GOS 1163010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_433
Annotathon code: GOS_1163010
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : COMSATSISB
Username : Saira
Annotated on : 2010-01-17 07:21:06
  • Malik Eeesha
  • Qamar Hira

Synopsis

Genomic Sequence

>JCVI_READ_433 GOS_1163010 Genomic DNA
TGTTATAATTGGCTTTGTTGGAGTTGTAATGATTATGAAACCTAATAGTAGCATTTTTTCTTATTATTCTATTTTACCAATACTAGTTGCTTTCTTATGG
GCTGTCCAAGTGATAGTACTAAAATTTATACCAGATAATTTTTCTACAGGAAAAATTCAATTCTATTCTCTCTTTTCATCTTTTCTTGGTTCATTAATAT
TTATTTTTTTTACAACTGGTCATACATATATTGAGAGCAATACTGACTTTTTAATTTTATCATTAATTGGTATTTTTGGAGGAACAGCTGCAATTCTATT
TATTTACTCTTATAGGTTAATAGCAGCTAGTAAAATCGCAGTTTTTGAATATCTAGCAATACCCTCATCTTTTATTCTAGCATGGATATTTTTTGGTGAA
GCACCTTTTGATCAACTTTTCCCTGGAGTTTTATTAATAGTTTTCGCTGGAATGATTATTATTTGGAGAGATAAAAATAAGAAAATTAATAAACCAAACT
AAATGTTTATATCATTTAGATTTCATAGACTTCATGACTATGGTTCGATCAATTTCTCCAACTAACTCACCAGATTGTGCATTTATTATAGGGTAGGCTG
TATCATCCTCACATATCTGGTCAATTAATGTTTCAATTTTAGCATTTTCATCTATGCATTTAGTTTTATCTGAAAATAATTTCTTTGACTCATCAGAACA
TTCCTTACGCATAACTTTTCCAGCACTTAATACTTTATATTTTGGAACATCTTCACAAAAATCTTTAACGTATTTGTCAACTGGATTTGCCACAATTTCT
TCAGGCGTTCCAACTTGAGAAATCTCTCCATCTTTCATGATAGCAATATGATCGCCCATTTTTATTGCCTCTAAAAAATCATGAGTAATAAATACCATAG
TGCGTTGCAATTTTTTTTGAATGTCTAATAGCTCGTCTTGCATTTCTCGTCTAATTAATGGGTCTAAGCAGAAAACGGCTCATCGAATATTAAGATTTCT
GGGTTCACTGCCATC

Translation

[37 - 501/1015]   indirect strand
>GOS_1163010 Translation [37-501   indirect strand]
AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIVANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKK
LFSDKTKCIDENAKIETLIDQICEDDTAYPIINAQSGELVGEIDRTIVMKSMKSK

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

The sequence i have taken has Origin Sargasso Sea: Sargasso Sea, Station 11 (Bermuda (UK))and is 1015 bp long.

Filtered to: 0.1-0.8 microns

Habitat: Open Ocean

Depth: 5m (Sea floor: >4200m)

Temperature: 20.5°C

The query sequence have highest homology with glycine betaine transport ATP-binding protein opuAA [Candidatus

Pelagibacter sp. HTCC7211] of 76% and it is present in a-proteobacteria.

Score _ 248 bits (633), Expect _ 1e-64, Method: Compositional matrix adjust.

Identities _ 116/151 (76%), Positives _ 138/151 (91%), Gaps _ 0/151 (0%)


Taxonomic lineage:Bacteria › Proteobacteria › Alphaproteobacteria › Rickettsiales › SAR11 cluster › Candidatus Pelagibacter.


ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code



RESULTS ANALYSIS

Using the SMS ORFinder the sequence is determined for the presence of ORF.

Following are the results on direct strand:

No ORFs were found in reading frame 1.

ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 502.Its lenght is 500 bases.

ORF number 1 in reading frame 3 on the direct strand extends from base 597 to base 818.Its lenght is 221 bases.


Following are the results on reverse strand:

ORF number 1 in reading frame 1 on the reverse strand extends from base 37 to base 504.Its lenght is 467.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

First I took the longest ORF that extended from 2 base to 502 base on the direct strand but its Interspro result showed no protein domain n its Blast results also showed very poor homology which was not a good evidence to prove it as coding or non coding.So for this reason I took the 2nd largest ORF that extended from 37 base to 504 base on the indirect strand.Its Interspro result also showed no protein domain but its Blast result showed acceptable homology i.e 71%.so i assumed it to be as coding sequence.

RAW RESULTS

direct strand:

No ORFs were found in reading frame 1.
>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 502.
GTTATAATTGGCTTTGTTGGAGTTGTAATGATTATGAAACCTAATAGTAGCATTTTTTCT
TATTATTCTATTTTACCAATACTAGTTGCTTTCTTATGGGCTGTCCAAGTGATAGTACTA
AAATTTATACCAGATAATTTTTCTACAGGAAAAATTCAATTCTATTCTCTCTTTTCATCT
TTTCTTGGTTCATTAATATTTATTTTTTTTACAACTGGTCATACATATATTGAGAGCAAT
ACTGACTTTTTAATTTTATCATTAATTGGTATTTTTGGAGGAACAGCTGCAATTCTATTT
ATTTACTCTTATAGGTTAATAGCAGCTAGTAAAATCGCAGTTTTTGAATATCTAGCAATA
CCCTCATCTTTTATTCTAGCATGGATATTTTTTGGTGAAGCACCTTTTGATCAACTTTTC
CCTGGAGTTTTATTAATAGTTTTCGCTGGAATGATTATTATTTGGAGAGATAAAAATAAG
AAAATTAATAAACCAAACTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
VIIGFVGVVMIMKPNSSIFSYYSILPILVAFLWAVQVIVLKFIPDNFSTGKIQFYSLFSS
FLGSLIFIFFTTGHTYIESNTDFLILSLIGIFGGTAAILFIYSYRLIAASKIAVFEYLAI
PSSFILAWIFFGEAPFDQLFPGVLLIVFAGMIIIWRDKNKKINKPN*


>ORF number 1 in reading frame 3 on the direct strand extends from base 597 to base 818.
GCTGTATCATCCTCACATATCTGGTCAATTAATGTTTCAATTTTAGCATTTTCATCTATG
CATTTAGTTTTATCTGAAAATAATTTCTTTGACTCATCAGAACATTCCTTACGCATAACT
TTTCCAGCACTTAATACTTTATATTTTGGAACATCTTCACAAAAATCTTTAACGTATTTG
TCAACTGGATTTGCCACAATTTCTTCAGGCGTTCCAACTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
AVSSSHIWSINVSILAFSSMHLVLSENNFFDSSEHSLRITFPALNTLYFGTSSQKSLTYL
STGFATISSGVPT*

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 502.
GTTATAATTGGCTTTGTTGGAGTTGTAATGATTATGAAACCTAATAGTAGCATTTTTTCT
TATTATTCTATTTTACCAATACTAGTTGCTTTCTTATGGGCTGTCCAAGTGATAGTACTA
AAATTTATACCAGATAATTTTTCTACAGGAAAAATTCAATTCTATTCTCTCTTTTCATCT
TTTCTTGGTTCATTAATATTTATTTTTTTTACAACTGGTCATACATATATTGAGAGCAAT
ACTGACTTTTTAATTTTATCATTAATTGGTATTTTTGGAGGAACAGCTGCAATTCTATTT
ATTTACTCTTATAGGTTAATAGCAGCTAGTAAAATCGCAGTTTTTGAATATCTAGCAATA
CCCTCATCTTTTATTCTAGCATGGATATTTTTTGGTGAAGCACCTTTTGATCAACTTTTC
CCTGGAGTTTTATTAATAGTTTTCGCTGGAATGATTATTATTTGGAGAGATAAAAATAAG
AAAATTAATAAACCAAACTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
VIIGFVGVVMIMKPNSSIFSYYSILPILVAFLWAVQVIVLKFIPDNFSTGKIQFYSLFSS
FLGSLIFIFFTTGHTYIESNTDFLILSLIGIFGGTAAILFIYSYRLIAASKIAVFEYLAI
PSSFILAWIFFGEAPFDQLFPGVLLIVFAGMIIIWRDKNKKINKPN*

>ORF number 1 in reading frame 3 on the direct strand extends from base 597 to base 818.
GCTGTATCATCCTCACATATCTGGTCAATTAATGTTTCAATTTTAGCATTTTCATCTATG
CATTTAGTTTTATCTGAAAATAATTTCTTTGACTCATCAGAACATTCCTTACGCATAACT
TTTCCAGCACTTAATACTTTATATTTTGGAACATCTTCACAAAAATCTTTAACGTATTTG
TCAACTGGATTTGCCACAATTTCTTCAGGCGTTCCAACTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
AVSSSHIWSINVSILAFSSMHLVLSENNFFDSSEHSLRITFPALNTLYFGTSSQKSLTYL
STGFATISSGVPT*

Reverse strand:

>ORF number 1 in reading frame 1 on the reverse strand extends from base 37 to base 504.
GCCGTTTTCTGCTTAGACCCATTAATTAGACGAGAAATGCAAGACGAGCTATTAGACATT
CAAAAAAAATTGCAACGCACTATGGTATTTATTACTCATGATTTTTTAGAGGCAATAAAA
ATGGGCGATCATATTGCTATCATGAAAGATGGAGAGATTTCTCAAGTTGGAACGCCTGAA
GAAATTGTGGCAAATCCAGTTGACAAATACGTTAAAGATTTTTGTGAAGATGTTCCAAAA
TATAAAGTATTAAGTGCTGGAAAAGTTATGCGTAAGGAATGTTCTGATGAGTCAAAGAAA
TTATTTTCAGATAAAACTAAATGCATAGATGAAAATGCTAAAATTGAAACATTAATTGAC
CAGATATGTGAGGATGATACAGCCTACCCTATAATAAATGCACAATCTGGTGAGTTAGTT
GGAGAAATTGATCGAACCATAGTCATGAAGTCTATGAAATCTAAATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE
EIVANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLID
QICEDDTAYPIINAQSGELVGEIDRTIVMKSMKSK*

No ORFs were found in reading frame 2.
No ORFs were found in reading frame 3.

>ORF number 1 in reading frame 1 on the reverse strand extends from base 37 to base 504.
GCCGTTTTCTGCTTAGACCCATTAATTAGACGAGAAATGCAAGACGAGCTATTAGACATT
CAAAAAAAATTGCAACGCACTATGGTATTTATTACTCATGATTTTTTAGAGGCAATAAAA
ATGGGCGATCATATTGCTATCATGAAAGATGGAGAGATTTCTCAAGTTGGAACGCCTGAA
GAAATTGTGGCAAATCCAGTTGACAAATACGTTAAAGATTTTTGTGAAGATGTTCCAAAA
TATAAAGTATTAAGTGCTGGAAAAGTTATGCGTAAGGAATGTTCTGATGAGTCAAAGAAA
TTATTTTCAGATAAAACTAAATGCATAGATGAAAATGCTAAAATTGAAACATTAATTGAC
CAGATATGTGAGGATGATACAGCCTACCCTATAATAAATGCACAATCTGGTGAGTTAGTT
GGAGAAATTGATCGAACCATAGTCATGAAGTCTATGAAATCTAAATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE
EIVANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLID
QICEDDTAYPIINAQSGELVGEIDRTIVMKSMKSK*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

methods algorithmes bio-informatique/A la Carte mose/ default settings are used.


RESULTS ANALYSIS

In this the input contained the parent sequence and 19 homologous sequencese i-e 15 closely related and 4 less closely related sequences and i assumed that all these sequences have an evolutionary relationship by which they share a lineage and are descended from a common ancestor. From the resulting MSA, sequence homology can be inferred and phylogenetic analysis can be conducted to assess the sequences shared evolutionary origins.and from this MSA we come to know about the conserved portion and the mutations such as point mutation,insertion or deletion mutations in all sequences. The conserved portion is shown by *.

To eliminates poorly aligned positions and divergent regions(alignment noise) i use Gblock 0.91b.These positions may not be homologous or may have been saturated by multiple substitutions and it is convenient to eliminate them prior to phylogenetic analysis step.


Parameters used

Minimum Number Of Sequences For A Conserved Position: 11

Minimum Number Of Sequences For A Flanking Position: 17

Maximum Number Of Contiguous Nonconserved Positions: 8

Minimum Length Of A Block: 10

Allowed Gap Positions: None

Use Similarity Matrices: Yes



Flank positions of the 1 selected block(s)

Flanks: [233 318]


New number of positions in input.fasta-gb: 86 (18% of the original 465 positions)




CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|1637378      ------------------------------------MNTTKIQIRNLYKIFGANPGTVLP
gi|7740463      --------------------------------MTKSAREDVIRCEGIWKIFGRRSRQAME
gi|2604604      ---------------------MTDGTEQGAVQPGTDGRPVKLACRNVWKLFGANAANFIR
gi|1347610      ---------------------MTDGTERGSTQKGTNDRPVKLACRNVWKLFGTNAASFIR
gi|2544691      -----------------------------------MNQSVLLDCQDLWKIYGSNAETFLR
gi|1267406      -----------------------------------MPLKTKLSCRNVWKLYGANAERFLD
gi|1637376      --------------------------MRTGTGAALMTPKTKLSCRNIWKLYGANAEAFLN
gi|2574683      --------------------------MSKNIENDAHDEKYILSVKNLTKLYGLNKNEAVK
gi|2567720      MSQTESQSNPPSRARPRSRPAGGLVAGSGAGSDAGSGAGSVFSVRNLWKVFGPKAERIPA
gi|2399455      ---------------MTGTETLKATGPSGNAGATGTDENPVFSVRNLWKVFGPKADRIPG
gi|2828708      ---------------------MTGTETLKATGNAGPAENPVFSVRDLWKVFGPRADRIPG
gi|1824348      ---------------------MTGTETLKATGNPGPAENPVFSVRDLWKVFGPRADRIPG
gi|1452979      -------------------------------------MTVKLEVKSLYKIFGEQPEKVFK
GOS_116301      ------------------------------------------------------------
gi|2544559      -----------------------------------MADNNKIVCTNIWKLFGPDEKRIKE
gi|2578701      --------------------------------------MSKVKVAHLTKIFGKKKQQAFA
gi|2578774      -------------------------------------------MEHLTKIFGKKKQQALA
gi|2578674      --------------------------------------MSKVKVEHLTKIFGKKKQQALA
gi|2309845      --------------------------------------MNKIEVNQLTKIFGSHSKKGLQ
gi|1491819      ---------------------------MSESFIKGDMRMYKIEVNNLTKIFGSNPKEGLK
                                                                            

gi|1637378      MVRNQGMGKSQLLEEHKHVLGLQDISIDIQAGEISVIMGLSGSGKSTLIRHLNRLIEPTA
gi|7740463      AVRSGGLSKTEIRERFDCVVGVQDASFSVKRGEIFCIMGLSGSGKSTLIRHINRLIEPTS
gi|2604604      E--RDGKASMADVTAAGLVGAVRAVDLEIRQGEIFIIMGLSGSGKSTLVRCMSRLVEPTH
gi|1347610      E--RDGKASMADVTSAGLVGAVRAVDLEIRQGEIFIIMGLSGSGKSTLVRCMSRLVEPSH
gi|2544691      D--RSSTPDLEALDAAGLTGAVRAADLQIMKGEIFVIMGLSGSGKSTLVRCLSRLVEPTA
gi|1267406      R---DMPPSGEDLRKAGIIGAVRNASIDIAEGEIFIIMGLSGSGKSTLVRCLSRLIEPTA
gi|1637376      A---NPTPSGEDIRKAGIIGAVRDARIDIAEGEIFIIMGLSGSGKSTLVRCLSRLIEPTG
gi|2574683      M-LKAGAEKSEVFKKTGVTSAIWDMSFDVKQGEIFVIIGLSGSGKSTVIRCLNRLHNPTS
gi|2567720      DPELVSLDAAALRERTGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|2399455      S-EHASLPPAELREATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|2828708      G-EHAALPPAELRAATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|1824348      G-EHAALPPAELRAATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|1452979      L-LEKGHDRASILKKTGQTLGVHGVDLAIHEGEIFVVMGLSGSGKSTLVRLFNRLIEPTR
GOS_116301      --------------------------------AVFC------------------------
gi|2544559      N-LDPNLSIKEVQEKTGHVVAVKNVSFSIQKGETFVVMGLSGSGKSTLVRCISRLIEPTS
gi|2578701      M-IQEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|2578774      M-VKEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|2578674      M-VKEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|2309845      L-LEEGYTKDEILKKSGNTVGVNNVSFDVKSGEFFVIMGLSGSGKSTLIRLINRLIEPTN
gi|1491819      R-LNEGQGKEKILEETGMTVGVNNASFQVKAGEFFVIMGLSGSGKSTLIRLVNRLIEPTA
                                                                            

gi|1637378      GEILLDGQDVMDLDPVQLREMRQRSMSMVFQKFALLPHKTVLENAETALRVRGDDRATCE
gi|7740463      GSVFIEGQNVNAMNARDLRALRAQRIGMVFQSMALMPHRTVRDNVVFSLEVRGRPEEERA
gi|2604604      GKVEFEGKDLLKISDAALIELRRHRMGMVFQNFALLPHLNVLDNIAFPLSIQGQDRATRE
gi|1347610      GKVEFEGKDLLKISDAALIELRRHRMGMVFQNFALLPHLNVLDNIAFPLSIQGQDRATRE
gi|2544691      GAIRFEGQDLLSMSERELIEVRRKKMGMVFQQFALLPHLTVLQNVAFPLDVQGVRRAERE
gi|1267406      GQVLFDGTDLLCANEAELIEIRRHKMGMVFQHFALLPHLTVLQNVMFPLTIQGVAKSQAA
gi|1637376      GQVLFDGVDLLTASEQELIEIRRHKMGMVFQHFALLPHLTVLQNVMFPLTVQAVPKSEAE
gi|2574683      GNILFDGKEISKFSQKELIDFRRNKISMVFQNFGLMSHRDVISNIEYGLEIKGISKEERE
gi|2567720      GTLSIDGEDVLAMDPARLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGVGRGERR
gi|2399455      GTLAIDGEDVLAMDRARLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKAERR
gi|2828708      GTIAIDGEDVLAMDRSRLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKSERR
gi|1824348      GTIAIDGEDVLAMDRSRLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKSERR
gi|1452979      GQVLIDGEDIAAISDSELRQVRRKKISMVFQSFALMPHLSVLENAAFGLELAGVPLLERQ
GOS_116301      ------------------------------------------------------------
gi|2544559      GTVKMDDIDVTKMSGGELLDLRRNKMSMVFQHFGLFPHRTVVENIAYGLEIRGNKKQERT
gi|2578701      GDIYIDGEDIAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVPKEERV
gi|2578774      GDIYIDGVDVAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVSKEERT
gi|2578674      GDIYIDGVDVAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVSKEERT
gi|2309845      GSINIDGDDITKMNKEQLIETRRNKLGMVFQNFGLFPHRTVINNVSYGLEIQGVSKEERN
gi|1491819      GEVLIDGHNITEMSKTDLMLTRRKKLAMVFQKFALFPHRTVQDNVEYGLEIQGMAKEERS
                                                                            

gi|1637378      AAARKWLDRVGLSGFENRYPSQLSGGMQQRVGIARALTADTDIMLLDEAFSALDPLIRTD
gi|7740463      RVAAQAIEAVDLTGWETKYPDELSGGMQQRVGLARAIAADPTILLMDEPFSALDPLIRKQ
gi|2604604      ARAREVIELVGLRGREHFYPRELSGGQQQRVGIARSLATKPEIWFLDEPFSALDPLIRRE
gi|1347610      ARAREVIELVGLHGREHFYPRELSGGQQQRVGIARSLATKPEIWFLDEPFSALDPLIRRE
gi|2544691      ARAQEMIDTVGLTGRENAYPRELSGGQQQRVGIARSLVGDPHLWFLDEPFSALDPLIRRE
gi|1267406      ESALEVVELVGLKGREAYYPRELSGGQQQRVGIARSLVTEPDLWFLDEPFSALDPLIRRE
gi|1637376      VKAREVVELVGLKGREDYYPRELSGGQQQRVGIARSLVTEPDLWFLDEPFSALDPLIRRE
gi|2574683      KKAMEVLKMVGLEGLEHESINSLSGGMKQRVGIARALANDPEILLMDEPFSALDPLVRSD
gi|2567720      ERAAEFVAKVGLHGMERRRPGQLSGGQQQRVGLARALAVDPEVLLFDEPFSALDPLIRRD
gi|2399455      TKAAELVAKVGLAGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|2828708      SKATELVAKVGLDGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|1824348      SKAAELVAKVGLDGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|1452979      ESARQALNQVGLGQLVDSFPDALSGGMKQRVGLARALANDPDILLMDEAFSALDPLIRTE
GOS_116301      ----------------------------------------------------LDPLIRRE
gi|2544559      DKAMEVLKMVGLDGWQNNYPRELSGGMQQRVGLARALAVDPEILIFDEPFSALDPLIRRE
gi|2578701      AKAEKALANSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|2578774      AKAEKALENSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|2578674      AKAEKALENSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|2309845      KKAYKSIEDVGLKGYENSYPNELSGGMQQRVGLARALANDTDILLMDEAFSALDPLIRKE
gi|1491819      KKALKSIHDVGLKGYEESYPDQLSGGMQQRVGLARALANDSDILLMDEAFSALDPLIRKE
                                                                    ****:* :

