GOS 1168010

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_438
Annotathon code: GOS_1168010
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : COMSATSISB
Username : hira
Annotated on : 2010-01-25 10:08:00
  • khan hira

Contents

Synopsis

  • Taxonomy: Burkholderia (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 32008
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Betaproteobacteria - Order: Burkholderiales
    Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia;

Genomic Sequence

>JCVI_READ_438 GOS_1168010 Genomic DNA
CAGCAGCACGCGGCGAAGCGCATTGCCCAAGGTGTGGCCGTAACCGCGTTCGAACGGTTCCATGACCACCCTCGCGTGGTTCTCGCCCAGCGATTCCACG
GCGATGATCTTGGGTTTCAGCAAACTGGTTTGCATGGGCTTTCCTTTTCAATACCCTCGGCTCGTTACACCGATAAGGCTGACCGGTAACAACCAGAAAA
TAAACAGCCGAGGCCCCTCCTTGCGCAACGCAATCGGGGTACCTCGGCCGTCAATCGGATTAACGCGAATACAATTCGACGATCAGGCTTTCGTTGATGT
CGCCTGCGATTTCAGCGCGTTCCGGCATTTGCTTGAACGTGCCTTCGAACTTCTTCGCATCGACTGCAACCCAGCTCGGCATGCCGCCTTGCTCGGCCAG
CGACAGCGCTTCGACGATACGTGCCTGCTTCTTCGCCTTTTCGCGGATCGCGACGATGTCACCTGCCTTCACTTGCTGCGACGGGACGTTCGCGACGACG
CCGTTCACGGTGATCGACTTGTGGCTCACCAGCTGACGCGCTTCAGCGCGGGTCGAGCCGAAGCCCATGCGATACACGACGTTGTCGAGACGCGACTCGA
GCAGTTGCAGCAGGTTTTCACCCGTGTTGCCCTTGCGGCGGTCGGCTTCAGCGAAGTAGCGGCGGAACTGACGCTCCAGCACGCCGTAGATACGCTTGAC
CTTCTGCTTTTCGCGCAGCTGCGTACCGTAGTCGGACGTACGTGCGCCCGAGGTACGGCCGTGCTGACCCGGCTTGCTGTCGAGCTTGCACTTGTCGGCG
AGCGAGCGGCGCGCGCTCTTCAGGAACAGGTCGGTGCCTTCACGGCGGGACAGCTTGGCCTTCGGGCC

Translation

[301 - 606/868]   indirect strand
>GOS_1168010 Translation [301-606   indirect strand]
MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELY
SR

Annotator commentaries

the sequence which is given to me is searched for ORF and domains. i found 3 ORFs and a putative domain superfamily S4. hence it is a coding sequence.

Then the selected ORF was searched aginst the Non-redundant protein database at BLAST and many good hits were reported. By studying lineage report i selected top 20 hits and included them in "ingroup" and other 5 sequences of two other genera and placed them in "outgroup" and then used all these sequences as input in the MUSCLE alignment program at phylogeny.fr along with my ORf sequence to produce the multiple sequence alignment. This MSA was curated and refined by the GBlocks program at phylogeny.fr. Then Phyml program was used, also available at phylogeny.fr with default parameters, except that bootstrap was set to 100 and phylogenetic tree was obtained.


This sequence encodes for 30S ribosomal protein S4 and it has RNA binding funtion. its lineage is

Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia




ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'universal' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'universal' genetic code



RESULTS ANALYSIS


By ORFinder, as shown in raw results 3 ORF are found. 2 on direct strand and 1 on reverse strand.

out of these the longest ORF which is (>ORF number 1 in reading frame 2 on the direct strand extending from base 62 to base 868.) was searched for homologs, very poor result was found. same happened to the 2nd ORF.

but the ORF on reverse strand showed very good results and had homologs.. that is why i selected the ORF which has the following sequence.


>ORF number 1 in reading frame 1 on the reverse strand extending from base 301 to base 609.

ATGGGCTTCGGCTCGACCCGCGCTGAAGCGCGTCAGCTGGTGAGCCACAAGTCGATCACC

GTGAACGGCGTCGTCGCGAACGTCCCGTCGCAGCAAGTGAAGGCAGGTGACATCGTCGCG

ATCCGCGAAAAGGCGAAGAAGCAGGCACGTATCGTCGAAGCGCTGTCGCTGGCCGAGCAA

GGCGGCATGCCGAGCTGGGTTGCAGTCGATGCGAAGAAGTTCGAAGGCACGTTCAAGCAA

ATGCCGGAACGCGCTGAAATCGCAGGCGACATCAACGAAAGCCTGATCGTCGAATTGTAT

TCGCGTTAA


>Translation of ORF number 1 in reading frame 1 on the reverse strand.

MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ

GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR


As there are 3 ORFs so i can say that this is a coding sequence. to confirm this the next step domain finding is done.

RAW RESULTS


a) forward starnd

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 62 to base 868.
ATGACCACCCTCGCGTGGTTCTCGCCCAGCGATTCCACGGCGATGATCTTGGGTTTCAGC
AAACTGGTTTGCATGGGCTTTCCTTTTCAATACCCTCGGCTCGTTACACCGATAAGGCTG
ACCGGTAACAACCAGAAAATAAACAGCCGAGGCCCCTCCTTGCGCAACGCAATCGGGGTA
CCTCGGCCGTCAATCGGATTAACGCGAATACAATTCGACGATCAGGCTTTCGTTGATGTC
GCCTGCGATTTCAGCGCGTTCCGGCATTTGCTTGAACGTGCCTTCGAACTTCTTCGCATC
GACTGCAACCCAGCTCGGCATGCCGCCTTGCTCGGCCAGCGACAGCGCTTCGACGATACG
TGCCTGCTTCTTCGCCTTTTCGCGGATCGCGACGATGTCACCTGCCTTCACTTGCTGCGA
CGGGACGTTCGCGACGACGCCGTTCACGGTGATCGACTTGTGGCTCACCAGCTGACGCGC
TTCAGCGCGGGTCGAGCCGAAGCCCATGCGATACACGACGTTGTCGAGACGCGACTCGAG
CAGTTGCAGCAGGTTTTCACCCGTGTTGCCCTTGCGGCGGTCGGCTTCAGCGAAGTAGCG
GCGGAACTGACGCTCCAGCACGCCGTAGATACGCTTGACCTTCTGCTTTTCGCGCAGCTG
CGTACCGTAGTCGGACGTACGTGCGCCCGAGGTACGGCCGTGCTGACCCGGCTTGCTGTC
GAGCTTGCACTTGTCGGCGAGCGAGCGGCGCGCGCTCTTCAGGAACAGGTCGGTGCCTTC
ACGGCGGGACAGCTTGGCCTTCGGGCC
>Translation of ORF number 1 in reading frame 2 on the direct strand.
MTTLAWFSPSDSTAMILGFSKLVCMGFPFQYPRLVTPIRLTGNNQKINSRGPSLRNAIGV
PRPSIGLTRIQFDDQAFVDVACDFSAFRHLLERAFELLRIDCNPARHAALLGQRQRFDDT
CLLLRLFADRDDVTCLHLLRRDVRDDAVHGDRLVAHQLTRFSAGRAEAHAIHDVVETRLE
QLQQVFTRVALAAVGFSEVAAELTLQHAVDTLDLLLFAQLRTVVGRTCARGTAVLTRLAV
ELALVGERAARALQEQVGAFTAGQLGLRA

>ORF number 1 in reading frame 3 on the direct strand extends from base 297 to base 536.
ATGTCGCCTGCGATTTCAGCGCGTTCCGGCATTTGCTTGAACGTGCCTTCGAACTTCTTC
GCATCGACTGCAACCCAGCTCGGCATGCCGCCTTGCTCGGCCAGCGACAGCGCTTCGACG
ATACGTGCCTGCTTCTTCGCCTTTTCGCGGATCGCGACGATGTCACCTGCCTTCACTTGC
TGCGACGGGACGTTCGCGACGACGCCGTTCACGGTGATCGACTTGTGGCTCACCAGCTGA
>Translation of ORF number 1 in reading frame 3 on the direct strand.
MSPAISARSGICLNVPSNFFASTATQLGMPPCSASDSASTIRACFFAFSRIATMSPAFTC
CDGTFATTPFTVIDLWLTS



b)reverse starnd

>ORF number 1 in reading frame 1 on the reverse strand extending from base 301 to base 609.
ATGGGCTTCGGCTCGACCCGCGCTGAAGCGCGTCAGCTGGTGAGCCACAAGTCGATCACC
GTGAACGGCGTCGTCGCGAACGTCCCGTCGCAGCAAGTGAAGGCAGGTGACATCGTCGCG
ATCCGCGAAAAGGCGAAGAAGCAGGCACGTATCGTCGAAGCGCTGTCGCTGGCCGAGCAA
GGCGGCATGCCGAGCTGGGTTGCAGTCGATGCGAAGAAGTTCGAAGGCACGTTCAAGCAA
ATGCCGGAACGCGCTGAAATCGCAGGCGACATCAACGAAAGCCTGATCGTCGAATTGTAT
TCGCGTTAA
>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ
GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

A)Phylogeny.fr /MUSCLE default parameters(input: ingroup, outgroup sequences and selected ORF sequence)


RESULTS ANALYSIS

from the results of MSA i got very good alignment of the ingroup and outgroup sequences with my ORF sequences showing that the sequence given is closely related with the ingroup and outgroup sequences.



RAW RESULTS





=>CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|2095213      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|2828887      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1864775      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|2380259      ------MARYTGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
Translatio      ------------------------------------------------------------
gi|1615234      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1720443      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1342944      MIKECNVARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1070242      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|7806494      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1153503      MIKECNVARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1707007      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1720593      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|8372074      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|2542534      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1678381      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|2174248      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|5372079      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|1264540      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|1675877      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|1675643      ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|2248165      ------MARYIGPKCKLSRREGVDLGLKSRARALETKCKLDKAPGQHGERRT-RLSDYAV
gi|2542831      -----------------------------------------------------------M
gi|2691040      ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGQHGARRG-RLSDYGV
gi|1529722      ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKP-RLSDYGV
gi|2065757      ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKP-RLSDYGV
                                                                            

gi|2095213      QLREKQKVKRIYGVLERQFRRYFAEADRLKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|2828887      QLREKQKVKRIYGVLERQFRRYFAEADRLKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1864775      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLKLLESRLDNVVYRMGFGSTRAE
gi|2380259      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
Translatio      ---------------------------------------------------MGFGSTRAE
gi|1615234      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1720443      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1342944      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1070242      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|7806494      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1153503      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE

gi|1707007      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1720593      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|8372074      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|2542534      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1678381      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|2174248      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|5372079      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|1264540      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|1675877      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|1675643      QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|2248165      QLREKQKLRRIYGVLEKQFRNYYKKAAQRKGSTGENLLKLLEGRLDNVVYRMGFGSTRSE
gi|2542831      QLREKQKVRRIYGVLEKQFRNYYKEAARLKGATGENLLQLLECRLDNVVYRMGFGSTRAE
gi|2691040      QLREKQKVRRIYGVLEKQFRNYYQEAARLKGNTGENLLQLLEGRLDNVVYRMGFGATRAE
gi|1529722      QLREKQKVRRMYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAE
gi|2065757      QLREKQKVRRMYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAE
                                                                   ****:**:*

gi|2095213      ARQLVGHKAITVNGVVSNIPSMQVKAGDVVAVREQKRKQARIIEALSLAEQGGMPSWVAV
gi|2828887      ARQLVSHKAIMVNGVVSNIPSMQVKAGDVVAVREQSKKQARILEALSLAEQGGMPSWVSV
gi|1864775      ARQLVSHKAITVNGVVANIPSLQVKAGDVIAVREQAKKQARILEALSLAEQGGLPQWVAV
gi|2380259      ARQLVSHKAITVNGVASNIPSLQVKPGDVIAIREKSKKQARIVEALSLAEQGGMPSWVAV
Translatio      ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1615234      ARQLVSHKSITVNGIVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|1720443      ARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|1342944      ARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|1070242      ARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|7806494      ARQLVSHKSITVNGVVANVPSQQVKSGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1153503      ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1707007      ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1720593      ARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|8372074      ARQLVSHKAITVNGIVANIPSQQVKAGDVISIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|2542534      ARQLVSHKAITVNGIVANIPSQQVKAGDVIAIREKAKKQARIVESLSLAEQGGMPSWVAV
gi|1678381      ARQLVSHKAITVNGIVANIPSQQVKAGDVVSIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|2174248      ARQLVSHKAITVNGIVANIPSQQVRAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|5372079      ARQLVSHKAITVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1264540      ARQLVSHKAVTVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|1675877      ARQLVSHKAITVNGIVANVPSQQVKAGDVIAIREKAKKQARIVEALSLAEQGGLASWVAV
gi|1675643      ARQLVSHKAITLNGVVANVPSQQVKAGDVISIREKAKKQARIVEALSLAEQGGLASWVAV
gi|2248165      ARQLVSHRAVLVNGQVVNIAAYQVQPSDVVSIREKARKQVRIQDSMTLAEQSGFPSWVEV
gi|2542831      ARQLVAHKGILINNAVVNIPSYQVKPGDVVSIREKAKKQLRVQAALSLAEQRGEPVWIEV
gi|2691040      ARQLVSHKAILVNGQVVNVPSYKVAANDVVSIREKAKNQARIKAALEVATQRELPTWVEV
gi|1529722      ARQLVSHKAIMVNGRVVNIASYQVKANDVVSIREKAKKQSRVKAALELAEQREKPTWLEV
gi|2065757      ARQLVSHKAIMVNGRVVNIASYQVKANDVVSIREKAKKQSRVKAALELAEQREKPTWLEV
                *****.*..: :*. . *:.: :* ..*::::**: .:* *:  :: :* *   . *: *

gi|2095213      DAKKFEGTFKQKPERSDIAGDINESLIVELYSR
gi|2828887      DSKKFEGTFKQKPERSEIAGDINESLIVELYSR
gi|1864775      DSKKFEGTFKSMPERSDIAGDINESLIVELYSR
gi|2380259      DAKKFEGTFKQVPERAEIAGDINESLIVELYSR
Translatio      DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|1615234      DAKKFEGTFKQVPERADIGGDINESLIVELYSR
gi|1720443      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|1342944      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|1070242      DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|7806494      DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|1153503      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|1707007      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|1720593      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|8372074      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|2542534      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|1678381      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|2174248      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|5372079      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|1264540      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|1675877      DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|1675643      DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|2248165      DTSKFEGTFKAIPDRSDLPADINESLVVELYSK
gi|2542831      NNEKLEGTFKAKPERADLSSEINENLIVELYSK
gi|2691040      DNKKMEGTFKRLPERSDLSADINEHLIVELYSK
gi|1529722      DAGKMEGTFKRQPERSDLSADINEHLIVELYSK
gi|2065757      DAGKMEGTFKRQPERSDLSADINEHLIVELYSK
                :  *:*****  *:*::: .:*** *:*****.



=>Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 26
Alignment assumed to be: Protein
New number of positions: 102 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|209521361|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|282888779|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|186477562|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|238025957|re  ------MARYTGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
Translation_of   ------------------------------------------------------------
gi|161523454|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|172044373|sp  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|134294468|re  MIKECNVARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|107024278|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|78064949|ref  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|115350347|re  MIKECNVARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|170700719|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|172059366|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|83720741|ref  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|254253495|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|167838187|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|217424827|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|53720796|ref  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|126454036|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRISGARTSDYGT
gi|167587747|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|167564391|re  ------MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTSGARTSDYGT
gi|224816509|re  ------MARYIGPKCKLSRREGVDLGLKSRARALETKCKLDKAPGQHGERRT-RLSDYAV
gi|254283192|re  -----------------------------------------------------------M
gi|269104036|re  ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGQHGARRG-RLSDYGV
gi|152972204|re  ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKP-RLSDYGV
gi|206575742|re  ------MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKP-RLSDYGV
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|209521361|re  QLREKQKVKRIYGVLERQFRRYFAEADRLKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|282888779|re  QLREKQKVKRIYGVLERQFRRYFAEADRLKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|186477562|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLKLLESRLDNVVYRMGFGSTRAE
gi|238025957|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
Translation_of   ---------------------------------------------------MGFGSTRAE
gi|161523454|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|172044373|sp  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|134294468|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|107024278|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|78064949|ref  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|115350347|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|170700719|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|172059366|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|83720741|ref  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|254253495|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|167838187|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|217424827|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|53720796|ref  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|126454036|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGETLLQLLESRLDNVVYRMGFGSTRAE
gi|167587747|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|167564391|re  QLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVYRMGFGSTRAE
gi|224816509|re  QLREKQKLRRIYGVLEKQFRNYYKKAAQRKGSTGENLLKLLEGRLDNVVYRMGFGSTRSE
gi|254283192|re  QLREKQKVRRIYGVLEKQFRNYYKEAARLKGATGENLLQLLECRLDNVVYRMGFGSTRAE
gi|269104036|re  QLREKQKVRRIYGVLEKQFRNYYQEAARLKGNTGENLLQLLEGRLDNVVYRMGFGATRAE
gi|152972204|re  QLREKQKVRRMYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAE
gi|206575742|re  QLREKQKVRRMYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAE
                                                                    #########


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|209521361|re  ARQLVGHKAITVNGVVSNIPSMQVKAGDVVAVREQKRKQARIIEALSLAEQGGMPSWVAV
gi|282888779|re  ARQLVSHKAIMVNGVVSNIPSMQVKAGDVVAVREQSKKQARILEALSLAEQGGMPSWVSV
gi|186477562|re  ARQLVSHKAITVNGVVANIPSLQVKAGDVIAVREQAKKQARILEALSLAEQGGLPQWVAV
gi|238025957|re  ARQLVSHKAITVNGVASNIPSLQVKPGDVIAIREKSKKQARIVEALSLAEQGGMPSWVAV
Translation_of   ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|161523454|re  ARQLVSHKSITVNGIVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|172044373|sp  ARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|134294468|re  ARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQGGMPSWVAV
gi|107024278|re  ARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|78064949|ref  ARQLVSHKSITVNGVVANVPSQQVKSGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|115350347|re  ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|170700719|re  ARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|172059366|re  ARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|83720741|ref  ARQLVSHKAITVNGIVANIPSQQVKAGDVISIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|254253495|re  ARQLVSHKAITVNGIVANIPSQQVKAGDVIAIREKAKKQARIVESLSLAEQGGMPSWVAV
gi|167838187|re  ARQLVSHKAITVNGIVANIPSQQVKAGDVVSIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|217424827|re  ARQLVSHKAITVNGIVANIPSQQVRAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|53720796|ref  ARQLVSHKAITVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|126454036|re  ARQLVSHKAVTVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQGGMPSWVAV
gi|167587747|re  ARQLVSHKAITVNGIVANVPSQQVKAGDVIAIREKAKKQARIVEALSLAEQGGLASWVAV
gi|167564391|re  ARQLVSHKAITLNGVVANVPSQQVKAGDVISIREKAKKQARIVEALSLAEQGGLASWVAV
gi|224816509|re  ARQLVSHRAVLVNGQVVNIAAYQVQPSDVVSIREKARKQVRIQDSMTLAEQSGFPSWVEV
gi|254283192|re  ARQLVAHKGILINNAVVNIPSYQVKPGDVVSIREKAKKQLRVQAALSLAEQRGEPVWIEV
gi|269104036|re  ARQLVSHKAILVNGQVVNVPSYKVAANDVVSIREKAKNQARIKAALEVATQRELPTWVEV
gi|152972204|re  ARQLVSHKAIMVNGRVVNIASYQVKANDVVSIREKAKKQSRVKAALELAEQREKPTWLEV
gi|206575742|re  ARQLVSHKAIMVNGRVVNIASYQVKANDVVSIREKAKKQSRVKAALELAEQREKPTWLEV
                 ############################################################


                        190       200       210
                 =========+=========+=========+===
gi|209521361|re  DAKKFEGTFKQKPERSDIAGDINESLIVELYSR
gi|282888779|re  DSKKFEGTFKQKPERSEIAGDINESLIVELYSR
gi|186477562|re  DSKKFEGTFKSMPERSDIAGDINESLIVELYSR
gi|238025957|re  DAKKFEGTFKQVPERAEIAGDINESLIVELYSR
Translation_of   DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|161523454|re  DAKKFEGTFKQVPERADIGGDINESLIVELYSR
gi|172044373|sp  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|134294468|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|107024278|re  DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|78064949|ref  DAKKFEGTFKQMPERAEIAGDINESLIVELYSR
gi|115350347|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|170700719|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|172059366|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|83720741|ref  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|254253495|re  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|167838187|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|217424827|re  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|53720796|ref  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|126454036|re  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|167587747|re  DAKKFEGTFKQMPERADIAGDINESLIVELYSR
gi|167564391|re  DAKKFEGTFKQVPERADIAGDINESLIVELYSR
gi|224816509|re  DTSKFEGTFKAIPDRSDLPADINESLVVELYSK
gi|254283192|re  NNEKLEGTFKAKPERADLSSEINENLIVELYSK
gi|269104036|re  DNKKMEGTFKRLPERSDLSADINEHLIVELYSK
gi|152972204|re  DAGKMEGTFKRQPERSDLSADINEHLIVELYSK
gi|206575742|re  DAGKMEGTFKRQPERSDLSADINEHLIVELYSK
                 #################################





Parameters used
Minimum Number Of Sequences For A Conserved Position: 14
Minimum Number Of Sequences For A Flanking Position: 22
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 1 selected block(s)
Flanks: [112  213]  

New number of positions in input.fasta-gb:  102  (47% of the original 213 positions)



Protein Domains

PROTOCOL

InterPro default parameters at EBI



RESULTS ANALYSIS


By INTERPRO database, i found results of domains..3 of which were integrated and the other 2 were unintegrated. so i ignored the unintegrated domains and selected 3 integrated domain which are..

Domain name start stop E.value Function

PS50889 S4 1 55 11.160 RNA-binding S4 Molecular Function: RNA binding (GO:0003723)

SM00363 S4 1 56 8.8e-06 RNA-binding S4 Molecular Function: RNA binding (GO:0003723)

PF01479 S4 1 39 4.8e-13 RNA-binding S4 Molecular Function: RNA binding (GO:0003723)


they belong to the S4 superfamily..S4 is an RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; These domains are found in stress proteins, ribosomal proteins and tRNA synthetases.


Hence by this step i cocclude that the sequence given is coding beacuse it has ORF and also a putative domain.

RAW RESULTS
Translation	6CF11648C29D0FC7	102	superfamily	SSF55174	Alpha-L RNA-	1	102	5.9e-32	T	08-Jan-2010	NULL	NULL	
                                                                               binding motif
Translation	6CF11648C29D0FC7	102	ProfileScan	PS50889	        S4	        1	55	11.160	T	08-Jan-2010	IPR002942	RNA-binding S4	Molecular Function: RNA binding (GO:0003723)
Translation	6CF11648C29D0FC7	102	HMMSmart	SM00363	        S4	        1	56	8.8e-06	T	08-Jan-2010	IPR002942	RNA-binding S4	Molecular Function: RNA binding (GO:0003723)
Translation	6CF11648C29D0FC7	102	HMMPfam	        PF01479	        S4	        1	39	4.8e-13	T	08-Jan-2010	IPR002942	RNA-binding S4	Molecular Function: RNA binding (GO:0003723)
Translation	6CF11648C29D0FC7	102	Gene3D	G3DSA:3.10.290.10	no description	1	102	6.4e-30	T	08-Jan-2010	NULL	NULL	

Phylogeny

PROTOCOL

Phylogeny.fr / PhyML method / bootstrap


RESULTS ANALYSIS

In the raw results tree is shown which is taken after bootstraping.every node is showing that the organism is from which class of proteobacteria.

