: Full=30S ribosomal protein S5
 gb|AAT83570.1|  30S ribosomal protein S5 [Propionibacterium acnes KPA171202]
 gb|EEB67224.1|  ribosomal protein S5 [Propionibacterium acnes SK137]
Length=215

 GENE ID: 2932623 rpsE | 30S ribosomal protein S5
[Propionibacterium acnes KPA171202] (10 or fewer PubMed links)

 Score =  147 bits (372),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 89/117 (76%), Gaps = 0/117 (0%)

Query  3    ESELQESVIHINRVAKVVKGGRNFAFTALVAVGDGNGSAGIGYGKGSEVPLAIQKAIENA  62
            ++E  E V+ INRVAKVV+GGR F+FTALV VGDG GS G+GYGK  EVP AI KA+E A
Sbjct  31   QNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKEVPAAIAKAVEEA  90

Query  63   KKDIHQIPMAGSTIVHTITGEHGSSKVLLKPASPGTGIIAGGAAREVLQVAGIKDIL  119
            KK   ++P+ G TI H + GE  +  V+L+PASPGTG+IAGG+AR VL+ AG+ D+L
Sbjct  91   KKHFFKVPLVGRTITHPVIGEKAAGVVMLRPASPGTGVIAGGSARAVLECAGVHDVL  147