gi|1637378      MQDLLLELQTELHKTIVFITHDLDEALKLADHLVILKDGAVVQQGPPQGIVMNPADPYIE
gi|7740463      LQTTFMALSAELHKTTVFITHDLDEAIRIGDRIAIMKDGVLVQIGTPEEIVTEPADEYVA
gi|2604604      MQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELVVNPATDYVA
gi|1347610      MQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELVVNPATDYVA
gi|2544691      MQNEFLRLQSKLHKTIIFITHDFEEAIRLADRIAVMKDGEIVQIATPEQLVTHPATEYVE
gi|1267406      MQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGEIIQVATPEELVLNPASDYVA
gi|1637376      MQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGHIIQIATPEELVLNPATDYVA
gi|2574683      MQFELLSIQKKLKKTIIFITHDINEAFKLGDKVAIMKDSRLIQLDTPENMSANPADDYVR
gi|2567720      MQEEVVRLHREEGRTMVFITHDLGEALRLGDRIALMRDGRIVQLGTPEEIVGSPADDYVR
gi|2399455      MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|2828708      MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|1824348      MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|1452979      MQDELLKLQASHQRTIVFISHDLDEAMRIGDRIAIMQDGQVIQVGTPDEILSQPANDYVR
GOS_116301      MQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIVANPVDKYVK
gi|2544559      MQDELLKLQEKLQKTMVFITHDFLEAIKMGDHIAIMKDGEVSQVGTPEEIVANPKDQYVK
gi|2578701      MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANQYVR
gi|2578774      MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEDILTNPANQYVR
gi|2578674      MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEDILTNPANQYVR
gi|2309845      MQDELLKLQNTLNKTILFITHDLDEALKLGDRIAIMKDGEIVQVGTSEEILENPANEYVS
gi|1491819      MQDELLNLQSKLGKTILFITHDLDEALKLGDRIAIMKNGSIVQVGTAEEILENPANEYVY
                :*  .: :     .* :**:**: **..:. .:.::.:. : *  . : :   *   *: 

gi|1637378      AFVGDINRARVLRAGTIAVT----------------------------------------
gi|7740463      DFVAGISKLDLVSAARIMQP--------------------------------FEQYRRTR
gi|2604604      EFTRDVDRAKVISARGLMRA----------------------------------------
gi|1347610      EFTRNVDRAKVISARSLMRA----------------------------------------
gi|2544691      EFTQHIPKTKVIQLATIMEP----------------------------------------
gi|1267406      EFTRHIPRSKVLSVGGIMSA----------------------------------------
gi|1637376      EFTRHIPRSKVLTVGGIMAS----------------------------------------
gi|2574683      QFIDSADKTKVISVKQIMFN---PSCIIRLKEGAGIAIREMKSNRVSSAYVIDNHMKFLG
gi|2567720      DFVRDVPREQVLTVRSAMRP---------------------------------------A
gi|2399455      EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|2828708      EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|1824348      EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|1452979      AFFRGVDLANVFSARDIVSRKQMPLIKKHTTDGPGNALRQLKDQEREFGYVVDRSRRFLG
GOS_116301      DFCEDVPKYKVLSAGKVMRK-----------------------------ECSDESKKLF-
gi|2544559      DFCEDVPKYKVLSAGKVMRK-----------------------------ECCDDTKKLYG
gi|2578701      DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKKRHLKG
gi|2578774      DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKRRHLKG
gi|2578674      DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKRRHLKG
gi|2309845      NFVKDVDRSKVLDAGTVMRK---PEVLTTYKDGPRMAVRKMEEVGASSIFVVDRQDHYKG
gi|1491819      NFVEDVDRSKVLVAGNVMKK---PDVVTTWKDGPRMAVKKMEDAGLSSIFVVDKDKNLKG
                 *        :.                                                

gi|1637378      GEPEGRLAGEVDWQDTLETVIKK-----------------AGGRADVSV-SVLRDGQVAG
gi|7740463      PTDGIEAWPVARPDDKLNRLVDL-----------------AVGTDHPI--LIKDADAVVG
gi|2604604      -CDGSEHGGTVAPEAKIASFSAD-----------------IVSSGKPFA-VVNGTGKPIG
gi|1347610      -CDGAEHGGTVAPDAKIASFSAS-----------------IVSAGKPFA-VVNGTGKPIG
gi|2544691      GCSAGSYSGDLSTHLKVADVAVQ-----------------VGKSNRPFR-VMNDDGEPIG
gi|1267406      --ELTGEGDPIPQVTRISAVAEE-----------------IISADSPRP-VCDGDGRIIG
gi|1637376      --GTDGEGTPVPQTARVSDVAEQ-----------------IIAADAPRP-VCDDSGRIIG
gi|2574683      IITIDSALKCRNENGFLSDYIIGEIPTTSSDTLINDIL--PIAVNTKFPIAVIDDGELMG
gi|2567720      RNGEAAAGPALAPSATVHEAIEA-----------------VARSGETA--RVVENGRCLG
gi|2399455      LAGESERGPAVRPDATVSEAIEA-----------------VSRSGDPVA-RVMDGGRLVG
gi|2828708      LAGESERGPAVRPEATVAEAIEA-----------------VSRSGDPAA-RVMDGGRLVG
gi|1824348      LAGESERGPAVRPEATVAEAIEA-----------------VSRSGDPAA-RVMDGGRLVG
gi|1452979      VVSVESLGQAVKNKGSLEQALLADIQPILGDTSLNELISQVASAPCQVP-VVEEDGTYLG
GOS_116301      ----SDKTKCIDENAKIETLIDQ-----------------ICEDDTAYPIINAQSGELVG
gi|2544559      -----DKSHCILDNSKIETLIDK-----------------LVDSDKSFPVVCSDTGDLLG
gi|2578701      SLTAESAREARKNNLTLKEVIDKNVQKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|2578774      SLTAESAREARKNNLTLKEVIDKNVKKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|2578674      SLTAESAREARKNNLTLKEVIDKNVKKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|2309845      LLTIDDAIRSYKEDIPMEDVLQTEIYQTTPSTPLSDLI--GIAADTKYPIAVVEEDKLVG
gi|1491819      LLTIDSAIQAYKENKWVEDVLEQDYHTTTPDTPLNDLI--GVAAESRYPIAVVEDNKLMG
                                :                                      .   *

gi|1637378      KIEMSELMLALV---------------------PYDSQTNNSSGF
gi|7740463      VVGKRALLRGIQ--------------------GREDAAACQAEAV
gi|2604604      EVTPQAVIELLA--------------------GIERSGVGG----
gi|1347610      EVTPQAVIDLLA--------------------GIEHARAGA----
gi|2544691      TIDRDRIVSLML--------------------EQELVE-------
gi|1267406      SIGRNAVAHVLF--------------------GSGEAS-------
gi|1637376      SINRQAVARVLF--------------------GAGETSGGIE---
gi|2574683      IVSKASILSTLI---------------------------------
gi|2567720      VVDQTVLLGVVA--------------------GVPAPAGRAVA--
gi|2399455      VVDHACLLDVVAGTTAS--VAPEASGTP--DDASDAPDGSREVTA
gi|2828708      VVDHACLLDVVAGTTGPGHATASASGAPGTHAGPDAPDGAREVTF
gi|1824348      VVDHACLLDVVAGTTGPGHATASASGAPGTHTGPDAPDGAREVTF
gi|1452979      LISKANLLNTLD-------------------------RSTPV---
GOS_116301      EIDRTIVMKSMK---------------------------SK----
gi|2544559      EIDRAIVMKSMK---------------------------SAS---
gi|2578701      VVIRGSVIEALAETDSS---------------VTEEGVVVNG---
gi|2578774      VVIRGSVIEALAETDSA--------------AQAEEGVVTNG---
gi|2578674      VVIRGSVIEALAETDSA--------------AQAEEGVVTNG---
gi|2309845      IVSRVSILSGLV-------------------LGKENAEVNE----
gi|1491819      IIVRVSILSGLV-------------------LGKEQSEVTAE---
                 :    :   :                                  



Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 20
Alignment assumed to be: Protein
New number of positions: 86 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  ------------------------------------MNTTKIQIRNLYKIFGANPGTVLP
gi|77404631|ref  --------------------------------MTKSAREDVIRCEGIWKIFGRRSRQAME
gi|260460413|re  ---------------------MTDGTEQGAVQPGTDGRPVKLACRNVWKLFGANAANFIR
gi|13476103|ref  ---------------------MTDGTERGSTQKGTNDRPVKLACRNVWKLFGTNAASFIR
gi|254469197|re  -----------------------------------MNQSVLLDCQDLWKIYGSNAETFLR
gi|126740664|re  -----------------------------------MPLKTKLSCRNVWKLYGANAERFLD
gi|163737616|re  --------------------------MRTGTGAALMTPKTKLSCRNIWKLYGANAEAFLN
gi|257468377|re  --------------------------MSKNIENDAHDEKYILSVKNLTKLYGLNKNEAVK
gi|256772043|re  MSQTESQSNPPSRARPRSRPAGGLVAGSGAGSDAGSGAGSVFSVRNLWKVFGPKAERIPA
gi|239945528|re  ---------------MTGTETLKATGPSGNAGATGTDENPVFSVRNLWKVFGPKADRIPG
gi|282870808|re  ---------------------MTGTETLKATGNAGPAENPVFSVRDLWKVFGPRADRIPG
gi|182434875|re  ---------------------MTGTETLKATGNPGPAENPVFSVRDLWKVFGPRADRIPG
gi|145297974|re  -------------------------------------MTVKLEVKSLYKIFGEQPEKVFK
GOS_1163010_Tra  ------------------------------------------------------------
gi|254455917|re  -----------------------------------MADNNKIVCTNIWKLFGPDEKRIKE
gi|257870167|re  --------------------------------------MSKVKVAHLTKIFGKKKQQAFA
gi|257877491|re  -------------------------------------------MEHLTKIFGKKKQQALA
gi|257867409|re  --------------------------------------MSKVKVEHLTKIFGKKKQQALA
gi|23098454|ref  --------------------------------------MNKIEVNQLTKIFGSHSKKGLQ
gi|149181987|re  ---------------------------MSESFIKGDMRMYKIEVNNLTKIFGSNPKEGLK
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  MVRNQGMGKSQLLEEHKHVLGLQDISIDIQAGEISVIMGLSGSGKSTLIRHLNRLIEPTA
gi|77404631|ref  AVRSGGLSKTEIRERFDCVVGVQDASFSVKRGEIFCIMGLSGSGKSTLIRHINRLIEPTS
gi|260460413|re  E--RDGKASMADVTAAGLVGAVRAVDLEIRQGEIFIIMGLSGSGKSTLVRCMSRLVEPTH
gi|13476103|ref  E--RDGKASMADVTSAGLVGAVRAVDLEIRQGEIFIIMGLSGSGKSTLVRCMSRLVEPSH
gi|254469197|re  D--RSSTPDLEALDAAGLTGAVRAADLQIMKGEIFVIMGLSGSGKSTLVRCLSRLVEPTA
gi|126740664|re  R---DMPPSGEDLRKAGIIGAVRNASIDIAEGEIFIIMGLSGSGKSTLVRCLSRLIEPTA
gi|163737616|re  A---NPTPSGEDIRKAGIIGAVRDARIDIAEGEIFIIMGLSGSGKSTLVRCLSRLIEPTG
gi|257468377|re  M-LKAGAEKSEVFKKTGVTSAIWDMSFDVKQGEIFVIIGLSGSGKSTVIRCLNRLHNPTS
gi|256772043|re  DPELVSLDAAALRERTGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|239945528|re  S-EHASLPPAELREATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|282870808|re  G-EHAALPPAELRAATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|182434875|re  G-EHAALPPAELRAATGCTAAVRDVSFDVRKGEVFVVMGLSGSGKSTLVRCLTRLIEPTS
gi|145297974|re  L-LEKGHDRASILKKTGQTLGVHGVDLAIHEGEIFVVMGLSGSGKSTLVRLFNRLIEPTR
GOS_1163010_Tra  --------------------------------AVFC------------------------
gi|254455917|re  N-LDPNLSIKEVQEKTGHVVAVKNVSFSIQKGETFVVMGLSGSGKSTLVRCISRLIEPTS
gi|257870167|re  M-IQEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|257877491|re  M-VKEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|257867409|re  M-VKEQRSKNEILEKTGATVGVYDVNFEVNEGEIFVIMGLSGSGKSTLIRLLNRLIEPSG
gi|23098454|ref  L-LEEGYTKDEILKKSGNTVGVNNVSFDVKSGEFFVIMGLSGSGKSTLIRLINRLIEPTN
gi|149181987|re  R-LNEGQGKEKILEETGMTVGVNNASFQVKAGEFFVIMGLSGSGKSTLIRLVNRLIEPTA
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  GEILLDGQDVMDLDPVQLREMRQRSMSMVFQKFALLPHKTVLENAETALRVRGDDRATCE
gi|77404631|ref  GSVFIEGQNVNAMNARDLRALRAQRIGMVFQSMALMPHRTVRDNVVFSLEVRGRPEEERA
gi|260460413|re  GKVEFEGKDLLKISDAALIELRRHRMGMVFQNFALLPHLNVLDNIAFPLSIQGQDRATRE
gi|13476103|ref  GKVEFEGKDLLKISDAALIELRRHRMGMVFQNFALLPHLNVLDNIAFPLSIQGQDRATRE
gi|254469197|re  GAIRFEGQDLLSMSERELIEVRRKKMGMVFQQFALLPHLTVLQNVAFPLDVQGVRRAERE
gi|126740664|re  GQVLFDGTDLLCANEAELIEIRRHKMGMVFQHFALLPHLTVLQNVMFPLTIQGVAKSQAA
gi|163737616|re  GQVLFDGVDLLTASEQELIEIRRHKMGMVFQHFALLPHLTVLQNVMFPLTVQAVPKSEAE
gi|257468377|re  GNILFDGKEISKFSQKELIDFRRNKISMVFQNFGLMSHRDVISNIEYGLEIKGISKEERE
gi|256772043|re  GTLSIDGEDVLAMDPARLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGVGRGERR
gi|239945528|re  GTLAIDGEDVLAMDRARLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKAERR
gi|282870808|re  GTIAIDGEDVLAMDRSRLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKSERR
gi|182434875|re  GTIAIDGEDVLAMDRSRLRELRRHRAAMVFQHFGLLPHRTVLDNVAYGLEIQGLSKSERR
gi|145297974|re  GQVLIDGEDIAAISDSELRQVRRKKISMVFQSFALMPHLSVLENAAFGLELAGVPLLERQ
GOS_1163010_Tra  ------------------------------------------------------------
gi|254455917|re  GTVKMDDIDVTKMSGGELLDLRRNKMSMVFQHFGLFPHRTVVENIAYGLEIRGNKKQERT
gi|257870167|re  GDIYIDGEDIAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVPKEERV
gi|257877491|re  GDIYIDGVDVAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVSKEERT
gi|257867409|re  GDIYIDGVDVAKMSKEELREVRRHKINMVFQSFGLFPHRTILENTEYGLEVRGVSKEERT
gi|23098454|ref  GSINIDGDDITKMNKEQLIETRRNKLGMVFQNFGLFPHRTVINNVSYGLEIQGVSKEERN
gi|149181987|re  GEVLIDGHNITEMSKTDLMLTRRKKLAMVFQKFALFPHRTVQDNVEYGLEIQGMAKEERS
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  AAARKWLDRVGLSGFENRYPSQLSGGMQQRVGIARALTADTDIMLLDEAFSALDPLIRTD
gi|77404631|ref  RVAAQAIEAVDLTGWETKYPDELSGGMQQRVGLARAIAADPTILLMDEPFSALDPLIRKQ
gi|260460413|re  ARAREVIELVGLRGREHFYPRELSGGQQQRVGIARSLATKPEIWFLDEPFSALDPLIRRE
gi|13476103|ref  ARAREVIELVGLHGREHFYPRELSGGQQQRVGIARSLATKPEIWFLDEPFSALDPLIRRE
gi|254469197|re  ARAQEMIDTVGLTGRENAYPRELSGGQQQRVGIARSLVGDPHLWFLDEPFSALDPLIRRE
gi|126740664|re  ESALEVVELVGLKGREAYYPRELSGGQQQRVGIARSLVTEPDLWFLDEPFSALDPLIRRE
gi|163737616|re  VKAREVVELVGLKGREDYYPRELSGGQQQRVGIARSLVTEPDLWFLDEPFSALDPLIRRE
gi|257468377|re  KKAMEVLKMVGLEGLEHESINSLSGGMKQRVGIARALANDPEILLMDEPFSALDPLVRSD
gi|256772043|re  ERAAEFVAKVGLHGMERRRPGQLSGGQQQRVGLARALAVDPEVLLFDEPFSALDPLIRRD
gi|239945528|re  TKAAELVAKVGLAGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|282870808|re  SKATELVAKVGLDGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|182434875|re  SKAAELVAKVGLDGLEDRRPSQLSGGQQQRVGLARALAVDPSVLLFDEPFSALDPLIRRE
gi|145297974|re  ESARQALNQVGLGQLVDSFPDALSGGMKQRVGLARALANDPDILLMDEAFSALDPLIRTE
GOS_1163010_Tra  ----------------------------------------------------LDPLIRRE
gi|254455917|re  DKAMEVLKMVGLDGWQNNYPRELSGGMQQRVGLARALAVDPEILIFDEPFSALDPLIRRE
gi|257870167|re  AKAEKALANSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|257877491|re  AKAEKALENSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|257867409|re  AKAEKALENSGLLSFKDQYPDQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRRE
gi|23098454|ref  KKAYKSIEDVGLKGYENSYPNELSGGMQQRVGLARALANDTDILLMDEAFSALDPLIRKE
gi|149181987|re  KKALKSIHDVGLKGYEESYPDQLSGGMQQRVGLARALANDSDILLMDEAFSALDPLIRKE
                                                                     ########


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  MQDLLLELQTELHKTIVFITHDLDEALKLADHLVILKDGAVVQQGPPQGIVMNPADPYIE
gi|77404631|ref  LQTTFMALSAELHKTTVFITHDLDEAIRIGDRIAIMKDGVLVQIGTPEEIVTEPADEYVA
gi|260460413|re  MQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELVVNPATDYVA
gi|13476103|ref  MQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELVVNPATDYVA
gi|254469197|re  MQNEFLRLQSKLHKTIIFITHDFEEAIRLADRIAVMKDGEIVQIATPEQLVTHPATEYVE
gi|126740664|re  MQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGEIIQVATPEELVLNPASDYVA
gi|163737616|re  MQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGHIIQIATPEELVLNPATDYVA
gi|257468377|re  MQFELLSIQKKLKKTIIFITHDINEAFKLGDKVAIMKDSRLIQLDTPENMSANPADDYVR
gi|256772043|re  MQEEVVRLHREEGRTMVFITHDLGEALRLGDRIALMRDGRIVQLGTPEEIVGSPADDYVR
gi|239945528|re  MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|282870808|re  MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|182434875|re  MQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIVGSPADDYVR
gi|145297974|re  MQDELLKLQASHQRTIVFISHDLDEAMRIGDRIAIMQDGQVIQVGTPDEILSQPANDYVR
GOS_1163010_Tra  MQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIVANPVDKYVK
gi|254455917|re  MQDELLKLQEKLQKTMVFITHDFLEAIKMGDHIAIMKDGEVSQVGTPEEIVANPKDQYVK
gi|257870167|re  MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANQYVR
gi|257877491|re  MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEDILTNPANQYVR
gi|257867409|re  MQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGEDILTNPANQYVR
gi|23098454|ref  MQDELLKLQNTLNKTILFITHDLDEALKLGDRIAIMKDGEIVQVGTSEEILENPANEYVS
gi|149181987|re  MQDELLNLQSKLGKTILFITHDLDEALKLGDRIAIMKNGSIVQVGTAEEILENPANEYVY
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  AFVGDINRARVLRAGTIAVT----------------------------------------
gi|77404631|ref  DFVAGISKLDLVSAARIMQP--------------------------------FEQYRRTR
gi|260460413|re  EFTRDVDRAKVISARGLMRA----------------------------------------
gi|13476103|ref  EFTRNVDRAKVISARSLMRA----------------------------------------
gi|254469197|re  EFTQHIPKTKVIQLATIMEP----------------------------------------
gi|126740664|re  EFTRHIPRSKVLSVGGIMSA----------------------------------------
gi|163737616|re  EFTRHIPRSKVLTVGGIMAS----------------------------------------
gi|257468377|re  QFIDSADKTKVISVKQIMFN---PSCIIRLKEGAGIAIREMKSNRVSSAYVIDNHMKFLG
gi|256772043|re  DFVRDVPREQVLTVRSAMRP---------------------------------------A
gi|239945528|re  EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|282870808|re  EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|182434875|re  EFVRDVPREQVLTVATAMRP---------------------------------------A
gi|145297974|re  AFFRGVDLANVFSARDIVSRKQMPLIKKHTTDGPGNALRQLKDQEREFGYVVDRSRRFLG
GOS_1163010_Tra  DFCEDVPKYKVLSAGKVMRK-----------------------------ECSDESKKLF-
gi|254455917|re  DFCEDVPKYKVLSAGKVMRK-----------------------------ECCDDTKKLYG
gi|257870167|re  DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKKRHLKG
gi|257877491|re  DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKRRHLKG
gi|257867409|re  DFVEDVDRSKVLTAQNIMVP---ALTTNIEIDGPSVALNRMRKEEVSMLLAVDKRRHLKG
gi|23098454|ref  NFVKDVDRSKVLDAGTVMRK---PEVLTTYKDGPRMAVRKMEEVGASSIFVVDRQDHYKG
gi|149181987|re  NFVEDVDRSKVLVAGNVMKK---PDVVTTWKDGPRMAVKKMEDAGLSSIFVVDKDKNLKG
                 ##################                                          