It is seen that the ORF sequence lies in the Ingroup and belongs to the b-proteobactia. my sequence is more closely related to the organisms Burkholderia_ambifaria_AMMD and Burkholderia_ambifaria_IOP40 because these are originating from the same node showing that it is evolutionary related to these organisms.


hence the linege of our sequence is :

Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia




RAW RESULTS
                                  +Klebsiella_pneumoniae_subsp._pneumoniae_MGH_78578_gi_152972204[enterobacteria]
                      +-----------+
                      |           +Klebsiella_pneumoniae_342_gi_206575742[enterobacteria]
          +-----------+
          |           +-----------Photobacterium_damselae_subsp._damselae_CIP_102761_gi_269104036[g-proteobactia]
     +----+
 +---+    +---------------------------gamma_proteobacterium_NOR51-B_gi_254283192[g-proteobactia]
 |   |
 |   +--------------------------------Thioalkalivibrio_sp._K90mix_gi_224816509[g-proteobactia]
 |
 |
 |                             +------Burkholderia_sp._H160_gi_209521361[b-proteobactia]
 |                         +---+
 |                     +---+   +-----ribosomal_protein_S4_Burkholderia_gi_282888779[b-proteobactia]
 |                     |   |
 |                     |   +-----Burkholderia_phymatum_STM815_gi_186477562[b-proteobactia]
 |                     |
 |                     |       +Burkholderia_cenocepacia_AU_1054_gi_107024278[b-proteobactia]
 |                     |      ++
 |                     |      |+-Burkholderia_sp._383_gi_78064949[b-proteobactia]
 |                     |      |
 |                     |      |+-Translation_of_ORF_number_1_in_reading_frame_1_on_the_reverse_st[ORF SEQUENCE]
 |                     |      ||
 |                     |      |+Burkholderia_ambifaria_AMMD_gi_115350347[b-proteobactia]
 |                     |     ++|
 |                     |     ||+Burkholderia_ambifaria_IOP40-10_gi_170700719[b-proteobactia]
 +---------------------+     ||
                       |     ||
                       |   +-++Burkholderia_ambifaria_MC40-6_gi_172059366[b-proteobactia]
                       |   | |
                       |   | |+Burkholderia_vietnamiensis_G4_gi_172044373[b-proteobactia]
                       |   | ||
                       |   | ++Burkholderia_vietnamiensis_G4_gi_134294468[b-proteobactia]
                       |  ++  |
                       |  ||  +---Burkholderia_multivorans_ATCC_17616_gi_161523454[b-proteobactia]
                       |  ||
                       |  ||  +-Burkholderia_ubonensis_Bu_gi_167587747[b-proteobactia]
                       |  |+--+
                       +--+   +----Burkholderia_oklahomensis_EO147_gi_167564391[b-proteobactia]
                          |
                          | +-------Burkholderia_glumae_BGR1_gi_238025957[b-proteobactia]
                          | |
                          | | +Burkholderia_thailandensis_E264_gi_83720741[b-proteobactia]
                          +-+++
                            |||
                            ||+--Burkholderia_thailandensis_MSMB43_gi_167838187[b-proteobactia]
                            ++
                             |-Burkholderia_dolosa_AUO158_gi_254253495[b-proteobactia]
                             |
                             |+-Burkholderia_pseudomallei_576_gi_217424827[b-proteobactia]
                             ||
                             ++-Burkholderia_pseudomallei_1106a_gi_126454036[b-proteobactia]
                              |
                              +Burkholderia_pseudomallei_K96243_gi_53720796[b-proteobactia]

Taxonomy report

PROTOCOL

BLASTp versus NR, NCBI default parameters apart from "Number of Target sequences_1000"


RESULTS ANALYSIS

on the basis of lineage report there are 3 species of bacteria seen. gamma proteobacterium, beta proteobacterium and enterobacteria. most of the homologues belong to beta proteobacterium, so the first 20 hits which belong to beta proteobacterium are placed in the "ingroup" and fron middle of the hits 5 organisms ( 3 belonging to gamma proteobacterium and 2 to enterobacteria) are placed in the "outgroup".



_>INGROUP: b-proteobacteria


Orgnism name score E.value

ref|YP_622605.1| Burkholderia cenocepacia AU 1054[b-proteobacteria] 207 3e-52

ref|ZP_02891714.1| Burkholderia ambifaria IOP40-10 [b-proteobacteria] 206 5e-52

ref|YP_772186.1| Burkholderia ambifaria AMMD[b-proteobacteria] 206 6e-52

ref|YP_367718.1| Burkholderia sp. 383 [b-proteobacteria] 206 8e-52

ref|YP_001807018.1| Burkholderia ambifaria MC40-6 [b-proteobacteria] 206 8e-52

sp|A4JAR5.2| Full_30S ribosomal protein S4 [b-proteobacteria] 205 2e-51

ref|YP_001118203.1| Burkholderia vietnamiensis G4 [b-proteobacteria] 204 2e-51

ref|ZP_02465046.1| Burkholderia thailandensis MSMB43 [b-proteobacteria] 202 9e-51

ref|YP_109782.1| Burkholderia pseudomallei K96243 [b-proteobacteria] 201 2e-50

ref|YP_001578466.1| Burkholderia multivorans ATCC 17616 [b-proteobacteria] 201 3e-50

ref|YP_001068009.1| Burkholderia pseudomallei 1106a[b-proteobacteria] 200 3e-50

ref|ZP_03456324.1| Burkholderia pseudomallei 576 [b-proteobacteria] 200 4e-50

ref|YP_443547.1| Burkholderia thailandensis E264 [b-proteobacteria] 199 5e-50

ref|ZP_04946813.1| Burkholderia dolosa AUO158[b-proteobacteria] 199 5e-50

ref|ZP_02380135.1| Burkholderia ubonensis Bu [b-proteobacteria] 199 1e-49

ref|ZP_02357307.1| Burkholderia oklahomensis EO147 [b-proteobacteria] 195 1e-48

ref|YP_002910188.1| Burkholderia glumae BGR1[b-proteobacteria] 193 4e-48

ref|YP_001859032.1| Burkholderia phymatum STM815 [b-proteobacteria] 189 5e-47

ref|ZP_03270074.1| Burkholderia sp. H160 [b-proteobacteria] 189 8e-47

ref|ZP_06297353.1| Burkholderia sp. CCGE1001 [b-proteobacteria] 189 9e-47






_>OUTGROUP: g-proteobacteria,enterobacteria


Orgnism name score E.value

ref|ZP_03689644.1| Thioalkalivibrio sp. K90mix [g-proteobacteria] 146 6e-34

ref|ZP_06156733.1| Photobacterium damselae subsp. damselae CIP[g-proteobacteria] 146 7e-34

ref|ZP_04958160.1| gamma proteobacterium NOR51-B [g-proteobacteria] 145 9e-34

ref|YP_001337350.1| Klebsiella pneumoniae subsp. pneumoniae MGH[enterobacteria] 145 1e-33

ref|YP_002236302.1| Klebsiella pneumoniae 342 [enterobacteria] 145 1e-33


RAW RESULTS

Lineage Report

root
. cellular organisms
. . Bacteria                     [bacteria]
. . . Proteobacteria               [proteobacteria]
. . . . Betaproteobacteria           [b-proteobacteria]
. . . . . Burkholderiales              [b-proteobacteria]
. . . . . . Burkholderiaceae             [b-proteobacteria]
. . . . . . . Burkholderia                 [b-proteobacteria]
. . . . . . . . Burkholderia cepacia complex [b-proteobacteria]
. . . . . . . . . Burkholderia cenocepacia     [b-proteobacteria]
. . . . . . . . . . Burkholderia cenocepacia AU 1054 -----------------------------  207  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
. . . . . . . . . . Burkholderia cenocepacia HI2424 ..............................  207  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
. . . . . . . . . . Burkholderia cenocepacia MC0-3 ...............................  207  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
. . . . . . . . . . Burkholderia cenocepacia J2315 ...............................  207  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
. . . . . . . . . . Burkholderia cenocepacia PC184 ...............................  207  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
. . . . . . . . . Burkholderia ambifaria IOP40-10 --------------------------------  206  2 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia ambifaria IOP40-10] >gi|
. . . . . . . . . Burkholderia ambifaria MEX-5 ...................................  206  2 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia ambifaria IOP40-10] >gi|
. . . . . . . . . Burkholderia ambifaria AMMD ....................................  206  3 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia ambifaria IOP40-10] >gi|
. . . . . . . . . Burkholderia sp. 383 ...........................................  206  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia sp. 383] >gi|9010167
. . . . . . . . . Burkholderia ambifaria MC40-6 ..................................  206  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia ambifaria MC40-6] >g
. . . . . . . . . Burkholderia vietnamiensis G4 ..................................  205  3 hits [b-proteobacteria]       RecName: Full=30S ribosomal protein S4
. . . . . . . . . Burkholderia multivorans ATCC 17616 ............................  201  5 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia multivorans ATCC 176
. . . . . . . . . Burkholderia multivorans CGD2M .................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia multivorans ATCC 176
. . . . . . . . . Burkholderia multivorans CGD2 ..................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia multivorans ATCC 176
. . . . . . . . . Burkholderia multivorans CGD1 ..................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia multivorans ATCC 176
. . . . . . . . . Burkholderia dolosa AUO158 .....................................  199  2 hits [b-proteobacteria]       Ribosomal protein S4 [Burkholderia dolosa AUO158] >gi|12489
. . . . . . . . Burkholderia thailandensis MSMB43 --------------------------------  202  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia thailandensis MSMB43]
. . . . . . . . Burkholderia pseudomallei K96243 .................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei ATCC 23344 ...................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei GB8 horse 4 ..................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 1710b ..................................  201  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei SAVP1 ........................................  201  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei NCTC 10229 ...................................  201  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 668 ....................................  201  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei NCTC 10247 ...................................  201  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 305 ....................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei PRL-20 .......................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei DM98 ...................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 14 .....................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 91 .....................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 9 ......................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 7894 ...................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei NCTC 13177 .............................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 112 ....................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei BCC215 .................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei Pakistan 9 .............................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei MSHR346 ................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei ATCC 10399 ...................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 1655 ...................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei Pasteur 52237 ..........................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei S13 ....................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei FMH ..........................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei JHU ..........................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 1710a ..................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 406e ...................................  201  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia mallei ..............................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei ........................................  201  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
. . . . . . . . Burkholderia pseudomallei 1106a ..................................  200  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei 1106a] 
. . . . . . . . Burkholderia pseudomallei B7210 ..................................  200  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei 1106a] 
. . . . . . . . Burkholderia pseudomallei 1106b ..................................  200  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei 1106a] 
. . . . . . . . Burkholderia pseudomallei 576 ....................................  200  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia pseudomallei 576] >g
. . . . . . . . Burkholderia thailandensis E264 ..................................  199  4 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia thailandensis E264] 
. . . . . . . . Burkholderia thailandensis TXDOH .................................  199  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia thailandensis E264] 
. . . . . . . . Burkholderia thailandensis Bt4 ...................................  199  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia thailandensis E264] 
. . . . . . . . Burkholderia ubonensis Bu ........................................  199  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia ubonensis Bu]
. . . . . . . . Burkholderia oklahomensis EO147 ..................................  195  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia oklahomensis EO147] 
. . . . . . . . Burkholderia oklahomensis C6786 ..................................  195  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia oklahomensis EO147] 
. . . . . . . . Burkholderia glumae BGR1 .........................................  193  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia glumae BGR1] >gi|237
. . . . . . . . Burkholderia phymatum STM815 .....................................  189  3 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia phymatum STM815] >gi|226
. . . . . . . . Burkholderia sp. H160 ............................................  189  2 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia sp. H160] >gi|209498181|
. . . . . . . . Burkholderia sp. CCGE1001 ........................................  189  2 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia sp. CCGE1001] >gi|281325
. . . . . . . . Burkholderia sp. CCGE1002 ........................................  188  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia sp. CCGE1002] >gi|27
. . . . . . . . Burkholderia graminis C4D1M ......................................  188  2 hits [b-proteobacteria]       ribosomal protein S4 [Burkholderia graminis C4D1M] >gi|1701
. . . . . . . . Burkholderia phytofirmans PsJN ...................................  187  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia phytofirmans PsJN] >
. . . . . . . . Burkholderia xenovorans LB400 ....................................  186  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Burkholderia xenovorans LB400] >g
. . . . . . . Cupriavidus taiwanensis --------------------------------------------  174  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Cupriavidus taiwanensis] >gi|2266
. . . . . . . Ralstonia eutropha JMP134 ..........................................  174  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Ralstonia eutropha JMP134] >gi|90
. . . . . . . Ralstonia eutropha H16 .............................................  173  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Ralstonia eutropha H16] >gi|12303
. . . . . . . Ralstonia metallidurans CH34 .......................................  172  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Ralstonia metallidurans CH34] >gi
. . . . . . . Ralstonia pickettii 12D ............................................  172  2 hits [b-proteobacteria]       ribosomal protein S4 [Ralstonia pickettii 12D] >gi|24086653
. . . . . . . Ralstonia solanacearum UW551 .......................................  171  2 hits [b-proteobacteria]       SSU ribosomal protein S4P [Ralstonia solanacearum UW551] >g
. . . . . . . Ralstonia solanacearum IPO1609 .....................................  171  2 hits [b-proteobacteria]       SSU ribosomal protein S4P [Ralstonia solanacearum UW551] >g
. . . . . . . Ralstonia pickettii 12J ............................................  171  3 hits [b-proteobacteria]       ribosomal protein S4 [Ralstonia pickettii 12J] >gi|22669910
. . . . . . . Ralstonia solanacearum GMI1000 .....................................  171  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Ralstonia solanacearum GMI1000] >
. . . . . . . Ralstonia solanacearum .............................................  171  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Ralstonia solanacearum GMI1000] >
. . . . . . . Limnobacter sp. MED105 .............................................  153  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Limnobacter sp. MED105] >gi|14982
. . . . . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ......  149  3 hits [b-proteobacteria]       ribosomal protein S4 [Polynucleobacter necessarius subsp. a
. . . . . . . Polynucleobacter necessarius subsp. necessarius STIR1 ..............  146  3 hits [b-proteobacteria]       ribosomal protein S4 [Polynucleobacter necessarius subsp. n
. . . . . . Herminiimonas arsenicoxydans -----------------------------------------  171  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Herminiimonas arsenicoxydans] >gi
. . . . . . Janthinobacterium sp. Marseille ......................................  169  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Janthinobacterium sp. Marseille] 
. . . . . . Diaphorobacter sp. TPSY ..............................................  156  3 hits [b-proteobacteria]       ribosomal protein S4 [Diaphorobacter sp. TPSY] >gi|25476458
. . . . . . Comamonas testosteroni KF-1 ..........................................  155  2 hits [b-proteobacteria]       ribosomal protein S4 [Comamonas testosteroni KF-1] >gi|2207
. . . . . . Acidovorax sp. JS42 ..................................................  155  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Acidovorax sp. JS42] >gi|15206092
. . . . . . Polaromonas naphthalenivorans CJ2 ....................................  154  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Polaromonas naphthalenivorans CJ2
. . . . . . Comamonas testosteroni CNB-2 .........................................  154  2 hits [b-proteobacteria]       ribosomal protein S4 [Comamonas testosteroni CNB-2] >gi|262
. . . . . . Rhodoferax ferrireducens T118 ........................................  154  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Rhodoferax ferrireducens T118] >g
. . . . . . Variovorax paradoxus S110 ............................................  154  3 hits [b-proteobacteria]       ribosomal protein S4 [Variovorax paradoxus S110] >gi|259495
. . . . . . Acidovorax delafieldii 2AN ...........................................  154  2 hits [b-proteobacteria]       ribosomal protein S4 [Acidovorax delafieldii 2AN] >gi|24136
. . . . . . Acidovorax avenae subsp. avenae ATCC 19860 ...........................  153  2 hits [b-proteobacteria]       ribosomal protein S4 [Acidovorax avenae subsp. avenae ATCC 
. . . . . . Delftia acidovorans SPH-1 ............................................  152  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Delftia acidovorans SPH-1] >gi|22
. . . . . . Acidovorax citrulli AAC00-1 ..........................................  152  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Acidovorax avenae subsp. citrulli
. . . . . . Oxalobacter formigenes OXCC13 ........................................  151  2 hits [b-proteobacteria]       small subunit ribosomal protein S4 [Oxalobacter formigenes 
. . . . . . Methylibium petroleiphilum PM1 .......................................  151  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Methylibium petroleiphilum PM1] >
. . . . . . Polaromonas sp. JS666 ................................................  151  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Polaromonas sp. JS666] >gi|123060
. . . . . . Oxalobacter formigenes HOxBLS ........................................  150  2 hits [b-proteobacteria]       small subunit ribosomal protein S4 [Oxalobacter formigenes 
. . . . . . Verminephrobacter eiseniae EF01-2 ....................................  150  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Verminephrobacter eiseniae EF01-2
. . . . . . Thiomonas intermedia K12 .............................................  148  2 hits [b-proteobacteria]       ribosomal protein S4 [Thiomonas intermedia K12] >gi|2567416
. . . . . . Leptothrix cholodnii SP-6 ............................................  147  3 hits [b-proteobacteria]       ribosomal protein S4 [Leptothrix cholodnii SP-6] >gi|226699
. . . . . . Bordetella petrii DSM 12804 ..........................................  145  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Bordetella petrii DSM 12804] >gi|
. . . . . . Bordetella petrii ....................................................  145  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Bordetella petrii DSM 12804] >gi|
. . . . . . Bordetella pertussis Tohama I ........................................  143  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella parapertussis 12822 .......................................  143  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella bronchiseptica RB50 .......................................  143  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella pertussis .................................................  143  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella bronchiseptica ............................................  143  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella parapertussis .............................................  143  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Bordetella pertussis Tohama I] >g
. . . . . . Bordetella avium 197N ................................................  139  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Bordetella avium 197N] >gi|123515
. . . . . Lutiella nitroferrum 2002 ----------------------------------------------  169  2 hits [b-proteobacteria]       ribosomal protein S4 [Lutiella nitroferrum 2002] >gi|224600
. . . . . Chromobacterium violaceum ATCC 12472 ...................................  168  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Chromobacterium violaceum ATCC 12
. . . . . Chromobacterium violaceum ..............................................  168  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Chromobacterium violaceum ATCC 12
. . . . . Neisseria sicca ATCC 29256 .............................................  164  2 hits [b-proteobacteria]       ribosomal protein S4 [Neisseria sicca ATCC 29256] >gi|26136
. . . . . Neisseria mucosa ATCC 25996 ............................................  164  1 hit  [b-proteobacteria]       ribosomal protein S4 [Neisseria sicca ATCC 29256] >gi|26136
. . . . . Neisseria subflava NJ9703 ..............................................  162  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria subflava NJ9703]
. . . . . Neisseria flavescens SK114 .............................................  162  2 hits [b-proteobacteria]       ribosomal protein S4 [Neisseria flavescens SK114] >gi|24132
. . . . . Neisseria flavescens NRL30031/H210 .....................................  162  2 hits [b-proteobacteria]       hypothetical protein NEIFLAOT_01464 [Neisseria flavescens N
. . . . . Neisseria cinerea ATCC 14685 ...........................................  160  2 hits [b-proteobacteria]       ribosomal protein S4 [Neisseria cinerea ATCC 14685] >gi|269
. . . . . Neisseria lactamica ATCC 23970 .........................................  160  2 hits [b-proteobacteria]       ribosomal protein S4 [Neisseria lactamica ATCC 23970] >gi|2
. . . . . Neisseria gonorrhoeae NCCP11945 ........................................  157  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria gonorrhoeae NCCP11945] 
. . . . . Neisseria meningitidis MC58 ............................................  157  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae FA 1090 ..........................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis FAM18 ...........................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis 053442 ..........................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis Z2491 ...........................................  157  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae 35/02 ............................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae DGI18 ............................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae FA6140 ...........................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae FA19 .............................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae MS11 .............................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae PID18 ............................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae PID1 .............................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae PID24-1 ..........................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae PID332 ...........................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae SK-92-679 ........................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae SK-93-1035 .......................................  157  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae 1291 .............................................  157  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis alpha14 .........................................  157  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria gonorrhoeae DGI2 .............................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis serogroup B .....................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis serogroup A .....................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis alpha153 ........................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis alpha275 ........................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Neisseria meningitidis 8013 ............................................  157  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Neisseria meningitidis MC58] >gi|
. . . . . Kingella oralis ATCC 51147 .............................................  156  2 hits [b-proteobacteria]       hypothetical protein GCWU000324_01515 [Kingella oralis ATCC
. . . . . Laribacter hongkongensis HLHK9 .........................................  155  3 hits [b-proteobacteria]       RpsD [Laribacter hongkongensis HLHK9] >gi|254764593|sp|C1DA
. . . . . Eikenella corrodens ATCC 23834 .........................................  148  2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_01699 [Eikenella corrodens AT
. . . . . Gallionella ferruginea ES-2 ............................................  122  2 hits [b-proteobacteria]       ribosomal protein S4 [Gallionella ferruginea ES-2] >gi|2518
. . . . . Methylotenera mobilis JLW8 .............................................  120  2 hits [b-proteobacteria]       ribosomal protein S4 [Methylotenera mobilis JLW8] >gi|25398
. . . . . Methylovorus sp. SIP3-4 ................................................  120  2 hits [b-proteobacteria]       ribosomal protein S4 [Methylovorus sp. SIP3-4] >gi|25398471
. . . . . beta proteobacterium KB13 ..............................................  119  2 hits [b-proteobacteria]       ribosomal protein S4 [beta proteobacterium KB13] >gi|207087
. . . . . Nitrosospira multiformis ATCC 25196 ....................................  118  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Nitrosospira multiformis ATCC 251
. . . . . Nitrosomonas sp. AL212 .................................................  116  2 hits [b-proteobacteria]       ribosomal protein S4 [Nitrosomonas sp. AL212] >gi|254981920
. . . . . Thiobacillus denitrificans ATCC 25259 ..................................  115  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Thiobacillus denitrificans ATCC 2
. . . . . Aromatoleum aromaticum EbN1 ............................................  112  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Aromatoleum aromaticum EbN1] >gi|
. . . . . Thauera sp. MZ1T .......................................................  112  2 hits [b-proteobacteria]       ribosomal protein S4 [Thauera sp. MZ1T] >gi|237625218|gb|AC
. . . . . Azoarcus sp. BH72 ......................................................  111  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Azoarcus sp. BH72] >gi|152060933|
. . . . . Dechloromonas aromatica RCB ............................................  110  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Dechloromonas aromatica RCB] >gi|
. . . . . Nitrosomonas europaea ATCC 19718 .......................................  109  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Nitrosomonas europaea ATCC 19718]
. . . . . Nitrosomonas europaea ..................................................  109  1 hit  [b-proteobacteria]       30S ribosomal protein S4 [Nitrosomonas europaea ATCC 19718]
. . . . . Nitrosomonas eutropha C91 ..............................................  108  3 hits [b-proteobacteria]       30S ribosomal protein S4 [Nitrosomonas eutropha C91] >gi|12
. . . . . Methylophilales bacterium HTCC2181 .....................................  108  2 hits [b-proteobacteria]       30S ribosomal protein S4 [Methylophilales bacterium HTCC218
. . . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ...............  105  2 hits [b-proteobacteria]       ribosomal protein S4 [Candidatus Accumulibacter phosphatis 
. . . . Pseudoalteromonas tunicata D2 --------------------------------------------  147  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudoalteromonas tunicata D2] >g
. . . . Thioalkalivibrio sp. K90mix ..............................................  146  2 hits [g-proteobacteria]       ribosomal protein S4 [Thioalkalivibrio sp. K90mix] >gi|2246
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................  146  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Photobacterium damselae su
. . . . gamma proteobacterium NOR51-B ............................................  145  2 hits [g-proteobacteria]       ribosomal protein S4 [gamma proteobacterium NOR51-B] >gi|21
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  145  3 hits [enterobacteria]         30S ribosomal protein S4 [Klebsiella pneumoniae subsp. pneu
. . . . Klebsiella pneumoniae 342 ................................................  145  3 hits [enterobacteria]         30S ribosomal protein S4 [Klebsiella pneumoniae subsp. pneu
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................  145  2 hits [enterobacteria]         30S ribosomal protein S4 [Klebsiella pneumoniae subsp. pneu
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  145  2 hits [enterobacteria]         30S ribosomal protein S4 [Klebsiella pneumoniae subsp. pneu
. . . . Klebsiella variicola At-22 ...............................................  145  2 hits [enterobacteria]         30S ribosomal protein S4 [Klebsiella pneumoniae subsp. pneu
. . . . Enterobacter sp. 638 .....................................................  145  3 hits [enterobacteria]         30S ribosomal protein S4 [Enterobacter sp. 638] >gi|1720460
. . . . Vibrio splendidus 12B01 ..................................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio splendidus 12B01] >gi|8437
. . . . Vibrio sp. MED222 ........................................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio sp. MED222] >gi|148982227|
. . . . Vibrionales bacterium SWAT-3 .............................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio sp. MED222] >gi|148982227|
. . . . Vibrio splendidus LGP32 ..................................................  145  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio sp. MED222] >gi|148982227|
. . . . Photobacterium profundum 3TCK ............................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Photobacterium profundum 3TCK] >g
. . . . Photobacterium profundum SS9 .............................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Photobacterium profundum 3TCK] >g
. . . . Photobacterium profundum .................................................  145  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Photobacterium profundum 3TCK] >g
. . . . Vibrio furnissii CIP 102972 ..............................................  145  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Vibrio furnissii CIP 10297
. . . . Pseudomonas syringae pv. oryzae str. 1_6 .................................  145  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas syringae pv. oryzae s
. . . . Vibrio vulnificus CMCP6 ..................................................  145  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio vulnificus CMCP6] >gi|3767
. . . . Vibrio vulnificus YJ016 ..................................................  145  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio vulnificus CMCP6] >gi|3767
. . . . Vibrio vulnificus ........................................................  145  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio vulnificus CMCP6] >gi|3767
. . . . Vibrio parahaemolyticus RIMD 2210633 .....................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio parahaemolyticus AQ3810 ...........................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio harveyi ATCC BAA-1116 .............................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio parahaemolyticus AN-5034 ..........................................  144  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio parahaemolyticus Peru-466 .........................................  144  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio parahaemolyticus AQ4037 ...........................................  144  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio sp. Ex25 ..........................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio alginolyticus 40B .................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio parahaemolyticus ..................................................  144  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio parahaemolyticus RIMD 2210
. . . . Vibrio sp. AND4 ..........................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio sp. AND4] >gi|159172034|gb
. . . . Enterobacter cancerogenus ATCC 35316 .....................................  144  1 hit  [enterobacteria]         30S ribosomal protein S4 [Enterobacter cancerogenus ATCC 35
. . . . Pseudoalteromonas atlantica T6c ..........................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudoalteromonas atlantica T6c] 
. . . . Aliivibrio salmonicida LFI1238 ...........................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Aliivibrio salmonicida LFI1238] >
. . . . Pseudomonas fluorescens Pf0-1 ............................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas fluorescens Pf0-1] >g
. . . . Vibrio cholerae V52 ......................................................  144  2 hits [g-proteobacteria]       topoisomerase IV subunit A [Vibrio cholerae V52] >gi|121627
. . . . Vibrio harveyi 1DA3 ......................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio harveyi 1DA3] >gi|26983563
. . . . Vibrio fischeri ES114 ....................................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio fischeri ES114] >gi|197334
. . . . Vibrio fischeri MJ11 .....................................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio fischeri ES114] >gi|197334
. . . . Thioalkalivibrio sp. HL-EbGR7 ............................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Thioalkalivibrio sp. HL-EbGR7] >g
. . . . Vibrio cholerae 623-39 ...................................................  144  2 hits [g-proteobacteria]       ribosomal protein S4 [Vibrio cholerae 623-39] >gi|148873050
. . . . Photobacterium sp. SKA34 .................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Photobacterium sp. SKA34] >gi|905
. . . . Photobacterium angustum S14 ..............................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Photobacterium sp. SKA34] >gi|905
. . . . Vibrio metschnikovii CIP 69.14 ...........................................  144  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Vibrio metschnikovii CIP 6
. . . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae O395 .....................................................  144  4 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae NCTC 8457 ................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae M66-2 ....................................................  144  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae BX 330286 ................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae B33 ......................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae TMA 21 ...................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae RC9 ......................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae TM 11079-80 ..............................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae 12129(1) .................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae MJ-1236 ..................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae AM-19226 .................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae MO10 .....................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholera CIRS 101 ..................................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Vibrio cholerae ..........................................................  144  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Vibrio cholerae O1 biovar El Tor 
. . . . Nitrococcus mobilis Nb-231 ...............................................  144  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Nitrococcus mobilis Nb-231] >gi|8
. . . . Bermanella marisrubri ....................................................  144  2 hits [g-proteobacteria]       ribosomal protein S4 [Oceanobacter sp. RED65] >gi|94426908|
. . . . Vibrio parahaemolyticus 16 ...............................................  143  2 hits [g-proteobacteria]       ribosomal protein S4 [Vibrio parahaemolyticus 16] >gi|21954
. . . . Vibrio mimicus VM603 .....................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM603] >gi|2612111
. . . . Vibrio sp. RC341 .........................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM603] >gi|2612111
. . . . Vibrio mimicus MB-451 ....................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM603] >gi|2612111
. . . . Vibrio sp. RC586 .........................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM603] >gi|2612111
. . . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  143  2 hits [g-proteobacteria]       ribosomal protein S4 [Pseudomonas syringae pv. tomato str. 
. . . . Pseudomonas syringae pv. syringae B728a ..................................  143  3 hits [g-proteobacteria]       ribosomal protein S4 [Pseudomonas syringae pv. tomato str. 
. . . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  143  3 hits [g-proteobacteria]       ribosomal protein S4 [Pseudomonas syringae pv. tomato str. 
. . . . Pseudomonas syringae pv. tomato T1 .......................................  143  2 hits [g-proteobacteria]       ribosomal protein S4 [Pseudomonas syringae pv. tomato str. 
. . . . Pseudomonas syringae pv. tomato ..........................................  143  1 hit  [g-proteobacteria]       ribosomal protein S4 [Pseudomonas syringae pv. tomato str. 
. . . . Vibrio mimicus VM573 .....................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM573] >gi|2621665
. . . . Vibrio mimicus VM223 .....................................................  143  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Vibrio mimicus VM573] >gi|2621665
. . . . Pseudomonas fluorescens Pf-5 .............................................  143  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas fluorescens Pf-5] >gi
. . . . Pseudomonas fluorescens SBW25 ............................................  143  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas fluorescens SBW25] >g
. . . . Alteromonas macleodii 'Deep ecotype' .....................................  143  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Alteromonas macleodii 'Deep ecoty
. . . . Alteromonas macleodii ATCC 27126 .........................................  143  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Alteromonas macleodii 'Deep ecoty
. . . . Vibrio cholerae bv. albensis VL426 .......................................  142  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Vibrio cholerae bv. albens
. . . . Grimontia hollisae CIP 101886 ............................................  142  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Grimontia hollisae CIP 101
. . . . marine gamma proteobacterium HTCC2148 ....................................  142  2 hits [g-proteobacteria]       ribosomal protein S4 [marine gamma proteobacterium HTCC2148
. . . . Vibrio orientalis CIP 102891 .............................................  142  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Vibrio orientalis CIP 1028
. . . . Vibrio coralliilyticus ATCC BAA-450 ......................................  142  2 hits [g-proteobacteria]       SSU ribosomal protein S4p (S9e) [Vibrio coralliilyticus ATC
. . . . Shewanella sediminis HAW-EB3 .............................................  142  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Shewanella sediminis HAW-EB3] >gi
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  142  3 hits [g-proteobacteria]       SSU ribosomal protein S4P [Alkalilimnicola ehrlichii MLHE-1
. . . . Neptuniibacter caesariensis ..............................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Oceanospirillum sp. MED92] >gi|89
. . . . Moritella sp. PE36 .......................................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Moritella sp. PE36] >gi|149804633
. . . . Pantoea sp. At-9b ........................................................  141  2 hits [enterobacteria]         ribosomal protein S4 [Pantoea sp. At-9b] >gi|258531031|gb|E
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  141  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas syringae pv. tabaci A
. . . . Escherichia coli O157:H7 EDL933 ..........................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. Sakai ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli str. K-12 substr. MG1655 ................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli CFT073 ..................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella sonnei Ss046 ....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella boydii Sb227 ....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella dysenteriae Sd197 ...............................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli str. K-12 substr. W3110 .................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli UTI89 ...................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli 536 .....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella flexneri 5 str. 8401 ............................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli APEC O1 .................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Citrobacter koseri ATCC BAA-895 ..........................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli E24377A .................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli HS ......................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella flexneri 2a str. 2457T ..........................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4113 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4401 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4501 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4486 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4196 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4076 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC869 ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC508 ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli ATCC 8739 ...............................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli str. K-12 substr. DH10B .................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli SMS-3-5 .................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia albertii TW07627 .............................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella boydii CDC 3083-94 ..............................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli 53638 ...................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli F11 .....................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli E22 .....................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli E110019 .................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli B171 ....................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella dysenteriae 1012 ................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli 101-1 ...................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4024 .....................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4206 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4045 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4042 .....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. EC4115 .....................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli SE11 ....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. TW14588 ....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia fergusonii ATCC 35469 ........................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli IAI1 ....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli S88 .....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli ED1a ....................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli 55989 ...................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli IAI39 ...................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli UMN026 ..................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli 83972 ...................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia sp. 3_2_53FAA ................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli BW2952 ..................................................  141  3 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli BL21(DE3) ...............................................  141  4 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia sp. 1_1_43 ...................................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli B str. REL606 ...........................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. TW14359 ....................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella sp. D9 ..........................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia sp. 4_1_40B ..................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O103:H2 str. 12009 ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O26:H11 str. 11368 ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O111:H- str. 11128 ......................................  141  2 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli K-12 ....................................................  141  7 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O6 ......................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli O157:H7 .................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli .........................................................  141 28 hits [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli DH1 .....................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Escherichia coli SE15 ....................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . Shigella flexneri 2002017 ................................................  141  1 hit  [enterobacteria]         30S ribosomal protein S4 [Escherichia coli O157:H7 EDL933] 
. . . . marine gamma proteobacterium HTCC2080 ....................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [marine gamma proteobacterium HTCC
. . . . Shewanella loihica PV-4 ..................................................  141  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Shewanella loihica PV-4] >gi|1521
. . . . Haemophilus influenzae Rd KW20 ...........................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Haemophilus influenzae Rd KW20] >
. . . . Haemophilus influenzae RdAW ..............................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Haemophilus influenzae Rd KW20] >
. . . . Haemophilus influenzae ...................................................  141  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Haemophilus influenzae Rd KW20] >
. . . . Pseudomonas stutzeri A1501 ...............................................  141  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas stutzeri A1501] >gi|1
. . . . Shewanella benthica KT99 .................................................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Shewanella benthica KT99] >gi|161
. . . . Pasteurella multocida subsp. multocida str. Pm70 .........................  141  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Pasteurella multocida subsp. mult
. . . . Pasteurella multocida ....................................................  141  1 hit  [g-proteobacteria]       30S ribosomal protein S4 [Pasteurella multocida subsp. mult
. . . . Shewanella woodyi ATCC 51908 .............................................  141  3 hits [g-proteobacteria]       ribosomal protein S4 [Shewanella woodyi ATCC 51908] >gi|226
. . . . Citrobacter sp. 30_2 .....................................................  141  2 hits [enterobacteria]         ribosomal protein S4 [Citrobacter sp. 30_2] >gi|226909253|g
. . . . Pseudoalteromonas haloplanktis TAC125 ....................................  141  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudoalteromonas haloplanktis TA
. . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  140  1 hit  [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Actinob
. . . . Actinobacillus pleuropneumoniae L20 ......................................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Actinob
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Actinob
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Actinob
. . . . Aggregatibacter aphrophilus NJ8700 .......................................  140  2 hits [g-proteobacteria]       ribosomal protein S4 [Aggregatibacter aphrophilus NJ8700] >
. . . . Mannheimia succiniciproducens MBEL55E ....................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Mannheimia succiniciproducens MBE
. . . . Providencia rustigianii DSM 4541 .........................................  140  2 hits [enterobacteria]         ribosomal protein S4 [Providencia rustigianii DSM 4541] >gi
. . . . Shewanella amazonensis SB2B ..............................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Shewanella amazonensis SB2B] >gi|
. . . . Haemophilus influenzae R2866 .............................................  140  1 hit  [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae R2846 .............................................  140  1 hit  [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 86-028NP ..........................................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 22.1-21 ...........................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae R3021 .............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 3655 ..............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae PittAA ............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae PittHH ............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae PittII ............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 22.4-21 ...........................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae PittEE ............................................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae PittGG ............................................  140  3 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 6P18H1 ............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae 7P49H1 ............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Haemophilus influenzae NT127 .............................................  140  2 hits [g-proteobacteria]       COG0522: Ribosomal protein S4 and related proteins [Haemoph
. . . . Actinobacillus succinogenes 130Z .........................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Actinobacillus succinogenes 130Z]
. . . . Haemophilus parasuis 29755 ...............................................  140  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Haemophilus parasuis 29755] >gi|2
. . . . Haemophilus parasuis SH0165 ..............................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Haemophilus parasuis 29755] >gi|2
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica ......................................................  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella typhimurium LT2] >gi|5
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Enterobacter sakazakii ATCC BAA-8
. . . . Cronobacter turicensis ...................................................  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Enterobacter sakazakii ATCC BAA-8
. . . . Cronobacter turicensis z3032 .............................................  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Enterobacter sakazakii ATCC BAA-8
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Pasteurella dagmatis ATCC 43325 ..........................................  140  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Pasteurella dagmatis ATCC 43325] 
. . . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi ........................  140  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Salmonella enterica subsp. enterica serovar Typhi str. AG3 ...............  140  1 hit  [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Serratia odorifera 4Rx13 .................................................  140  2 hits [enterobacteria]         30S ribosomal protein S4 [Serratia odorifera 4Rx13] >gi|270
. . . . Pseudomonas aeruginosa PA7 ...............................................  140  3 hits [g-proteobacteria]       30S ribosomal protein S4 [Pseudomonas aeruginosa PA7] >gi|1
. . . . Halorhodospira halophila SL1 .............................................  140  3 hits [g-proteobacteria]       ribosomal protein S4 [Halorhodospira halophila SL1] >gi|152
. . . . Actinobacillus minor 202 .................................................  139  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Actinobacillus minor 202] >gi|240
. . . . Actinobacillus minor NM305 ...............................................  139  2 hits [g-proteobacteria]       30S ribosomal protein S4 [Actinobacillus minor 202] >gi|240
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  139  3 hits [enterobacteria]         30S ribosomal protein S4 [Salmonella enterica subsp. enteri
. . . . Acinetobacter radioresistens SK82 ........................................  139  