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|163737853|re  GEPEGRLAGEVDWQDTLETVIKK-----------------AGGRADVSV-SVLRDGQVAG
gi|77404631|ref  PTDGIEAWPVARPDDKLNRLVDL-----------------AVGTDHPI--LIKDADAVVG
gi|260460413|re  -CDGSEHGGTVAPEAKIASFSAD-----------------IVSSGKPFA-VVNGTGKPIG
gi|13476103|ref  -CDGAEHGGTVAPDAKIASFSAS-----------------IVSAGKPFA-VVNGTGKPIG
gi|254469197|re  GCSAGSYSGDLSTHLKVADVAVQ-----------------VGKSNRPFR-VMNDDGEPIG
gi|126740664|re  --ELTGEGDPIPQVTRISAVAEE-----------------IISADSPRP-VCDGDGRIIG
gi|163737616|re  --GTDGEGTPVPQTARVSDVAEQ-----------------IIAADAPRP-VCDDSGRIIG
gi|257468377|re  IITIDSALKCRNENGFLSDYIIGEIPTTSSDTLINDIL--PIAVNTKFPIAVIDDGELMG
gi|256772043|re  RNGEAAAGPALAPSATVHEAIEA-----------------VARSGETA--RVVENGRCLG
gi|239945528|re  LAGESERGPAVRPDATVSEAIEA-----------------VSRSGDPVA-RVMDGGRLVG
gi|282870808|re  LAGESERGPAVRPEATVAEAIEA-----------------VSRSGDPAA-RVMDGGRLVG
gi|182434875|re  LAGESERGPAVRPEATVAEAIEA-----------------VSRSGDPAA-RVMDGGRLVG
gi|145297974|re  VVSVESLGQAVKNKGSLEQALLADIQPILGDTSLNELISQVASAPCQVP-VVEEDGTYLG
GOS_1163010_Tra  ----SDKTKCIDENAKIETLIDQ-----------------ICEDDTAYPIINAQSGELVG
gi|254455917|re  -----DKSHCILDNSKIETLIDK-----------------LVDSDKSFPVVCSDTGDLLG
gi|257870167|re  SLTAESAREARKNNLTLKEVIDKNVQKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|257877491|re  SLTAESAREARKNNLTLKEVIDKNVKKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|257867409|re  SLTAESAREARKNNLTLKEVIDKNVKKIDKDMLVTDIF--NLIYDSPTPLAVVENDRLIG
gi|23098454|ref  LLTIDDAIRSYKEDIPMEDVLQTEIYQTTPSTPLSDLI--GIAADTKYPIAVVEEDKLVG
gi|149181987|re  LLTIDSAIQAYKENKWVEDVLEQDYHTTTPDTPLNDLI--GVAAESRYPIAVVEDNKLMG
                                                                             


                        430       440       450       460
                 =========+=========+=========+=========+=====
gi|163737853|re  KIEMSELMLALV---------------------PYDSQTNNSSGF
gi|77404631|ref  VVGKRALLRGIQ--------------------GREDAAACQAEAV
gi|260460413|re  EVTPQAVIELLA--------------------GIERSGVGG----
gi|13476103|ref  EVTPQAVIDLLA--------------------GIEHARAGA----
gi|254469197|re  TIDRDRIVSLML--------------------EQELVE-------
gi|126740664|re  SIGRNAVAHVLF--------------------GSGEAS-------
gi|163737616|re  SINRQAVARVLF--------------------GAGETSGGIE---
gi|257468377|re  IVSKASILSTLI---------------------------------
gi|256772043|re  VVDQTVLLGVVA--------------------GVPAPAGRAVA--
gi|239945528|re  VVDHACLLDVVAGTTAS--VAPEASGTP--DDASDAPDGSREVTA
gi|282870808|re  VVDHACLLDVVAGTTGPGHATASASGAPGTHAGPDAPDGAREVTF
gi|182434875|re  VVDHACLLDVVAGTTGPGHATASASGAPGTHTGPDAPDGAREVTF
gi|145297974|re  LISKANLLNTLD-------------------------RSTPV---
GOS_1163010_Tra  EIDRTIVMKSMK---------------------------SK----
gi|254455917|re  EIDRAIVMKSMK---------------------------SAS---
gi|257870167|re  VVIRGSVIEALAETDSS---------------VTEEGVVVNG---
gi|257877491|re  VVIRGSVIEALAETDSA--------------AQAEEGVVTNG---
gi|257867409|re  VVIRGSVIEALAETDSA--------------AQAEEGVVTNG---
gi|23098454|ref  IVSRVSILSGLV-------------------LGKENAEVNE----
gi|149181987|re  IIVRVSILSGLV-------------------LGKEQSEVTAE---
                                                              






Parameters used
Minimum Number Of Sequences For A Conserved Position: 11
Minimum Number Of Sequences For A Flanking Position: 17
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 1 selected block(s)
Flanks: [233  318]  

New number of positions in input.fasta-gb:  86  (18% of the original 465 positions)




Protein Domains

PROTOCOL

InterPro default parameters at EBI


RESULTS ANALYSIS

NO integrated protein domain was found in my query sequence.


But the best hit (glycine betaine transport ATP-binding protein opuAA [Candidatus Pelagibacter sp. HTCC7211])

found by blastp showed protein Domains having lenght of 348 a.a but as my query sequence is a partial protein with lenght of 155 a.a from this evidence i have deduced that my sequence might also have protein domains but the protein domain is missing in the given ORF length


Homolog contain domain PS00211 ABC_TRANSPORTER_1 having ABC transporter, conserved site and the molecular function of ATP binding (GO:0005524)and ATPase activity (GO:0016887)

RAW RESULTS:
Unintegrated protein domains found in my query sequence:

GOS_1163010	0ADE99D6411BABA0	155	Gene3D	G3DSA:3.40.50.300	no description	5	84	4.5e-15	T	08-Jan-2010	NULL	NULL	
GOS_1163010	0ADE99D6411BABA0	155	HMMPanther	PTHR19222:SF48	GLYCINE BETAINE/L-PROLINE ABC TRANSPORTER	5	96	3e-41	T	08-Jan-2010	NULL	NULL	
GOS_1163010	0ADE99D6411BABA0	155	HMMPanther	PTHR19222	ATP BINDING CASSETE (ABC) TRANSPORTER	5	96	3e-41	T	08-Jan-2010	NULL	NULL	
GOS_1163010	0ADE99D6411BABA0	155	superfamily	SSF53795	PEP carboxykinase-like	5	76	5.4e-16	T	08-Jan-2010	NULL	NULL	


Protein Domains of the best hit fount by blastp:
glycine betaine transport ATP-binding protein opuAA [Candidatus Pelagibacter sp. HTCC7211]


ZP_05069346.1	99E3C3FEAF812217	348	PatternScan	PS00211	ABC_TRANSPORTER_1	167	181	0.0	T	08-Jan-2010	IPR017871	ABC transporter, conserved site	Molecular Function: ATP binding (GO:0005524), Molecular Function: ATPase activity (GO:0016887)
ZP_05069346.1	99E3C3FEAF812217	348	HMMSmart	SM00382	AAA	55	244	4.80000830876748E-18	T	08-Jan-2010	IPR003593	ATPase, AAA+ type, core	Molecular Function: nucleotide binding (GO:0000166), Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
ZP_05069346.1	99E3C3FEAF812217	348	HMMTigr	TIGR01186	proV	38	346	4.30000170645869E-109	T	08-Jan-2010	IPR005892	Glycine betaine/L-proline transport ATP-binding subunit	Molecular Function: ATP binding (GO:0005524), Biological Process: amino acid transport (GO:0006865), Molecular Function: amino acid transmembrane transporter activity (GO:0015171), Cellular Component: membrane (GO:0016020)
ZP_05069346.1	99E3C3FEAF812217	348	ProfileScan	PS50893	ABC_TRANSPORTER_2	31	267	0.0	T	08-Jan-2010	IPR003439	ABC transporter-like	Molecular Function: ATP binding (GO:0005524), Molecular Function: ATPase activity (GO:0016887)
ZP_05069346.1	99E3C3FEAF812217	348	HMMPfam	PF00005	ABC_tran	56	243	7.099983251125599E-69	T	08-Jan-2010	IPR003439	ABC transporter-like	Molecular Function: ATP binding (GO:0005524), Molecular Function: ATPase activity (GO:0016887)

Phylogeny

PROTOCOL

a)Phylogeny.fr / PhyML method / default bootstrap / default substitution model


b) Phylogeny.fr / BioNJ method / bootstrap_5 / default substitution model


RESULTS ANALYSIS


The tree results of both PhyML and Neighbor both showed the same ancestor lineage.


The phylogenetic tree is showing the relationship between the ingroup and the outgroup species.


It is also telling about the homologues that exist and share a common ancestor with the ORF.



RAW RESULTS                                                                                                   -------0.2------
 
             


                                    +gi_239945528_ref_ZP_04697465.1_putative_glycine_betaine_ABC_tran  [high GC Gram+] 
                                                 |
                                                 |gi_282870808_ref_ZP_06279808.1_glycine_betaine/L-proline_ABC_tra  [high GC Gram+]  
                                             +---+
                                             |   +gi_182434875_ref_YP_001822594.1_putative_glycine_betaine_ABC_tra  [high GC Gram+]  
             +-------------------------------+
             |                               +----gi_256772043_ref_ZP_05511217.1_glycine_betaine_ABC_transporter_A  [high GC Gram+]
         +---+
         |   |
         |   |                 +-----GOS_1163010_Translation_37-501_indirect_strand
         |   +-----------------+
         |                     +--gi_254455917_ref_ZP_05069346.1_glycine_betaine_transport_ATP-bin  [a-proteobacteria]
         |
         |     +----------------------------------------gi_163737853_ref_ZP_02145270.1_D-cysteine_desulfhydrase_Phaeobac  [a-proteobacteria]
         |     |
         |     |                  +gi_260460413_ref_ZP_05808665.1_glycine_betaine/L-proline_ABC_tra  [a-proteobacteria] 
         |   +-+          +-------+
         |   | |          |       +-gi_13476103_ref_NP_107673.1_ABC_transporter_ATP-binding_protein [a-proteobacteria]
         |   | |          |
         |   | +----------+        +--------------------gi_254469197_ref_ZP_05082602.1_glycine_betaine_transport_ATP-bin [a-proteobacteria]
         |   |            |        |
         |---+            +--------+
         |   |                     |+-gi_126740664_ref_ZP_01756350.1_ABC_transporter_ATP-binding_prote  [a-proteobacteria] 
 +-------+   |                     ++
 |       |   |                      +-gi_163737616_ref_ZP_02145033.1_ABC_transporter_ATP-binding_prote   [a-proteobacteria]
 |       |   |
 |       |   +-------------------------------------gi_77404631_ref_YP_345205.1_glycine_betaine/L-proline_ABC_transp  [d-proteobacteria]  
 |       |
 |       |               +----gi_23098454_ref_NP_691920.1_glycine_betaine_ABC_transporter_ATP-  [firmicutes] 
 |       |   +-----------+
 |       |   |           +------gi_149181987_ref_ZP_01860474.1_glycine_betaine_ABC_transporter_A  [firmicutes]
 |       |   |
 |       |   |            +gi_257870167_ref_ZP_05649820.1_glycine_betaine/L-proline_transpo   [firmicutes] 
 |       +---+            |
 |           | +----------+
 |           | |          |+gi_257877491_ref_ZP_05657144.1_glycine_betaine/L-proline_transpo  [firmicutes]
 |           +-+          ++
 |             |           +gi_257867409_ref_ZP_05647062.1_glycine_betaine/L-proline_transpo  [firmicutes]
 |             |
 |             +---------------------------gi_145297974_ref_YP_001140815.1_glycine_betaine/L-proline_transp  [g-proteobacteria]
 |
 +---------------------------------------gi_257468377_ref_ZP_05632471.1_glycine_betaine/L-proline_ABC_tra  [fusobacteria]


Neighbour joining tree:



         +--gi|23098454|ref|NP_691920.1| glycine betaine ABC transporter ATP-binding protein [Oceanobacillus iheyensis HTE831]
  +-----11  
  !      +----gi|149181987|ref|ZP_01860474.1| glycine betaine ABC transporter ATP-binding protein [Bacillus sp. SG-1]
  !  
  !                    +----------gi|256806345|ref|ZP_05535969.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Streptomyces viridochromogenes DSM 40736]
  !                    ! 
  !     +--------------4  +--gi|256772043|ref|ZP_05511217.1| glycine betaine ABC transporter ATP-binding protein [Streptomyces sp. C]
  !     !              !  ! 
  !     !              +--3     +gi|239945528|ref|ZP_04697465.1| putative glycine betaine ABC transporter ATP-binding protein [Streptomyces roseosporus NRRL 15998]
  !     !                 !   +-1 
  !  +-15                 +---2 +gi|282870808|ref|ZP_06279808.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Streptomyces sp. ACT-1]
  !  !  !                     ! 
  !  !  !                     +gi|182434875|ref|YP_001822594.1| putative glycine betaine ABC transporter ATP-binding protein [Streptomyces griseus subsp. griseus NBRC 13350]
  !  !  !  
  !  !  !  +----------------gi|145297974|ref|YP_001140815.1| glycine betaine/L-proline transport system, ATPase component [Aeromonas salmonicida subsp. salmonicida A449]
  !  !  +-13  
  !  !     !         +gi|257870167|ref|ZP_05649820.1| glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus gallinarum EG2]
  !  !     +---------9 
  !  !               ! +gi|257877491|ref|ZP_05657144.1| glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus casseliflavus EC20]
 14-16               +-8 
  !  !                 +gi|257867409|ref|ZP_05647062.1| glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus casseliflavus EC30]
  !  !  
  !  !               +---GOS_1163010 Translation [37-501   indirect strand]
  !  !  +------------5 
  !  !  !            +-gi|254455917|ref|ZP_05069346.1| glycine betaine transport ATP-binding protein opuAA [Candidatus Pelagibacter sp. HTCC7211]
  !  !  !  
  !  !  !             +gi|260460413|ref|ZP_05808665.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Mesorhizobium opportunistum WSM2075]
  !  +-17       +-----7 
  !     !       !     +gi|13476103|ref|NP_107673.1| ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
  !     !  +---12  
  !     !  !    !   +----------gi|254469197|ref|ZP_05082602.1| glycine betaine transport ATP-binding protein opuAA [Pseudovibrio sp. JE062]
  !     !  !    +--10  
  !     +-18        !   +gi|126740664|ref|ZP_01756350.1| ABC transporter ATP-binding protein [Roseobacter sp. SK209-2-6]
  !        !        +---6 
  !        !            +-gi|163737616|ref|ZP_02145033.1| ABC transporter ATP-binding protein [Phaeobacter gallaeciensis BS107]
  !        !  
  !        +-------------------------gi|257468377|ref|ZP_05632471.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Fusobacterium ulcerans ATCC 49185]
  !  
  +------------------------gi|163737853|ref|ZP_02145270.1| D-cysteine desulfhydrase [Phaeobacter gallaeciensis BS107]

Taxonomy report

PROTOCOL

blast vs NR default NCBI parameters * "1000 maximum target sequence"


RESULTS ANALYSIS

The lineage report gives a simplified view of the relationships between the organisms, according to their classification in the taxonomy database. This also tells us that how closely are the organisms in the BLAST hitlist related to the query sequence according to the taxonomy database.All of the species in our list comes from cellular organisms.a-protobacteria are the source of best hit.In group and out group organisms that you have chosen are:


In group: a-proteobacteria


ref|ZP_05069346.1| glycine betaine transport ATP-binding protein 1e-64 Candidatus Pelagibacter sp. [a-proteobacteria]

ref|ZP_01756350.1| ABC transporter ATP-binding protein 6e-30 Roseobacter sp. SK209-2-6 [a-proteobacteria]

ref|ZP_02145033.1| ABC transporter ATP-binding protein 2e-29 Phaeobacter gallaeciensis BS107[a-proteobacteria]


Out group:g- proteobacteria.,d-proteobacteria.

ref|YP_001140815.1| glycine betaine/L-proline transport system, ATPase component 1e-20 Aeromonas. salmonicida subsp. salmonicida A449] [g-proteobacteria]

ref|NP_691920.1| glycine betaine ABC transporter ATP-binding protein 1e-27 Oceanobacillus iheyensis HTE831 [firmicutes]

ref|YP_345205.1| glycine betaine/L-proline ABC transporter ATPase 1e-20 [d-proteobacteria]

Lineage Report

root
. cellular organisms
. . Bacteria                [bacteria]
. . . Proteobacteria          [proteobacteria]
. . . . Alphaproteobacteria     [a-proteobacteria]
. . . . . Candidatus Pelagibacter [a-proteobacteria]04697465.1|  putative glycine betaine ABC transporter A...   124   
. . . . . . Candidatus Pelagibacter sp. HTCC7211 ---------------------------------  248  6 hits [a-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Candid
. . . . . . Candidatus Pelagibacter ubique HTCC1062 ..............................  114  4 hits [a-proteobacteria]    glycine betaine/l-proline transport ATP-binding protein [Ca
. . . . . . Candidatus Pelagibacter ubique HTCC1002 ..............................  114  4 hits [a-proteobacteria]    glycine betaine/l-proline transport ATP-binding protein [Ca
. . . . . Roseobacter sp. SK209-2-6 ----------------------------------------------  133 10 hits [a-proteobacteria]    ABC transporter ATP-binding protein [Roseobacter sp. SK209-
. . . . . Phaeobacter gallaeciensis BS107 ........................................  131  8 hits [a-proteobacteria]    ABC transporter ATP-binding protein [Phaeobacter gallaecien
. . . . . Phaeobacter gallaeciensis 2.10 .........................................  131  4 hits [a-proteobacteria]    ABC transporter ATP-binding protein [Phaeobacter gallaecien
. . . . . Mesorhizobium opportunistum WSM2075 ....................................  127  4 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Mesorhizobium loti MAFF303099 ..........................................  125  4 hits [a-proteobacteria]    ABC transporter ATP-binding protein [Mesorhizobium loti MAF
. . . . . Pseudovibrio sp. JE062 .................................................  124  6 hits [a-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Pseudo
. . . . . Rhodobacteraceae bacterium KLH11 .......................................  121  6 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein Pro
. . . . . Octadecabacter antarcticus 238 .........................................  120 10 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . . Rhodobacter sp. SW2 ....................................................  118  2 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Roseovarius sp. HTCC2601 ...............................................  118  4 hits [a-proteobacteria]    ABC Glycine betaine/L-proline transporter, ATPase subunit [
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  117  6 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Labrenzia alexandrii DFL-11 ............................................  116  2 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit sub
. . . . . Roseovarius nubinhibens ISM ............................................  113  6 hits [a-proteobacteria]    ABC Glycine betaine/L-proline transporter, ATPase subunit [
. . . . . Roseobacter sp. MED193 .................................................  113  2 hits [a-proteobacteria]    glycine betaine/proline ABC transporter, ATP-binding protei
. . . . . Ruegeria pomeroyi DSS-3 ................................................  112  8 hits [a-proteobacteria]    glycine betaine/proline ABC transporter, ATP-binding protei
. . . . . Roseobacter litoralis Och 149 ..........................................  112  4 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein [Ro
. . . . . Agrobacterium tumefaciens str. C58 .....................................  112  6 hits [a-proteobacteria]    ABC transporter, nucleotide binding/ATPase protein [Agrobac
. . . . . Rhodobacterales bacterium HTCC2150 .....................................  111  6 hits [a-proteobacteria]    glycine betaine/proline ABC transporter, ATP-binding protei
. . . . . Dinoroseobacter shibae DFL 12 ..........................................  110  2 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Rhodobacterales bacterium HTCC2255 .....................................  110  6 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein [al
. . . . . Hoeflea phototrophica DFL-43 ...........................................  110  2 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein [Ho
. . . . . Rhodobacter sphaeroides ATCC 17025 .....................................  109  2 hits [a-proteobacteria]    ABC transporter related [Rhodobacter sphaeroides ATCC 17025
. . . . . Rhodobacterales bacterium HTCC2083 .....................................  109  4 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . . Octadecabacter antarcticus 307 .........................................  108  4 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit sub
. . . . . Rhodospirillum rubrum ATCC 11170 .......................................  108  2 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding subunit [Rh
. . . . . Sagittula stellata E-37 ................................................  108  2 hits [a-proteobacteria]    ABC transporter ATP-binding protein [Sagittula stellata E-3
. . . . . Sulfitobacter sp. EE-36 ................................................  108  2 hits [a-proteobacteria]    ABC glycine betaine/L-proline transporter, ATPase subunit, 
. . . . . Roseobacter sp. CCS2 ...................................................  108  2 hits [a-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein [Ro
. . . . . Thalassiobium sp. R2A62 ................................................  108  2 hits [a-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Thalas
. . . . . Sulfitobacter sp. NAS-14.1 .............................................  108  2 hits [a-proteobacteria]    ABC glycine betaine/L-proline transporter, ATPase subunit, 
. . . . . Roseovarius sp. 217 ....................................................  108  4 hits [a-proteobacteria]    ABC glycine betaine/L-proline transporter, ATPase subunit, 
. . . . . Roseovarius sp. TM1035 .................................................  107  6 hits [a-proteobacteria]    ABC glycine betaine/L-proline tranporter, ATPase subunit, P
. . . . . Ruegeria sp. R11 .......................................................  107  2 hits [a-proteobacteria]    choline ABC transporter, ATP-binding protein [Ruegeria sp. 
. . . . . Paracoccus denitrificans PD1222 ........................................  107  2 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Silicibacter lacuscaerulensis ITI-1157 .................................  107  4 hits [a-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Silici
. . . . . Roseobacter sp. AzwK-3b ................................................  107  4 hits [a-proteobacteria]    glycine betaine/proline ABC transporter, ATP-binding protei
. . . . . Rhodobacter sphaeroides ATCC 17029 .....................................  107  2 hits [a-proteobacteria]    ABC transporter related [Rhodobacter sphaeroides ATCC 17029
. . . . . Rhodobacter sphaeroides KD131 ..........................................  107  2 hits [a-proteobacteria]    ABC transporter related [Rhodobacter sphaeroides ATCC 17029
. . . . . Rhodobacter sphaeroides 2.4.1 ..........................................  107  4 hits [a-proteobacteria]    ABC glycine betaine/L-proline tranporter, ATPase subunit, P
. . . . . Agrobacterium radiobacter K84 ..........................................  106  4 hits [a-proteobacteria]    proline/glycine betaine ABC transporter [Agrobacterium radi
. . . . . Rhodobacterales bacterium HTCC2654 .....................................  106  2 hits [a-proteobacteria]    hypothetical protein RB2654_07089 [Rhodobacterales bacteriu
. . . . . Rhodobacterales bacterium Y4I ..........................................  105  2 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . . Fulvimarina pelagi HTCC2506 ............................................  105  4 hits [a-proteobacteria]    glycine betaine ABC transporter (ATP-binding protein) [Fulv
. . . . . Agrobacterium vitis S4 .................................................  104  2 hits [a-proteobacteria]    ABC transporter nucleotide binding/ATPase protein [Agrobact
. . . . . Chelativorans sp. BNC1 .................................................  103  2 hits [a-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . . Rhizobium leguminosarum bv. viciae 3841 ................................  103  6 hits [a-proteobacteria]    putative glycine betaine/L-proline transport ATP-binding pr
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...........................  103  4 hits [a-proteobacteria]    ABC transporter related [Rhizobium leguminosarum bv. trifol
. . . . . Rhizobium etli CIAT 652 ................................................  103  4 hits [a-proteobacteria]    probable glycine betaine/L-proline ABC transporter, ATP-bin
. . . . . Roseobacter sp. GAI101 .................................................  103  2 hits [a-proteobacteria]    choline ABC transporter, ATP-binding protein [Roseobacter s
. . . . . Rhizobium etli GR56 ....................................................  103  1 hit  [a-proteobacteria]    probable glycine betaine/L-proline ABC transporter, ATP-bin
. . . . . alpha proteobacterium BAL199 ...........................................  103  2 hits [a-proteobacteria]    putative lycine betaine/L-proline ABC transporter, ATP-bind
. . . . . Ochrobactrum intermedium LMG 3301 ......................................  103  2 hits [a-proteobacteria]    choline ABC transporter, ATP-binding protein [Ochrobactrum 
. . . . . Rhizobium etli Brasil 5 ................................................  102  1 hit  [a-proteobacteria]    probable glycine betaine/L-proline ABC transporter, ATP-bin
. . . . . Rhizobium etli IE4771 ..................................................  102  1 hit  [a-proteobacteria]    choline ABC transporter, ATP-binding protein [Rhizobium etl
. . . . Myxococcus xanthus DK 1622 -----------------------------------------------  119  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  118  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Psychromonas ingrahamii 37 ...............................................  117  2 hits [g-proteobacteria]    ABC transporter ATP-binding protein [Psychromonas ingrahami
. . . . Desulfovibrio salexigens DSM 2638 ........................................  116  4 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Marinobacter sp. ELB17 ...................................................  115  2 hits [g-proteobacteria]    glycine betaine/l-proline transport ATP-binding protein [Ma
. . . . Desulfobacterium autotrophicum HRM2 ......................................  115  2 hits [d-proteobacteria]    ProV [Desulfobacterium autotrophicum HRM2] >gi|223693585|gb
. . . . Desulfonatronospira thiodismutans ASO3-1 .................................  113  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfomicrobium baculatum DSM 4028 ......................................  113  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfovibrio vulgaris str. Hildenborough ................................  113  2 hits [d-proteobacteria]    glycine/betaine/L-proline ABC transporter, ATP binding prot
. . . . Desulfovibrio vulgaris DP4 ...............................................  113  2 hits [d-proteobacteria]    glycine/betaine/L-proline ABC transporter, ATP binding prot
. . . . Desulfovibrio vulgaris RCH1 ..............................................  113  2 hits [d-proteobacteria]    glycine/betaine/L-proline ABC transporter, ATP binding prot
. . . . Bordetella pertussis Tohama I ............................................  113  2 hits [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pe
. . . . Bordetella bronchiseptica RB50 ...........................................  113  2 hits [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pe
. . . . Bordetella parapertussis 12822 ...........................................  113  1 hit  [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pa
. . . . Bordetella parapertussis .................................................  113  1 hit  [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pa
. . . . Bordetella petrii DSM 12804 ..............................................  112  1 hit  [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pe
. . . . Bordetella petrii ........................................................  112  1 hit  [b-proteobacteria]    putative ABC-transporter ATP-binding protein [Bordetella pe
. . . . Bordetella avium 197N ....................................................  112  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter,ATP-binding prote
. . . . Burkholderia phymatum STM815 .............................................  110  4 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  110  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Hahella chejuensis KCTC 2396 .............................................  110  2 hits [g-proteobacteria]    ABC-type proline/glycine betaine transport system, ATPase c
. . . . Vibrio sp. MED222 ........................................................  110  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Vibrio splendidus LGP32 ..................................................  110  2 hits [g-proteobacteria]    ABC transporter: ATP binding protein [Vibrio splendidus LGP
. . . . Vibrionales bacterium SWAT-3 .............................................  110  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Vibrio splendidus 12B01 ..................................................  110  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Vibrio orientalis CIP 102891 .............................................  109  2 hits [g-proteobacteria]    L-proline Glycine Betaine ABC transport ATP-binding protein
. . . . Desulfohalobium retbaense DSM 5692 .......................................  108  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio parahaemolyticus 16 ...............................................  108  2 hits [g-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Vibrio
. . . . Desulfotalea psychrophila LSv54 ..........................................  108  2 hits [d-proteobacteria]    glycine betaine/L-proline transport ATP-binding protein (Pr
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................  108  2 hits [d-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [De
. . . . Dickeya dadantii Ech703 ..................................................  108  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfatibacillum alkenivorans AK-01 .....................................  108  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella halifaxensis HAW-EB4 ..........................................  108  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Burkholderia glumae BGR1 .................................................  107  2 hits [b-proteobacteria]    Glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . . Desulfovibrio aespoeensis Aspo-2 .........................................  107  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio metschnikovii CIP 69.14 ...........................................  107  2 hits [g-proteobacteria]    L-proline Glycine Betaine ABC transport ATP-binding protein
. . . . Vibrio sp. Ex25 ..........................................................  107  4 hits [g-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit sub
. . . . Vibrio harveyi 1DA3 ......................................................  107  2 hits [g-proteobacteria]    conserved hypothetical protein [Vibrio harveyi 1DA3] >gi|26
. . . . Escherichia coli O157:H7 EDL933 ..........................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. Sakai ......................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4113 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4401 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4501 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4486 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4196 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4076 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC869 ......................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC508 ......................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4024 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4206 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4045 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4042 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. EC4115 .....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. TW14588 ....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. TW14359 ....................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................  107  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................  107  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli .........................................................  107  6 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Shewanella baltica OS195 .................................................  107  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio harveyi ATCC BAA-1116 .............................................  107  2 hits [g-proteobacteria]    glycine betaine ABC transporter ATP-binding protein [Vibrio
. . . . Vibrio harveyi HY01 ......................................................  107  2 hits [g-proteobacteria]    BusAA [Vibrio harveyi HY01] >gi|148871554|gb|EDL70409.1| Bu
. . . . Escherichia albertii TW07627 .............................................  107  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Shewanella baltica OS185 .................................................  107  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella baltica OS223 .................................................  107  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella frigidimarina NCIMB 400 .......................................  107  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella baltica OS155 .................................................  107  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shigella flexneri 5 str. 8401 ............................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Shigella f
. . . . Enterobacter sp. 638 .....................................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Enterobact
. . . . Cronobacter turicensis ...................................................  107  1 hit  [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Cronobacter turicensis z3032 .............................................  107  1 hit  [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  107  2 hits [enterobacteria]      hypothetical protein ESA_00589 [Enterobacter sakazakii ATCC
. . . . Escherichia coli 53638 ...................................................  107  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Escherichia fergusonii ATCC 35469 ........................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli HS ......................................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Enterobacter cancerogenus ATCC 35316 .....................................  107  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Enterobact
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis .................  107  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Choleraes
. . . . Shigella dysenteriae Sd197 ...............................................  107  2 hits [enterobacteria]      ATP-binding component of transport system for glycine, beta
. . . . Escherichia coli IAI39 ...................................................  107  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Klebsiella pneumoniae 342 ................................................  107  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . Klebsiella variicola At-22 ...............................................  107  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . Escherichia coli E110019 .................................................  107  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  107  2 hits [enterobacteria]      ATP-binding component of transport system for glycine, beta
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................  107  2 hits [enterobacteria]      ATP-binding component of transport system for glycine, beta
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  107  2 hits [enterobacteria]      ATP-binding component of transport system for glycine, beta
. . . . Escherichia coli str. K-12 substr. MG1655 ................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Shigella boydii Sb227 ....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli str. K-12 substr. W3110 .................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli E24377A .................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli ATCC 8739 ...............................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Shigella boydii CDC 3083-94 ..............................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli E22 .....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli B171 ....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli 101-1 ...................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli SE11 ....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli IAI1 ....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli ED1a ....................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli 55989 ...................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli BW2952 ..................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli BL21(DE3) ...............................................  107  4 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia sp. 1_1_43 ...................................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli B str. REL606 ...........................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Shigella sp. D9 ..........................................................  107  1 hit  [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia sp. 4_1_40B ..................................................  107  1 hit  [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli O103:H2 str. 12009 ......................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli O26:H11 str. 11368 ......................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli O111:H- str. 11128 ......................................  107  2 hits [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli K-12 ....................................................  107  1 hit  [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Escherichia coli DH1 .....................................................  107  1 hit  [enterobacteria]      glycine betaine transporter subunit [Escherichia coli str. 
. . . . Salmonella enterica subsp. enterica serovar Infantis .....................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C ..................  106  2 hits [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Senftenberg ..................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  106  4 hits [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B ..................  106  2 hits [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Derby ........................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund ...............  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Montevideo ...................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Newport ......................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Infantis]
. . . . Salmonella enterica subsp. enterica serovar Panama .......................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Panama]
. . . . Shigella dysenteriae 1012 ................................................  106  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Shigella sonnei Ss046 ....................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Shigella s
. . . . Shigella flexneri 2a str. 2457T ..........................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Shigella f
. . . . Shigella flexneri 2a str. 301 ............................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Shigella f
. . . . Escherichia coli B7A .....................................................  106  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Escherichia coli CFT073 ..................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli UTI89 ...................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli 536 .....................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli APEC O1 .................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli F11 .....................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli S88 .....................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli UMN026 ..................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Escherichia coli 83972 ...................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Escherichi
. . . . Shigella flexneri 2002017 ................................................  106  1 hit  [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein [Sh
. . . . Citrobacter sp. 30_2 .....................................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Citrobacte
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  106  1 hit  [enterobacteria]      ProV [Salmonella enterica subsp. enterica serovar Paratyphi
. . . . Escherichia coli SMS-3-5 .................................................  106  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Escherichia coli SE15 ....................................................  106  1 hit  [enterobacteria]      glycine/betaine/proline ABC transporter ATP-binding compone
. . . . Vibrio sp. AND4 ..........................................................  106  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Citrobacter koseri ATCC BAA-895 ..........................................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Citrobacte
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  106  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP binding prot
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  106  2 hits [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  106  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  106  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  106  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Vibrio alginolyticus 40B .................................................  106  2 hits [g-proteobacteria]    conserved hypothetical protein [Vibrio alginolyticus 40B] >
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........  106  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Pantoea sp. At-9b ........................................................  106  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio alginolyticus 12G01 ...............................................  106  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ...............................  106  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio coralliilyticus ATCC BAA-450 ......................................  106  2 hits [g-proteobacteria]    L-proline Glycine Betaine ABC transport ATP-binding protein
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  106  1 hit  [enterobacteria]      glycine betaine transporter ATP-binding subunit [Salmonella
. . . . Acidovorax citrulli AAC00-1 ..............................................  106  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Erwinia tasmaniensis Et1/99 ..............................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein Pro
. . . . Erwinia pyrifoliae Ep1/96 ................................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein Pro
. . . . Yersinia pestis FV-1 .....................................................  105  1 hit  [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  105  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Yersinia pseudotuberculosis IP 32953 .....................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis Antiqua ..................................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis Nepal516 .................................................  105  4 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis Pestoides F ..............................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis CA88-4125 ................................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pseudotuberculosis IP 31758 .....................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Orientalis str. IP275 .............................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Antiqua str. E1979001 .............................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Antiqua str. B42003004 ............................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pseudotuberculosis YPIII ........................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pseudotuberculosis PB1/+ ........................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis CO92 .....................................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis Pestoides A ..............................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis biovar Orientalis str. India 195 .........................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis KIM D27 ..................................................  105  2 hits [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis D106004 ..................................................  105  1 hit  [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis D182038 ..................................................  105  1 hit  [enterobacteria]      ABC glycine/betaine/L-proline transporter, ATP-binding subu
. . . . Yersinia pestis Angola ...................................................  105  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Bermanella marisrubri ....................................................  105  4 hits [g-proteobacteria]    ABC-type proline/glycine betaine transport system, ATPase c
. . . . Yersinia pestis KIM 10 ...................................................  105  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Yersinia pestis biovar Microtus str. 91001 ...............................  105  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Moritella sp. PE36 .......................................................  105  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Yersinia intermedia ATCC 29909 ...........................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Yersinia ruckeri ATCC 29473 ..............................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Yersinia frederiksenii ATCC 33641 ........................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Yersinia kristensenii ATCC 33638 .........................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Yersinia aldovae ATCC 35236 ..............................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Yersinia rohdei ATCC 43380 ...............................................  105  2 hits [enterobacteria]      Glycine betaine/L-proline transport ATP-binding protein pro
. . . . Variovorax paradoxus S110 ................................................  105  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella sediminis HAW-EB3 .............................................  104  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Burkholderia vietnamiensis G4 ............................................  104  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........  104  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Ralstonia solanacearum GMI1000 ...........................................  104  2 hits [b-proteobacteria]    putative glycine betaine/L-proline ATP-binding ABC transpor
. . . . Burkholderia cenocepacia AU 1054 .........................................  104  2 hits [b-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [Bu
. . . . Burkholderia cenocepacia HI2424 ..........................................  104  2 hits [b-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [Bu
. . . . Burkholderia cenocepacia MC0-3 ...........................................  104  2 hits [b-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [Bu
. . . . Desulfuromonas acetoxidans DSM 684 .......................................  104  2 hits [d-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [De
. . . . Citrobacter rodentium ICC168 .............................................  104  1 hit  [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . Burkholderia ubonensis Bu ................................................  104  1 hit  [b-proteobacteria]    ABC glycine betaine/L-proline transporter, ATPase subunit [
. . . . Chromohalobacter salexigens DSM 3043 .....................................  104  2 hits [g-proteobacteria]    glycine betaine/L-proline transport ATP binding subunit [Ch
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  104  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Yersinia enterocolitica ..................................................  104  1 hit  [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Ye
. . . . Reinekea blandensis MED297 ...............................................  104  4 hits [g-proteobacteria]    ABC-type proline/glycine betaine transport system, ATPase c
. . . . Burkholderia cenocepacia PC184 ...........................................  104  2 hits [b-proteobacteria]    Glycine betaine/L-proline transport ATP-binding subunit [Bu
. . . . Dickeya zeae Ech1591 .....................................................  104  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  104  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein pro
. . . . Halorhodospira halophila SL1 .............................................  104  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Marinomonas sp. MED121 ...................................................  103  4 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Escherichia sp. 3_2_53FAA ................................................  103  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein pro
. . . . Shewanella woodyi ATCC 51908 .............................................  103  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Dickeya dadantii Ech586 ..................................................  103  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Desulfococcus oleovorans Hxd3 ............................................  103  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Delftia acidovorans SPH-1 ................................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Burkholderia sp. 383 .....................................................  103  2 hits [b-proteobacteria]    ABC glycine betaine/L-proline transporter, ATPase subunit [
. . . . Burkholderia ambifaria MEX-5 .............................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Shewanella pealeana ATCC 700345 ..........................................  103  2 hits [g-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Burkholderia sp. CCGE1001 ................................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Photobacterium profundum 3TCK ............................................  103  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Burkholderia multivorans CGD2M ...........................................  103  4 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . . Burkholderia multivorans CGD2 ............................................  103  4 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . . Burkholderia multivorans CGD1 ............................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . . Burkholderia multivorans ATCC 17616 ......................................  103  4 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Burkholderia graminis C4D1M ..............................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  103  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  103  1 hit  [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Pe
. . . . Burkholderia ambifaria AMMD ..............................................  103  4 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Serratia odorifera 4Rx13 .................................................  103  2 hits [enterobacteria]      transporter [Serratia odorifera 4Rx13] >gi|270040767|gb|EFA
. . . . Neptuniibacter caesariensis ..............................................  103  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Providencia stuartii ATCC 25827 ..........................................  103  2 hits [enterobacteria]      hypothetical protein PROSTU_01457 [Providencia stuartii ATC
. . . . Photobacterium profundum SS9 .............................................  103  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Burkholderia sp. H160 ....................................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Serratia proteamaculans 568 ..............................................  103  4 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Pectobacterium atrosepticum SCRI1043 .....................................  103  2 hits [enterobacteria]      glycine betaine/L-proline transport ATP-binding protein [Pe
. . . . Pectobacterium wasabiae WPP163 ...........................................  103  2 hits [enterobacteria]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................  103  2 hits [g-proteobacteria]    L-proline Glycine Betaine ABC transport ATP-binding protein
. . . . Vibrio fischeri MJ11 .....................................................  103  2 hits [g-proteobacteria]    glycine betaine transport ATP-binding protein opuAA [Vibrio
. . . . Providencia rettgeri DSM 1131 ............................................  103  1 hit  [enterobacteria]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . . Burkholderia ambifaria MC40-6 ............................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Vibrio fischeri ES114 ....................................................  103  2 hits [g-proteobacteria]    glycine betaine transporter subunit [Vibrio fischeri ES114]
. . . . Burkholderia ambifaria IOP40-10 ..........................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Burkholderia xenovorans LB400 ............................................  103  2 hits [b-proteobacteria]    ABC proline/glycine betaine transporter, ATPase subunit [Bu
. . . . Burkholderia phytofirmans PsJN ...........................................  103  2 hits [b-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Photobacterium sp. SKA34 .................................................  103  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Burkholderia cenocepacia J2315 ...........................................  102  2 hits [b-proteobacteria]    putative glycine betaine/L-proline ABC transporter ATP-bind
. . . . Photobacterium angustum S14 ..............................................  102  2 hits [g-proteobacteria]    putative glycine betaine ABC transporter ATP-binding protei
. . . . Ralstonia eutropha JMP134 ................................................  102  2 hits [b-proteobacteria]    glycine betaine/L-proline transport ATP-binding subunit [Ra
. . . . Burkholderia sp. CCGE1002 ................................................  102  2 hits [b-proteobacteria]    ABC proline/glycine betaine transporter, ATPase subunit [Bu
. . . . Haliangium ochraceum DSM 14365 ...........................................  102  2 hits [d-proteobacteria]    glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . . Mannheimia succiniciproducens MBEL55E ....................................  102  2 hits [g-proteobacteria]    ProV protein [Mannheimia succiniciproducens MBEL55E] >gi|52
. . . . Erwinia chrysanthemi .....................................................  102  1 hit  [enterobacteria]      osmoprotectant transport protein OusBV [Erwinia chrysanthem
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................  102  2 hits [g-proteobacteria]    glycine betaine/L-proline transport system, ATPase componen
. . . Oceanobacillus iheyensis HTE831 --------------------------------------------  125  6 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Oceano
. . . Streptomyces sp. ACT-1 .....................................................  124  4 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Enterococcus gallinarum EG2 ................................................  124  2 hits [firmicutes]          glycine betaine/L-proline transporter ATP-binding subunit [
. . . Streptomyces griseus subsp. griseus NBRC 13350 .............................  124  4 hits [high GC Gram+]       putative glycine betaine ABC transporter ATP-binding protei
. . . Bacillus sp. SG-1 ..........................................................  124  2 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Streptomyces roseosporus NRRL 15998 ........................................  124  2 hits [high GC Gram+]       putative glycine betaine ABC transporter ATP-binding protei
. . . Streptomyces roseosporus NRRL 11379 ........................................  124  2 hits [high GC Gram+]       putative glycine betaine ABC transporter ATP-binding protei
. . . Streptomyces sp. C .........................................................  123  2 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Enterococcus casseliflavus EC20 ............................................  123  2 hits [firmicutes]          glycine betaine/L-proline transporter ATP-binding subunit [
. . . Enterococcus casseliflavus EC30 ............................................  123  2 hits [firmicutes]          glycine betaine/L-proline transporter ATP-binding subunit [
. . . Enterococcus casseliflavus EC10 ............................................  123  2 hits [firmicutes]          glycine betaine/L-proline transporter ATP-binding subunit [
. . . Brevibacillus brevis NBRC 100599 ...........................................  123  4 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Brevib