BLAST

PROTOCOL

BLASTp versus NR, NCBI default parameters apart from "Number of Target sequences_1000"



RESULTS ANALYSIS

the ORF selected was searched for homology in Blast and it showed many homologous sequences having significant alignment with the ORF which are shown in the raw result. and a clear S4 superfamily domain is also seen in the blast which clearly shows that the sequences is coding having homologous sequences and a putative domain.


with the first hit, the results sre:

Score _ 207 bits (526), Expect _ 3e-52, Method: Compositional matrix adjust.

Identities _ 101/102 (99%), Positives _ 102/102 (100%), Gaps _ 0/102 (0%)


showing a very good alignment.


RAW RESULTS

=>Sequences producing significant alignments:                      
            
                                                                   (Bits)  Value

ref|YP_622605.1|  30S ribosomal protein S4 [Burkholderia cenoc...   207    3e-52 Gene info
ref|ZP_02891714.1|  ribosomal protein S4 [Burkholderia ambifar...   206    5e-52
ref|YP_772186.1|  30S ribosomal protein S4 [Burkholderia ambif...   206    6e-52 Gene info
ref|YP_367718.1|  30S ribosomal protein S4 [Burkholderia sp. 3...   206    8e-52 Gene info
ref|YP_001807018.1|  30S ribosomal protein S4 [Burkholderia am...   206    8e-52 Gene info
sp|A4JAR5.2|RS4_BURVG  RecName: Full=30S ribosomal protein S4       205    2e-51
ref|YP_001118203.1|  30S ribosomal protein S4 [Burkholderia vi...   204    2e-51 Gene info
ref|ZP_02465046.1|  30S ribosomal protein S4 [Burkholderia tha...   202    9e-51
ref|YP_109782.1|  30S ribosomal protein S4 [Burkholderia pseud...   201    2e-50 Gene info
ref|YP_001578466.1|  30S ribosomal protein S4 [Burkholderia mu...   201    3e-50 Gene info
ref|YP_001068009.1|  30S ribosomal protein S4 [Burkholderia ps...   200    3e-50 Gene info
ref|ZP_03456324.1|  30S ribosomal protein S4 [Burkholderia pse...   200    4e-50
ref|YP_443547.1|  30S ribosomal protein S4 [Burkholderia thail...   199    5e-50 Gene info
ref|ZP_04946813.1|  Ribosomal protein S4 [Burkholderia dolosa ...   199    5e-50
ref|ZP_02380135.1|  30S ribosomal protein S4 [Burkholderia ubo...   199    1e-49
ref|ZP_02357307.1|  30S ribosomal protein S4 [Burkholderia okl...   195    1e-48
ref|YP_002910188.1|  30S ribosomal protein S4 [Burkholderia gl...   193    4e-48 Gene info
ref|YP_001859032.1|  ribosomal protein S4 [Burkholderia phymat...   189    5e-47 Gene info
ref|ZP_03270074.1|  ribosomal protein S4 [Burkholderia sp. H16...   189    8e-47
ref|ZP_06297353.1|  ribosomal protein S4 [Burkholderia sp. CCG...   189    9e-47
ref|ZP_06228536.1|  30S ribosomal protein S4 [Burkholderia sp....   188    1e-46
ref|ZP_02886848.1|  ribosomal protein S4 [Burkholderia gramini...   188    2e-46
ref|YP_001897233.1|  30S ribosomal protein S4 [Burkholderia ph...   187    3e-46 Gene info
ref|YP_560646.1|  30S ribosomal protein S4 [Burkholderia xenov...   186    5e-46 Gene info
ref|YP_002006905.1|  30S ribosomal protein S4 [Cupriavidus tai...   174    3e-42 Gene info
ref|YP_297359.1|  30S ribosomal protein S4 [Ralstonia eutropha...   174    3e-42 Gene info
ref|YP_727895.1|  30S ribosomal protein S4 [Ralstonia eutropha...   173    5e-42 Gene info
ref|YP_585433.1|  30S ribosomal protein S4 [Ralstonia metallid...   172    7e-42 Gene info
ref|YP_002982867.1|  ribosomal protein S4 [Ralstonia pickettii...   172    1e-41 Gene info
ref|ZP_00945201.1|  SSU ribosomal protein S4P [Ralstonia solan...   171    2e-41
ref|YP_001101372.1|  30S ribosomal protein S4 [Herminiimonas a...   171    2e-41 Gene info
ref|YP_001900826.1|  ribosomal protein S4 [Ralstonia pickettii...   171    3e-41 Gene info
ref|NP_521115.1|  30S ribosomal protein S4 [Ralstonia solanace...   171    3e-41 Gene info
ref|YP_001355076.1|  30S ribosomal protein S4 [Janthinobacteri...   169    6e-41 Gene info
ref|ZP_03700138.1|  ribosomal protein S4 [Lutiella nitroferrum...   169    8e-41
ref|NP_903831.1|  30S ribosomal protein S4 [Chromobacterium vi...   168    2e-40 Gene info
ref|ZP_05319289.1|  ribosomal protein S4 [Neisseria sicca ATCC...   164    2e-39
ref|ZP_05985156.1|  30S ribosomal protein S4 [Neisseria subfla...   162    8e-39
ref|ZP_04757756.1|  ribosomal protein S4 [Neisseria flavescens...   162    1e-38
ref|ZP_03719618.1|  hypothetical protein NEIFLAOT_01464 [Neiss...   162    1e-38
ref|ZP_05982638.1|  ribosomal protein S4 [Neisseria cinerea AT...   160    4e-38
ref|ZP_05986201.1|  ribosomal protein S4 [Neisseria lactamica ...   160    4e-38
ref|YP_002003076.1|  30S ribosomal protein S4 [Neisseria gonor...   157    3e-37 Gene info
ref|NP_273225.1|  30S ribosomal protein S4 [Neisseria meningit...   157    3e-37 Gene info
ref|ZP_04602041.1|  hypothetical protein GCWU000324_01515 [Kin...   156    7e-37
ref|YP_002551881.1|  ribosomal protein S4 [Diaphorobacter sp. ...   156    7e-37 Gene info
ref|ZP_03540933.1|  ribosomal protein S4 [Comamonas testostero...   155    1e-36
ref|YP_984733.1|  30S ribosomal protein S4 [Acidovorax sp. JS4...   155    1e-36 Gene info
ref|YP_002794282.1|  RpsD [Laribacter hongkongensis HLHK9] >sp...   155    2e-36 Gene info
ref|YP_980588.1|  30S ribosomal protein S4 [Polaromonas naphth...   154    2e-36 Gene info
ref|YP_003280471.1|  ribosomal protein S4 [Comamonas testoster...   154    3e-36 Gene info
ref|YP_525436.1|  30S ribosomal protein S4 [Rhodoferax ferrire...   154    3e-36 Gene info
ref|YP_002946914.1|  ribosomal protein S4 [Variovorax paradoxu...   154    4e-36 Gene info
ref|ZP_04761586.1|  ribosomal protein S4 [Acidovorax delafield...   154    4e-36
ref|ZP_06211203.1|  ribosomal protein S4 [Acidovorax avenae su...   153    5e-36
ref|ZP_01914851.1|  30S ribosomal protein S4 [Limnobacter sp. ...   153    7e-36
ref|YP_001562076.1|  30S ribosomal protein S4 [Delftia acidovo...   152    8e-36 Gene info
ref|XP_001617741.1|  hypothetical protein NEMVEDRAFT_v1g156832...   152    8e-36 Gene info
ref|YP_969003.1|  30S ribosomal protein S4 [Acidovorax avenae ...   152    8e-36 Gene info
ref|ZP_04580019.1|  small subunit ribosomal protein S4 [Oxalob...   151    2e-35
ref|YP_001022606.1|  30S ribosomal protein S4 [Methylibium pet...   151    2e-35 Gene info
ref|YP_547362.1|  30S ribosomal protein S4 [Polaromonas sp. JS...   151    3e-35 Gene info
ref|ZP_04577869.1|  small subunit ribosomal protein S4 [Oxalob...   150    3e-35
ref|YP_997068.1|  30S ribosomal protein S4 [Verminephrobacter ...   150    4e-35 Gene info
ref|YP_001154863.1|  ribosomal protein S4 [Polynucleobacter ne...   149    1e-34 Gene info
ref|ZP_05500070.1|  ribosomal protein S4 [Thiomonas intermedia...   148    2e-34
ref|ZP_03714004.1|  hypothetical protein EIKCOROL_01699 [Eiken...   148    2e-34
ref|YP_001792943.1|  ribosomal protein S4 [Leptothrix cholodni...   147    3e-34 Gene info
ref|ZP_01136096.1|  30S ribosomal protein S4 [Pseudoalteromona...   147    3e-34
ref|YP_001797017.1|  ribosomal protein S4 [Polynucleobacter ne...   146    5e-34 Gene info
ref|ZP_03689644.1|  ribosomal protein S4 [Thioalkalivibrio sp....   146    6e-34
ref|ZP_06156733.1|  SSU ribosomal protein S4p (S9e) [Photobact...   146    7e-34
ref|ZP_04958160.1|  ribosomal protein S4 [gamma proteobacteriu...   145    9e-34
ref|YP_001337350.1|  30S ribosomal protein S4 [Klebsiella pneu...   145    1e-33 Gene info
ref|YP_001178435.1|  30S ribosomal protein S4 [Enterobacter sp...   145    1e-33 Gene info
ref|ZP_00993306.1|  30S ribosomal protein S4 [Vibrio splendidu...   145    1e-33
ref|ZP_01067071.1|  30S ribosomal protein S4 [Vibrio sp. MED22...   145    1e-33
ref|ZP_01222942.1|  30S ribosomal protein S4 [Photobacterium p...   145    2e-33
ref|ZP_05879866.1|  SSU ribosomal protein S4p (S9e) [Vibrio fu...   145    2e-33
emb|CAG18783.1|  putative ribosomal protein S4 [Photobacterium...   145    2e-33 Gene info
ref|ZP_04585917.1|  30S ribosomal protein S4 [Pseudomonas syri...   145    2e-33
ref|YP_001633544.1|  30S ribosomal protein S4 [Bordetella petr...   145    2e-33 Gene info
ref|NP_759719.1|  30S ribosomal protein S4 [Vibrio vulnificus ...   145    2e-33 Gene info
ref|NP_796660.1|  30S ribosomal protein S4 [Vibrio parahaemoly...   144    2e-33 Gene info
ref|ZP_02197919.1|  30S ribosomal protein S4 [Vibrio sp. AND4]...   144    2e-33
ref|ZP_05970624.1|  30S ribosomal protein S4 [Enterobacter can...   144    2e-33
ref|YP_660593.1|  30S ribosomal protein S4 [Pseudoalteromonas ...   144    2e-33 Gene info
ref|YP_002261875.1|  30S ribosomal protein S4 [Aliivibrio salm...   144    2e-33 Gene info
ref|YP_350784.1|  30S ribosomal protein S4 [Pseudomonas fluore...   144    2e-33 Gene info
ref|ZP_01682658.1|  topoisomerase IV subunit A [Vibrio cholera...   144    2e-33
ref|ZP_06174092.1|  30S ribosomal protein S4 [Vibrio harveyi 1...   144    2e-33
ref|YP_203644.1|  30S ribosomal protein S4 [Vibrio fischeri ES...   144    3e-33 Gene info
ref|YP_002514367.1|  30S ribosomal protein S4 [Thioalkalivibri...   144    3e-33 Gene info
ref|ZP_01984136.1|  ribosomal protein S4 [Vibrio cholerae 623-...   144    3e-33
ref|ZP_01162641.1|  30S ribosomal protein S4 [Photobacterium s...   144    3e-33
ref|ZP_05881037.1|  SSU ribosomal protein S4p (S9e) [Vibrio me...   144    4e-33
ref|NP_232200.1|  30S ribosomal protein S4 [Vibrio cholerae O1...   144    4e-33 Gene info
ref|ZP_01127979.1|  30S ribosomal protein S4 [Nitrococcus mobi...   144    4e-33
ref|ZP_01307493.1|  ribosomal protein S4 [Oceanobacter sp. RED...   144    4e-33
ref|ZP_05121526.1|  ribosomal protein S4 [Vibrio parahaemolyti...   143    5e-33
ref|ZP_05720643.1|  30S ribosomal protein S4 [Vibrio mimicus V...   143    6e-33
ref|NP_790497.1|  ribosomal protein S4 [Pseudomonas syringae p...   143    6e-33 Gene info
ref|ZP_05717754.1|  30S ribosomal protein S4 [Vibrio mimicus V...   143    6e-33
ref|YP_262627.1|  30S ribosomal protein S4 [Pseudomonas fluore...   143    6e-33 Gene info
ref|YP_002874998.1|  30S ribosomal protein S4 [Pseudomonas flu...   143    6e-33 Gene info
ref|NP_882150.1|  30S ribosomal protein S4 [Bordetella pertuss...   143    6e-33 Gene info
ref|YP_002125270.1|  30S ribosomal protein S4 [Alteromonas mac...   143    6e-33 Gene info
ref|ZP_04413958.1|  SSU ribosomal protein S4p (S9e) [Vibrio ch...   142    8e-33
ref|ZP_06051169.1|  SSU ribosomal protein S4p (S9e) [Grimontia...   142    8e-33
ref|ZP_05096639.1|  ribosomal protein S4 [marine gamma proteob...   142    9e-33
ref|ZP_05942968.1|  SSU ribosomal protein S4p (S9e) [Vibrio or...   142    9e-33
ref|ZP_05888369.1|  SSU ribosomal protein S4p (S9e) [Vibrio co...   142    1e-32
ref|YP_001476027.1|  30S ribosomal protein S4 [Shewanella sedi...   142    1e-32 Gene info
ref|YP_741326.1|  SSU ribosomal protein S4P [Alkalilimnicola e...   142    2e-32 Gene info
ref|ZP_01166539.1|  30S ribosomal protein S4 [Oceanospirillum ...   141    2e-32
ref|ZP_01900859.1|  30S ribosomal protein S4 [Moritella sp. PE...   141    2e-32
ref|ZP_05732248.1|  ribosomal protein S4 [Pantoea sp. At-9b] >...   141    2e-32
ref|ZP_05637250.1|  30S ribosomal protein S4 [Pseudomonas syri...   141    2e-32
ref|NP_289857.1|  30S ribosomal protein S4 [Escherichia coli O...   141    2e-32 Gene info
gb|AAP19385.1|  30S ribosomal subunit protein S4 [Shigella fle...   141    2e-32 Gene info
ref|ZP_01625032.1|  30S ribosomal protein S4 [marine gamma pro...   141    2e-32
ref|YP_001092313.1|  30S ribosomal protein S4 [Shewanella loih...   141    2e-32 Gene info
pdb|1P6G|D  Chain D, Real Space Refined Coordinates Of The 30s...   141    2e-32 Related structures
ref|NP_438961.1|  30S ribosomal protein S4 [Haemophilus influe...   141    2e-32 GeoGene info
ref|YP_001171347.1|  30S ribosomal protein S4 [Pseudomonas stu...   141    2e-32 Gene info
ref|ZP_02159331.1|  30S ribosomal protein S4 [Shewanella benth...   141    2e-32
pdb|2GY9|D  Chain D, Structure Of The 30s Subunit Of A Pre-Tra...   141    2e-32 Related structures
ref|NP_246330.1|  30S ribosomal protein S4 [Pasteurella multoc...   141    2e-32 Gene info
ref|YP_001763011.1|  ribosomal protein S4 [Shewanella woodyi A...   141    3e-32 Gene info
ref|ZP_04559112.1|  ribosomal protein S4 [Citrobacter sp. 30_2...   141    3e-32
ref|YP_341286.1|  30S ribosomal protein S4 [Pseudoalteromonas ...   141    3e-32 Gene info
gb|AAV39591.1|  ribosomal protein S4 [synthetic construct]          141    3e-32
ref|ZP_00134833.1|  COG0522: Ribosomal protein S4 and related ...   140    3e-32
ref|YP_003008582.1|  ribosomal protein S4 [Aggregatibacter aph...   140    3e-32 Gene info
ref|YP_089216.1|  30S ribosomal protein S4 [Mannheimia succini...   140    3e-32 Gene info
ref|ZP_05974555.1|  ribosomal protein S4 [Providencia rustigia...   140    3e-32
ref|YP_926118.1|  30S ribosomal protein S4 [Shewanella amazone...   140    3e-32 Gene info
ref|ZP_00156656.1|  COG0522: Ribosomal protein S4 and related ...   140    3e-32
ref|YP_001343794.1|  30S ribosomal protein S4 [Actinobacillus ...   140    3e-32 Gene info
ref|ZP_02478094.1|  30S ribosomal protein S4 [Haemophilus para...   140    4e-32
ref|NP_462320.1|  30S ribosomal protein S4 [Salmonella typhimu...   140    4e-32 Gene info
ref|YP_001436175.1|  30S ribosomal protein S4 [Enterobacter sa...   140    5e-32 Gene info
ref|YP_001590406.1|  30S ribosomal protein S4 [Salmonella ente...   140    5e-32 Gene info
ref|ZP_05921123.1|  30S ribosomal protein S4 [Pasteurella dagm...   140    5e-32
ref|NP_458484.1|  30S ribosomal protein S4 [Salmonella enteric...   140    5e-32 Gene info
ref|ZP_03401776.1|  30S ribosomal protein S4 [Salmonella enter...   140    5e-32
ref|ZP_06192615.1|  30S ribosomal protein S4 [Serratia odorife...   140    6e-32
ref|YP_001346247.1|  30S ribosomal protein S4 [Pseudomonas aer...   140    6e-32 Gene info
ref|YP_001002412.1|  ribosomal protein S4 [Halorhodospira halo...   140    6e-32 Gene info
ref|ZP_03612208.1|  30S ribosomal protein S4 [Actinobacillus m...   139    6e-32
ref|YP_002143902.1|  30S ribosomal protein S4 [Salmonella ente...   139    7e-32 Gene info
ref|ZP_05360996.1|  ribosomal protein S4 [Acinetobacter radior...   139    7e-32
ref|YP_001189364.1|  30S ribosomal protein S4 [Pseudomonas men...   139    7e-32 Gene info
ref|YP_114764.1|  30S ribosomal protein S4 [Methylococcus caps...   139    8e-32 Gene info
emb|CBG91221.1|  30S ribosomal subunit protein S4 [Citrobacter...   139    8e-32
ref|ZP_06070512.1|  ribosomal protein S4 [Acinetobacter lwoffi...   139    8e-32
ref|YP_003002716.1|  ribosomal protein S4 [Dickeya zeae Ech159...   139    8e-32 Gene info
ref|ZP_04978855.1|  ribosomal protein S4 [Mannheimia haemolyti...   139    8e-32
ref|YP_003335248.1|  ribosomal protein S4 [Dickeya dadantii Ec...   139    9e-32 Gene info
ref|YP_002650332.1|  30S ribosomal protein S4 [Erwinia pyrifol...   139    9e-32 Gene info
ref|ZP_04624669.1|  30S ribosomal protein S4 [Yersinia kristen...   139    9e-32
ref|YP_002934935.1|  30S ribosomal protein S4 (BS4) [Edwardsie...   139    1e-31 Gene info
ref|YP_718290.1|  30S ribosomal protein S4 [Haemophilus somnus...   139    1e-31 Gene info
ref|ZP_02224938.1|  30S ribosomal protein S4 (BS4) [Yersinia p...   139    1e-31
ref|YP_001785291.1|  ribosomal protein S4 [Haemophilus somnus ...   139    1e-31 Gene info
ref|ZP_02962221.1|  hypothetical protein PROSTU_04324 [Provide...   139    1e-31
ref|YP_001480742.1|  30S ribosomal protein S4 [Serratia protea...   139    1e-31 Gene info
ref|YP_572506.1|  SSU ribosomal protein S4P [Chromohalobacter ...   139    1e-31 Gene info
ref|YP_784597.1|  30S ribosomal protein S4 [Bordetella avium 1...   139    1e-31 Gene info
ref|NP_874283.1|  30S ribosomal protein S4 [Haemophilus ducrey...   139    1e-31 Gene info
ref|YP_003255200.1|  hypothetical protein D11S_0571 [Aggregati...   138    1e-31 Gene info
ref|ZP_03805023.1|  hypothetical protein PROPEN_03414 [Proteus...   138    2e-31
ref|NP_671307.1|  30S ribosomal protein S4 [Yersinia pestis KI...   138    2e-31 Gene info
ref|YP_001909051.1|  30S ribosomal protein S4 [Erwinia tasmani...   138    2e-31 Gene info
ref|ZP_04632678.1|  30S ribosomal protein S4 [Yersinia frederi...   138    2e-31
ref|YP_002152964.1|  30S ribosomal protein S4 [Proteus mirabil...   138    2e-31 Gene info
ref|NP_931865.1|  30S ribosomal protein S4 [Photorhabdus lumin...   138    2e-31 Gene info
ref|NP_252929.1|  30S ribosomal protein S4 [Pseudomonas aerugi...   138    2e-31 Gene info
ref|YP_002891339.1|  ribosomal protein S4 [Tolumonas auensis D...   138    2e-31 Gene info
ref|YP_003043021.1|  30s ribosomal subunit protein s4 [Photorh...   138    2e-31 Gene info
gb|AAT49880.1|  PA4239 [synthetic construct]                        138    2e-31
ref|NP_709084.2|  30S ribosomal protein S4 [Shigella flexneri ...   137    3e-31 Gene info
sp|P59132.1|RS4_SHIFL  RecName: Full=30S ribosomal protein S4       137    3e-31
ref|YP_002797875.1|  30S ribosomal protein S4 [Azotobacter vin...   137    3e-31 Gene info
ref|YP_455934.1|  30S ribosomal protein S4 [Sodalis glossinidi...   137    3e-31 Gene info
ref|YP_001086056.1|  30S ribosomal protein S4 [Acinetobacter b...   137    3e-31 Gene info
ref|YP_002986064.1|  ribosomal protein S4 [Dickeya dadantii Ec...   137    3e-31 Gene info
ref|ZP_06057985.1|  30S ribosomal protein S4 [Acinetobacter ca...   137    3e-31
ref|YP_854866.1|  ribosomal protein S4 [Aeromonas hydrophila s...   137    3e-31 Gene info
ref|YP_001706110.1|  30S ribosomal protein S4 [Acinetobacter b...   137    4e-31 Gene info
ref|YP_156273.1|  30S ribosomal protein S4 [Idiomarina loihien...   137    4e-31 Gene info
ref|ZP_05824032.1|  ribosomal protein S4 [Acinetobacter sp. RU...   137    4e-31
ref|YP_943931.1|  ribosomal protein S4 [Psychromonas ingrahami...   137    4e-31 Gene info
ref|ZP_06063879.1|  ribosomal protein S4 [Acinetobacter johnso...   137    4e-31
ref|YP_944782.1|  ribosomal protein S4 [Psychromonas ingrahami...   137    5e-31 Gene info
ref|YP_052094.1|  30S ribosomal protein S4 [Pectobacterium atr...   137    5e-31 Gene info
ref|YP_047701.1|  30S ribosomal protein S4 [Acinetobacter sp. ...   136    6e-31 Gene info
ref|ZP_06066775.1|  ribosomal protein S4 [Acinetobacter junii ...   136    6e-31
ref|YP_903452.1|  SSU ribosomal protein S4P [Candidatus Ruthia...   136    7e-31 Gene info
ref|YP_001143752.1|  ribosomal protein S4 [Aeromonas salmonici...   136    7e-31 Gene info
ref|YP_390588.1|  ribosomal protein S4 [Thiomicrospira crunoge...   136    7e-31 Gene info
ref|YP_001847913.1|  30S ribosomal protein S4 [Acinetobacter b...   136    8e-31 Gene info
ref|ZP_04774461.1|  ribosomal protein S4 [Allochromatium vinos...   136    8e-31
ref|ZP_01044198.1|  30S ribosomal protein S4 [Idiomarina balti...   135    9e-31
ref|YP_748873.1|  30S ribosomal protein S4 [Shewanella frigidi...   135    9e-31 Gene info
ref|YP_003261314.1|  ribosomal protein S4 [Pectobacterium wasa...   135    1e-30 Gene info
ref|ZP_03824359.1|  30S ribosomal protein S4 [Acinetobacter sp...   135    1e-30
ref|YP_867873.1|  30S ribosomal protein S4 [Shewanella sp. ANA...   135    2e-30 Gene info
ref|YP_437263.1|  ribosomal protein S4 [Hahella chejuensis KCT...   135    2e-30 Gene info
ref|YP_561214.1|  30S ribosomal protein S4 [Shewanella denitri...   134    2e-30 Gene info
ref|YP_003145649.1|  ribosomal protein S4 [Kangiella koreensis...   134    2e-30 Gene info
ref|NP_715895.1|  30S ribosomal protein S4 [Shewanella oneiden...   134    2e-30 Gene info
ref|YP_961587.1|  30S ribosomal protein S4 [Shewanella sp. W3-...   134    3e-30 Gene info
sp|Q9S0Q9.1|RS4_SHEVI  RecName: Full=30S ribosomal protein S4 ...   134    3e-30
ref|YP_001052480.1|  ribosomal protein S4 [Shewanella baltica ...   134    3e-30 Gene info
ref|YP_001500071.1|  30S ribosomal protein S4 [Shewanella peal...   133    5e-30 Gene info
ref|YP_001343082.1|  ribosomal protein S4 [Marinomonas sp. MWY...   133    6e-30 Gene info
ref|YP_001666754.1|  30S ribosomal protein S4 [Pseudomonas put...   133    7e-30 Gene info
ref|ZP_01448420.1|  30S ribosomal protein S4 [alpha proteobact...   133    7e-30
ref|YP_001751570.1|  30S ribosomal protein S4 [Pseudomonas put...   133    7e-30 Gene info
ref|NP_742644.1|  30S ribosomal protein S4 [Pseudomonas putida...   132    8e-30 Gene info
ref|YP_606277.1|  30S ribosomal protein S4 [Pseudomonas entomo...   132    9e-30 Gene info
ref|YP_001219047.1|  30S ribosomal protein S4 [Candidatus Vesi...   132    2e-29 Gene info
gb|EEZ80756.1|  ribosomal protein S4 [uncultured SUP05 cluster...   131    2e-29
ref|YP_958027.1|  ribosomal protein S4 [Marinobacter aquaeolei...   130    3e-29 Gene info
ref|YP_169398.1|  30S ribosomal protein S4 [Francisella tulare...   130    4e-29 Gene info
ref|YP_001892104.1|  30S ribosomal protein S4 [Francisella tul...   130    5e-29 Gene info
ref|ZP_05062762.1|  ribosomal protein S4 [gamma proteobacteriu...   130    5e-29
ref|ZP_05128992.1|  ribosomal protein S4 [gamma proteobacteriu...   130    6e-29
ref|YP_202198.1|  30S ribosomal protein S4 [Xanthomonas oryzae...   129    8e-29 Gene info
ref|ZP_01102066.1|  30S ribosomal protein S4 [Congregibacter l...   129    1e-28
ref|ZP_01894419.1|  ribosomal protein S4 [Marinobacter algicol...   129    1e-28
ref|YP_001122532.1|  30S ribosomal protein S4 [Francisella tul...   129    1e-28 Gene info
ref|YP_003072531.1|  ribosomal protein S4 [Teredinibacter turn...   129    1e-28 Gene info
ref|NP_636304.1|  30S ribosomal protein S4 [Xanthomonas campes...   129    1e-28 Gene info
ref|YP_001677283.1|  30S ribosomal protein S4 [Francisella phi...   128    2e-28 Gene info
ref|YP_762917.1|  30S ribosomal protein S4 [Francisella tulare...   128    2e-28 Gene info