. . . Enterococcus faecium Com15 .................................................  122  2 hits [firmicutes]          glycine betaine/L-proline transporter ATP-binding subunit [
. . . Enterococcus faecium TX1330 ................................................  122  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Enterococcus faecium 
. . . Enterococcus faecium 1,141,733 .............................................  122  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Enterococcus faecium 
. . . Enterococcus faecium Com12 .................................................  122  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Enterococcus faecium 
. . . Enterococcus faecium DO ....................................................  122  3 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium 1,230,933 .............................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium 1,231,502 .............................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium 1,231,501 .............................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium 1,231,410 .............................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium 1,231,408 .............................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium C68 ...................................................  122  2 hits [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium .......................................................  122  1 hit  [firmicutes]          Glycine betaine/L-proline transport ATP-binding subunit [En
. . . Enterococcus faecium TC 6 ..................................................  122  2 hits [firmicutes]          glycine betaine/L-proline transport ATP-binding subunit [En
. . . Paenibacillus sp. oral taxon 786 str. D14 ..................................  122  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter [Paenibacillus sp
. . . Enterococcus faecalis HH22 .................................................  121  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Enterococcus faecalis
. . . Parabacteroides johnsonii DSM 18315 ........................................  121  2 hits [CFB group bacteria]  hypothetical protein PRABACTJOHN_01923 [Parabacteroides joh
. . . Enterococcus faecalis TX1322 ...............................................  121  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Enterococcus faecalis
. . . Enterococcus faecalis V583 .................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis TX0104 ...............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis ATCC 29200 ...........................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis T1 ...................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis T2 ...................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis ATCC 4200 ............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis T3 ...................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis T8 ...................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis DS5 ..................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis Merz96 ...............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis HIP11704 .............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis JH1 ..................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis E1Sol ................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis Fly1 .................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis D6 ...................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis CH188 ................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis AR01/DG ..............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis T11 ..................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis X98 ..................................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Enterococcus faecalis TUSoD Ef11 ...........................................  121  2 hits [firmicutes]          glycine betaine transport ATP-binding protein opuAA [Entero
. . . Alkaliphilus oremlandii OhILAs .............................................  121  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptomyces flavogriseus ATCC 33331 .......................................  120  4 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Lysinibacillus sphaericus C3-41 ............................................  120  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Lysinibacill
. . . Bacillus sp. B14905 ........................................................  120  4 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding subu
. . . Geobacillus sp. Y412MC10 ...................................................  120  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Parabacteroides merdae ATCC 43184 ..........................................  120  2 hits [CFB group bacteria]  hypothetical protein PARMER_00891 [Parabacteroides merdae A
. . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ..................  120  2 hits [firmicutes]          hypothetical protein STRINF_00707 [Streptococcus infantariu
. . . Dethiobacter alkaliphilus AHT 1 ............................................  120  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptomyces avermitilis MA-4680 ...........................................  119  4 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Streptomyces hygroscopicus ATCC 53653 ......................................  119  2 hits [high GC Gram+]       putative glycine betaine ABC transporter ATP-binding protei
. . . Paenibacillus larvae subsp. larvae BRL-230010 ..............................  119  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptococcus mutans NN2025 ................................................  119  1 hit  [firmicutes]          putative ABC transporter ATP-binding protein [Streptococcus
. . . Streptococcus mutans UA159 .................................................  119  2 hits [firmicutes]          putative ABC transporter, ATP-binding protein, proline/glyc
. . . Streptococcus sp. 2_1_36FAA ................................................  119  2 hits [firmicutes]          amino acid ABC transporter [Streptococcus sp. 2_1_36FAA] >g
. . . Streptococcus sanguinis SK36 ...............................................  119  2 hits [firmicutes]          glycine-betaine ABC transporter, ATPase component, putative
. . . Lactococcus lactis subsp. lactis KF147 .....................................  119  2 hits [firmicutes]          Glycine betaine/carnitine/choline ABC transporter, ATP-bind
. . . Streptococcus pyogenes MGAS10394 ...........................................  119  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Streptococcu
. . . Propionibacterium acnes J139 ...............................................  119  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Pr
. . . Lactococcus lactis subsp. lactis Il1403 ....................................  119  2 hits [firmicutes]          betaine ABC transporter ATP binding protein [Lactococcus la
. . . Lactococcus lactis subsp. lactis ...........................................  119  1 hit  [firmicutes]          betaine ABC transporter ATP binding protein [Lactococcus la
. . . Lactococcus lactis .........................................................  119  2 hits [firmicutes]          betaine ABC transporter ATP binding protein [Lactococcus la
. . . Propionibacterium acnes KPA171202 ..........................................  119  2 hits [high GC Gram+]       putative glycine betaine/proline ABC transporter [Propionib
. . . Propionibacterium acnes SK137 ..............................................  119  2 hits [high GC Gram+]       putative glycine betaine/proline ABC transporter [Propionib
. . . Streptomyces sp. ACTE ......................................................  119  4 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Lactococcus lactis subsp. cremoris SK11 ....................................  119  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Lactococcus lactis subsp. cremoris MG1363 ..................................  119  3 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Streptomyces albus J1074 ...................................................  119  2 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Weissella paramesenteroides ATCC 33313 .....................................  119  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, ABC prote
. . . Streptococcus pyogenes MGAS2096 ............................................  119  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Streptococcu
. . . Streptococcus pyogenes NZ131 ...............................................  118  2 hits [firmicutes]          L-proline Glycine Betaine ABC transport ATP- binding protei
. . . Halobacillus trueperi ......................................................  118  1 hit  [firmicutes]          OpuAA [Halobacillus trueperi]
. . . Bacillus licheniformis ATCC 14580 ..........................................  118  4 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Streptococcus pyogenes M1 GAS ..............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS8232 ............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS315 .............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes SSI-1 ...............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS6180 ............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS5005 ............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS9429 ............................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes MGAS10270 ...........................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptococcus pyogenes str. Manfredo .......................................  118  2 hits [firmicutes]          putative glycine betaine/proline ABC transporter ATP-bindin
. . . Streptomyces lividans TK24 .................................................  118  2 hits [high GC Gram+]       glycine betaine ABC transport system ATP-binding protein [S
. . . Streptococcus pyogenes MGAS10750 ...........................................  118  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein [Streptococcu
. . . Bacillus sp. NRRL B-14911 ..................................................  118  2 hits [firmicutes]          OpuAA [Bacillus sp. NRRL B-14911] >gi|89088780|gb|EAR67889.
. . . Streptococcus pyogenes M49 591 .............................................  118  1 hit  [firmicutes]          COG4175: ABC-type proline/glycine betaine transport system,
. . . Corynebacterium aurimucosum ATCC 700975 ....................................  118  3 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Coryne
. . . Streptomyces viridochromogenes DSM 40736 ...................................  118  3 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Halothermothrix orenii H 168 ...............................................  118  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Psychroflexus torquis ATCC 700755 ..........................................  118  1 hit  [CFB group bacteria]  ABC transporter ATP-binding protein [Psychroflexus torquis 
. . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ......................  118  2 hits [firmicutes]          putative glycine betaine transport ATP-binding protein [Str
. . . Lactobacillus casei ATCC 334 ...............................................  118  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Lactobacillus casei BL23 ...................................................  118  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Lactobacillus paracasei subsp. paracasei ATCC 25302 ........................  118  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Lactobacillus paracasei subsp. paracasei 8700:2 ............................  118  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Natranaerobius thermophilus JW/NM-WN-LF ....................................  118  4 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Desulfotomaculum reducens MI-1 .............................................  117  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Listeria grayi DSM 20601 ...................................................  117  4 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, ABC prote
. . . Streptococcus agalactiae 2603V/R ...........................................  117  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Streptococ
. . . Streptococcus agalactiae 18RS21 ............................................  117  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Streptococ
. . . Streptococcus agalactiae A909 ..............................................  117  2 hits [firmicutes]          glycine betaine/proline ABC transporter, ATP-binding protei
. . . Streptococcus agalactiae H36B ..............................................  117  2 hits [firmicutes]          glycine betaine/proline ABC transporter, ATP-binding protei
. . . Streptococcus agalactiae COH1 ..............................................  117  2 hits [firmicutes]          glycine betaine/proline ABC transporter, ATP-binding protei
. . . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ...................  117  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Bacteroides sp. 2_1_33B ....................................................  117  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 2_1_7 ......................................................  117  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Parabacteroides sp. D13 ....................................................  117  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Leuconostoc mesenteroides subsp. cremoris ATCC 19254 .......................  117  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Leuconostoc mesentero
. . . Streptomyces griseoflavus Tu4000 ...........................................  117  2 hits [high GC Gram+]       glycine betaine transport ATP-binding protein [Streptomyces
. . . Streptococcus agalactiae NEM316 ............................................  117  2 hits [firmicutes]          hypothetical protein gbs1839 [Streptococcus agalactiae NEM3
. . . Parabacteroides distasonis ATCC 8503 .......................................  117  4 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Parabacteroi
. . . Alkaliphilus metalliredigens QYMF ..........................................  117  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptococcus agalactiae CJB111 ............................................  117  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Streptococ
. . . Streptomyces ghanaensis ATCC 14672 .........................................  117  2 hits [high GC Gram+]       glycine betaine transport ATP-binding protein [Streptomyces
. . . Lactobacillus rhamnosus HN001 ..............................................  117  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Lactobacillus rhamnosus GG .................................................  117  3 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase component
. . . Streptomyces coelicolor A3(2) ..............................................  117  4 hits [high GC Gram+]       glycine betaine ABC transport system ATP-binding protein [S
. . . Lactobacillus brevis subsp. gravesensis ATCC 27305 .........................  117  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Lactobacillus brevis 
. . . Carnobacterium sp. AT7 .....................................................  117  2 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Carnob
. . . Lactobacillus rhamnosus LMS2-1 .............................................  116  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Lactobacillus rhamnos
. . . Lactobacillus rhamnosus Lc 705 .............................................  116  2 hits [firmicutes]          quaternary-amine-transporting ATPase [Lactobacillus rhamnos
. . . Lactobacillus buchneri ATCC 11577 ..........................................  116  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, ABC prote
. . . Desulfotomaculum acetoxidans DSM 771 .......................................  116  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Lactobacillus hilgardii ATCC 8290 ..........................................  116  2 hits [firmicutes]          ABC superfamily ATP binding cassette transporter, ABC prote
. . . Saccharomonospora viridis DSM 43017 ........................................  116  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Sa
. . . Bacillus subtilis ..........................................................  115  3 hits [firmicutes]          glycine betain/L-proline transport ATPase [Bacillus subtili
. . . Bacillus subtilis subsp. subtilis str. 168 .................................  115  3 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ...........................  115  1 hit  [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Bacillus subtilis subsp. subtilis str. JH642 ...............................  115  1 hit  [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Bacillus subtilis subsp. subtilis str. SMY .................................  115  1 hit  [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Bacillus selenitireducens MLS10 ............................................  115  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system ATPase co
. . . Bacteroides thetaiotaomicron VPI-5482 ......................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 1_1_6 ......................................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Streptosporangium roseum DSM 43021 .........................................  115  2 hits [high GC Gram+]       glycine betaine/proline ABC transporter, ATP- binding prote
. . . Bacillus pumilus SAFR-032 ..................................................  115  2 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Streptomyces sp. Mg1 .......................................................  115  4 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Clostridium tetani E88 .....................................................  115  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Clostridium 
. . . Bacteroides sp. 4_3_47FAA ..................................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacillus pumilus ATCC 7061 .................................................  115  2 hits [firmicutes]          glycine betaine transport ATP-binding protein opuAA (Quater
. . . Bacteroides vulgatus ATCC 8482 .............................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Lactobacillus sakei subsp. sakei 23K .......................................  115  2 hits [firmicutes]          putative glycine/betaine/carnitine ABC transporter, ATP-bin
. . . Bacteroides sp. 9_1_42FAA ..................................................  115  4 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides dorei 5_1_36/D4 ................................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 3_1_33FAA ..................................................  115  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides dorei DSM 17855 ................................................  115  2 hits [CFB group bacteria]  hypothetical protein BACDOR_02727 [Bacteroides dorei DSM 17
. . . Streptomyces pristinaespiralis ATCC 25486 ..................................  115  4 hits [high GC Gram+]       glycine betaine ABC transport ATP-binding protein [Streptom
. . . Listeria innocua Clip11262 .................................................  114  1 hit  [firmicutes]          hypothetical protein lin1013 [Listeria innocua Clip11262] >
. . . Listeria innocua ...........................................................  114  1 hit  [firmicutes]          hypothetical protein lin1013 [Listeria innocua Clip11262] >
. . . Streptococcus agalactiae 515 ...............................................  114  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Streptococ
. . . Listeria monocytogenes EGD-e ...............................................  114  2 hits [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes str. 1/2a F6854 .....................................  114  2 hits [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes HCC23 ...............................................  114  2 hits [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes Finland 1988 ........................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL R2-561 ..........................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL N3-165 ..........................................  114  2 hits [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes 10403S ..............................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL N1-017 ..........................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes J0161 ...............................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes J2818 ...............................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes F6900 ...............................................  114  2 hits [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes .....................................................  114  1 hit  [firmicutes]          hypothetical protein lmo1014 [Listeria monocytogenes EGD-e]
. . . Bacteroides fragilis 3_1_12 ................................................  114  1 hit  [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Listeria monocytogenes str. 4b F2365 .......................................  114  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes Clip80459 ...........................................  114  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes FSL J1-194 ..........................................  114  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes FSL R2-503 ..........................................  114  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes FSL J2-071 ..........................................  114  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes HPB2262 .............................................  114  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes FSL J2-064 ..........................................  114  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria monocytogenes FSL J1-175 ..........................................  114  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...............................  114  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP- binding pro
. . . Listeria monocytogenes str. 4b H7858 .......................................  114  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacteroides fragilis NCTC 9343 .............................................  114  2 hits [CFB group bacteria]  putative glycine betaine transport ATP-binding protein [Bac
. . . Bacteroides fragilis YCH46 .................................................  114  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 3_2_5 ......................................................  114  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 2_1_16 .....................................................  114  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Trichodesmium erythraeum IMS101 ............................................  114  2 hits [cyanobacteria]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptomyces sviceus ATCC 29083 ............................................  114  6 hits [high GC Gram+]       glycine betaine ABC transporter ATP-binding protein [Strept
. . . Bacillus amyloliquefaciens FZB42 ...........................................  113  2 hits [firmicutes]          OpuAA [Bacillus amyloliquefaciens FZB42] >gi|154350642|gb|A
. . . Streptococcus uberis 0140J .................................................  113  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Streptococcu
. . . Clostridium kluyveri NBRC 12016 ............................................  113  2 hits [firmicutes]          hypothetical protein CKR_0695 [Clostridium kluyveri NBRC 12
. . . Streptococcus equi subsp. zooepidemicus MGCS10565 ..........................  113  2 hits [firmicutes]          glycine betaine transport ATP-binding protein OpuAA [Strept
. . . Streptococcus equi subsp. equi 4047 ........................................  113  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Streptococcu
. . . Clostridium kluyveri DSM 555 ...............................................  113  2 hits [firmicutes]          ProV [Clostridium kluyveri DSM 555] >gi|146346294|gb|EDK328
. . . Streptomyces sp. SPB74 .....................................................  113  2 hits [high GC Gram+]       glycine betaine ABC transport ATP-binding protein [Streptom
. . . Bacteroides finegoldii DSM 17565 ...........................................  113  2 hits [CFB group bacteria]  glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacteroides sp. 2_2_4 ......................................................  113  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Listeria monocytogenes LO28 ................................................  113  1 hit  [firmicutes]          glycine betaine transport ATP-binding protein opuAA (Quater
. . . Bacteroides sp. D1 .........................................................  112  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides sp. 2_1_22 .....................................................  112  2 hits [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Bacteroides ovatus ATCC 8483 ...............................................  112  2 hits [CFB group bacteria]  hypothetical protein BACOVA_04493 [Bacteroides ovatus ATCC 
. . . Streptococcus equi subsp. zooepidemicus ....................................  112  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Streptococcu
. . . Bacteroides sp. D2 .........................................................  112  1 hit  [CFB group bacteria]  glycine betaine transport ATP-binding protein [Bacteroides 
. . . Paenibacillus sp. JDR-2 ....................................................  112  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptomyces sp. SPB78 .....................................................  112  1 hit  [high GC Gram+]       putative glycine betaine ABC transporter ATP-binding protei
. . . Bacteroides caccae ATCC 43185 ..............................................  112  2 hits [CFB group bacteria]  hypothetical protein BACCAC_02738 [Bacteroides caccae ATCC 
. . . Streptomyces clavuligerus ATCC 27064 .......................................  112  2 hits [high GC Gram+]       glycine betaine transport ATP-binding protein [Streptomyces
. . . marine actinobacterium PHSC20C1 ............................................  112  2 hits [high GC Gram+]       putative glycine betaine/proline ABC transporter [marine ac
. . . Bacillus clausii KSM-K16 ...................................................  111  2 hits [firmicutes]          glycine betaine ABC transporter ATP-binding protein [Bacill
. . . Bacillus cytotoxicus NVH 391-98 ............................................  111  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ......................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein [Bacillus thu
. . . Bacillus cereus G9842 ......................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein [Bacillus thu
. . . Bacillus thuringiensis IBL 4222 ............................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein [Bacillus thu
. . . Bacillus thuringiensis IBL 200 .............................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein [Bacillus thu
. . . Bacillus cereus Rock3-44 ...................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus MM3 ........................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus thuringiensis serovar berliner ATCC 10792 .........................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 ...................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus thuringiensis Bt407 ...............................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus mycoides DSM 2048 .................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus AH1273 .....................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus AH1272 .....................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus AH603 ......................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus weihenstephanensis KBAB4 ..........................................  111  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Bacillus cereus BDRD-ST196 .................................................  111  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Bacillus cereus AH621 ......................................................  111  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Bacillus cereus ATCC 14579 .................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus AH1134 .....................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus B4264 ......................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 .......................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus AH676 ......................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus Rock4-2 ....................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus Rock1-15 ...................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus BDRD-Cer4 ..................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus BDRD-ST24 ..................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus m1550 ......................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus 172560W ....................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus cereus ATCC 10876 .................................................  111  2 hits [firmicutes]          glycine betaine transport ATP-binding protein [Bacillus cer
. . . Bacillus thuringiensis serovar pakistani str. T13001 .......................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus Rock3-29 ...................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus Rock3-28 ...................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus pseudomycoides DSM 12442 ..........................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus mycoides Rock1-4 ..................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus mycoides Rock3-17 .................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Jonesia denitrificans DSM 20603 ............................................  111  2 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .....................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus Rock1-3 ....................................................  111  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Denitrovibrio acetiphilus DSM 12809 ........................................  111  2 hits [bacteria]            glycine betaine/L-proline transport ATP binding subunit [De
. . . Corynebacterium accolens ATCC 49725 ........................................  111  2 hits [high GC Gram+]       quaternary-amine-transporting ATPase [Corynebacterium accol
. . . Staphylococcus haemolyticus JCSC1435 .......................................  111  2 hits [firmicutes]          hypothetical protein SH2655 [Staphylococcus haemolyticus JC
. . . Bacillus cereus F65185 .....................................................  110  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Sanguibacter keddieii DSM 10542 ............................................  110  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Sa
. . . Bacillus anthracis str. A2012 ..............................................  110  1 hit  [firmicutes]          COG4175: ABC-type proline/glycine betaine transport system,
. . . Bacillus cereus R309803 ....................................................  110  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus thuringiensis str. Al Hakam .......................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus BGSC 6E1 ...................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Rubrobacter xylanophilus DSM 9941 ..........................................  110  4 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Ru
. . . Stackebrandtia nassauensis DSM 44728 .......................................  110  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [St
. . . Leuconostoc citreum KM20 ...................................................  110  2 hits [firmicutes]          ABC-type proline/glycine betaine transport system, ATPase c
. . . Bacillus cereus ATCC 10987 .................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus H3081.97 ...................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus AH187 ......................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus Q1 .........................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus BDRD-ST26 ..................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Ames ...............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. 'Ames Ancestor' ....................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Sterne .............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ........................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus E33L .......................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0488 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0442 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0193 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0465 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0389 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0174 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis Tsiankovskii-I ..........................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus W ..........................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus NVH0597-99 .................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus 03BB108 ....................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus AH820 ......................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus 03BB102 ....................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. CDC 684 ............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ........................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ...................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ....................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus Rock3-42 ...................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus 95/8201 ....................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus ATCC 4342 ..................................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A0248 ..............................................  110  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. CNEVA-9066 .........................................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. A1055 ..............................................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Western North America USA6153 ......................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Kruger B ...........................................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Vollum .............................................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus anthracis str. Australia 94 .......................................  110  1 hit  [firmicutes]          glycine betaine/L-proline ABC transporter, ATP-binding prot
. . . Bacillus cereus m1293 ......................................................  110  2 hits [firmicutes]          Glycine betaine transport ATP-binding protein opuAA [Bacill
. . . Bacillus cereus G9241 ......................................................  110  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Bacillus c
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 .......................  110  2 hits [firmicutes]          amino acid ABC transporter, ATP-binding protein [Bacillus c
. . . Salinibacter ruber DSM 13855 ...............................................  110  2 hits [CFB group bacteria]  glycine betaine/L-proline transport ATP binding protein [Sa
. . . Salinispora arenicola CNS-205 ..............................................  110  4 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Brevibacterium linens BL2 ..................................................  110  1 hit  [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Thermobifida fusca YX ......................................................  110  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP-binding subunit [Th
. . . Xylanimonas cellulosilytica DSM 15894 ......................................  109  2 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Victivallis vadensis ATCC BAA-548 ..........................................  108  2 hits [bacteria]            glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Beutenbergia cavernae DSM 12333 ............................................  108  2 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Streptomyces sp. AA4 .......................................................  108  1 hit  [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Pyramidobacter piscolens W5455 .............................................  107  2 hits [bacteria]            glycine betaine ABC transporter, ATP-binding protein OpuAA 
. . . Salinispora tropica CNB-440 ................................................  107  2 hits [high GC Gram+]       glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Chryseobacterium gleum ATCC 35910 ..........................................  107  2 hits [CFB group bacteria]  quaternary-amine-transporting ATPase [Chryseobacterium gleu
. . . Brachybacterium faecium DSM 4810 ...........................................  107  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Br
. . . Saccharopolyspora erythraea NRRL 2338 ......................................  106  4 hits [high GC Gram+]       putative glycine betaine/proline ABC transporter [Saccharop
. . . Desulfitobacterium hafniense DCB-2 .........................................  106  2 hits [firmicutes]          glycine betaine/L-proline ABC transporter, ATPase subunit [
. . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ....................  106  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [No
. . . Desulfitobacterium hafniense Y51 ...........................................  105  2 hits [firmicutes]          hypothetical protein DSY1221 [Desulfitobacterium hafniense 
. . . Anaerococcus hydrogenalis DSM 7454 .........................................  105  2 hits [firmicutes]          hypothetical protein ANHYDRO_00852 [Anaerococcus hydrogenal
. . . Meiothermus ruber DSM 1279 .................................................  105  2 hits [bacteria]            glycine betaine/L-proline transport ATP binding subunit [Me
. . . Corynebacterium genitalium ATCC 33030 ......................................  104  2 hits [high GC Gram+]       ABC superfamily ATP binding cassette transporter, ABC prote
. . . Geodermatophilus obscurus DSM 43160 ........................................  103  2 hits [high GC Gram+]       glycine betaine/L-proline transport ATP binding subunit [Ge
. . . Fusobacterium varium ATCC 27725 ............................................  102  2 hits [fusobacteria]        glycine betaine/L-proline ABC transporter [Fusobacterium va
. . . Fusobacterium ulcerans ATCC 49185 ..........................................  102  1 hit  [fusobacteria]        glycine betaine/L-proline ABC transporter, ATPase subunit [
. . Methanoculleus marisnigri JR1 ------------------------------------------------  120  2 hits [euryarchaeotes]      glycine betaine/L-proline ABC transporter, ATPase subunit [
. . Methanosarcina mazei Go1 .....................................................  120  3 hits [euryarchaeotes]      glycine betaine transporter, ATP-binding protein [Methanosa
. . Methanohalophilus portucalensis FDF-1 ........................................  117  1 hit  [euryarchaeotes]      ATP-binding protein [Methanohalophilus portucalensis FDF-1]
. . Methanocorpusculum labreanum Z ...............................................  115  2 hits [euryarchaeotes]      hypothetical protein Mlab_1060 [Methanocorpusculum labreanu
. . Methanosarcina barkeri str. Fusaro ...........................................  112  2 hits [euryarchaeotes]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . Methanosarcina acetivorans C2A ...............................................  111  2 hits [euryarchaeotes]      glycine betaine/L-proline ABC transporter, ATP-binding prot
. . Methanococcoides burtonii DSM 6242 ...........................................  108  2 hits [euryarchaeotes]      ABC glycine betaine/L-proline transporter, ATPase subunit [
. . Populus trichocarpa (black cottonwood) .......................................  104  1 hit  [eudicots]            predicted protein [Populus trichocarpa]
. uncultured marine microorganism HF4000_133I24 ----------------------------------  112  2 hits [unclassified]        putative ABC transporter [uncultured marine microorganism H
. uncultured marine microorganism HF4000_001B09 ..................................  112  1 hit  [unclassified]        putative ABC transporter [uncultured marine microorganism H
. uncultured marine microorganism HF4000_008G09 ..................................  108  1 hit  [unclassified]        putative ABC transporter [uncultured marine microorganism H
. uncultured marine microorganism HF4000_001L24 ..................................  108  1 hit  [unclassified]        putative ABC transporter [uncultured marine microorganism H
. uncultured marine microorganism HF4000_141F21 ..................................  107  1 hit  [unclassified]        putative ABC transporter [uncultured marine microorganism H
. uncultured marine microorganism HF4000_009A22 ..................................  106  1 hit  [unclassified]        putative ABC transporter [uncultured marine microorganism H