ref|YP_344289.1|  ribosomal protein S4 [Nitrosococcus oceani A...   128    2e-28 Gene info
ref|ZP_01114775.1|  ribosomal protein S4 [Reinekea sp. MED297]...   127    3e-28
ref|ZP_01737766.1|  ribosomal protein S4 [Marinobacter sp. ELB...   127    3e-28
ref|YP_692141.1|  30S ribosomal protein S4 [Alcanivorax borkum...   127    3e-28 Gene info
ref|ZP_05040511.1|  ribosomal protein S4 [Alcanivorax sp. DG88...   127    3e-28
ref|YP_003262256.1|  ribosomal protein S4 [Halothiobacillus ne...   127    3e-28 Gene info
ref|ZP_01618187.1|  ribosomal protein S4 [marine gamma proteob...   127    3e-28
ref|YP_001981232.1|  ribosomal protein S4 [Cellvibrio japonicu...   127    3e-28 Gene info
ref|ZP_05339849.1|  RNA-binding S4 domain protein [Sideroxydan...   127    5e-28
ref|NP_778044.1|  30S ribosomal protein S4 [Buchnera aphidicol...   127    5e-28 Gene info
ref|ZP_05619344.1|  ribosomal protein S4 [Enhydrobacter aerosa...   125    1e-27
ref|ZP_01224769.1|  30S ribosomal protein S4 [marine gamma pro...   125    1e-27
ref|ZP_01078664.1|  30S ribosomal protein S4 [Marinomonas sp. ...   125    2e-27
ref|ZP_02061937.1|  ribosomal protein S4 [Rickettsiella grylli...   124    2e-27
ref|YP_001210128.1|  30S ribosomal protein S4 [Dichelobacter n...   124    2e-27 Gene info
ref|YP_588800.1|  ribosomal protein S4 [Baumannia cicadellinic...   124    3e-27 Gene info
ref|YP_526457.1|  SSU ribosomal protein S4P [Saccharophagus de...   124    3e-27 Gene info
ref|ZP_05704077.1|  30S ribosomal protein S4 [Cardiobacterium ...   124    3e-27
ref|YP_001279354.1|  30S ribosomal protein S4 [Psychrobacter s...   124    3e-27 Gene info
ref|YP_001970812.1|  putative 30S ribosomal subunit protein S4...   124    3e-27 Gene info
ref|YP_864796.1|  SSU ribosomal protein S4P [Magnetococcus sp....   124    4e-27 Gene info
ref|YP_263810.1|  30S ribosomal protein S4 [Psychrobacter arct...   123    7e-27 Gene info
ref|YP_579775.1|  30S ribosomal protein S4 [Psychrobacter cryo...   122    9e-27 Gene info
ref|YP_267375.1|  ribosomal protein S4 [Colwellia psychrerythr...   122    1e-26 Gene info
ref|ZP_04831552.1|  ribosomal protein S4 [Gallionella ferrugin...   122    1e-26
ref|NP_819306.1|  30S ribosomal protein S4 [Coxiella burnetii ...   121    2e-26 Gene info
ref|YP_002304885.1|  30S ribosomal protein S4 [Coxiella burnet...   121    2e-26 Gene info
ref|NP_240307.1|  30S ribosomal protein S4 [Buchnera aphidicol...   120    3e-26 Gene info
ref|YP_003047807.1|  ribosomal protein S4 [Methylotenera mobil...   120    5e-26 Gene info
ref|YP_003050103.1|  ribosomal protein S4 [Methylovorus sp. SI...   120    6e-26 Gene info
gb|AAC05398.1|  ribosomal protein S4 [Buchnera aphidicola] >pr...   119    7e-26
ref|ZP_02096742.1|  ribosomal protein S4 [Coxiella burnetii 'M...   119    1e-25
ref|ZP_05081851.1|  ribosomal protein S4 [beta proteobacterium...   119    1e-25
ref|NP_778690.1|  30S ribosomal protein S4 [Xylella fastidiosa...   119    1e-25 Gene info
ref|ZP_00652778.1|  Ribosomal protein S4, bacterial and organe...   119    1e-25
ref|ZP_00683165.1|  Ribosomal protein S4, bacterial and organe...   119    1e-25
ref|YP_411490.1|  30S ribosomal protein S4 [Nitrosospira multi...   118    2e-25 Gene info
ref|NP_660813.1|  30S ribosomal protein S4 [Buchnera aphidicol...   117    3e-25 Gene info
ref|ZP_02000981.1|  30S ribosomal protein S4 [Beggiatoa sp. PS...   117    5e-25
ref|ZP_05108651.1|  30S ribosomal protein S4 [Legionella dranc...   117    5e-25
ref|NP_298465.1|  30S ribosomal protein S4 [Xylella fastidiosa...   117    5e-25 Gene info
ref|ZP_05314231.1|  ribosomal protein S4 [Nitrosomonas sp. AL2...   116    6e-25
ref|ZP_06186544.1|  ribosomal protein S4 [Legionella longbeach...   116    9e-25
ref|YP_314187.1|  30S ribosomal protein S4 [Thiobacillus denit...   115    2e-24 Gene info
ref|ZP_03683050.1|  hypothetical protein CATMIT_01694 [Catenib...   115    2e-24
ref|YP_094397.1|  30S ribosomal protein S4 [Legionella pneumop...   114    2e-24 Gene info
ref|YP_002924585.1|  30S ribosomal subunit protein S4 [Candida...   114    3e-24 Gene info
gb|AAR05301.1|  ribosomal protein S4 [uncultured marine gamma ...   114    3e-24
ref|NP_878514.1|  30S ribosomal protein S4 [Candidatus Blochma...   114    3e-24 Gene info
ref|YP_122758.1|  30S ribosomal protein S4 [Legionella pneumop...   114    3e-24 Gene info
gb|AAS73108.1|  predicted ribosomal protein S4 [uncultured mar...   113    7e-24
ref|YP_159207.1|  30S ribosomal protein S4 [Aromatoleum aromat...   112    1e-23 Gene info
ref|YP_002890285.1|  ribosomal protein S4 [Thauera sp. MZ1T] >...   112    1e-23 Gene info
ref|YP_934894.1|  30S ribosomal protein S4 [Azoarcus sp. BH72]...   111    2e-23 Gene info
ref|ZP_02439830.1|  hypothetical protein CLOSS21_02312 [Clostr...   111    2e-23
ref|YP_283573.1|  30S ribosomal protein S4 [Dechloromonas arom...   110    4e-23 Gene info
ref|NP_840512.1|  30S ribosomal protein S4 [Nitrosomonas europ...   109    1e-22 Gene info
dbj|BAC24713.1|  rpsD [Wigglesworthia glossinidia endosymbiont...   109    1e-22 Gene info
ref|NP_871570.2|  30S ribosomal protein S4 [Wigglesworthia glo...   109    1e-22 Gene info
ref|ZP_06113170.1|  small subunit ribosomal protein S4 [Clostr...   108    2e-22
ref|YP_746819.1|  30S ribosomal protein S4 [Nitrosomonas eutro...   108    2e-22 Gene info
ref|ZP_03352701.1|  30S ribosomal protein S4 [Salmonella enter...   108    2e-22
ref|ZP_01552658.1|  30S ribosomal protein S4 [Methylophilales ...   108    2e-22
ref|ZP_05292850.1|  SSU ribosomal protein S4p (S9e) [Acidithio...   108    2e-22
ref|YP_001560726.1|  RNA-binding S4 domain-containing protein ...   108    2e-22 Gene info
ref|YP_277728.1|  30S ribosomal protein S4 [Candidatus Blochma...   108    3e-22 Gene info
ref|ZP_05313158.1|  ribosomal protein S4 [Geobacter sp. M18] >...   107    4e-22
ref|ZP_01910626.1|  SSU ribosomal protein S4P [Plesiocystis pa...   106    7e-22
gb|AAP81238.1|  ribosomal protein S4 [Candidatus Portiera aley...   106    7e-22
ref|ZP_04666405.1|  conserved hypothetical protein [Clostridia...   106    7e-22
emb|CAX84055.1|  30S ribosomal protein S4 [uncultured bacterium]    106    7e-22
ref|YP_802864.1|  30S ribosomal protein S4 [Buchnera aphidicol...   106    1e-21 Gene info
ref|YP_003168657.1|  ribosomal protein S4 [Candidatus Accumuli...   105    1e-21 Gene info
ref|YP_002608076.1|  ribosomal protein S4 [Nautilia profundico...   105    1e-21 Gene info
ref|ZP_02088381.1|  hypothetical protein CLOBOL_05936 [Clostri...   105    1e-21
ref|YP_001359639.1|  30S ribosomal protein S4 [Sulfurovum sp. ...   105    1e-21 Gene info
gb|ABL59934.1|  ribosomal protein S4 [uncultured bacterium]         104    2e-21
ref|YP_002936369.1|  30S ribosomal protein S4 [Eubacterium rec...   104    3e-21 Gene info
ref|ZP_05370818.1|  ribosomal protein S4 [Geobacillus sp. Y4.1...   104    3e-21
ref|YP_003023085.1|  ribosomal protein S4 [Geobacter sp. M21] ...   103    4e-21 Gene info
ref|YP_002137776.1|  ribosomal protein S4 [Geobacter bemidjien...   103    4e-21 Gene info
ref|YP_002950681.1|  ribosomal protein S4 [Geobacillus sp. WCH...   103    5e-21 Gene info
ref|YP_002434533.1|  30S ribosomal protein S4 [Desulfovibrio v...   103    6e-21 Gene info
ref|ZP_01872260.1|  30S ribosomal protein S4 [Caminibacter med...   103    7e-21
ref|ZP_04446069.1|  hypothetical protein COLINT_02793 [Collins...   103    7e-21
ref|ZP_03753658.1|  hypothetical protein ROSEINA2194_02079 [Ro...   102    9e-21
ref|ZP_03296790.1|  hypothetical protein COLSTE_00675 [Collins...   102    9e-21
ref|YP_383619.1|  30S ribosomal protein S4 [Geobacter metallir...   102    1e-20 Gene info
ref|ZP_01463354.1|  ribosomal protein S4 [Stigmatella aurantia...   102    1e-20
ref|YP_003096500.1|  SSU ribosomal protein S4p (S9e) [Flavobac...   102    1e-20 Gene info
ref|ZP_03756975.1|  hypothetical protein CLOSTASPAR_00963 [Clo...   102    1e-20
ref|ZP_01772337.1|  Hypothetical protein COLAER_01341 [Collins...   102    1e-20
ref|ZP_03701012.1|  ribosomal protein S4 [Flavobacteria bacter...   102    1e-20
ref|ZP_01290031.1|  Ribosomal protein S4:RNA-binding S4 [delta...   102    1e-20
ref|ZP_03783342.1|  hypothetical protein RUMHYD_02809 [Blautia...   102    2e-20
ref|ZP_04744451.1|  ribosomal protein S4 [Roseburia intestinal...   102    2e-20
ref|ZP_02041880.1|  hypothetical protein RUMGNA_02655 [Ruminoc...   101    2e-20
ref|YP_003159242.1|  ribosomal protein S4 [Desulfomicrobium ba...   101    2e-20 Gene info
ref|ZP_01105011.1|  30S ribosomal protein S4 [Flavobacteriales...   101    3e-20
ref|ZP_01253849.1|  30S ribosomal protein S4 [Psychroflexus to...   100    3e-20
ref|YP_002929808.1|  small subunit ribosomal protein S4 [Eubac...   100    4e-20 Gene info
ref|YP_631524.1|  30S ribosomal protein S4 [Myxococcus xanthus...   100    4e-20 Gene info
ref|ZP_03854428.1|  ribosomal protein S4 [Chryseobacterium gle...   100    4e-20
ref|YP_002539042.1|  ribosomal protein S4 [Geobacter sp. FRC-3...   100    4e-20 Gene info
ref|YP_002560793.1|  30S ribosomal protein S4 [Macrococcus cas...   100    4e-20 Gene info
ref|YP_003180153.1|  ribosomal protein S4 [Atopobium parvulum ...   100    5e-20
ref|YP_001512078.1|  ribosomal protein S4 [Alkaliphilus oremla...   100    5e-20 Gene info
ref|YP_002218984.1|  ribosomal protein S4 [Acidithiobacillus f...   100    5e-20 Gene info
ref|YP_001229870.1|  30S ribosomal protein S4 [Geobacter urani...   100    5e-20 Gene info
ref|YP_001379124.1|  30S ribosomal protein S4 [Anaeromyxobacte...   100    5e-20 Gene info
ref|ZP_05072255.1|  ribosomal protein S4 [Campylobacterales ba...   100    5e-20
ref|YP_001951613.1|  ribosomal protein S4 [Geobacter lovleyi S...   100    6e-20 Gene info
ref|ZP_03568510.1|  ribosomal protein S4 [Atopobium rimae ATCC...   100    7e-20
ref|YP_003141286.1|  ribosomal protein S4 [Capnocytophaga ochr...  99.8    8e-20 Gene info
ref|YP_064887.1|  30S ribosomal protein S4 [Desulfotalea psych...  99.8    8e-20 Gene info
ref|ZP_01059711.1|  30S ribosomal protein S4 [Leeuwenhoekiella...  99.8    9e-20
ref|ZP_04857911.1|  conserved hypothetical protein [Ruminococc...  99.8    9e-20
ref|YP_076874.1|  30S ribosomal protein S4 [Symbiobacterium th...  99.4    9e-20 Gene info
ref|ZP_03391193.1|  ribosomal protein S4 [Capnocytophaga sputi...  99.4    1e-19
ref|YP_002990812.1|  ribosomal protein S4 [Desulfovibrio salex...  99.4    1e-19 Gene info
ref|ZP_03946842.1|  ribosomal protein S4 [Atopobium vaginae DS...  99.4    1e-19
ref|YP_388724.1|  30S ribosomal protein S4 [Desulfovibrio desu...  99.4    1e-19 Gene info
emb|CAA81389.1|  ribosomal protein RpsD [Bordetella pertussis ...  99.4    1e-19
ref|YP_465128.1|  30S ribosomal protein S4 [Anaeromyxobacter d...  99.4    1e-19 Gene info
ref|YP_002314834.1|  30S ribosomal protein S4 [Anoxybacillus f...  99.4    1e-19 Gene info
ref|YP_392842.1|  30S ribosomal protein S4 [Sulfurimonas denit...  99.0    1e-19 Gene info
ref|ZP_02420583.1|  hypothetical protein ANACAC_03200 [Anaeros...  99.0    1e-19
pdb|1QD7|C  Chain C, Partial Model For 30s Ribosomal Subunit >...  99.0    1e-19 Related structures
ref|ZP_05711611.1|  ribosomal protein S4 [Listeria monocytogen...  98.6    2e-19
ref|ZP_02025610.1|  hypothetical protein EUBVEN_00863 [Eubacte...  98.6    2e-19
ref|ZP_01891070.1|  30S ribosomal protein S4 [unidentified eub...  98.6    2e-19
ref|ZP_06231278.1|  ribosomal protein S4 [Desulfovibrio aespoe...  98.6    2e-19
ref|ZP_03715582.1|  hypothetical protein EUBHAL_00639 [Eubacte...  98.2    2e-19
ref|YP_001422248.1|  30S ribosomal protein S4 [Bacillus amylol...  98.2    2e-19 Gene info
gb|AAB21091.1|  ribosomal protein S4 [Bacillus stearothermophi...  98.2    2e-19
sp|P81288.3|RS4_BACST  RecName: Full=30S ribosomal protein S4;...  98.2    3e-19
ref|YP_900394.1|  30S ribosomal protein S4 [Pelobacter propion...  97.8    3e-19 Gene info
ref|YP_002249221.1|  ribosomal protein S4 [Thermodesulfovibrio...  97.8    3e-19 Gene info
ref|YP_003268372.1|  ribosomal protein S4 [Haliangium ochraceu...  97.8    3e-19 Gene info
ref|ZP_03702109.1|  ribosomal protein S4 [Flavobacteria bacter...  97.8    3e-19
ref|ZP_02867261.1|  hypothetical protein CLOSPI_01084 [Clostri...  97.8    3e-19
ref|YP_003150558.1|  SSU ribosomal protein S4P [Cryptobacteriu...  97.4    4e-19 Gene info
ref|NP_465121.1|  30S ribosomal protein S4 [Listeria monocytog...  97.4    4e-19 Gene info
ref|ZP_00231223.1|  ribosomal protein S4 [Listeria monocytogen...  97.4    4e-19
ref|ZP_04581943.1|  30S ribosomal protein S4 [Helicobacter bil...  97.4    4e-19
ref|ZP_01051162.1|  30S ribosomal protein S4 [Dokdonia donghae...  97.4    4e-19
ref|YP_001126794.1|  30S ribosomal protein S4 [Geobacillus the...  97.4    4e-19 Gene info
ref|YP_002604830.1|  RpsD [Desulfobacterium autotrophicum HRM2...  97.4    4e-19 Gene info
ref|ZP_03736725.1|  RNA-binding S4 domain protein [Desulfonatr...  97.4    5e-19
ref|ZP_02033725.1|  hypothetical protein PARMER_03760 [Parabac...  97.1    5e-19
ref|NP_953875.1|  30S ribosomal protein S4 [Geobacter sulfurre...  97.1    5e-19 Gene info
ref|YP_001916409.1|  SSU ribosomal protein S4P [Natranaerobius...  97.1    5e-19 Gene info
ref|ZP_05709494.1|  ribosomal protein S4 [Desulfurivibrio alka...  97.1    5e-19
ref|ZP_03476785.1|  hypothetical protein PRABACTJOHN_02459 [Pa...  97.1    5e-19
ref|YP_001355719.1|  30S ribosomal protein S4 [Nitratiruptor s...  97.1    5e-19 Gene info
ref|ZP_04444175.1|  30S ribosomal protein S4 [Listeria grayi D...  97.1    6e-19
ref|YP_003257132.1|  30S ribosomal protein S4 [Blattabacterium...  96.7    6e-19 Gene info
ref|ZP_02929524.1|  30S ribosomal protein S4 [Verrucomicrobium...  96.7    6e-19
ref|ZP_03968742.1|  ribosomal protein S4 [Sphingobacterium spi...  96.7    6e-19
ref|YP_003290153.1|  ribosomal protein S4 [Rhodothermus marinu...  96.7    7e-19 Gene info
ref|YP_002479271.1|  ribosomal protein S4 [Desulfovibrio desul...  96.7    7e-19 Gene info
ref|YP_862836.1|  30S ribosomal protein S4 [Gramella forsetii ...  96.7    7e-19 Gene info
ref|ZP_04057011.1|  ribosomal protein S4 [Capnocytophaga gingi...  96.7    7e-19
ref|ZP_04778340.1|  ribosomal protein S4 [Sphingobacterium spi...  96.7    8e-19
ref|ZP_02180613.1|  30S ribosomal protein S4 [Flavobacteriales...  96.7    8e-19
ref|ZP_05348261.1|  ribosomal protein S4 [Bryantella formatexi...  96.3    8e-19
ref|ZP_03464058.1|  hypothetical protein BACPEC_03159 [Bactero...  96.3    8e-19
ref|YP_003304993.1|  ribosomal protein S4 [Sulfurospirillum de...  96.3    9e-19 Gene info
ref|ZP_03288767.1|  hypothetical protein CLONEX_00957 [Clostri...  96.3    9e-19
ref|NP_244075.1|  30S ribosomal protein S4 [Bacillus haloduran...  96.3    9e-19 Gene info
ref|ZP_02160016.1|  30S ribosomal protein S4 [Kordia algicida ...  96.3    1e-18
ref|ZP_03227290.1|  30S ribosomal protein S4 [Bacillus coahuil...  96.3    1e-18
ref|ZP_05286915.1|  30S ribosomal protein S4 [Bacteroides sp. ...  95.9    1e-18
ref|ZP_03990180.1|  ribosomal protein S4 [Oribacterium sinus F...  95.9    1e-18
ref|YP_148655.1|  30S ribosomal protein S4 [Geobacillus kausto...  95.9    1e-18 Gene info
ref|ZP_04159019.1|  30S ribosomal protein S4 [Bacillus mycoide...  95.9    1e-18
ref|ZP_04390860.1|  ribosomal protein S4 [Geobacillus sp. Y412...  95.9    1e-18
ref|YP_003195002.1|  30S ribosomal protein S4 [Robiginitalea b...  95.9    1e-18 Gene info
sp|A6LEG6.2|RS4_PARD8  RecName: Full=30S ribosomal protein S4      95.9    1e-18
ref|ZP_02075504.1|  hypothetical protein CLOL250_02280 [Clostr...  95.5    1e-18
ref|NP_470974.1|  30S ribosomal protein S4 [Listeria innocua C...  95.5    2e-18 Gene info
ref|ZP_05289325.1|  30S ribosomal protein S4 [Listeria monocyt...  95.5    2e-18
ref|YP_001489948.1|  30S ribosomal protein S4 [Arcobacter butz...  95.5    2e-18 Gene info
ref|YP_002952622.1|  30S ribosomal protein S4 [Desulfovibrio m...  95.5    2e-18 Gene info
ref|ZP_03592756.1|  30S ribosomal protein S4 [Bacillus subtili...  95.1    2e-18
ref|ZP_01885767.1|  30S ribosomal protein S4 [Pedobacter sp. B...  95.1    2e-18
ref|YP_003144335.1|  SSU ribosomal protein S4P [Slackia heliot...  95.1    2e-18 Gene info
ref|NP_390844.1|  30S ribosomal protein S4 [Bacillus subtilis ...  95.1    2e-18 Gene info
ref|YP_003198902.1|  ribosomal protein S4 [Desulfohalobium ret...  95.1    2e-18 Gene info
ref|YP_849806.1|  30S ribosomal protein S4 [Listeria welshimer...  95.1    2e-18 Gene info
ref|NP_860933.1|  30S ribosomal protein S4 [Helicobacter hepat...  95.1    2e-18 Gene info
ref|ZP_01202639.1|  30S ribosomal protein S4 [Flavobacteria ba...  95.1    2e-18
ref|YP_010547.1|  30S ribosomal protein S4 [Desulfovibrio vulg...  95.1    2e-18 Gene info
ref|YP_003189889.1|  ribosomal protein S4 [Desulfotomaculum ac...  95.1    2e-18 Gene info
ref|ZP_01859586.1|  30S ribosomal protein S4 [Bacillus sp. SG-...  95.1    2e-18
ref|ZP_03658280.1|  30S ribosomal protein S4 [Helicobacter cin...  95.1    2e-18
ref|ZP_00950119.1|  30S ribosomal protein S4 [Croceibacter atl...  95.1    2e-18
ref|ZP_06076984.1|  30S ribosomal protein S4 [Bacteroides sp. ...  94.7    3e-18
ref|ZP_01119249.1|  30S ribosomal protein S4 [Polaribacter irg...  94.7    3e-18
ref|ZP_05108290.1|  30S ribosomal protein S4 [Polaribacter sp....  94.4    3e-18
ref|YP_001996024.1|  ribosomal protein S4 [Chloroherpeton thal...  94.4    3e-18 Gene info
ref|ZP_05855163.1|  ribosomal protein S4 [Blautia hansenii DSM...  94.4    4e-18
ref|YP_001111616.1|  30S ribosomal protein S4 [Desulfotomaculu...  94.4    4e-18 Gene info
ref|YP_001322181.1|  ribosomal protein S4 [Alkaliphilus metall...  94.4    4e-18 Gene info
ref|ZP_02234460.1|  hypothetical protein DORFOR_01331 [Dorea f...  94.4    4e-18
ref|ZP_04808499.1|  30S ribosomal protein S4 [Helicobacter pul...  94.4    4e-18
ref|ZP_05615996.1|  ribosomal protein S4 [Faecalibacterium pra...  94.4    4e-18
ref|YP_001944206.1|  ribosomal protein S4 [Chlorobium limicola...  94.4    4e-18 Gene info
ref|YP_002773637.1|  30S ribosomal protein S4 [Brevibacillus b...  94.0    4e-18 Gene info
ref|ZP_03780577.1|  hypothetical protein CLOHYLEM_07679 [Clost...  94.0    4e-18
ref|ZP_03655916.1|  30S ribosomal protein S4 [Helicobacter can...  94.0    4e-18
ref|ZP_04432583.1|  ribosomal protein S4 [Bacillus coagulans 3...  94.0    4e-18
ref|YP_754967.1|  ribosomal protein S4 [Syntrophomonas wolfei ...  94.0    5e-18 Gene info
ref|ZP_01313233.1|  RNA-binding S4 [Desulfuromonas acetoxidans...  93.6    5e-18
ref|ZP_03684298.1|  hypothetical protein CATMIT_02975 [Catenib...  93.6    5e-18
ref|YP_001487828.1|  30S ribosomal protein S4 [Bacillus pumilu...  93.6    5e-18 Gene info
ref|YP_595356.1|  30S ribosomal protein S4 [Lawsonia intracell...  93.6    5e-18 Gene info
gb|EAY55930.1|  ribosomal protein S4 [Leptospirillum rubarum] ...  93.6    6e-18
ref|YP_460374.1|  SSU ribosomal protein S4P [Syntrophus acidit...  93.6    6e-18 Gene info
ref|YP_003183141.1|  ribosomal protein S4 [Eggerthella lenta D...  93.6    6e-18
ref|YP_003090912.1|  ribosomal protein S4 [Pedobacter heparinu...  93.6    6e-18 Gene info
ref|ZP_03056001.1|  ribosomal protein S4 [Bacillus pumilus ATC...  93.6    6e-18
ref|YP_845703.1|  ribosomal protein S4 [Syntrophobacter fumaro...  93.6    6e-18 Gene info
ref|ZP_04153304.1|  30S ribosomal protein S4 [Bacillus pseudom...  93.6    6e-18
ref|NP_907820.1|  30S ribosomal protein S4 [Wolinella succinog...  93.6    7e-18 Gene info
ref|YP_014216.1|  30S ribosomal protein S4 [Listeria monocytog...  93.2    7e-18 Gene info
ref|ZP_04564958.1|  30S ribosomal protein S4 [Mollicutes bacte...  93.2    8e-18
ref|ZP_04833853.1|  ribosomal protein S4 [Prevotella melaninog...  93.2    8e-18
ref|ZP_02424538.1|  hypothetical protein ALIPUT_00655 [Alistip...  93.2    8e-18
ref|ZP_02428886.1|  hypothetical protein CLORAM_02306 [Clostri...  93.2    8e-18
ref|ZP_01965112.1|  hypothetical protein RUMOBE_02843 [Ruminoc...  93.2    8e-18
ref|YP_356156.1|  30S ribosomal protein S4 [Pelobacter carbino...  92.8    9e-18 Gene info
ref|NP_785803.1|  30S ribosomal protein S4 [Lactobacillus plan...  92.8    9e-18 Gene info
ref|ZP_02431961.1|  hypothetical protein CLOSCI_02197 [Clostri...  92.8    9e-18
ref|ZP_01968892.1|  hypothetical protein RUMTOR_02473 [Ruminoc...  92.8    9e-18
ref|ZP_03312736.1|  hypothetical protein DESPIG_02670 [Desulfo...  92.8    9e-18
ref|ZP_04390041.1|  ribosomal protein S4 [Porphyromonas endodo...  92.8    9e-18
ref|YP_080252.1|  30S ribosomal protein S4 [Bacillus lichenifo...  92.8    1e-17 Gene info
ref|YP_891268.1|  30S ribosomal protein S4 [Campylobacter fetu...  92.8    1e-17 Gene info
ref|YP_002308744.1|  30S ribosomal protein S4 [Candidatus Azob...  92.8    1e-17 Gene info
ref|ZP_05369697.1|  ribosomal protein S4 [Propionibacterium sp...  92.8    1e-17
ref|YP_001376539.1|  30S ribosomal protein S4 [Bacillus cereus...  92.8    1e-17 Gene info
ref|NP_208086.1|  30S ribosomal protein S4 [Helicobacter pylor...  92.8    1e-17 Gene info
ref|ZP_02090110.1|  hypothetical protein FAEPRAM212_00347 [Fae...  92.4    1e-17
ref|NP_693126.1|  30S ribosomal protein S4 [Oceanobacillus ihe...  92.4    1e-17 Gene info
ref|ZP_06289666.1|  ribosomal protein S4 [Prevotella timonensi...  92.4    1e-17
ref|YP_001877056.1|  ribosomal protein S4 [Akkermansia mucinip...  92.0    2e-17 Gene info
gb|ACX98379.1|  ribosomal protein S4 [Helicobacter pylori 51]      92.0    2e-17
ref|ZP_03940211.1|  30S ribosomal protein S4 [Lactobacillus br...  92.0    2e-17
ref|ZP_03168874.1|  hypothetical protein RUMLAC_02577 [Ruminoc...  92.0    2e-17
ref|ZP_03384155.1|  30S ribosomal protein S4 [Salmonella enter...  92.0    2e-17