Organism Report

  Candidatus Pelagibacter sp. HTCC7211 [a-proteobacteria] taxid 439493
 ref|ZP_05069346.1| glycine betaine transport ATP-binding p...     248  1e-64
 gb|EDZ60345.1| glycine betaine transport ATP-binding prote...     248  1e-64
 ref|ZP_05069647.1| glycine betaine transporter, ATP-bindin...     111  3e-23
 gb|EDZ60646.1| glycine betaine transporter, ATP-binding pr...     111  3e-23
 ref|ZP_05070116.1| glycine betaine transporter, ATP-bindin...     110  3e-23
 gb|EDZ61115.1| glycine betaine transporter, ATP-binding pr...     110  3e-23

  Roseobacter sp. SK209-2-6 [a-proteobacteria] taxid 388739
 ref|ZP_01756350.1| ABC transporter ATP-binding protein [Ro...     133  6e-30
 gb|EBA14895.1| ABC transporter ATP-binding protein [Roseob...     133  6e-30
 ref|ZP_01755756.1| glycine betaine/proline ABC transporter...     114  5e-24
 gb|EBA15597.1| glycine betaine/proline ABC transporter, AT...     114  5e-24
 ref|ZP_01753241.1| glycine betaine/proline ABC transporter...     113  8e-24
 gb|EBA17608.1| glycine betaine/proline ABC transporter, AT...     113  8e-24
 ref|ZP_01754776.1| glycine betaine/L-proline transport ATP...     108  1e-22
 gb|EBA16407.1| glycine betaine/L-proline transport ATP-bin...     108  1e-22
 ref|ZP_01755978.1| glycine betaine/proline ABC transporter...     103  6e-21
 gb|EBA15457.1| glycine betaine/proline ABC transporter, AT...     103  6e-21

  Phaeobacter gallaeciensis BS107 [a-proteobacteria] taxid 391619
 ref|ZP_02145033.1| ABC transporter ATP-binding protein [Ph...     131  2e-29
 gb|EDQ13494.1| ABC transporter ATP-binding protein [Phaeob...     131  2e-29
 ref|ZP_02145275.1| glycine betaine/L-proline transport ATP...     110  6e-23
 gb|EDQ12828.1| glycine betaine/L-proline transport ATP-bin...     110  6e-23
 ref|ZP_02144981.1| glycine betaine/proline ABC transporter...     108  1e-22
 gb|EDQ13442.1| glycine betaine/proline ABC transporter, AT...     108  1e-22
 ref|ZP_02145270.1| D-cysteine desulfhydrase [Phaeobacter g...     102  1e-20
 gb|EDQ13731.1| D-cysteine desulfhydrase [Phaeobacter galla...     102  1e-20

  Phaeobacter gallaeciensis 2.10 [a-proteobacteria] taxid 383629
 ref|ZP_02148203.1| ABC transporter ATP-binding protein [Ph...     131  2e-29
 gb|EDQ10177.1| ABC transporter ATP-binding protein [Phaeob...     131  2e-29
 ref|ZP_02151024.1| glycine betaine/proline ABC transporter...     109  1e-22
 gb|EDQ07512.1| glycine betaine/proline ABC transporter, AT...     109  1e-22

  Mesorhizobium opportunistum WSM2075 [a-proteobacteria] taxid 536019
 ref|ZP_05808665.1| glycine betaine/L-proline ABC transport...     127  5e-28
 gb|EEW35317.1| glycine betaine/L-proline ABC transporter, ...     127  5e-28
 ref|ZP_05810766.1| glycine betaine/L-proline ABC transport...     103  6e-21
 gb|EEW33024.1| glycine betaine/L-proline ABC transporter, ...     103  6e-21

  Oceanobacillus iheyensis HTE831 [firmicutes] taxid 221109
 ref|NP_691920.1| glycine betaine ABC transporter ATP-bindi...     125  1e-27
 dbj|BAC12955.1| glycine betaine ABC transporter ATP-bindin...     125  1e-27
 ref|NP_693866.1| glycine betaine ABC transporter ATP-bindi...     118  2e-25
 dbj|BAC14900.1| glycine betaine ABC transporter ATP-bindin...     118  2e-25
 ref|NP_694378.1| glycine betaine ABC transporter ATP-bindi...     118  2e-25
 dbj|BAC15412.1| glycine betaine ABC transporter ATP-bindin...     118  2e-25

  Mesorhizobium loti MAFF303099 [a-proteobacteria] taxid 266835
 ref|NP_107673.1| ABC transporter ATP-binding protein [Meso...     125  2e-27
 dbj|BAB53459.1| ABC transporter ATP-binding protein [Mesor...     125  2e-27
 ref|NP_104013.1| ABC transporter ATP-binding protein [Meso...     103  6e-21
 dbj|BAB49799.1| ABC transporter ATP-binding protein [Mesor...     103  6e-21

  Streptomyces sp. ACT-1 [high GC Gram+] taxid 649189
 ref|ZP_06279808.1| glycine betaine/L-proline ABC transport...     124  3e-27
 gb|EFB81296.1| glycine betaine/L-proline ABC transporter, ...     124  3e-27
 ref|ZP_06283230.1| glycine betaine/L-proline ABC transport...     115  2e-24
 gb|EFB77777.1| glycine betaine/L-proline ABC transporter, ...     115  2e-24

  Enterococcus gallinarum EG2 [firmicutes] taxid 565653
 ref|ZP_05649820.1| glycine betaine/L-proline transporter A...     124  3e-27
 gb|EEV33153.1| glycine betaine/L-proline transporter ATP-b...     124  3e-27

  Pseudovibrio sp. JE062 [a-proteobacteria] taxid 439495
 ref|ZP_05082602.1| glycine betaine transport ATP-binding p...     124  3e-27
 gb|EEA96227.1| glycine betaine transport ATP-binding prote...     124  3e-27
 ref|ZP_05085925.1| glycine betaine transport ATP-binding p...     108  1e-22
 gb|EEA94008.1| glycine betaine transport ATP-binding prote...     108  1e-22
 ref|ZP_05085839.1| choline ABC transporter, ATP-binding pr...     105  1e-21
 gb|EEA93922.1| choline ABC transporter, ATP-binding protei...     105  1e-21

  Streptomyces griseus subsp. griseus NBRC 13350 [high GC Gram+] taxid 455632
 ref|YP_001822594.1| putative glycine betaine ABC transport...     124  3e-27
 dbj|BAG17911.1| putative glycine betaine ABC transporter A...     124  3e-27
 ref|YP_001827402.1| putative glycine betaine ABC transport...     115  2e-24
 dbj|BAG22719.1| putative glycine betaine ABC transporter A...     115  2e-24

  Bacillus sp. SG-1 [firmicutes] taxid 161544
 ref|ZP_01860474.1| glycine betaine ABC transporter ATP-bin...     124  3e-27
 gb|EDL64495.1| glycine betaine ABC transporter ATP-binding...     124  3e-27

  Streptomyces roseosporus NRRL 15998 [high GC Gram+] taxid 457431
 ref|ZP_04697465.1| putative glycine betaine ABC transporte...     124  4e-27
 ref|ZP_04692006.1| putative glycine betaine ABC transporte...     114  5e-24

  Streptomyces roseosporus NRRL 11379 [high GC Gram+] taxid 457430
 ref|ZP_04712660.1| putative glycine betaine ABC transporte...     124  4e-27
 ref|ZP_04707222.1| putative glycine betaine ABC transporte...     114  5e-24

  Streptomyces sp. C [high GC Gram+] taxid 253839
 ref|ZP_05511217.1| glycine betaine ABC transporter ATP-bin...     123  6e-27
 ref|ZP_05510547.1| putative glycine betaine ABC transporte...     112  1e-23

  Enterococcus casseliflavus EC20 [firmicutes] taxid 565655
 ref|ZP_05657144.1| glycine betaine/L-proline transporter A...     123  7e-27
 gb|EEV40477.1| glycine betaine/L-proline transporter ATP-b...     123  7e-27

  Enterococcus casseliflavus EC30 [firmicutes] taxid 565652
 ref|ZP_05647062.1| glycine betaine/L-proline transporter A...     123  7e-27
 gb|EEV30395.1| glycine betaine/L-proline transporter ATP-b...     123  7e-27

  Enterococcus casseliflavus EC10 [firmicutes] taxid 565654
 ref|ZP_05653393.1| glycine betaine/L-proline transporter A...     123  7e-27
 gb|EEV36726.1| glycine betaine/L-proline transporter ATP-b...     123  7e-27

  Brevibacillus brevis NBRC 100599 [firmicutes] taxid 358681
 ref|YP_002774552.1| glycine betaine ABC transporter ATP-bi...     123  8e-27
 dbj|BAH46048.1| glycine betaine ABC transporter ATP-bindin...     123  8e-27
 ref|YP_002769857.1| probable glycine betaine ABC transport...     110  4e-23
 dbj|BAH41353.1| probable glycine betaine ABC transporter A...     110  4e-23

  Enterococcus faecium Com15 [firmicutes] taxid 565663
 ref|ZP_05679301.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV62634.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium TX1330 [firmicutes] taxid 525279
 ref|ZP_03982601.1| quaternary-amine-transporting ATPase [E...     122  1e-26
 gb|EEI59273.1| quaternary-amine-transporting ATPase [Enter...     122  1e-26

  Enterococcus faecium 1,141,733 [firmicutes] taxid 565659
 ref|ZP_05667870.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV51203.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium Com12 [firmicutes] taxid 565662
 ref|ZP_05676548.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV59881.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium DO [firmicutes] taxid 333849
 ref|ZP_00603730.1| Glycine betaine/L-proline transport ATP...     122  1e-26
 ref|ZP_05712458.1| glycine betaine/L-proline ABC transport...     122  1e-26
 gb|EAN09932.1| Glycine betaine/L-proline transport ATP-bin...     122  1e-26

  Enterococcus faecium 1,230,933 [firmicutes] taxid 565656
 ref|ZP_05660014.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV43347.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium 1,231,502 [firmicutes] taxid 565657
 ref|ZP_05661865.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV45198.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium 1,231,501 [firmicutes] taxid 565658
 ref|ZP_05665060.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV48393.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium 1,231,410 [firmicutes] taxid 565660
 ref|ZP_05670672.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV54005.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium 1,231,408 [firmicutes] taxid 565661
 ref|ZP_05673925.1| glycine betaine/L-proline transporter A...     122  1e-26
 gb|EEV57258.1| glycine betaine/L-proline transporter ATP-b...     122  1e-26

  Enterococcus faecium C68 [firmicutes] taxid 565664
 ref|ZP_05832851.1| glycine betaine/L-proline transport ATP...     122  1e-26
 gb|EEW61602.1| glycine betaine/L-proline transport ATP-bin...     122  1e-26

  Enterococcus faecium [firmicutes] taxid 1352
 gb|ADA62229.1| Glycine betaine ABC transport system, ATP-b...     122  1e-26

  Enterococcus faecium TC 6 [firmicutes] taxid 565666
 ref|ZP_05923680.1| glycine betaine/L-proline transport ATP...     122  1e-26
 gb|EEW64569.1| glycine betaine/L-proline transport ATP-bin...     122  1e-26

  Paenibacillus sp. oral taxon 786 str. D14 [firmicutes] taxid 621372
 ref|ZP_04854307.1| glycine betaine/L-proline ABC transport...     122  2e-26
 gb|EES71619.1| glycine betaine/L-proline ABC transporter [...     122  2e-26

  Enterococcus faecalis HH22 [firmicutes] taxid 491075
 ref|ZP_03984180.1| quaternary-amine-transporting ATPase [E...     121  2e-26
 gb|EEI57731.1| quaternary-amine-transporting ATPase [Enter...     121  2e-26

  Rhodobacteraceae bacterium KLH11 [a-proteobacteria] taxid 467661
 ref|ZP_05125345.1| glycine betaine/L-proline transport ATP...     121  2e-26
 gb|EEE35280.1| glycine betaine/L-proline transport ATP-bin...     121  2e-26
 ref|ZP_05124734.1| glycine betaine/proline ABC transporter...     116  9e-25
 gb|EEE35662.1| glycine betaine/proline ABC transporter, AT...     116  9e-25
 ref|ZP_05123263.1| glycine betaine/L-proline ABC transport...     106  8e-22
 gb|EEE37895.1| glycine betaine/L-proline ABC transporter, ...     106  8e-22