ref|ZP_03562752.1|  30S ribosomal protein S4 [Staphylococcus a...  92.0    2e-17
ref|YP_002431055.1|  ribosomal protein S4 [Desulfatibacillum a...  92.0    2e-17 Gene info
ref|ZP_02207374.1|  hypothetical protein COPEUT_02184 [Coproco...  92.0    2e-17
ref|YP_810921.1|  SSU ribosomal protein S4P [Oenococcus oeni P...  92.0    2e-17 Gene info
ref|NP_223932.1|  30S ribosomal protein S4 [Helicobacter pylor...  92.0    2e-17 Gene info
ref|YP_002885067.1|  ribosomal protein S4 [Exiguobacterium sp....  92.0    2e-17 Gene info
ref|ZP_01544062.1|  30S ribosomal protein S4 [Oenococcus oeni ...  92.0    2e-17
ref|YP_664010.1|  30S ribosomal protein S4 [Helicobacter acino...  92.0    2e-17 Gene info
ref|ZP_06267529.1|  ribosomal protein S4 [Prevotella bivia JCV...  92.0    2e-17
ref|ZP_06007283.1|  30S ribosomal protein S4 [Prevotella berge...  92.0    2e-17
sp|Q04E66.2|RS4_OENOB  RecName: Full=30S ribosomal protein S4      92.0    2e-17
ref|YP_002016695.1|  ribosomal protein S4 [Prosthecochloris ae...  92.0    2e-17 Gene info
ref|ZP_03943140.1|  30S ribosomal protein S4 [Lactobacillus bu...  91.7    2e-17
ref|ZP_05916470.1|  30S ribosomal protein S4 [Prevotella sp. o...  91.7    2e-17
ref|ZP_06161073.1|  ribosomal protein S4 [Slackia exigua ATCC ...  91.7    2e-17
ref|ZP_03127346.1|  ribosomal protein S4 [Chthoniobacter flavu...  91.7    2e-17
ref|ZP_01723552.1|  30S ribosomal protein S4 [Bacillus sp. B14...  91.7    2e-17
ref|YP_001210898.1|  30S ribosomal protein S4 [Pelotomaculum t...  91.7    3e-17 Gene info
ref|NP_372243.1|  30S ribosomal protein S4 [Staphylococcus aur...  91.3    3e-17 Gene info
ref|YP_003283892.1|  30S ribosomal protein S4 [Blattabacterium...  91.3    3e-17 Gene info
ref|YP_003108627.1|  30S ribosomal subunit protein S4 [Candida...  91.3    3e-17 Gene info
ref|YP_001716445.1|  RNA-binding S4 domain-containing protein ...  91.3    3e-17 Gene info
ref|YP_001129796.1|  30S ribosomal protein S4 [Prosthecochlori...  91.3    3e-17 Gene info
ref|NP_969733.1|  30S ribosomal protein S4 [Bdellovibrio bacte...  91.3    3e-17 Gene info
ref|ZP_06287551.1|  ribosomal protein S4 [Prevotella buccalis ...  90.9    3e-17
ref|YP_003186077.1|  ribosomal protein S4 [Alicyclobacillus ac...  90.9    4e-17 Gene info
ref|ZP_03729641.1|  ribosomal protein S4 [Dethiobacter alkalip...  90.9    4e-17
ref|ZP_03608839.1|  ribosomal protein S4 [Campylobacter rectus...  90.9    4e-17
ref|ZP_04868661.1|  30S ribosomal protein S4 [Staphylococcus a...  90.9    4e-17
ref|NP_905994.1|  30S ribosomal protein S4 [Porphyromonas ging...  90.9    4e-17 Gene info
ref|ZP_03954355.1|  30S ribosomal protein S4 [Lactobacillus hi...  90.9    4e-17
ref|YP_380119.1|  30S ribosomal protein S4 [Chlorobium chloroc...  90.5    4e-17 Gene info
ref|ZP_01733238.1|  30S ribosomal protein S4 [Flavobacteria ba...  90.5    4e-17
sp|A3CRA2.2|RS4_STRSV  RecName: Full=30S ribosomal protein S4      90.5    5e-17
ref|YP_627980.1|  30S ribosomal protein S4 [Helicobacter pylor...  90.5    5e-17 Gene info
ref|ZP_01996210.1|  hypothetical protein DORLON_02216 [Dorea l...  90.5    5e-17
ref|YP_002563110.1|  30S ribosomal protein S4 [Streptococcus u...  90.5    5e-17 Gene info
ref|YP_001036257.1|  30S ribosomal protein S4 [Streptococcus s...  90.5    5e-17 Gene info
ref|ZP_05683575.1|  SSU ribosomal protein S4 [Staphylococcus a...  90.5    5e-17
ref|YP_001296208.1|  30S ribosomal protein S4 [Flavobacterium ...  90.5    5e-17 Gene info
ref|ZP_02919698.1|  hypothetical protein STRINF_00550 [Strepto...  90.1    6e-17
ref|YP_821274.1|  30S ribosomal protein S4 [Streptococcus ther...  90.1    6e-17 Gene info
ref|YP_002786606.1|  putative 30S ribosomal protein S4 [Deinoc...  90.1    6e-17 Gene info
ref|YP_001547697.1|  ribosomal protein S4 [Herpetosiphon auran...  90.1    6e-17 Gene info
ref|YP_140406.1|  30S ribosomal protein S4 [Streptococcus ther...  90.1    6e-17 Gene info
ref|NP_270088.1|  30S ribosomal protein S4 [Streptococcus pyog...  90.1    6e-17 Gene info
ref|ZP_04583478.1|  30s ribosomal protein s4 [Helicobacter win...  90.1    6e-17
ref|NP_689122.1|  30S ribosomal protein S4 [Streptococcus agal...  90.1    6e-17 Gene info
ref|YP_826331.1|  SSU ribosomal protein S4P [Solibacter usitat...  90.1    6e-17 Gene info
ref|YP_395454.1|  30S ribosomal protein S4 [Lactobacillus sake...  90.1    6e-17 Gene info
ref|ZP_04176683.1|  30S ribosomal protein S4 [Bacillus cereus ...  90.1    7e-17
ref|ZP_04062710.1|  ribosomal protein S4 [Streptococcus saliva...  90.1    7e-17
ref|ZP_05421317.1|  30S ribosomal protein S4 [Enterococcus fae...  90.1    7e-17
ref|ZP_05624338.1|  ribosomal protein S4 [Campylobacter gracil...  90.1    7e-17
ref|YP_912809.1|  30S ribosomal protein S4 [Chlorobium phaeoba...  90.1    7e-17 Gene info
ref|NP_816682.1|  30S ribosomal protein S4 [Enterococcus faeca...  89.7    7e-17 Gene info
ref|YP_001814702.1|  ribosomal protein S4 [Exiguobacterium sib...  89.7    7e-17 Gene info
ref|YP_001199522.1|  30S ribosomal protein S4 [Streptococcus s...  89.7    7e-17 Gene info
ref|ZP_01172964.1|  30S ribosomal protein S4 [Bacillus sp. NRR...  89.7    8e-17
ref|YP_374137.1|  30S ribosomal protein S4 [Chlorobium luteolu...  89.7    8e-17 Gene info
ref|ZP_01688535.1|  ribosomal protein S4 [Microscilla marina A...  89.7    8e-17
ref|YP_001451346.1|  30S ribosomal protein S4 [Streptococcus g...  89.7    8e-17 Gene info
ref|NP_344633.1|  30S ribosomal protein S4 [Streptococcus pneu...  89.7    8e-17 Gene info
ref|ZP_05594198.1|  30S ribosomal protein S4 [Enterococcus fae...  89.7    8e-17
ref|YP_002532186.1|  ribosomal protein S4 (30S ribosomal prote...  89.7    9e-17 Gene info
ref|YP_001467696.1|  30S ribosomal protein S4 [Campylobacter c...  89.7    1e-16 Gene info
ref|NP_722420.1|  30S ribosomal protein S4 [Streptococcus muta...  89.7    1e-16 Gene info
ref|YP_001957345.1|  RNA-binding S4 domain protein [Candidatus...  89.4    1e-16 Gene info
ref|ZP_04055535.1|  ribosomal protein S4 [Porphyromonas uenoni...  89.4    1e-16
ref|YP_603443.1|  30S ribosomal protein S4 [Streptococcus pyog...  89.4    1e-16 Gene info
ref|ZP_02170578.1|  ribosomal protein S4 [Bacillus selenitired...  89.4    1e-16
ref|YP_002124256.1|  30S ribosomal protein S4 [Streptococcus e...  89.4    1e-16 Gene info
ref|ZP_03908012.1|  SSU ribosomal protein S4P [Denitrovibrio a...  89.4    1e-16
ref|YP_001405813.1|  30S ribosomal protein S4 [Campylobacter h...  89.4    1e-16 Gene info
ref|YP_176252.1|  30S ribosomal protein S4 [Bacillus clausii K...  89.4    1e-16 Gene info
ref|ZP_03494156.1|  ribosomal protein S4 [Alicyclobacillus aci...  89.4    1e-16
ref|YP_041184.1|  30S ribosomal protein S4 [Staphylococcus aur...  89.0    1e-16 Gene info
ref|ZP_04678923.1|  ribosomal protein S4 [Staphylococcus warne...  89.0    1e-16
ref|ZP_04017585.1|  30S ribosomal protein S4 [Staphylococcus a...  89.0    1e-16
ref|YP_804780.1|  30S ribosomal protein S4 [Pediococcus pentos...  89.0    1e-16 Gene info
ref|YP_001392762.1|  30S ribosomal protein S4 [Clostridium bot...  89.0    1e-16 Gene info
ref|YP_001298107.1|  30S ribosomal protein S4 [Bacteroides vul...  89.0    1e-16 Gene info
ref|YP_001409132.1|  30S ribosomal protein S4 [Campylobacter c...  89.0    1e-16 Gene info
ref|YP_001567810.1|  RNA-binding S4 domain-containing protein ...  89.0    2e-16 Gene info
ref|ZP_05254058.1|  30S ribosomal protein S4 [Bacteroides sp. ...  88.6    2e-16
ref|YP_590330.1|  SSU ribosomal protein S4P [Candidatus Koriba...  88.6    2e-16 Gene info
ref|ZP_05618542.1|  30S ribosomal protein S4 [Fusobacterium sp...  88.6    2e-16
ref|ZP_06254726.1|  ribosomal protein S4 [Prevotella oris F030...  88.6    2e-16
ref|ZP_00366123.1|  COG0522: Ribosomal protein S4 and related ...  88.6    2e-16
ref|YP_002286728.1|  SSU ribosomal protein S4p (S9e) [Streptoc...  88.6    2e-16 Gene info
ref|NP_266440.1|  30S ribosomal protein S4 [Lactococcus lactis...  88.6    2e-16 Gene info
ref|ZP_00236113.1|  ribosomal protein S4 [Bacillus cereus G924...  88.6    2e-16
ref|YP_001647270.1|  30S ribosomal protein S4 [Bacillus weihen...  88.6    2e-16 Gene info
emb|CAK99547.1|  probable 30s ribosomal protein s4 [Spiroplasm...  88.2    2e-16
ref|ZP_04209125.1|  30S ribosomal protein S4 [Bacillus cereus ...  88.2    2e-16
ref|YP_179738.1|  30S ribosomal protein S4 [Campylobacter jeju...  88.2    2e-16 Gene info
ref|YP_003242010.1|  ribosomal protein S4 [Geobacillus sp. Y41...  88.2    3e-16 Gene info
ref|YP_002634416.1|  30S ribosomal protein S4 [Staphylococcus ...  88.2    3e-16 Gene info
gb|AAS19824.1|  small ribosomal protein 4 [Mastigophora woodsi...  88.2    3e-16
gb|ACP28112.1|  small ribosomal protein 4 [Chiloscyphus helmsi...  88.2    3e-16
ref|YP_003121338.1|  ribosomal protein S4 [Chitinophaga pinens...  88.2    3e-16 Gene info
ref|YP_278598.1|  30S ribosomal protein S4 [Mycoplasma synovia...  87.8    3e-16 Gene info
gb|AAS19795.1|  small ribosomal protein 4 [Blepharostoma trich...  87.8    3e-16
ref|ZP_00144640.1|  SSU ribosomal protein S4P [Fusobacterium n...  87.8    3e-16
ref|ZP_04572760.1|  SSU ribosomal protein S4P [Fusobacterium s...  87.8    3e-16
gb|AAS19815.1|  small ribosomal protein 4 [Lejeunea catanduana]    87.8    3e-16
ref|ZP_00370448.1|  ribosomal protein S4 [Campylobacter upsali...  87.8    3e-16
ref|ZP_05628375.1|  30S ribosomal protein S4 [Fusobacterium sp...  87.8    3e-16
ref|ZP_06197225.1|  30S ribosomal protein S4 [Pediococcus acid...  87.8    3e-16
ref|NP_847106.1|  30S ribosomal protein S4 [Bacillus anthracis...  87.8    3e-16 Gene info
ref|ZP_06026583.1|  30S ribosomal protein S4 [Fusobacterium pe...  87.8    3e-16
ref|YP_002960766.1|  30S ribosomal protein S4 [Mycoplasma conj...  87.8    3e-16 Gene info
ref|YP_001255887.1|  ribosomal protein S4 [Clostridium botulin...  87.8    3e-16 Gene info
ref|ZP_06200927.1|  30S ribosomal protein S4 [Bacteroides sp. ...  87.8    3e-16
ref|ZP_02069376.1|  hypothetical protein BACUNI_00786 [Bactero...  87.8    3e-16
ref|NP_604181.1|  30S ribosomal protein S4 [Fusobacterium nucl...  87.8    3e-16 Gene info
ref|ZP_03642010.1|  hypothetical protein BACCOPRO_00351 [Bacte...  87.8    3e-16
ref|YP_001727494.1|  ribosomal protein S4 [Leuconostoc citreum...  87.8    3e-16 Gene info
ref|ZP_01719467.1|  30S ribosomal protein S4 [Algoriphagus sp....  87.8    4e-16
ref|ZP_04104383.1|  30S ribosomal protein S4 [Bacillus thuring...  87.8    4e-16
ref|ZP_03238063.1|  30S ribosomal protein S4 [Bacillus cereus ...  87.8    4e-16
ref|ZP_03009494.1|  hypothetical protein BACCOP_01356 [Bactero...  87.4    4e-16
ref|ZP_03460105.1|  hypothetical protein BACEGG_02912 [Bactero...  87.4    4e-16
ref|YP_877226.1|  30S ribosomal protein S4 [Clostridium novyi ...  87.4    4e-16 Gene info
ref|ZP_01070429.1|  ribosomal protein S4 [Campylobacter jejuni...  87.4    4e-16
ref|YP_001741182.1|  30S ribosomal subunit protein S4 [Candida...  87.4    4e-16 Gene info
ref|ZP_01067727.1|  ribosomal protein S4 [Campylobacter jejuni...  87.4    4e-16
ref|ZP_05336673.1|  RNA-binding S4 domain protein [Thermoanaer...  87.4    4e-16
ref|YP_053828.1|  30S ribosomal protein S4 [Mesoplasma florum ...  87.4    4e-16 Gene info
ref|YP_431257.1|  30S ribosomal protein S4 [Moorella thermoace...  87.4    4e-16 Gene info
ref|YP_795395.1|  30S ribosomal protein S4 [Lactobacillus brev...  87.4    4e-16 Gene info
ref|YP_001843303.1|  30S ribosomal protein S4 [Lactobacillus f...  87.4    4e-16 Gene info
ref|YP_002574711.1|  30S ribosomal protein S4 [Campylobacter l...  87.4    4e-16 Gene info
ref|ZP_02436472.1|  hypothetical protein BACSTE_02731 [Bactero...  87.4    4e-16
ref|YP_808330.1|  30S ribosomal protein S4 [Lactococcus lactis...  87.4    5e-16 Gene info
ref|YP_001271105.1|  30S ribosomal protein S4 [Lactobacillus r...  87.0    5e-16 Gene info
ref|ZP_00370869.1|  ribosomal protein S4 [Campylobacter coli R...  87.0    5e-16
ref|ZP_04570427.1|  SSU ribosomal protein S4P [Fusobacterium s...  87.0    5e-16
ref|YP_001841482.1|  30S ribosomal protein S4 [Lactobacillus r...  87.0    5e-16 Gene info
ref|ZP_04970223.1|  ribosomal protein S4 [Fusobacterium nuclea...  87.0    5e-16
ref|YP_001788735.1|  30S ribosomal protein S4 [Clostridium bot...  87.0    6e-16 Gene info
emb|CAD30547.1|  ribosomal protein S4 [Listonella anguillarum]     87.0    6e-16
ref|ZP_03206510.1|  hypothetical protein BACPLE_00114 [Bactero...  87.0    6e-16
emb|CAL39302.1|  small ribosomal protein 4 [Chiloscyphus vermi...  87.0    6e-16
ref|YP_001192727.1|  30S ribosomal protein S4 [Flavobacterium ...  86.7    6e-16 Gene info
ref|YP_361091.1|  30S ribosomal protein S4 [Carboxydothermus h...  86.7    6e-16 Gene info
ref|ZP_03111295.1|  ribosomal protein S4 [Bacillus cereus 03BB...  86.7    7e-16
ref|YP_002573585.1|  ribosomal protein S4 [Anaerocellum thermo...  86.7    7e-16 Gene info
ref|YP_002941560.1|  ribosomal protein S4 [Kosmotoga olearia T...  86.7    7e-16 Gene info
ref|YP_679719.1|  30S ribosomal protein S4 [Cytophaga hutchins...  86.7    7e-16 Gene info
ref|YP_003302617.1|  30S ribosomal protein S4 [Mycoplasma homi...  86.7    8e-16 Gene info
ref|ZP_05792005.1|  small subunit ribosomal protein S4 [Butyri...  86.7    8e-16
ref|NP_834361.1|  30S ribosomal protein S4 [Bacillus cereus AT...  86.7    8e-16 Gene info
ref|YP_003088736.1|  ribosomal protein S4 [Dyadobacter ferment...  86.7    8e-16 Gene info
ref|ZP_04819583.1|  30S ribosomal protein S4 [Staphylococcus e...  86.7    8e-16
ref|YP_002456952.1|  ribosomal protein S4 [Desulfitobacterium ...  86.3    8e-16 Gene info
ref|ZP_04059241.1|  ribosomal protein S4 [Staphylococcus homin...  86.3    9e-16
ref|ZP_04074296.1|  30S ribosomal protein S4 [Bacillus thuring...  86.3    9e-16
ref|ZP_04853081.1|  30S ribosomal protein S4 [Paenibacillus sp...  86.3    9e-16
ref|ZP_05548343.1|  30S ribosomal protein S4 [Lactobacillus cr...  86.3    9e-16
ref|ZP_04010464.1|  ribosomal protein S4 [Lactobacillus ultune...  86.3    9e-16
ref|NP_764951.1|  30S ribosomal protein S4 [Staphylococcus epi...  86.3    1e-15 Gene info
ref|ZP_04805837.1|  ribosomal protein S4 [Clostridium cellulov...  86.3    1e-15
ref|ZP_06253225.1|  ribosomal protein S4 [Prevotella copri DSM...  86.3    1e-15
ref|ZP_03613671.1|  ribosomal protein S4 [Staphylococcus capit...  86.3    1e-15
ref|ZP_03995366.1|  ribosomal protein S4 [Lactobacillus crispa...  86.3    1e-15
ref|ZP_04797429.1|  30S ribosomal protein S4 [Staphylococcus e...  85.9    1e-15
ref|YP_002507900.1|  ribosomal protein S4 [Halothermothrix ore...  85.9    1e-15 Gene info
gb|AAD40609.1|AF115283_28  ribosomal protein S4 [Leptospira in...  85.9    1e-15
ref|ZP_03959711.1|  30S ribosomal protein S4 [Lactobacillus va...  85.9    1e-15
gb|AAS19790.1|  small ribosomal protein 4 [Aphanolejeunea grac...  85.9    1e-15
ref|NP_710945.1|  30S ribosomal protein S4 [Leptospira interro...  85.9    1e-15 Gene info
ref|ZP_01453605.1|  30S ribosomal protein S4 [Mariprofundus fe...  85.9    1e-15
gb|AAS19807.1|  small ribosomal protein 4 [Heteroscyphus argutus]  85.9    1e-15
ref|ZP_02622421.1|  ribosomal protein S4 [Clostridium botulinu...  85.9    1e-15
ref|YP_001181029.1|  ribosomal protein S4 [Caldicellulosirupto...  85.9    1e-15 Gene info
ref|ZP_05752828.1|  30S ribosomal protein S4 [Lactobacillus he...  85.9    1e-15
ref|YP_001577241.1|  30S ribosomal protein S4 [Lactobacillus h...  85.9    1e-15 Gene info
ref|YP_001434051.1|  ribosomal protein S4 [Roseiflexus castenh...  85.9    1e-15 Gene info
gb|ACP28113.1|  small ribosomal protein 4 [Chiloscyphus lentus]    85.9    1e-15
gb|ACP28117.1|  small ribosomal protein 4 [Chiloscyphus spinifer]  85.9    1e-15
ref|YP_001664406.1|  30S ribosomal protein S4 [Thermoanaerobac...  85.9    1e-15 Gene info
gb|ACP28122.1|  small ribosomal protein 4 [Clasmatocolea trach...  85.5    1e-15
ref|ZP_03634588.1|  hypothetical protein HOLDEFILI_01882 [Hold...  85.5    1e-15
ref|ZP_02993125.1|  hypothetical protein CLOSPO_00167 [Clostri...  85.5    1e-15
ref|YP_535968.1|  30S ribosomal protein S4 [Lactobacillus sali...  85.5    1e-15 Gene info
ref|NP_295850.1|  30S ribosomal protein S4 [Deinococcus radiod...  85.5    1e-15 Gene info
gb|ACP28116.1|  small ribosomal protein 4 [Chiloscyphus semite...  85.5    2e-15
gb|AAT57808.1|  small ribosomal protein [Chiloscyphus appalach...  85.5    2e-15
ref|ZP_03980852.1|  30S ribosomal protein S4 [Enterococcus fae...  85.5    2e-15
ref|YP_002448221.1|  ribosomal protein S4 [Bacillus cereus G98...  85.5    2e-15 Gene info
ref|YP_001528619.1|  RNA-binding S4 domain-containing protein ...  85.5    2e-15 Gene info
ref|YP_516731.1|  30S ribosomal protein S4 [Desulfitobacterium...  85.5    2e-15 Gene info
ref|ZP_04574655.1|  SSU ribosomal protein S4P [Fusobacterium s...  85.5    2e-15
ref|YP_001275516.1|  ribosomal protein S4 [Roseiflexus sp. RS-...  85.5    2e-15 Gene info
emb|CAL39384.1|  small ribosomal protein 4 [Lophocolea difformis]  85.5    2e-15
ref|ZP_02616607.1|  30S ribosomal protein S4 [Clostridium botu...  85.5    2e-15
emb|CAL39318.1|  small ribosomal protein 4 [Lophocolea concreta]   85.5    2e-15
ref|YP_003310731.1|  ribosomal protein S4 [Sebaldella termitid...  85.5    2e-15 Gene info
ref|YP_002805947.1|  ribosomal protein S4 [Clostridium botulin...  85.5    2e-15 Gene info
ref|YP_193683.1|  30S ribosomal protein S4 [Lactobacillus acid...  85.5    2e-15 Gene info
ref|ZP_04021475.1|  30S ribosomal protein S4 [Lactobacillus ac...  85.5    2e-15
ref|YP_001679994.1|  30S ribosomal protein s4 [Heliobacterium ...  85.1    2e-15 Gene info
ref|ZP_04450036.1|  hypothetical protein GCWU000282_01271 [Cat...  85.1    2e-15
ref|ZP_03913416.1|  ribosomal protein S4 [Leuconostoc mesenter...  85.1    2e-15
ref|ZP_04858587.1|  ribosomal protein S4 [Fusobacterium varium...  85.1    2e-15
gb|ACP28118.1|  small ribosomal protein 4 [Chiloscyphus sp. XH...  85.1    2e-15
gb|ACF93806.1|  small ribosomal protein 4 [Leptoscyphus austra...  85.1    2e-15
ref|ZP_05646251.1|  ribosomal protein S4 [Enterococcus casseli...  85.1    2e-15
ref|YP_605305.1|  30S ribosomal protein S4 [Deinococcus geothe...  85.1    2e-15 Gene info
ref|ZP_04455468.1|  hypothetical protein GCWU000342_01489 [Shu...  85.1    2e-15
emb|CAL41754.1|  small ribosomal protein 4 [Cephalozia lunulif...  85.1    2e-15
gb|ACP28111.1|  small ribosomal protein 4 [Chiloscyphus austri...  85.1    2e-15
ref|YP_253121.1|  30S ribosomal protein S4 [Staphylococcus hae...  85.1    2e-15 Gene info
ref|ZP_03014228.1|  hypothetical protein BACINT_01796 [Bactero...  85.1    2e-15
ref|YP_819292.1|  SSU ribosomal protein S4P [Leuconostoc mesen...  85.1    2e-15 Gene info
gb|ABD62763.1|  ribosomal protein 4 [Lophocolea heterophylla]      85.1    2e-15
gb|AAT57841.1|  small ribosomal protein [Mastigophora diclados]    84.7    2e-15
gb|AAS19800.1|  small ribosomal protein 4 [Chiloscyphus cuspid...  84.7    2e-15
gb|AAS19817.1|  small ribosomal protein 4 [Lepicolea scolopendra]  84.7    2e-15
ref|ZP_05746550.1|  30S ribosomal protein S4 [Lactobacillus an...  84.7    3e-15
ref|YP_002864417.1|  30S ribosomal protein S4 [Clostridium bot...  84.7    3e-15 Gene info
ref|ZP_04566678.1|  SSU ribosomal protein S4P [Fusobacterium m...  84.7    3e-15
ref|ZP_05634949.1|  30S ribosomal protein S4 [Fusobacterium ul...  84.7    3e-15
gb|ACP28119.1|  small ribosomal protein 4 [Clasmatocolea cteno...  84.7    3e-15
gb|AAR99771.1|  small ribosomal protein 4 [Herbertus subdentatus]  84.7    3e-15
ref|ZP_04491575.1|  SSU ribosomal protein S4P [Spirosoma lingu...  84.7    3e-15
ref|YP_812718.1|  ribosomal protein S4 [Lactobacillus delbruec...  84.7    3e-15 Gene info
ref|ZP_03495635.1|  RNA-binding S4 domain protein [Thermus aqu...  84.7    3e-15
ref|YP_003012506.1|  ribosomal protein S4 [Paenibacillus sp. J...  84.7    3e-15 Gene info
ref|ZP_01870594.1|  30S ribosomal protein S4 [Vibrio shilonii ...  84.7    3e-15
gb|ABA28690.1|  small ribosomal protein 4 [Gyrothyra underwood...  84.3    3e-15
ref|ZP_05334492.1|  RNA-binding S4 domain protein [Thermoanaer...  84.3    3e-15
ref|ZP_01308711.1|  30S ribosomal protein S4 [Candidatus Sulci...  84.3    3e-15
gb|ABD62761.1|  ribosomal protein 4 [Gyrothyra underwoodiana]      84.3    3e-15
ref|YP_001621175.1|  small subunit ribosomal protein S4 [Achol...  84.3    4e-15 Gene info
gb|ACF93805.1|  small ribosomal protein 4 [Leptoscyphus antarc...  84.3    4e-15
ref|ZP_05427968.1|  ribosomal protein S4 [Eubacterium saphenum...  84.3    4e-15
ref|YP_073942.1|  30S ribosomal protein S4 [Symbiobacterium th...  84.0    4e-15 Gene info
ref|ZP_05860625.1|  ribosomal protein S4 [Jonquetella anthropi...  84.0    4e-15
ref|ZP_05413704.1|  ribosomal protein S4 [Bacteroides finegold...  84.0    4e-15
gb|AAS19791.1|  small ribosomal protein 4 [Austrolejeunea nudi...  84.0    4e-15
ref|YP_618786.1|  30S ribosomal protein S4 [Lactobacillus delb...  84.0    4e-15 Gene info
ref|ZP_05708015.1|  30S ribosomal protein S4 [Corynebacterium ...  84.0    4e-15
gb|ACP28114.1|  small ribosomal protein 4 [Chiloscyphus leucop...  84.0    4e-15
gb|ACP28121.1|  small ribosomal protein 4 [Clasmatocolea obvol...  84.0    5e-15
ref|ZP_02185706.1|  30S ribosomal protein S4 [Carnobacterium s...  84.0    5e-15
ref|YP_001618587.1|  30S ribosomal protein S4 [Sorangium cellu...  84.0    5e-15 Gene info
ref|YP_644885.1|  SSU ribosomal protein S4P [Rubrobacter xylan...  84.0    5e-15 Gene info
ref|ZP_05393513.1|  ribosomal protein S4 [Clostridium carboxid...  84.0    5e-15
ref|ZP_02443293.1|  hypothetical protein ANACOL_02598 [Anaerot...  84.0    5e-15
ref|YP_005270.1|  30S ribosomal protein S4 [Thermus thermophil...  83.6    5e-15 Gene info