  Parabacteroides johnsonii DSM 18315 [CFB group bacteria] taxid 537006
 ref|ZP_03476257.1| hypothetical protein PRABACTJOHN_01923 ...     121  3e-26
 gb|EEC96667.1| hypothetical protein PRABACTJOHN_01923 [Par...     121  3e-26

  Enterococcus faecalis TX1322 [firmicutes] taxid 525278
 ref|ZP_04433720.1| quaternary-amine-transporting ATPase [E...     121  3e-26
 gb|EEN75874.1| quaternary-amine-transporting ATPase [Enter...     121  3e-26

  Enterococcus faecalis V583 [firmicutes] taxid 226185
 ref|NP_816279.1| glycine betaine/L-proline ABC transporter...     121  3e-26
 gb|AAO82349.1| glycine betaine/L-proline ABC transporter, ...     121  3e-26

  Enterococcus faecalis TX0104 [firmicutes] taxid 491074
 ref|ZP_03949726.1| quaternary-amine-transporting ATPase [E...     121  3e-26
 gb|EEI10864.1| quaternary-amine-transporting ATPase [Enter...     121  3e-26

  Enterococcus faecalis ATCC 29200 [firmicutes] taxid 525271
 ref|ZP_04437964.1| quaternary-amine-transporting ATPase [E...     121  3e-26
 gb|EEN71472.1| quaternary-amine-transporting ATPase [Enter...     121  3e-26

  Enterococcus faecalis T1 [firmicutes] taxid 565636
 ref|ZP_05422539.1| glycine betaine/carnitine/choline ABC t...     121  3e-26
 gb|EET95447.1| glycine betaine/carnitine/choline ABC trans...     121  3e-26

  Enterococcus faecalis T2 [firmicutes] taxid 565637
 ref|ZP_05425593.1| glycine betaine/carnitine/choline trans...     121  3e-26
 gb|EET98501.1| glycine betaine/carnitine/choline transport...     121  3e-26

  Enterococcus faecalis ATCC 4200 [firmicutes] taxid 565642
 ref|ZP_05473697.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU15554.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis T3 [firmicutes] taxid 565638
 ref|ZP_05503853.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU24219.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis T8 [firmicutes] taxid 565639
 ref|ZP_05559311.1| glycine betaine/L-proline ABC transport...     121  3e-26
 gb|EEU25932.1| glycine betaine/L-proline ABC transporter [...     121  3e-26

  Enterococcus faecalis DS5 [firmicutes] taxid 565643
 ref|ZP_05562046.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU65003.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis Merz96 [firmicutes] taxid 565645
 ref|ZP_05565298.1| glycine betaine/L-proline transporter A...     121  3e-26
 gb|EEU68255.1| glycine betaine/L-proline transporter ATP-b...     121  3e-26

  Enterococcus faecalis HIP11704 [firmicutes] taxid 565646
 ref|ZP_05567925.1| glycine betaine/L-proline transporter A...     121  3e-26
 gb|EEU70882.1| glycine betaine/L-proline transporter ATP-b...     121  3e-26

  Enterococcus faecalis JH1 [firmicutes] taxid 565648
 ref|ZP_05574173.1| glycine betaine/L-proline transporter A...     121  3e-26
 gb|EEU75144.1| glycine betaine/L-proline transporter ATP-b...     121  3e-26

  Enterococcus faecalis E1Sol [firmicutes] taxid 565647
 ref|ZP_05576203.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU77174.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis Fly1 [firmicutes] taxid 565649
 ref|ZP_05578745.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU79716.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis D6 [firmicutes] taxid 565650
 ref|ZP_05581978.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU82949.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis CH188 [firmicutes] taxid 565644
 ref|ZP_05585137.1| ABC glycine betaine/L-proline transport...     121  3e-26
 gb|EEU86108.1| ABC glycine betaine/L-proline transporter A...     121  3e-26

  Enterococcus faecalis AR01/DG [firmicutes] taxid 565651
 ref|ZP_05593818.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU88612.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis T11 [firmicutes] taxid 565640
 ref|ZP_05597033.1| glycine betaine/L-proline transport ATP...     121  3e-26
 gb|EEU91827.1| glycine betaine/L-proline transport ATP-bin...     121  3e-26

  Enterococcus faecalis X98 [firmicutes] taxid 565641
 ref|ZP_05598772.1| ABC glycine betaine/L-proline transport...     121  3e-26
 gb|EEU93566.1| ABC glycine betaine/L-proline transporter [...     121  3e-26

  Enterococcus faecalis TUSoD Ef11 [firmicutes] taxid 553209
 ref|ZP_04647452.1| glycine betaine transport ATP-binding p...     121  3e-26
 gb|EEQ22517.1| glycine betaine transport ATP-binding prote...     121  3e-26

  Alkaliphilus oremlandii OhILAs [firmicutes] taxid 350688
 ref|YP_001513554.1| glycine betaine/L-proline ABC transpor...     121  3e-26
 gb|ABW19558.1| glycine betaine/L-proline ABC transporter, ...     121  3e-26

  Streptomyces flavogriseus ATCC 33331 [high GC Gram+] taxid 591167
 ref|ZP_05806874.1| glycine betaine/L-proline ABC transport...     120  3e-26
 gb|EEW69536.1| glycine betaine/L-proline ABC transporter, ...     120  3e-26
 ref|ZP_05804833.1| glycine betaine/L-proline ABC transport...     119  7e-26
 gb|EEW71593.1| glycine betaine/L-proline ABC transporter, ...     119  7e-26

  Methanoculleus marisnigri JR1 [euryarchaeotes] taxid 368407
 ref|YP_001046909.1| glycine betaine/L-proline ABC transpor...     120  3e-26
 gb|ABN56927.1| glycine betaine/L-proline ABC transporter, ...     120  3e-26

  Lysinibacillus sphaericus C3-41 [firmicutes] taxid 444177
 ref|YP_001697474.1| glycine betaine transport ATP-binding ...     120  3e-26
 gb|ACA39344.1| Glycine betaine transport ATP-binding prote...     120  3e-26

  Bacillus sp. B14905 [firmicutes] taxid 388400
 ref|ZP_01722327.1| glycine betaine/L-proline ABC transport...     120  4e-26
 gb|EAZ87228.1| glycine betaine/L-proline ABC transporter, ...     120  4e-26
 ref|ZP_01722955.1| hypothetical protein BB14905_04493 [Bac...     104  3e-21
 gb|EAZ86422.1| hypothetical protein BB14905_04493 [Bacillu...     104  3e-21

  Methanosarcina mazei Go1 [euryarchaeotes] taxid 192952
 ref|NP_632064.1| glycine betaine transporter, ATP-binding ...     120  4e-26
 gb|AAL86438.1|AF475089_1 ATP-binding protein OtaA [Methano...     120  4e-26
 gb|AAM29736.1| Glycine betaine transporter, ATP-binding pr...     120  4e-26

  Octadecabacter antarcticus 238 [a-proteobacteria] taxid 391616
 ref|ZP_05066248.1| glycine betaine/L-proline ABC transport...     120  5e-26
 gb|EDY91487.1| glycine betaine/L-proline ABC transporter, ...     120  5e-26
 ref|ZP_05066127.1| glycine betaine/proline ABC transporter...     109  8e-23
 gb|EDY91366.1| glycine betaine/proline ABC transporter, AT...     109  8e-23
 ref|ZP_05065607.1| glycine betaine/L-proline ABC transport...     108  1e-22
 gb|EDY90846.1| glycine betaine/L-proline ABC transporter, ...     108  1e-22
 ref|ZP_05068554.1| glycine betaine/L-proline ABC transport...     105  2e-21
 gb|EDY87801.1| glycine betaine/L-proline ABC transporter, ...     105  2e-21
 ref|ZP_05063115.1| choline ABC transporter, ATP-binding pr...     104  4e-21
 gb|EDY88354.1| choline ABC transporter, ATP-binding protei...     104  4e-21

  Geobacillus sp. Y412MC10 [firmicutes] taxid 481743
 ref|YP_003245288.1| glycine betaine/L-proline ABC transpor...     120  6e-26
 gb|ACX67481.1| glycine betaine/L-proline ABC transporter, ...     120  6e-26

  Parabacteroides merdae ATCC 43184 [CFB group bacteria] taxid 411477
 ref|ZP_02030915.1| hypothetical protein PARMER_00891 [Para...     120  6e-26
 gb|EDN87766.1| hypothetical protein PARMER_00891 [Parabact...     120  6e-26

  Streptococcus infantarius subsp. infantarius ATCC BAA-102 [firmicutes] taxid 471872
 ref|ZP_02919855.1| hypothetical protein STRINF_00707 [Stre...     120  6e-26
 gb|EDT48140.1| hypothetical protein STRINF_00707 [Streptoc...     120  6e-26

  Dethiobacter alkaliphilus AHT 1 [firmicutes] taxid 555088
 ref|ZP_03734791.1| glycine betaine/L-proline ABC transport...     120  7e-26
 gb|EEG76735.1| glycine betaine/L-proline ABC transporter, ...     120  7e-26

  Streptomyces avermitilis MA-4680 [high GC Gram+] taxid 227882
 ref|NP_824609.1| glycine betaine ABC transporter ATP-bindi...     119  7e-26
 dbj|BAC71144.1| putative glycine betaine ABC transporter A...     119  7e-26
 ref|NP_827891.1| glycine betaine ABC transport ATP-binding...     119  7e-26
 dbj|BAC74426.1| putative glycine betaine ABC transport ATP...     119  7e-26

  Streptomyces hygroscopicus ATCC 53653 [high GC Gram+] taxid 457427
 ref|ZP_05516988.1| putative glycine betaine ABC transporte...     119  8e-26
 ref|ZP_05519134.1| putative glycine betaine ABC transporte...     115  1e-24

  Paenibacillus larvae subsp. larvae BRL-230010 [firmicutes] taxid 392917
 ref|ZP_02327352.1| glycine betaine/L-proline ABC transport...     119  8e-26

  Streptococcus mutans NN2025 [firmicutes] taxid 511691
 dbj|BAH87999.1| putative ABC transporter ATP-binding prote...     119  9e-26

  Streptococcus mutans UA159 [firmicutes] taxid 210007
 ref|NP_721455.1| putative ABC transporter, ATP-binding pro...     119  1e-25
 gb|AAN58761.1|AE014944_11 putative ABC transporter, ATP-bi...     119  1e-25

  Streptococcus sp. 2_1_36FAA [firmicutes] taxid 469609
 ref|ZP_06059692.1| amino acid ABC transporter [Streptococc...     119  1e-25
 gb|EEY81074.1| amino acid ABC transporter [Streptococcus s...     119  1e-25

  Streptococcus sanguinis SK36 [firmicutes] taxid 388919
 ref|YP_001034388.1| glycine-betaine ABC transporter, ATPas...     119  1e-25
 gb|ABN43838.1| Glycine-betaine ABC transporter, ATPase com...     119  1e-25

  Lactococcus lactis subsp. lactis KF147 [firmicutes] taxid 684738
 ref|YP_003353988.1| Glycine betaine/carnitine/choline ABC ...     119  1e-25
 gb|ADA65221.1| Glycine betaine/carnitine/choline ABC trans...     119  1e-25

  Streptococcus pyogenes MGAS10394 [firmicutes] taxid 286636
 ref|YP_059521.1| glycine betaine transport ATP-binding pro...     119  1e-25
 gb|AAT86338.1| Glycine betaine transport ATP-binding prote...     119  1e-25

  Propionibacterium acnes J139 [high GC Gram+] taxid 679194
 ref|ZP_06263958.1| glycine betaine/L-proline transport ATP...     119  1e-25
 gb|EFB87587.1| glycine betaine/L-proline transport ATP bin...     119  1e-25

  Lactococcus lactis subsp. lactis Il1403 [firmicutes] taxid 272623
 ref|NP_267608.1| betaine ABC transporter ATP binding prote...     119  1e-25
 gb|AAK05550.1|AE006375_4 betaine ABC transporter ATP bindi...     119  1e-25

  Lactococcus lactis subsp. lactis [firmicutes] taxid 1360
 sp|Q9KIF7.1|OPUAA_LACLA RecName: Full=Glycine betaine tran...     119  1e-25

  Lactococcus lactis [firmicutes] taxid 1358
 gb|AAF37878.1|AF234619_1 OpuAA [Lactococcus lactis]               119  1e-25
 gb|AAF04258.1|AF139575_1 BusAA [Lactococcus lactis]               119  1e-25

  Propionibacterium acnes KPA171202 [high GC Gram+] taxid 267747
 ref|YP_056182.1| putative glycine betaine/proline ABC tran...     119  1e-25
 gb|AAT83224.1| putative glycine betaine/proline ABC transp...     119  1e-25

  Propionibacterium acnes SK137 [high GC Gram+] taxid 553199
 ref|ZP_03389406.1| glycine betaine transport ATP-binding p...     119  1e-25
 gb|EEB67380.1| glycine betaine transport ATP-binding prote...     119  1e-25

  Streptomyces sp. ACTE [high GC Gram+] taxid 647653
 ref|ZP_06273362.1| glycine betaine/L-proline ABC transport...     119  1e-25
 gb|EFB66339.1| glycine betaine/L-proline ABC transporter, ...     119  1e-25
 ref|ZP_06273775.1| glycine betaine/L-proline ABC transport...     117  5e-25
 gb|EFB66206.1| glycine betaine/L-proline ABC transporter, ...     117  5e-25

  Lactococcus lactis subsp. cremoris SK11 [firmicutes] taxid 272622
 ref|YP_809471.1| ABC-type proline/glycine betaine transpor...     119  1e-25
 gb|ABJ73049.1| ABC-type proline/glycine betaine transport ...     119  1e-25

  Lactococcus lactis subsp. cremoris MG1363 [firmicutes] taxid 416870
 ref|YP_001032362.1| glycine betaine/proline ABC transporte...     119  1e-25
 emb|CAL97641.1| glycine betaine/proline ABC transporter [L...     119  1e-25
 gb|AAF40473.1|AF184955_1 OpuAA [Lactococcus lactis subsp. ...     117  4e-25

  Myxococcus xanthus DK 1622 [d-proteobacteria] taxid 246197
 ref|YP_630470.1| glycine betaine/L-proline ABC transporter...     119  1e-25
 gb|ABF92588.1| glycine betaine/L-proline ABC transporter, ...     119  1e-25

  Streptomyces albus J1074 [high GC Gram+] taxid 457425
 ref|ZP_04702424.1| glycine betaine ABC transporter ATP-bin...     119  1e-25
 ref|ZP_04701071.1| putative glycine betaine ABC transporte...     115  1e-24

  Weissella paramesenteroides ATCC 33313 [firmicutes] taxid 585506
 ref|ZP_04783316.1| ABC superfamily ATP binding cassette tr...     119  1e-25
 gb|EER74502.1| ABC superfamily ATP binding cassette transp...     119  1e-25

  Streptococcus pyogenes MGAS2096 [firmicutes] taxid 370553
 ref|YP_599763.1| glycine betaine transport ATP-binding pro...     119  1e-25
 gb|ABF35219.1| Glycine betaine transport ATP-binding prote...     119  1e-25

  Streptococcus pyogenes NZ131 [firmicutes] taxid 471876
 ref|YP_002285205.1| L-proline Glycine Betaine ABC transpor...     118  2e-25
 gb|ACI60510.1| L-proline Glycine Betaine ABC transport ATP...     118  2e-25

  Halobacillus trueperi [firmicutes] taxid 156205
 gb|AAV48565.1| OpuAA [Halobacillus trueperi]                      118  2e-25

  Bacillus licheniformis ATCC 14580 [firmicutes] taxid 279010
 ref|YP_079781.1| glycine betaine ABC transporter ATP-bindi...     118  2e-25
 ref|YP_092195.1| OpuAA [Bacillus licheniformis ATCC 14580]        118  2e-25
 gb|AAU24143.1| glycine betaine ABC transporter (ATP-bindin...     118  2e-25
 gb|AAU41502.1| OpuAA [Bacillus licheniformis ATCC 14580]          118  2e-25

  Alkalilimnicola ehrlichii MLHE-1 [g-proteobacteria] taxid 187272
 ref|YP_741576.1| glycine betaine/L-proline ABC transporter...     118  2e-25
 gb|ABI56086.1| glycine betaine/L-proline ABC transporter, ...     118  2e-25

  Streptococcus pyogenes M1 GAS [firmicutes] taxid 160490
 ref|NP_268562.1| putative glycine betaine/proline ABC tran...     118  2e-25
 gb|AAK33283.1| putative glycine betaine/proline ABC transp...     118  2e-25

  Streptococcus pyogenes MGAS8232 [firmicutes] taxid 186103
 ref|NP_606483.1| putative glycine betaine/proline ABC tran...     118  2e-25
 gb|AAL96982.1| putative glycine betaine/proline ABC transp...     118  2e-25

  Streptococcus pyogenes MGAS315 [firmicutes] taxid 198466
 ref|NP_663947.1| putative glycine betaine/proline ABC tran...     118  2e-25
 gb|AAM78750.1| putative glycine betaine/proline ABC transp...     118  2e-25

  Streptococcus pyogenes SSI-1 [firmicutes] taxid 193567
 ref|NP_801409.1| putative glycine betaine/proline ABC tran...     118  2e-25
 dbj|BAC63242.1| putative glycine betaine/proline ABC trans...     118  2e-25

  Streptococcus pyogenes MGAS6180 [firmicutes] taxid 319701
 ref|YP_279624.1| glycine betaine transport ATP-binding pro...     118  2e-25
 gb|AAX71269.1| glycine betaine transport ATP-binding prote...     118  2e-25

  Streptococcus pyogenes MGAS5005 [firmicutes] taxid 293653
 ref|YP_281521.1| glycine betaine transport ATP-binding pro...     118  2e-25
 gb|AAZ50776.1| glycine betaine transport ATP-binding prote...     118  2e-25

  Streptococcus pyogenes MGAS9429 [firmicutes] taxid 370551
 ref|YP_595891.1| glycine betaine transport ATP-binding pro...     118  2e-25
 gb|ABF31347.1| glycine betaine transport ATP-binding prote...     118  2e-25

  Streptococcus pyogenes MGAS10270 [firmicutes] taxid 370552
 ref|YP_597768.1| glycine betaine transport ATP-binding pro...     118  2e-25
 gb|ABF33224.1| Glycine betaine transport ATP-binding prote...     118  2e-25

  Streptococcus pyogenes str. Manfredo [firmicutes] taxid 160491
 ref|YP_001127747.1| putative glycine betaine transport ATP...     118  2e-25
 emb|CAM29494.1| putative glycine betaine transport ATP-bin...     118  2e-25

  Streptomyces lividans TK24 [high GC Gram+] taxid 457428
 ref|ZP_05524123.1| glycine betaine ABC transport system AT...     118  2e-25
 ref|ZP_05527202.1| glycine betaine transport ATP-binding p...     112  1e-23

  Streptococcus pyogenes MGAS10750 [firmicutes] taxid 370554
 ref|YP_601657.1| Glycine betaine transport ATP-binding pro...     118  2e-25
 gb|ABF37113.1| Glycine betaine transport ATP-binding prote...     118  2e-25

  Bacillus sp. NRRL B-14911 [firmicutes] taxid 313627
 ref|ZP_01169657.1| OpuAA [Bacillus sp. NRRL B-14911]              118  2e-25
 gb|EAR67889.1| OpuAA [Bacillus sp. NRRL B-14911]                  118  2e-25

  Streptococcus pyogenes M49 591 [firmicutes] taxid 294934
 ref|ZP_00365590.1| COG4175: ABC-type proline/glycine betai...     118  2e-25

  Corynebacterium aurimucosum ATCC 700975 [high GC Gram+] taxid 548476
 ref|YP_002834151.1| glycine betaine ABC transporter ATP-bi...     118  2e-25
 ref|ZP_06043114.1| glycine betaine ABC transporter ATP-bin...     118  2e-25
 gb|ACP32213.1| glycine betaine ABC transporter ATP-binding...     118  2e-25

  Streptomyces viridochromogenes DSM 40736 [high GC Gram+] taxid 591159
 ref|ZP_05533747.1| glycine betaine ABC transporter ATP-bin...     118  2e-25
 ref|ZP_05530323.1| glycine betaine transport ATP-binding p...     114  3e-24
 ref|ZP_05535969.1| glycine betaine/L-proline ABC transport...     102  1e-20

  Rhodobacter sp. SW2 [a-proteobacteria] taxid 371731
 ref|ZP_05843137.1| glycine betaine/L-proline ABC transport...     118  2e-25
 gb|EEW26053.1| glycine betaine/L-proline ABC transporter, ...     118  2e-25