ref|ZP_02613576.1|  ribosomal protein S4 [Clostridium botulinu...  83.6    5e-15
ref|YP_796970.1|  30S ribosomal protein S4 [Leptospira borgpet...  83.6    5e-15 Gene info
gb|AAT57831.1|  small ribosomal protein [Lejeunea cladogyna]       83.6    6e-15
gb|AAS19805.1|  small ribosomal protein 4 [Herbertus sendtneri]    83.6    6e-15
pdb|1I94|D  Chain D, Crystal Structures Of The Small Ribosomal...  83.6    6e-15 Related structures
ref|ZP_05283798.1|  30S ribosomal protein S4 [Bacteroides frag...  83.6    6e-15
ref|YP_001960655.1|  ribosomal protein S4 [Chlorobium phaeobac...  83.6    6e-15 Gene info
ref|YP_001255934.1|  ribosomal protein S4 [Clostridium botulin...  83.6    6e-15 Gene info
emb|CAL39334.1|  small ribosomal protein 4 [Herbertus aduncus]     83.6    6e-15
sp|Q3S664.1|RS4_CORAM  RecName: Full=30S ribosomal protein S4 ...  83.6    6e-15
gb|ABD62762.1|  ribosomal protein 4 [Leiocolea heterocolpos]       83.6    6e-15
gb|ACP28120.1|  small ribosomal protein 4 [Clasmatocolea humilis]  83.6    6e-15
emb|CAL39366.1|  small ribosomal protein 4 [Leiocolea heteroco...  83.6    6e-15
ref|ZP_05650232.1|  ribosomal protein S4 [Enterococcus gallina...  83.6    7e-15
ref|YP_002907040.1|  30S ribosomal protein S4 [Corynebacterium...  83.6    7e-15 Gene info
ref|NP_811614.1|  30S ribosomal protein S4 [Bacteroides thetai...  83.6    7e-15 Gene info
gb|ABR20460.1|  small ribosomal protein [Trichocoleopsis saccu...  83.6    7e-15
ref|NP_975277.1|  30S ribosomal protein S4 [Mycoplasma mycoide...  83.6    7e-15 Gene info
ref|ZP_04863460.1|  ribosomal protein S4 [Clostridium botulinu...  83.2    7e-15
ref|YP_002730996.1|  ribosomal protein S4 [Persephonella marin...  83.2    7e-15 Gene info
ref|ZP_05980658.1|  ribosomal protein S4 [Subdoligranulum vari...  83.2    7e-15
ref|ZP_03956729.1|  30S ribosomal protein S4 [Lactobacillus ru...  83.2    7e-15
gb|AAS19813.1|  small ribosomal protein 4 [Jungermannia leiantha]  83.2    7e-15
ref|NP_623804.1|  30S ribosomal protein S4 [Thermoanaerobacter...  83.2    7e-15 Gene info
ref|YP_056511.1|  30S ribosomal protein S4 [Propionibacterium ...  83.2    8e-15 Gene info
ref|ZP_04008877.1|  30S ribosomal protein S4 [Lactobacillus sa...  83.2    8e-15
ref|ZP_02064042.1|  hypothetical protein BACOVA_01002 [Bactero...  83.2    8e-15
gb|ACF93816.1|  small ribosomal protein 4 [Leptoscyphus cleefii]   83.2    8e-15
ref|ZP_05864247.1|  30S ribosomal protein S4 [Lactobacillus fe...  83.2    8e-15
ref|YP_001039322.1|  SSU ribosomal protein S4P [Clostridium th...  83.2    8e-15 Gene info
gb|AAT01830.1|  small ribosomal protein 4 [Jungermannia leiantha]  83.2    8e-15
gb|AAT57822.1|  small ribosomal protein [Herbertus sakurai] >g...  83.2    8e-15
ref|YP_002017265.1|  ribosomal protein S4 [Pelodictyon phaeocl...  83.2    9e-15 Gene info
ref|ZP_02993076.1|  hypothetical protein CLOSPO_00117 [Clostri...  83.2    9e-15
emb|CAL41759.1|  small ribosomal protein 4 [Mesoptychia sahlbe...  82.8    9e-15
emb|CAL39386.1|  small ribosomal protein 4 [Diplophyllum taxif...  82.8    1e-14
ref|ZP_05735602.1|  ribosomal protein S4 [Prevotella tannerae ...  82.8    1e-14
emb|CAL39330.1|  small ribosomal protein 4 [Scapania lingulata]    82.8    1e-14
gb|AAS19827.1|  small ribosomal protein 4 [Neotrichocolea biss...  82.8    1e-14
gb|AAT57845.1|  small ribosomal protein [Neotrichocolea bisset...  82.8    1e-14
gb|ABA28692.1|  small ribosomal protein 4 [Plagiochilion conju...  82.8    1e-14
gb|AAS19853.1|  small ribosomal protein 4 [Trocholejeunea sand...  82.8    1e-14
gb|ACF93818.1|  small ribosomal protein 4 [Leptoscyphus cuneif...  82.8    1e-14
gb|AAS19855.1|  small ribosomal protein 4 [Zoopsis argentea]       82.8    1e-14
ref|YP_101432.1|  30S ribosomal protein S4 [Bacteroides fragil...  82.8    1e-14 Gene info
gb|ACF93833.1|  small ribosomal protein 4 [Leptoscyphus sp. 2 ...  82.8    1e-14
ref|YP_003248300.1|  ribosomal protein S4 [Fibrobacter succino...  82.8    1e-14 Gene info
emb|CAL39357.1|  small ribosomal protein 4 [Mesoptychia sahlbe...  82.8    1e-14
gb|ACF93817.1|  small ribosomal protein 4 [Leptoscyphus cuneif...  82.8    1e-14
gb|AAT01825.1|  small ribosomal protein 4 [Herbertus alpinus]      82.8    1e-14
ref|ZP_03929304.1|  conserved hypothetical protein [Acidaminoc...  82.4    1e-14
gb|AAK00191.1|  rps4 [Encalypta armata]                            82.4    1e-14
gb|AAS19849.1|  small ribosomal protein 4 [Triandrophyllum sub...  82.4    1e-14
ref|ZP_02533685.1|  30S ribosomal protein S4 [Endoriftia perse...  82.4    1e-14
ref|ZP_04777121.1|  ribosomal protein S4 [Gemella haemolysans ...  82.4    1e-14
ref|YP_002250727.1|  ribosomal protein S4 [Dictyoglomus thermo...  82.4    1e-14 Gene info
emb|CAL41744.1|  small ribosomal protein 4 [Scapania hyperborea]   82.4    1e-14
gb|AAT57794.1|  small ribosomal protein [Acromastigum exile]       82.4    1e-14
ref|NP_213044.1|  30S ribosomal protein S4 [Aquifex aeolicus V...  82.4    1e-14 Gene info
gb|AAT57868.1|  small ribosomal protein [Triandrophyllum subtr...  82.4    1e-14
ref|ZP_05404937.1|  ribosomal protein S4 [Mitsuokella multacid...  82.4    1e-14
gb|AAR99780.1|  small ribosomal protein 4 [Chiastocaulon dendr...  82.4    1e-14
emb|CAA23645.1|  unnamed protein product [Escherichia coli] >g...  82.4    1e-14
gb|AAK00192.1|  rps4 [Encalypta ciliata] >gb|AAY62799.1| small...  82.4    1e-14
ref|ZP_01958650.1|  hypothetical protein BACCAC_00227 [Bactero...  82.4    1e-14
ref|ZP_03935294.1|  ribosomal protein S4 [Corynebacterium stri...  82.4    1e-14
ref|YP_001788793.1|  30S ribosomal protein S4 [Clostridium bot...  82.4    1e-14 Gene info
ref|ZP_01874915.1|  30S ribosomal protein S4 [Lentisphaera ara...  82.0    2e-14
gb|AAT01831.1|  small ribosomal protein 4 [Lepicolea attenuata]    82.0    2e-14
gb|AAR99783.1|  small ribosomal protein 4 [Plagiochila diversi...  82.0    2e-14
ref|YP_001839319.1|  30S ribosomal protein S4 [Leptospira bifl...  82.0    2e-14 Gene info
ref|ZP_04844149.1|  30S ribosomal protein S4 [Bacteroides sp. ...  82.0    2e-14
gb|AAS19833.1|  small ribosomal protein 4 [Paraschistochila tu...  82.0    2e-14
ref|YP_424224.1|  30S ribosomal protein S4 [Mycoplasma caprico...  82.0    2e-14 Gene info
gb|AAS19823.1|  small ribosomal protein 4 [Mastigolejeunea aur...  82.0    2e-14
gb|AAS19841.1|  small ribosomal protein 4 [Ptychanthus striatus]   82.0    2e-14
gb|ABA28696.1|  small ribosomal protein 4 [Tetracymbaliella cy...  82.0    2e-14
gb|AAS19848.1|  small ribosomal protein 4 [Temnoma pilosum] >e...  82.0    2e-14
ref|ZP_06012087.1|  ribosomal protein S4 [Leptotrichia goodfel...  82.0    2e-14
ref|ZP_04440772.1|  ribosomal protein S4 [Lactobacillus rhamno...  82.0    2e-14
ref|YP_003171001.1|  30S ribosomal protein S4 (BS4) (S4P) [Lac...  82.0    2e-14 Gene info
ref|ZP_03210932.1|  Ribosomal protein S4 [Lactobacillus rhamno...  82.0    2e-14
ref|ZP_05747334.1|  30S ribosomal protein S4 [Erysipelothrix r...  82.0    2e-14
ref|YP_002833979.1|  30S ribosomal protein S4 [Corynebacterium...  82.0    2e-14 Gene info
gb|AAT01843.1|  small ribosomal protein 4 [Scapania nemorea]       82.0    2e-14
ref|ZP_04783053.1|  ribosomal protein S4 [Weissella paramesent...  82.0    2e-14
gb|AAT57859.1|  small ribosomal protein [Scapania nemorea]         81.6    2e-14
gb|AAT57854.1|  small ribosomal protein [Ptilidium ciliare]        81.6    2e-14
ref|YP_001997830.1|  ribosomal protein S4 [Chlorobaculum parvu...  81.6    2e-14 Gene info
ref|YP_001635993.1|  ribosomal protein S4 [Chloroflexus aurant...  81.6    2e-14 Gene info
gb|AAT57807.1|  small ribosomal protein [Ceratolejeunea coarina]   81.6    2e-14
ref|YP_198493.1|  30S ribosomal protein S4 [Wolbachia endosymb...  81.6    2e-14 Gene info
gb|AAT57832.1|  small ribosomal protein [Lepicolea ochroleuca]     81.6    2e-14
gb|ABA28689.1|  small ribosomal protein 4 [Delavayella serrata]    81.6    2e-14
pir||JE0399  ribosomal protein S4 - Thermus aquaticus (strain ...  81.6    2e-14
pdb|1FJG|D  Chain D, Structure Of The Thermus Thermophilus 30s...  81.6    2e-14 Related structures
gb|AAS19816.1|  small ribosomal protein 4 [Lepicolea ochroleuca]   81.6    2e-14
emb|CAL39393.1|  small ribosomal protein 4 [Calypogeia integri...  81.6    2e-14
gb|AAT01819.1|  small ribosomal protein 4 [Fossombronia angulosa]  81.6    2e-14
gb|ACF93832.1|  small ribosomal protein 4 [Leptoscyphus sp. 1 ...  81.6    3e-14
ref|YP_002505144.1|  ribosomal protein S4 [Clostridium cellulo...  81.6    3e-14 Gene info
ref|YP_001940092.1|  Ribosomal protein S4 [Methylacidiphilum i...  81.6    3e-14 Gene info
ref|ZP_04038338.1|  SSU ribosomal protein S4P [Meiothermus rub...  81.6    3e-14
emb|CAL39343.1|  small ribosomal protein 4 [Delavayella serrata]   81.6    3e-14
gb|AAL26194.1|AF313586_1  small ribosomal protein 4 [Selaginel...  81.6    3e-14
gb|AAM27384.1|  ribosomal protein 4 [Encalypta intermedia]         81.6    3e-14
gb|AAT57812.1|  small ribosomal protein [Diplophyllum albicans]    81.3    3e-14
gb|AAT57860.1|  small ribosomal protein [Schistochila lehmanni...  81.3    3e-14
gb|AAT57810.1|  small ribosomal protein [Cyclolejeunea convexi...  81.3    3e-14
gb|AAN87398.1|  SSU ribosomal protein S4 [Heliobacillus mobilis]   81.3    3e-14
gb|AAT57833.1|  small ribosomal protein [Lepicolea rara]           81.3    3e-14
gb|AAT57847.1|  small ribosomal protein [Odontolejeunea lunulata]  81.3    3e-14
emb|CAL39324.1|  small ribosomal protein 4 [Diplophyllum albic...  81.3    3e-14
gb|AAS19840.1|  small ribosomal protein 4 [Ptilidium pulcherri...  81.3    3e-14
emb|CAL39402.1|  small ribosomal protein 4 [Lophozia excisa]       81.3    3e-14
gb|AAS19806.1|  small ribosomal protein 4 [Herbertus dicranus]     81.3    3e-14
emb|CAL39321.1|  small ribosomal protein 4 [Leiomylia anomala]     81.3    3e-14
ref|YP_001306226.1|  30S ribosomal protein S4 [Thermosipho mel...  81.3    3e-14 Gene info
ref|YP_001470236.1|  30S ribosomal protein S4 [Thermotoga lett...  81.3    3e-14 Gene info
gb|AAT57801.1|  small ribosomal protein [Bazzania sp. Davis 146]   81.3    3e-14
gb|AAT01840.1|  small ribosomal protein 4 [Porella navicularis]    81.3    3e-14
ref|YP_301134.1|  30S ribosomal protein S4 [Staphylococcus sap...  81.3    3e-14 Gene info
gb|ACF93807.1|  small ribosomal protein 4 [Leptoscyphus amphib...  81.3    3e-14
emb|CAL39292.1|  small ribosomal protein 4 [Lophozia jamesonii...  81.3    3e-14
ref|ZP_04645612.1|  ribosomal protein S4 [Lactobacillus jensen...  81.3    3e-14
ref|YP_003239442.1|  ribosomal protein S4 [Ammonifex degensii ...  81.3    3e-14 Gene info
gb|AAS19821.1|  small ribosomal protein 4 [Lophozia ventricosa]    81.3    3e-14
ref|ZP_06143292.1|  small subunit ribosomal protein S4 [Rumino...  80.9    3e-14
ref|ZP_03956502.1|  30S ribosomal protein S4 [Lactobacillus je...  80.9    3e-14
emb|CAL39368.1|  small ribosomal protein 4 [Lophozia ventricos...  80.9    3e-14
ref|ZP_01666480.1|  ribosomal protein S4 [Thermosinus carboxyd...  80.9    4e-14
emb|CAL39372.1|  small ribosomal protein 4 [Lophozia longidens]    80.9    4e-14
ref|ZP_05553434.1|  ribosomal protein S4 [Lactobacillus coleoh...  80.9    4e-14
emb|CAL39400.1|  small ribosomal protein 4 [Jungermannia exser...  80.9    4e-14
ref|NP_938924.1|  30S ribosomal protein S4 [Corynebacterium di...  80.9    4e-14 Gene info
gb|AAC15523.1|  small ribosomal protein 4 [Bryobrittonia longi...  80.9    4e-14
gb|ACF93812.1|  small ribosomal protein 4 [Leptoscyphus azoric...  80.9    4e-14
gb|AAT57869.1|  small ribosomal protein [Trichocolea tomentosa]    80.9    4e-14
gb|ACF93831.1|  small ribosomal protein 4 [Leptoscyphus sp. 3 ...  80.9    4e-14
gb|ACH47262.1|  ribosomal protein S4 [Monsonia speciosa]           80.9    4e-14
gb|ABH09197.1|  small ribosomal protein 4 [Jackiella curvata]      80.9    4e-14
ref|ZP_03965318.1|  ribosomal protein S4 [Lactobacillus paraca...  80.9    4e-14
gb|ACF93825.1|  small ribosomal protein 4 [Leptoscyphus interm...  80.9    4e-14
gb|ACF93811.1|  small ribosomal protein 4 [Leptoscyphus amphib...  80.9    4e-14
ref|YP_002352901.1|  ribosomal protein S4 [Dictyoglomus turgid...  80.9    4e-14 Gene info
gb|AAT57835.1|  small ribosomal protein [Lepidozia reptans]        80.9    4e-14
gb|AAT57803.1|  small ribosomal protein [Bryopteris filicina]      80.9    4e-14
gb|AAT45838.1|  small ribosomal protein 4 [Plagiochila retrosp...  80.9    4e-14
ref|ZP_03920268.1|  ribosomal protein S4 [Corynebacterium pseu...  80.9    4e-14
emb|CAL39405.1|  small ribosomal protein 4 [Lophozia perssonii]    80.9    4e-14
ref|ZP_05898165.1|  ribosomal protein S4 [Selenomonas sputigen...  80.9    4e-14
gb|ACF93829.1|  small ribosomal protein 4 [Leptoscyphus porphy...  80.5    5e-14
emb|CAL41755.1|  small ribosomal protein 4 [Scapania compacta]     80.5    5e-14
emb|CAL39304.1|  small ribosomal protein 4 [Leptoscyphus ovatus]   80.5    5e-14
ref|ZP_01016021.1|  30S ribosomal protein S4 [Parvularcula ber...  80.5    5e-14
ref|YP_806471.1|  ribosomal protein S4 [Lactobacillus casei AT...  80.5    5e-14 Gene info
gb|AAC15522.1|  small ribosomal protein 4 [Encalypta rhaptocarpa]  80.5    5e-14
emb|CAL39344.1|  small ribosomal protein 4 [Blepharidophyllum ...  80.5    5e-14
emb|CAL41737.1|  small ribosomal protein 4 [Lepidozia cupressina]  80.5    5e-14
gb|AAS19793.1|  small ribosomal protein 4 [Bazzania sp. He-Nyg...  80.5    5e-14
ref|YP_638281.1|  30S ribosomal protein S4 [Mycobacterium sp. ...  80.5    6e-14 Gene info
gb|AAT57824.1|  small ribosomal protein [Herzogobryum teres]       80.5    6e-14
ref|ZP_02951597.1|  ribosomal protein S4 [Clostridium butyricu...  80.5    6e-14
gb|AAT57836.1|  small ribosomal protein [Lethocolea glossophylla]  80.5    6e-14
gb|AAT45839.1|  small ribosomal protein 4 [Plagiochila rutilans]   80.5    6e-14
gb|AAS19796.1|  small ribosomal protein 4 [Calypogeia integris...  80.5    6e-14
gb|AAS19852.1|  small ribosomal protein 4 [Tritomaria quinqued...  80.5    6e-14
emb|CAL39379.1|  small ribosomal protein 4 [Tritomaria scitula]    80.5    6e-14
gb|ACF93822.1|  small ribosomal protein 4 [Leptoscyphus hexago...  80.1    6e-14
ref|ZP_03979916.1|  30S ribosomal protein S4 [Corynebacterium ...  80.1    6e-14
gb|AAT01818.1|  small ribosomal protein 4 [Diplophyllum obtusi...  80.1    6e-14
gb|AAT57870.1|  small ribosomal protein [Tritomaria quinqueden...  80.1    6e-14
gb|AAT45811.1|  small ribosomal protein 4 [Plagiochila banksiana]  80.1    6e-14
gb|AAT01820.1|  small ribosomal protein 4 [Fossombronia foveol...  80.1    6e-14
gb|AAR99776.1|  small ribosomal protein 4 [Plagiochila buchtin...  80.1    6e-14
gb|AAT57814.1|  small ribosomal protein [Fossombronia pusilla]     80.1    6e-14
ref|ZP_05622921.1|  ribosomal protein S4 [Treponema vincentii ...  80.1    6e-14
ref|ZP_02210581.1|  hypothetical protein CLOBAR_00120 [Clostri...  80.1    6e-14
emb|CAL39300.1|  small ribosomal protein 4 [Lethocolea glossop...  80.1    6e-14
gb|AAT57867.1|  small ribosomal protein [Tetralophozia setifor...  80.1    7e-14
gb|AAT01821.1|  small ribosomal protein 4 [Fossombronia sp. St...  80.1    7e-14
emb|CAL30292.1|  small ribosomal protein 4 [Cheilolejeunea tri...  80.1    7e-14
ref|YP_002754510.1|  ribosomal protein S4 [Acidobacterium caps...  80.1    7e-14 Gene info
emb|CAL39367.1|  small ribosomal protein 4 [Tritomaria quinque...  80.1    7e-14
ref|YP_116101.1|  30S ribosomal protein S4 [Mycoplasma hyopneu...  80.1    7e-14 Gene info
gb|AAS19847.1|  small ribosomal protein 4 [Schistochila lamini...  80.1    7e-14
emb|CAL39391.1|  small ribosomal protein 4 [Lophozia obtusa]       80.1    7e-14
ref|YP_015766.1|  30S ribosomal protein S4 [Mycoplasma mobile ...  80.1    7e-14 Gene info
dbj|BAH69647.1|  hypothetical protein [Mycoplasma fermentans P...  80.1    7e-14
ref|ZP_03487978.1|  hypothetical protein EUBIFOR_00543 [Eubact...  80.1    7e-14
gb|AAT57840.1|  small ribosomal protein [Marsupidium latifolium]   80.1    7e-14
gb|ABA28684.1|  small ribosomal protein 4 [Acrobolbus ciliatus]    80.1    7e-14
gb|ACF93837.1|  small ribosomal protein 4 [Leptoscyphus porphy...  80.1    7e-14
emb|CAL39388.1|  small ribosomal protein 4 [Lophozia ventricos...  80.1    8e-14
gb|ABA28688.1|  small ribosomal protein 4 [Brevianthus flavus]     80.1    8e-14
gb|AAS19808.1|  small ribosomal protein 4 [Hygrolembidium acro...  79.7    8e-14
gb|AAT57804.1|  small ribosomal protein [Calypogeia muelleriana]   79.7    8e-14
ref|YP_002049349.1|  30S ribosomal protein S4 [Paulinella chro...  79.7    8e-14 Gene info
gb|ACF93823.1|  small ribosomal protein 4 [Leptoscyphus infusc...  79.7    8e-14
ref|YP_002000152.1|  ribosomal protein S4 [Mycoplasma arthriti...  79.7    8e-14 Gene info
ref|YP_003058983.1|  ribosomal protein S4 [Hirschia baltica AT...  79.7    8e-14 Gene info
gb|ACF93821.1|  small ribosomal protein 4 [Leptoscyphus gibbos...  79.7    9e-14
gb|AAT57805.1|  small ribosomal protein [Cephalozia catenulata]    79.7    9e-14
ref|ZP_06003845.1|  small subunit ribosomal protein S4 [Seleno...  79.7    9e-14
ref|YP_002464294.1|  ribosomal protein S4 [Chloroflexus aggreg...  79.7    9e-14 Gene info
gb|AAS19799.1|  small ribosomal protein 4 [Chandonanthus sp. H...  79.7    9e-14
ref|ZP_01085792.1|  30S ribosomal protein S4 [Synechococcus sp...  79.7    9e-14
emb|CAL41751.1|  small ribosomal protein 4 [Pachyschistochila ...  79.7    9e-14
ref|NP_663037.1|  30S ribosomal protein S4 [Chlorobium tepidum...  79.7    9e-14 Gene info
gb|AAR28108.1|  small ribosomal protein 4 [Porella pinnata] >g...  79.7    9e-14
ref|YP_002335027.1|  30S ribosomal protein S4 [Thermosipho afr...  79.7    9e-14 Gene info
emb|CAL39342.1|  small ribosomal protein 4 [Plicanthus hirtellus]  79.7    1e-13
emb|CAL41748.1|  small ribosomal protein 4 [Scapania obcordata]    79.3    1e-13
emb|CAL41746.1|  small ribosomal protein 4 [Lophozia ventricos...  79.3    1e-13
emb|CAL39397.1|  small ribosomal protein 4 [Lophozia longiflora]   79.3    1e-13
emb|CAL39378.1|  small ribosomal protein 4 [Lophozia wenzelii]     79.3    1e-13
gb|AAT57865.1|  small ribosomal protein [Telaranea pulcherrima]    79.3    1e-13
gb|AAT45817.1|  small ribosomal protein 4 [Plagiochila dura]       79.3    1e-13
ref|ZP_04659889.1|  ribosomal protein S4 [Selenomonas flueggei...  79.3    1e-13
ref|ZP_05851686.1|  30S ribosomal protein S4 [Granulicatella e...  79.3    1e-13
ref|YP_003317670.1|  ribosomal protein S4 [Thermanaerovibrio a...  79.3    1e-13 Gene info
emb|CAL39399.1|  small ribosomal protein 4 [Lophozia ventricos...  79.3    1e-13
ref|ZP_02077407.1|  hypothetical protein EUBDOL_01202 [Eubacte...  79.3    1e-13
emb|CAJ55411.1|  small ribosomal protein 4 [Plagiochila dusenii]   79.3    1e-13
emb|CAL39395.1|  small ribosomal protein 4 [Lophozia ciliata]      79.3    1e-13
ref|YP_815033.1|  30S ribosomal protein S4 [Lactobacillus gass...  79.3    1e-13 Gene info
gb|ABE76819.1|  ribosomal protein subunit 4 [Metzgeria furcata]    79.3    1e-13
gb|AAS19803.1|  small ribosomal protein 4 [Gottschea nuda]         79.3    1e-13
gb|AAS19832.1|  small ribosomal protein 4 [Pallavicinia sp. He...  79.3    1e-13
gb|AAR99788.1|  small ribosomal protein 4 [Plagiochilion mayeb...  79.3    1e-13
gb|AAY62798.1|  small ribosomal protein subunit 4 [Bryobartram...  79.3    1e-13
ref|NP_964806.1|  30S ribosomal protein S4 [Lactobacillus john...  79.3    1e-13 Gene info
gb|ABD62764.1|  ribosomal protein 4 [Metzgeria furcata]            79.3    1e-13
ref|NP_599800.1|  30S ribosomal protein S4 [Corynebacterium gl...  79.3    1e-13 Gene info
gb|AAR99794.1|  small ribosomal protein 4 [Plagiochila rutilans]   79.3    1e-13
ref|YP_756247.1|  30S ribosomal protein S4 [Maricaulis maris M...  79.0    1e-13 Gene info
gb|AAS19814.1|  small ribosomal protein 4 [Leiomitra lanata]       79.0    1e-13
ref|ZP_02037290.1|  hypothetical protein BACCAP_02904 [Bactero...  79.0    1e-13
gb|AAT57830.1|  small ribosomal protein [Jungermannia crenulif...  79.0    1e-13
gb|AAT57838.1|  small ribosomal protein [Nardia insecta] >gb|A...  79.0    1e-13
gb|ABA28691.1|  small ribosomal protein 4 [Nardia compressa]       79.0    1e-13
gb|ACM44287.1|  small ribosomal protein subunit 4 [Niphotrichu...  79.0    1e-13
emb|CAL39353.1|  small ribosomal protein 4 [Lophozia setosa]       79.0    1e-13
emb|CAF02174.1|  ribosomal protein small subunit 4 [Andreaea r...  79.0    1e-13
gb|ACG63786.1|  rps4 [Costesia spongiosa]                          79.0    1e-13
gb|ACM44267.1|  small ribosomal protein subunit 4 [Codriophoru...  79.0    1e-13
gb|ACM44268.1|  small ribosomal protein subunit 4 [Niphotrichu...  79.0    1e-13
gb|AAT57800.1|  small ribosomal protein [Balantiopsis diplophy...  79.0    1e-13
emb|CAL39325.1|  small ribosomal protein 4 [Nardia scalaris]       79.0    2e-13
emb|CAL39306.1|  small ribosomal protein 4 [Jamesoniella rubri...  79.0    2e-13
gb|AAX61177.1|  small ribosomal protein 4 [Makinoa crispata]       79.0    2e-13
gb|ACB15116.1|  small ribosomal protein 4 [Bowenia spectabilis]    79.0    2e-13
emb|CAI29117.1|  small ribosomal protein 4 [Plagiochila rubesc...  79.0    2e-13
gb|AAT57839.1|  small ribosomal protein [Marsupella aquatica]      79.0    2e-13
ref|ZP_05476840.1|  30S ribosomal protein S4 [Streptomyces sp....  79.0    2e-13
gb|AAX07763.1|  Rps4 [Pallavicinia lyellii]                        79.0    2e-13
ref|ZP_03971810.1|  30S ribosomal protein S4 [Corynebacterium ...  79.0    2e-13
emb|CAL39394.1|  small ribosomal protein 4 [Lophozia ascendens]    79.0    2e-13
gb|ABC18277.1|  small ribosomal subunit protein 4 [Herbertus a...  79.0    2e-13
gb|AAT01850.1|  small ribosomal protein 4 [Xenothallus vulcani...  79.0    2e-13

************


=>Alignments:


>ref|YP_622605.1| Gene info 30S ribosomal protein S4 [Burkholderia cenocepacia AU 1054]
 ref|YP_834020.1| Gene info 30S ribosomal protein S4 [Burkholderia cenocepacia HI2424]
 ref|YP_001763654.1| Gene info 30S ribosomal protein S4 [Burkholderia cenocepacia MC0-3]
 11 more sequence titles
 
ref|YP_002229426.1| Gene info 30S ribosomal protein S4 [Burkholderia cenocepacia J2315] ref|ZP_04939899.1| Ribosomal protein S4 [Burkholderia cenocepacia PC184] sp|Q1BRX3.1|RS4_BURCA Gene info RecName: Full=30S ribosomal protein S4 sp|A0K3Q0.1|RS4_BURCH Gene info RecName: Full=30S ribosomal protein S4 sp|B1JU47.1|RS4_BURCC Gene info RecName: Full=30S ribosomal protein S4 sp|B4E5E5.1|RS4_BURCJ Gene info RecName: Full=30S ribosomal protein S4 gb|ABF77632.1| Gene info SSU ribosomal protein S4P [Burkholderia cenocepacia AU 1054] gb|ABK07127.1| Gene info SSU ribosomal protein S4P [Burkholderia cenocepacia HI2424] gb|EAY63070.1| Ribosomal protein S4 [Burkholderia cenocepacia PC184] gb|ACA89532.1| Gene info ribosomal protein S4 [Burkholderia cenocepacia MC0-3] emb|CAR50570.1| Gene info 30S ribosomal protein S4 [Burkholderia cenocepacia J2315]
Length=207

 GENE ID: 4091486 rpsD | 30S ribosomal protein S4
[Burkholderia cenocepacia AU 1054]

 Score =  207 bits (526),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  207


>ref|ZP_02891714.1|  ribosomal protein S4 [Burkholderia ambifaria IOP40-10]
 ref|ZP_02907531.1|  ribosomal protein S4 [Burkholderia ambifaria MEX-5]
 sp|Q0BJ21.2|RS4_BURCM  RecName: Full=30S ribosomal protein S4
 gb|EDT02722.1|  ribosomal protein S4 [Burkholderia ambifaria IOP40-10]
 gb|EDT41350.1|  ribosomal protein S4 [Burkholderia ambifaria MEX-5]
Length=207

 Score =  206 bits (525),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  207


>ref|YP_772186.1| Gene info 30S ribosomal protein S4 [Burkholderia ambifaria AMMD]
 gb|ABI85852.1| Gene info SSU ribosomal protein S4P [Burkholderia ambifaria AMMD]
Length=213

 GENE ID: 4311296 rpsD | 30S ribosomal protein S4 [Burkholderia ambifaria AMMD]

 Score =  206 bits (524),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ
Sbjct  112  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  171

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  172  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  213


>ref|YP_367718.1| Gene info 30S ribosomal protein S4 [Burkholderia sp. 383]
 sp|Q39KE2.1|RS4_BURS3 Gene info RecName: Full=30S ribosomal protein S4
 gb|ABB07074.1| Gene info SSU ribosomal protein S4P [Burkholderia sp. 383]
Length=207

 GENE ID: 3748649 rpsD | 30S ribosomal protein S4 [Burkholderia sp. 383]

 Score =  206 bits (523),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVK+GD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKSGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  207


>ref|YP_001807018.1| Gene info 30S ribosomal protein S4 [Burkholderia ambifaria MC40-6]
 sp|B1YRQ4.1|RS4_BURA4 Gene info RecName: Full=30S ribosomal protein S4
 gb|ACB62802.1| Gene info ribosomal protein S4 [Burkholderia ambifaria MC40-6]
Length=207

 GENE ID: 6178228 rpsD | 30S ribosomal protein S4
[Burkholderia ambifaria MC40-6]

 Score =  206 bits (523),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  207


>sp|A4JAR5.2|RS4_BURVG  RecName: Full=30S ribosomal protein S4
Length=207

 Score =  205 bits (521),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGD++AIREKAKKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  207


>ref|YP_001118203.1| Gene info 30S ribosomal protein S4 [Burkholderia vietnamiensis G4]
 gb|ABO53368.1| Gene info SSU ribosomal protein S4P [Burkholderia vietnamiensis G4]
Length=213

 GENE ID: 4952042 rpsD | 30S ribosomal protein S4
[Burkholderia vietnamiensis G4]

 Score =  204 bits (520),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGD++AIREKAKKQARI+EALSLAEQ
Sbjct  112  MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQ  171

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  172  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  213


>ref|ZP_02465046.1|  30S ribosomal protein S4 [Burkholderia thailandensis MSMB43]
Length=207

 Score =  202 bits (514),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/102 (94%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VAN+PSQQVKAGD+V+IREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANIPSQQVKAGDVVSIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  207


>ref|YP_109782.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei K96243]
 ref|YP_104141.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei ATCC 23344]
 ref|ZP_00439641.1|  30S ribosomal protein S4 [Burkholderia mallei GB8 horse 4]
 52 more sequence titles
 
ref|YP_335115.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei 1710b] ref|YP_994431.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei SAVP1] ref|YP_001027920.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei NCTC 10229] ref|YP_001060725.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei 668] ref|YP_001083015.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei NCTC 10247] ref|ZP_01769924.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 305] ref|ZP_02267466.1| 30S ribosomal protein S4 [Burkholderia mallei PRL-20] ref|ZP_02404788.1| 30S ribosomal protein S4 [Burkholderia pseudomallei DM98] ref|ZP_02413300.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 14] ref|ZP_02449411.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 91] ref|ZP_02457599.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 9] ref|ZP_02483614.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 7894] ref|ZP_02491799.1| 30S ribosomal protein S4 [Burkholderia pseudomallei NCTC 13177] ref|ZP_02499950.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 112] ref|ZP_02507909.1| 30S ribosomal protein S4 [Burkholderia pseudomallei BCC215] ref|ZP_03793811.1| 30S ribosomal protein S4 [Burkholderia pseudomallei Pakistan 9] ref|YP_002898571.1| Gene info ribosomal protein S4 [Burkholderia pseudomallei MSHR346] ref|ZP_04881926.1| 30S ribosomal protein S4 [Burkholderia mallei ATCC 10399] ref|ZP_04886962.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 1655] ref|ZP_04896835.1| 30S ribosomal protein S4 [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04904968.1| 30S ribosomal protein S4 [Burkholderia pseudomallei S13] ref|ZP_04907578.1| 30S ribosomal protein S4 [Burkholderia mallei FMH] ref|ZP_04912906.1| 30S ribosomal protein S4 [Burkholderia mallei JHU] ref|ZP_04951130.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 1710a] ref|ZP_04968046.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 406e] sp|Q62GN0.1|RS4_BURMA RecName: Full=30S ribosomal protein S4 sp|Q63Q36.1|RS4_BURPS RecName: Full=30S ribosomal protein S4 sp|Q3JMT8.1|RS4_BURP1 Gene info RecName: Full=30S ribosomal protein S4 sp|A1V878.1|RS4_BURMS Gene info RecName: Full=30S ribosomal protein S4 sp|A2S7K1.1|RS4_BURM9 Gene info RecName: Full=30S ribosomal protein S4 sp|A3MRX9.1|RS4_BURM7 Gene info RecName: Full=30S ribosomal protein S4 sp|A3NEF4.1|RS4_BURP6 Gene info RecName: Full=30S ribosomal protein S4 emb|CAH37199.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei K96243] gb|AAU47845.1| Gene info ribosomal protein S4 [Burkholderia mallei ATCC 23344] gb|ABA50307.1| Gene info ribosomal protein S4 [Burkholderia pseudomallei 1710b] gb|ABM52371.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei SAVP1] gb|ABN02238.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei NCTC 10229] gb|ABN82276.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei 668] gb|ABO04961.1| Gene info 30S ribosomal protein S4 [Burkholderia mallei NCTC 10247] gb|EBA45511.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 305] gb|EDK54184.1| 30S ribosomal protein S4 [Burkholderia mallei FMH] gb|EDK59163.1| 30S ribosomal protein S4 [Burkholderia mallei JHU] gb|EDO87698.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 406e] gb|EDO93673.1| 30S ribosomal protein S4 [Burkholderia pseudomallei Pasteur 52237] gb|EDP86280.1| 30S ribosomal protein S4 [Burkholderia mallei ATCC 10399] gb|EDS87980.1| 30S ribosomal protein S4 [Burkholderia pseudomallei S13] gb|EDU07946.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 1655] gb|EEH25776.1| 30S ribosomal protein S4 [Burkholderia pseudomallei Pakistan 9] gb|ACQ96664.1| Gene info ribosomal protein S4 [Burkholderia pseudomallei MSHR346] gb|EEP85093.1| 30S ribosomal protein S4 [Burkholderia mallei GB8 horse 4] gb|EES44757.1| 30S ribosomal protein S4 [Burkholderia mallei PRL-20] gb|EET08149.1| 30S ribosomal protein S4 [Burkholderia pseudomallei 1710a]
Length=207

 GENE ID: 3091836 rpsD | 30S ribosomal protein S4
[Burkholderia pseudomallei K96243] (10 or fewer PubMed links)

 Score =  201 bits (511),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/102 (94%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VAN+PSQQVKAGD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|YP_001578466.1| Gene info 30S ribosomal protein S4 [Burkholderia multivorans ATCC 17616]
 ref|YP_001947401.1| Gene info 30S ribosomal protein S4 [Burkholderia multivorans ATCC 17616]
 ref|ZP_03574628.1|  30S ribosomal protein S4 [Burkholderia multivorans CGD2M]
 8 more sequence titles
 
ref|ZP_03580345.1| 30S ribosomal protein S4 [Burkholderia multivorans CGD2] ref|ZP_03586448.1| 30S ribosomal protein S4 [Burkholderia multivorans CGD1] sp|A9ADL8.1|RS4_BURM1 Gene info RecName: Full=30S ribosomal protein S4 gb|ABX13969.1| Gene info ribosomal protein S4 [Burkholderia multivorans ATCC 17616] dbj|BAG44865.1| Gene info small subunit ribosomal protein S4 [Burkholderia multivorans ATCC 17616] gb|EED99396.1| 30S ribosomal protein S4 [Burkholderia multivorans CGD1] gb|EEE05360.1| 30S ribosomal protein S4 [Burkholderia multivorans CGD2] gb|EEE10815.1| 30S ribosomal protein S4 [Burkholderia multivorans CGD2M]
Length=207

 GENE ID: 5765654 rpsD | 30S ribosomal protein S4
[Burkholderia multivorans ATCC 17616]

 Score =  201 bits (510),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 101/102 (99%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHKSITVNG+VANVPSQQVKAGD++AIREKAKKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKSITVNGIVANVPSQQVKAGDVIAIREKAKKQARIIEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+I GDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIGGDINESLIVELYSR  207


>ref|YP_001068009.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei 1106a]
 ref|ZP_02473148.1|  30S ribosomal protein S4 [Burkholderia pseudomallei B7210]
 ref|ZP_04813955.1|  30S ribosomal protein S4 [Burkholderia pseudomallei 1106b]
 sp|A3P088.1|RS4_BURP0 Gene info RecName: Full=30S ribosomal protein S4
 gb|ABN91218.1| Gene info 30S ribosomal protein S4 [Burkholderia pseudomallei 1106a]
 gb|EES24580.1|  30S ribosomal protein S4 [Burkholderia pseudomallei 1106b]
Length=207

 GENE ID: 4902194 rpsD | 30S ribosomal protein S4
[Burkholderia pseudomallei 1106a]

 Score =  200 bits (509),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK++TVNG+VAN+PSQQVKAGD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAVTVNGIVANIPSQQVKAGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|ZP_03456324.1|  30S ribosomal protein S4 [Burkholderia pseudomallei 576]
 gb|EEC32308.1|  30S ribosomal protein S4 [Burkholderia pseudomallei 576]
Length=207

 Score =  200 bits (509),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VAN+PSQQV+AGD+VAIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANIPSQQVRAGDVVAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|YP_443547.1| Gene info 30S ribosomal protein S4 [Burkholderia thailandensis E264]
 ref|ZP_02375472.1|  30S ribosomal protein S4 [Burkholderia thailandensis TXDOH]
 ref|ZP_02389343.1|  30S ribosomal protein S4 [Burkholderia thailandensis Bt4]
 ref|ZP_05585929.1|  30S ribosomal protein S4 [Burkholderia thailandensis E264]
 sp|Q2SU52.1|RS4_BURTA Gene info RecName: Full=30S ribosomal protein S4
 gb|ABC38629.1| Gene info ribosomal protein S4 [Burkholderia thailandensis E264]
Length=207

 GENE ID: 3847862 rpsD | 30S ribosomal protein S4
[Burkholderia thailandensis E264] (10 or fewer PubMed links)

 Score =  199 bits (507),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VAN+PSQQVKAGD+++IREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANIPSQQVKAGDVISIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|ZP_04946813.1|  Ribosomal protein S4 [Burkholderia dolosa AUO158]
 gb|EAY69984.1|  Ribosomal protein S4 [Burkholderia dolosa AUO158]
Length=207

 Score =  199 bits (507),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 102/102 (100%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VAN+PSQQVKAGD++AIREKAKKQARIVE+LSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANIPSQQVKAGDVIAIREKAKKQARIVESLSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|ZP_02380135.1|  30S ribosomal protein S4 [Burkholderia ubonensis Bu]
Length=207

 Score =  199 bits (505),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 101/102 (99%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNG+VANVPSQQVKAGD++AIREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGIVANVPSQQVKAGDVIAIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GG+ SWVAVDAKKFEGTFKQMPERA+IAGDINESLIVELYSR
Sbjct  166  GGLASWVAVDAKKFEGTFKQMPERADIAGDINESLIVELYSR  207


>ref|ZP_02357307.1|  30S ribosomal protein S4 [Burkholderia oklahomensis EO147]
 ref|ZP_02364412.1|  30S ribosomal protein S4 [Burkholderia oklahomensis C6786]
Length=207

 Score =  195 bits (495),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 101/102 (99%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+IT+NGVVANVPSQQVKAGD+++IREKAKKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITLNGVVANVPSQQVKAGDVISIREKAKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GG+ SWVAVDAKKFEGTFKQ+PERA+IAGDINESLIVELYSR
Sbjct  166  GGLASWVAVDAKKFEGTFKQVPERADIAGDINESLIVELYSR  207


>ref|YP_002910188.1| Gene info 30S ribosomal protein S4 [Burkholderia glumae BGR1]
 gb|ACR27484.1| Gene info 30S ribosomal protein S4 [Burkholderia glumae BGR1]
Length=207

 GENE ID: 7905748 bglu_1g02830 | 30S ribosomal protein S4
[Burkholderia glumae BGR1]

 Score =  193 bits (491),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 99/102 (97%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNGV +N+PS QVK GD++AIREK+KKQARIVEALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGVASNIPSLQVKPGDVIAIREKSKKQARIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ+PERAEIAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQVPERAEIAGDINESLIVELYSR  207


>ref|YP_001859032.1| Gene info ribosomal protein S4 [Burkholderia phymatum STM815]
 sp|B2JI40.1|RS4_BURP8 Gene info RecName: Full=30S ribosomal protein S4
 gb|ACC71986.1| Gene info ribosomal protein S4 [Burkholderia phymatum STM815]
Length=207

 GENE ID: 6244297 rpsD | 30S ribosomal protein S4 [Burkholderia phymatum STM815]

 Score =  189 bits (481),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 99/102 (97%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNGVVAN+PS QVKAGD++A+RE+AKKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGVVANIPSLQVKAGDVIAVREQAKKQARILEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GG+P WVAVD+KKFEGTFK MPER++IAGDINESLIVELYSR
Sbjct  166  GGLPQWVAVDSKKFEGTFKSMPERSDIAGDINESLIVELYSR  207


>ref|ZP_03270074.1|  ribosomal protein S4 [Burkholderia sp. H160]
 gb|EDZ98323.1|  ribosomal protein S4 [Burkholderia sp. H160]
Length=207

 Score =  189 bits (480),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLV HK+ITVNGVV+N+PS QVKAGD+VA+RE+ +KQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVGHKAITVNGVVSNIPSMQVKAGDVVAVREQKRKQARIIEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ PER++IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQKPERSDIAGDINESLIVELYSR  207


>ref|ZP_06297353.1|  ribosomal protein S4 [Burkholderia sp. CCGE1001]
 gb|EFB07518.1|  ribosomal protein S4 [Burkholderia sp. CCGE1001]
Length=207

 Score =  189 bits (479),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 99/102 (97%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNGVV+N+PS QVKAGD+VA+RE++KKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAIMVNGVVSNIPSMQVKAGDVVAVREQSKKQARILEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWV+VD+KKFEGTFKQ PER+EIAGDINESLIVELYSR
Sbjct  166  GGMPSWVSVDSKKFEGTFKQKPERSEIAGDINESLIVELYSR  207


>ref|ZP_06228536.1|  30S ribosomal protein S4 [Burkholderia sp. CCGE1002]
 gb|EFA52435.1|  30S ribosomal protein S4 [Burkholderia sp. CCGE1002]
Length=207

 Score =  188 bits (478),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 97/102 (95%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLV HK+ITVNGVV N+PS QVKAGD+VA+RE+ +KQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVGHKAITVNGVVTNIPSMQVKAGDVVAVREQKRKQARIIEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVDAKKFEGTFKQ PER++IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDAKKFEGTFKQKPERSDIAGDINESLIVELYSR  207


>ref|ZP_02886848.1|  ribosomal protein S4 [Burkholderia graminis C4D1M]
 gb|EDT07497.1|  ribosomal protein S4 [Burkholderia graminis C4D1M]
Length=207

 Score =  188 bits (477),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+ITVNGVV+N+PS QVKAGD+VA+RE+ KKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAITVNGVVSNIPSMQVKAGDVVAVREQKKKQARILEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVD+KKFEGTFK  PER++IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDSKKFEGTFKSKPERSDIAGDINESLIVELYSR  207


>ref|YP_001897233.1| Gene info 30S ribosomal protein S4 [Burkholderia phytofirmans PsJN]
 sp|B2T726.1|RS4_BURPP Gene info RecName: Full=30S ribosomal protein S4
 gb|ACD18009.1| Gene info ribosomal protein S4 [Burkholderia phytofirmans PsJN]
Length=207

 GENE ID: 6284335 rpsD | 30S ribosomal protein S4
[Burkholderia phytofirmans PsJN]

 Score =  187 bits (475),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 97/102 (95%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNGVV+N+PS QVKAGD+VA+RE  KKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAIVVNGVVSNIPSMQVKAGDVVAVRETKKKQARILEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GGMPSWVAVD+KKFEGTFKQ PER++IAGDINESLIVELYSR
Sbjct  166  GGMPSWVAVDSKKFEGTFKQKPERSDIAGDINESLIVELYSR  207


>ref|YP_560646.1| Gene info 30S ribosomal protein S4 [Burkholderia xenovorans LB400]
 sp|Q13TJ5.1|RS4_BURXL Gene info RecName: Full=30S ribosomal protein S4
 gb|ABE32594.1| Gene info SSU ribosomal protein S4P [Burkholderia xenovorans LB400]
Length=207

 GENE ID: 4006079 rpsD | 30S ribosomal protein S4
[Burkholderia xenovorans LB400] (10 or fewer PubMed links)

 Score =  186 bits (473),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 98/102 (96%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNGVV+N+PS QVKAGD+VA+RE+ KKQARI+EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAIMVNGVVSNIPSMQVKAGDVVAVREQKKKQARILEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
            GG+PSWVAVD+KKFEGTFKQ PER++IAGDINESLIVELYSR
Sbjct  166  GGLPSWVAVDSKKFEGTFKQKPERSDIAGDINESLIVELYSR  207


>ref|YP_002006905.1| Gene info 30S ribosomal protein S4 [Cupriavidus taiwanensis]
 sp|B3R7E4.1|RS4_CUPTR Gene info RecName: Full=30S ribosomal protein S4
 emb|CAQ70844.1| Gene info 30S ribosomal subunit protein S4 [Cupriavidus taiwanensis]
Length=207

 GENE ID: 6455037 rpsD | 30S ribosomal protein S4 [Cupriavidus taiwanensis]
(10 or fewer PubMed links)

 Score =  174 bits (440),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K+GD++ IRE++KKQ RI EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQTLNVPSAQIKSGDVITIREQSKKQVRIAEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVDAKKFEGTFKQ+P+RA+I+GDINESLIVELYSR
Sbjct  166  SGFPTWVAVDAKKFEGTFKQVPDRADISGDINESLIVELYSR  207


>ref|YP_297359.1| Gene info 30S ribosomal protein S4 [Ralstonia eutropha JMP134]
 sp|Q46WG8.1|RS4_RALEJ Gene info RecName: Full=30S ribosomal protein S4
 gb|AAZ62515.1| Gene info SSU ribosomal protein S4P [Ralstonia eutropha JMP134]
Length=207

 GENE ID: 3610995 rpsD | 30S ribosomal protein S4 [Ralstonia eutropha JMP134]

 Score =  174 bits (440),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K+GD++ IRE++KKQ RI EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQTLNVPSAQIKSGDVITIREQSKKQVRIAEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVDAKKFEGTFKQ+P+RA+I+GDINESLIVELYSR
Sbjct  166  SGFPTWVAVDAKKFEGTFKQVPDRADISGDINESLIVELYSR  207


>ref|YP_727895.1| Gene info 30S ribosomal protein S4 [Ralstonia eutropha H16]
 sp|Q0K644.1|RS4_RALEH Gene info RecName: Full=30S ribosomal protein S4
 emb|CAJ94527.1| Gene info SSU ribosomal protein S4 [Ralstonia eutropha H16]
Length=207

 GENE ID: 4249601 rpsD | 30S ribosomal protein S4 [Ralstonia eutropha H16]
(10 or fewer PubMed links)

 Score =  173 bits (439),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K+GD+V IRE++KKQ RI EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQTLNVPSAQIKSGDVVTIREQSKKQVRIAEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVD+KKFEGTFKQ+P+RA+I+GDINESLIVELYSR
Sbjct  166  SGFPTWVAVDSKKFEGTFKQVPDRADISGDINESLIVELYSR  207


>ref|YP_585433.1| Gene info 30S ribosomal protein S4 [Ralstonia metallidurans CH34]
 sp|Q1LI62.1|RS4_RALME Gene info RecName: Full=30S ribosomal protein S4
 gb|ABF10164.1| Gene info SSU ribosomal protein S4P [Ralstonia metallidurans CH34]
Length=207

 GENE ID: 4040127 rpsD | 30S ribosomal protein S4 [Ralstonia metallidurans CH34]

 Score =  172 bits (437),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K+GDIV++RE++KKQ RI EALSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGETLNVPSAQIKSGDIVSVREQSKKQVRIAEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVDAKKFEGT+KQ P+RA+I+GDINESLIVELYSR
Sbjct  166  SGFPTWVAVDAKKFEGTYKQAPDRADISGDINESLIVELYSR  207


>ref|YP_002982867.1| Gene info ribosomal protein S4 [Ralstonia pickettii 12D]
 gb|ACS64195.1| Gene info ribosomal protein S4 [Ralstonia pickettii 12D]
Length=207

 GENE ID: 8020597 Rpic12D_2925 | ribosomal protein S4 [Ralstonia pickettii 12D]

 Score =  172 bits (435),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K GD++AIREK+KKQ RI E+L+LAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQALNVPSAQIKTGDVIAIREKSKKQVRIAESLTLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVDAKK EGTFKQ+P+RA+IAGDINESLIVELYSR
Sbjct  166  TGFPTWVAVDAKKMEGTFKQVPDRADIAGDINESLIVELYSR  207


>ref|ZP_00945201.1|  SSU ribosomal protein S4P [Ralstonia solanacearum UW551]
 ref|YP_002260943.1| Gene info 30s ribosomal protein s4 [Ralstonia solanacearum IPO1609]
 gb|EAP72293.1|  SSU ribosomal protein S4P [Ralstonia solanacearum UW551]
 emb|CAQ62884.1| Gene info 30s ribosomal protein s4. [Ralstonia solanacearum IPO1609]
Length=207

 Score =  171 bits (434),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS Q+K+GD+VAIREK+KKQ RI E+LSLAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQALNVPSAQIKSGDVVAIREKSKKQVRIAESLSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P+WVAVDAKK EGTFKQ P+R +IAGDINESLIVELYSR
Sbjct  166  SGFPTWVAVDAKKMEGTFKQAPDRVDIAGDINESLIVELYSR  207


>ref|YP_001101372.1| Gene info 30S ribosomal protein S4 [Herminiimonas arsenicoxydans]
 sp|A4G9R4.1|RS4_HERAR Gene info RecName: Full=30S ribosomal protein S4
 emb|CAL63251.1| Gene info 30S ribosomal subunit protein S4 [Herminiimonas arsenicoxydans]
Length=207

 GENE ID: 4931660 rpsD | 30S ribosomal protein S4 [Herminiimonas arsenicoxydans]
(10 or fewer PubMed links)

 Score =  171 bits (434),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAE RQLVSHK+ TVNG+V N+ S QVK GDIVA+REK+KKQ RIVEALSLAEQ
Sbjct  106  MGFGSTRAEGRQLVSHKAFTVNGIVVNIASYQVKPGDIVAVREKSKKQVRIVEALSLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             GMPSWVAVD+KK EGTFK +P+R+EIA D+NESLIVELYSR
Sbjct  166  IGMPSWVAVDSKKMEGTFKSVPDRSEIAADVNESLIVELYSR  207


>ref|YP_001900826.1| Gene info ribosomal protein S4 [Ralstonia pickettii 12J]
 sp|B2UEJ4.1|RS4_RALPJ Gene info RecName: Full=30S ribosomal protein S4
 gb|ACD28394.1| Gene info ribosomal protein S4 [Ralstonia pickettii 12J]
Length=207

 GENE ID: 6287943 rpsD | 30S ribosomal protein S4 [Ralstonia pickettii 12J]

 Score =  171 bits (432),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)

Query  1    MGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDIVAIREKAKKQARIVEALSLAEQ  60
            MGFGSTRAEARQLVSHK+I VNG   NVPS QVK+GD++AIREK+KKQ RI E+L+LAEQ
Sbjct  106  MGFGSTRAEARQLVSHKAILVNGQALNVPSAQVKSGDVIAIREKSKKQVRIAESLTLAEQ  165

Query  61   GGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR  102
             G P WVAVDAKK EGTFKQ P+RA+IAGDINESLIVELYSR
Sbjct  166  SGFPIWVAVDAKKMEGTFKQAPDRADIAGDINESLIVELYSR  207
Personal tools