  Halothermothrix orenii H 168 [firmicutes] taxid 373903
 ref|YP_002509891.1| glycine betaine/L-proline ABC transpor...     118  2e-25
 gb|ACL70896.1| glycine betaine/L-proline ABC transporter, ...     118  2e-25

  Psychroflexus torquis ATCC 700755 [CFB group bacteria] taxid 313595
 ref|ZP_01256638.1| ABC transporter ATP-binding protein [Ps...     118  2e-25

  Streptococcus dysgalactiae subsp. equisimilis GGS_124 [firmicutes] taxid 486410
 ref|YP_002997700.1| putative glycine betaine transport ATP...     118  2e-25
 dbj|BAH82486.1| putative glycine betaine transport ATP-bin...     118  2e-25

  Lactobacillus casei ATCC 334 [firmicutes] taxid 321967
 ref|YP_807336.1| ABC-type proline/glycine betaine transpor...     118  2e-25
 gb|ABJ70894.1| ABC-type proline/glycine betaine transport ...     118  2e-25

  Lactobacillus casei BL23 [firmicutes] taxid 543734
 ref|YP_001988252.1| GbuA protein [Lactobacillus casei BL23]       118  2e-25
 emb|CAQ67394.1| GbuA protein [Lactobacillus casei BL23]           118  2e-25

  Lactobacillus paracasei subsp. paracasei ATCC 25302 [firmicutes] taxid 525337
 ref|ZP_03963891.1| quaternary-amine-transporting ATPase [L...     118  2e-25
 gb|EEI68610.1| quaternary-amine-transporting ATPase [Lacto...     118  2e-25

  Lactobacillus paracasei subsp. paracasei 8700:2 [firmicutes] taxid 537973
 ref|ZP_04673035.1| ABC-type proline/glycine betaine transp...     118  2e-25
 gb|EEQ66617.1| ABC-type proline/glycine betaine transport ...     118  2e-25

  Natranaerobius thermophilus JW/NM-WN-LF [firmicutes] taxid 457570
 ref|YP_001917784.1| glycine betaine/L-proline ABC transpor...     118  2e-25
 gb|ACB85196.1| glycine betaine/L-proline ABC transporter, ...     118  2e-25
 ref|YP_001918201.1| glycine betaine/L-proline ABC transpor...     117  5e-25
 gb|ACB85613.1| glycine betaine/L-proline ABC transporter, ...     117  5e-25

  Roseovarius sp. HTCC2601 [a-proteobacteria] taxid 314265
 ref|ZP_01443618.1| ABC Glycine betaine/L-proline transport...     118  2e-25
 gb|EAU46164.1| ABC Glycine betaine/L-proline transporter, ...     118  2e-25
 ref|ZP_01442216.1| ABC glycine betaine/L-proline tranporte...     103  8e-21
 gb|EAU47698.1| ABC glycine betaine/L-proline tranporter, A...     103  8e-21

  Desulfotomaculum reducens MI-1 [firmicutes] taxid 349161
 ref|YP_001114536.1| glycine betaine/L-proline ABC transpor...     117  3e-25
 gb|ABO51711.1| glycine betaine/L-proline ABC transporter, ...     117  3e-25

  Listeria grayi DSM 20601 [firmicutes] taxid 525367
 ref|ZP_04444377.1| ABC superfamily ATP binding cassette tr...     117  3e-25
 gb|EEN76877.1| ABC superfamily ATP binding cassette transp...     117  3e-25
 ref|ZP_04443925.1| ABC superfamily ATP binding cassette tr...     111  3e-23
 gb|EEN77290.1| ABC superfamily ATP binding cassette transp...     111  3e-23

  Streptococcus agalactiae 2603V/R [firmicutes] taxid 208435
 ref|NP_688787.1| amino acid ABC transporter, ATP-binding p...     117  3e-25
 gb|AAN00660.1|AE014273_7 amino acid ABC transporter, ATP-b...     117  3e-25

  Streptococcus agalactiae 18RS21 [firmicutes] taxid 342613
 ref|ZP_00781109.1| amino acid ABC transporter, ATP-binding...     117  3e-25
 gb|EAO62301.1| amino acid ABC transporter, ATP-binding pro...     117  3e-25

  Rhizobium leguminosarum bv. trifolii WSM2304 [a-proteobacteria] taxid 395492
 ref|YP_002283921.1| glycine betaine/L-proline ABC transpor...     117  3e-25
 gb|ACI59529.1| glycine betaine/L-proline ABC transporter, ...     117  3e-25
 ref|YP_002279204.1| glycine betaine/L-proline ABC transpor...     103  7e-21
 gb|ACI58464.1| glycine betaine/L-proline ABC transporter, ...     103  7e-21
 ref|YP_002282321.1| choline ABC transporter, ATP-binding p...     102  1e-20
 gb|ACI56095.1| choline ABC transporter, ATP-binding protei...     102  1e-20

  Streptococcus agalactiae A909 [firmicutes] taxid 205921
 ref|YP_330415.1| glycine betaine/proline ABC transporter, ...     117  4e-25
 gb|ABA45734.1| glycine betaine/proline ABC transporter, AT...     117  4e-25

  Streptococcus agalactiae H36B [firmicutes] taxid 342615
 ref|ZP_00783730.1| amino acid ABC transporter, ATP-binding...     117  4e-25
 gb|EAO77536.1| amino acid ABC transporter, ATP-binding pro...     117  4e-25

  Streptococcus agalactiae COH1 [firmicutes] taxid 342616
 ref|ZP_00786426.1| amino acid ABC transporter, ATP-binding...     117  4e-25
 gb|EAO74836.1| amino acid ABC transporter, ATP-binding pro...     117  4e-25

  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 [firmicutes] taxid 203120
 ref|YP_817853.1| ABC-type proline/glycine betaine transpor...     117  4e-25
 gb|ABJ61480.1| ABC-type proline/glycine betaine transport ...     117  4e-25

  Bacteroides sp. 2_1_33B [CFB group bacteria] taxid 469589
 ref|ZP_06077939.1| glycine betaine transport ATP-binding p...     117  4e-25
 gb|EEY81459.1| glycine betaine transport ATP-binding prote...     117  4e-25

  Bacteroides sp. 2_1_7 [CFB group bacteria] taxid 457388
 ref|ZP_05288626.1| glycine betaine transport ATP-binding p...     117  4e-25
 ref|ZP_05287711.1| glycine betaine transport ATP-binding p...     113  6e-24

  Parabacteroides sp. D13 [CFB group bacteria] taxid 563193
 ref|ZP_05547790.1| choline ABC transporter, ATP-binding pr...     117  4e-25
 gb|EEU49500.1| choline ABC transporter, ATP-binding protei...     117  4e-25

  Leuconostoc mesenteroides subsp. cremoris ATCC 19254 [firmicutes] taxid 586220
 ref|ZP_03914643.1| quaternary-amine-transporting ATPase [L...     117  4e-25
 gb|EEJ41805.1| quaternary-amine-transporting ATPase [Leuco...     117  4e-25

  Streptomyces griseoflavus Tu4000 [high GC Gram+] taxid 467200
 ref|ZP_05542285.1| glycine betaine transport ATP-binding p...     117  4e-25
 ref|ZP_05539255.1| glycine betaine ABC transport system AT...     116  8e-25

  Streptococcus agalactiae NEM316 [firmicutes] taxid 211110
 ref|NP_736273.1| hypothetical protein gbs1839 [Streptococc...     117  4e-25
 emb|CAD47498.1| Unknown [Streptococcus agalactiae NEM316]         117  4e-25

  Parabacteroides distasonis ATCC 8503 [CFB group bacteria] taxid 435591
 ref|YP_001301513.1| glycine betaine transport ATP-binding ...     117  4e-25
 gb|ABR41891.1| glycine betaine transport ATP-binding prote...     117  4e-25
 ref|YP_001305162.1| glycine betaine transport ATP-binding ...     114  4e-24
 gb|ABR45540.1| glycine betaine transport ATP-binding prote...     114  4e-24

  Alkaliphilus metalliredigens QYMF [firmicutes] taxid 293826
 ref|YP_001320617.1| glycine betaine/L-proline ABC transpor...     117  4e-25
 gb|ABR48958.1| glycine betaine/L-proline ABC transporter, ...     117  4e-25

  Psychromonas ingrahamii 37 [g-proteobacteria] taxid 357804
 ref|YP_944709.1| ABC transporter ATP-binding protein [Psyc...     117  4e-25
 gb|ABM05110.1| ABC transporter ATP-binding protein [Psychr...     117  4e-25

  Streptococcus agalactiae CJB111 [firmicutes] taxid 342617
 ref|ZP_00788346.1| amino acid ABC transporter, ATP-binding...     117  4e-25
 gb|EAO72907.1| amino acid ABC transporter, ATP-binding pro...     117  4e-25

  Streptomyces ghanaensis ATCC 14672 [high GC Gram+] taxid 566461
 ref|ZP_04689251.1| glycine betaine transport ATP-binding p...     117  5e-25
 ref|ZP_04686320.1| glycine betaine ABC transporter ATP-bin...     115  1e-24

  Lactobacillus rhamnosus HN001 [firmicutes] taxid 486408
 ref|ZP_03210865.1| ABC-type proline/glycine betaine transp...     117  5e-25
 gb|EDY99771.1| ABC-type proline/glycine betaine transport ...     117  5e-25

  Lactobacillus rhamnosus GG [firmicutes] taxid 568703
 ref|YP_003171894.1| glycine betaine/L-proline ABC transpor...     117  5e-25
 emb|CAR88043.1| ABC transporter, glycine betaine/L-proline...     117  5e-25
 dbj|BAI42592.1| glycine/betaine/carnitine ABC transporter ...     117  5e-25

  Methanohalophilus portucalensis FDF-1 [euryarchaeotes] taxid 523843
 gb|AAX73263.2| ATP-binding protein [Methanohalophilus port...     117  5e-25

  Streptomyces coelicolor A3(2) [high GC Gram+] taxid 100226
 ref|NP_628986.1| glycine betaine ABC transport system ATP-...     117  5e-25
 emb|CAB97433.1| putative glycine betaine ABC transport sys...     117  5e-25
 ref|NP_625896.1| glycine betaine transport ATP-binding pro...     112  1e-23
 emb|CAB59474.1| glycine betaine transport ATP-binding prot...     112  1e-23

  Lactobacillus brevis subsp. gravesensis ATCC 27305 [firmicutes] taxid 525310
 ref|ZP_03940027.1| quaternary-amine-transporting ATPase [L...     117  6e-25
 gb|EEI70651.1| quaternary-amine-transporting ATPase [Lacto...     117  6e-25

  Carnobacterium sp. AT7 [firmicutes] taxid 333990
 ref|ZP_02185274.1| glycine betaine ABC transporter ATP-bin...     117  6e-25
 gb|EDP67996.1| glycine betaine ABC transporter ATP-binding...     117  6e-25

  Lactobacillus rhamnosus LMS2-1 [firmicutes] taxid 525361
 ref|ZP_04441767.1| quaternary-amine-transporting ATPase [L...     116  6e-25
 gb|EEN79512.1| quaternary-amine-transporting ATPase [Lacto...     116  6e-25

  Lactobacillus rhamnosus Lc 705 [firmicutes] taxid 568704
 ref|YP_003174845.1| glycine betaine/L-proline ABC transpor...     116  6e-25
 emb|CAR90994.1| ABC transporter, glycine betaine/L-proline...     116  6e-25

  Lactobacillus buchneri ATCC 11577 [firmicutes] taxid 525318
 ref|ZP_03942961.1| ABC superfamily ATP binding cassette tr...     116  6e-25
 gb|EEI19224.1| ABC superfamily ATP binding cassette transp...     116  6e-25

  Desulfotomaculum acetoxidans DSM 771 [firmicutes] taxid 485916
 ref|YP_003190058.1| glycine betaine/L-proline ABC transpor...     116  6e-25
 gb|ACV61435.1| glycine betaine/L-proline ABC transporter, ...     116  6e-25

  Lactobacillus hilgardii ATCC 8290 [firmicutes] taxid 525327
 ref|ZP_03953089.1| ABC superfamily ATP binding cassette tr...     116  6e-25
 gb|EEI25170.1| ABC superfamily ATP binding cassette transp...     116  6e-25

  Desulfovibrio salexigens DSM 2638 [d-proteobacteria] taxid 526222
 ref|YP_002990281.1| glycine betaine/L-proline ABC transpor...     116  6e-25
 gb|ACS78742.1| glycine betaine/L-proline ABC transporter, ...     116  6e-25
 ref|YP_002990423.1| glycine betaine/L-proline ABC transpor...     114  5e-24
 gb|ACS78884.1| glycine betaine/L-proline ABC transporter, ...     114  5e-24

  Saccharomonospora viridis DSM 43017 [high GC Gram+] taxid 471857
 ref|YP_003132028.1| glycine betaine/L-proline transport AT...     116  8e-25
 gb|ACU95201.1| glycine betaine/L-proline transport ATP bin...     116  8e-25

  Labrenzia alexandrii DFL-11 [a-proteobacteria] taxid 244592
 ref|ZP_05114116.1| glycine betaine/L-proline transport ATP...     116  8e-25
 gb|EEE44715.1| glycine betaine/L-proline transport ATP bin...     116  8e-25

  Bacillus subtilis [firmicutes] taxid 1423
 dbj|BAA08932.1| glycine betain/L-proline transport ATPase ...     115  1e-24
 sp|P46920.3|OPUAA_BACSU RecName: Full=Glycine betaine tran...     115  1e-24
 gb|AAC43455.1| ATPase [Bacillus subtilis]                         115  1e-24

  Bacillus subtilis subsp. subtilis str. 168 [firmicutes] taxid 224308
 ref|ZP_03589961.1| glycine betaine ABC transporter ATP-bin...     115  1e-24
 ref|NP_388180.2| glycine betaine ABC transporter (ATP-bind...     115  1e-24
 emb|CAB12092.2| glycine betaine ABC transporter (ATP-bindi...     115  1e-24

  Bacillus subtilis subsp. subtilis str. NCIB 3610 [firmicutes] taxid 535026
 ref|ZP_03594242.1| glycine betaine ABC transporter ATP-bin...     115  1e-24

  Bacillus subtilis subsp. subtilis str. JH642 [firmicutes] taxid 535025
 ref|ZP_03598664.1| glycine betaine ABC transporter ATP-bin...     115  1e-24

  Bacillus subtilis subsp. subtilis str. SMY [firmicutes] taxid 535024
 ref|ZP_03602929.1| glycine betaine ABC transporter ATP-bin...     115  1e-24

  Bacillus selenitireducens MLS10 [firmicutes] taxid 439292
 ref|ZP_02168951.1| ABC-type proline/glycine betaine transp...     115  1e-24
 gb|EDP84159.1| ABC-type proline/glycine betaine transport ...     115  1e-24

  Bacteroides thetaiotaomicron VPI-5482 [CFB group bacteria] taxid 226186
 ref|NP_810664.1| glycine betaine transport ATP-binding pro...     115  1e-24
 gb|AAO76858.1| Glycine betaine transport ATP-binding prote...     115  1e-24

  Bacteroides sp. 1_1_6 [CFB group bacteria] taxid 469586
 ref|ZP_04849303.1| glycine betaine transport ATP-binding p...     115  1e-24
 gb|EES66581.1| glycine betaine transport ATP-binding prote...     115  1e-24

  Streptosporangium roseum DSM 43021 [high GC Gram+] taxid 479432
 ref|YP_003337529.1| glycine betaine/proline ABC transporte...     115  1e-24
 gb|ACZ84786.1| glycine betaine/proline ABC transporter, AT...     115  1e-24

  Marinobacter sp. ELB17 [g-proteobacteria] taxid 270374
 ref|ZP_01736894.1| glycine betaine/l-proline transport ATP...     115  1e-24
 gb|EBA00464.1| glycine betaine/l-proline transport ATP-bin...     115  1e-24

  Bacillus pumilus SAFR-032 [firmicutes] taxid 315750
 ref|YP_001485528.1| glycine betaine ABC transporter ATP-bi...     115  2e-24
 gb|ABV60968.1| glycine betaine ABC superfamily ATP binding...     115  2e-24

  Streptomyces sp. Mg1 [high GC Gram+] taxid 465541
 ref|ZP_04999671.1| glycine betaine ABC transporter ATP-bin...     115  2e-24
 gb|EDX24182.1| glycine betaine ABC transporter ATP-binding...     115  2e-24
 ref|ZP_05002637.1| glycine betaine ABC transport ATP-bindi...     110  5e-23
 gb|EDX27148.1| glycine betaine ABC transport ATP-binding p...     110  5e-23

  Clostridium tetani E88 [firmicutes] taxid 212717
 ref|NP_782881.1| glycine betaine transport ATP-binding pro...     115  2e-24
 gb|AAO36818.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Bacteroides sp. 4_3_47FAA [CFB group bacteria] taxid 457394
 ref|ZP_05254752.1| glycine betaine transport ATP-binding p...     115  2e-24
 gb|EET15144.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Bacillus pumilus ATCC 7061 [firmicutes] taxid 536229
 ref|ZP_03056072.1| glycine betaine transport ATP-binding p...     115  2e-24
 gb|EDW20304.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Methanocorpusculum labreanum Z [euryarchaeotes] taxid 410358
 ref|YP_001030496.1| hypothetical protein Mlab_1060 [Methan...     115  2e-24
 gb|ABN07229.1| glycine betaine/L-proline ABC transporter, ...     115  2e-24

  Bacteroides vulgatus ATCC 8482 [CFB group bacteria] taxid 435590
 ref|YP_001300521.1| glycine betaine transport ATP-binding ...     115  2e-24
 gb|ABR40899.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Lactobacillus sakei subsp. sakei 23K [firmicutes] taxid 314315
 ref|YP_396309.1| putative glycine/betaine/carnitine ABC tr...     115  2e-24
 emb|CAI56003.1| Putative glycine/betaine/carnitine ABC tra...     115  2e-24

  Desulfobacterium autotrophicum HRM2 [d-proteobacteria] taxid 177437
 ref|YP_002605032.1| ProV [Desulfobacterium autotrophicum H...     115  2e-24
 gb|ACN16868.1| ProV [Desulfobacterium autotrophicum HRM2]         115  2e-24

  Bacteroides sp. 9_1_42FAA [CFB group bacteria] taxid 457395
 ref|ZP_04540441.1| glycine betaine transport ATP-binding p...     115  2e-24
 gb|EEO61774.1| glycine betaine transport ATP-binding prote...     115  2e-24
 ref|ZP_04538926.1| glycine betaine transport ATP-binding p...     114  4e-24
 gb|EEO63387.1| glycine betaine transport ATP-binding prote...     114  4e-24

  Bacteroides dorei 5_1_36/D4 [CFB group bacteria] taxid 556260
 ref|ZP_04555856.1| glycine betaine transport ATP-binding p...     115  2e-24
 gb|EEO46139.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Bacteroides sp. 3_1_33FAA [CFB group bacteria] taxid 457391
 ref|ZP_06088966.1| glycine betaine transport ATP-binding p...     115  2e-24
 gb|EEZ20849.1| glycine betaine transport ATP-binding prote...     115  2e-24

  Bacteroides dorei DSM 17855 [CFB group bacteria] taxid 483217
 ref|ZP_03301345.1| hypothetical protein BACDOR_02727 [Bact...     115  2e-24
 gb|EEB24894.1| hypothetical protein BACDOR_02727 [Bacteroi...     115  2e-24

  Streptomyces pristinaespiralis ATCC 25486 [high GC Gram+] taxid 457429
 ref|ZP_05010582.1| glycine betaine ABC transport ATP-bindi...     115  2e-24
 gb|EDY63146.1| glycine betaine ABC transport ATP-binding p...     115  2e-24
 ref|ZP_05009453.1| glycine betaine ABC transporter ATP-bin...     112  1e-23
 gb|EDY62017.1| glycine betaine ABC transporter ATP-binding...     112  1e-23

  Listeria innocua Clip11262 [firmicutes] taxid 272626
 ref|NP_470350.1| hypothetical protein lin1013 [Listeria in...     114  3e-24

  Listeria innocua [firmicutes] taxid 1642
 emb|CAC96244.1| gbuA [Listeria innocua]                           114  3e-24

  Streptococcus agalactiae 515 [firmicutes] taxid 342614
 ref|ZP_00790073.1| amino acid ABC transporter, ATP-binding...     114  3e-24
 gb|EAO71165.1| amino acid ABC transporter, ATP-binding pro...     114  3e-24

  Listeria monocytogenes EGD-e [firmicutes] taxid 169963
 ref|NP_464539.1| hypothetical protein lmo1014 [Listeria mo...     114  3e-24
 emb|CAC99092.1| gbuA [Listeria monocytogenes]                     114  3e-24

  Listeria monocytogenes str. 1/2a F6854 [firmicutes] taxid 267409
 ref|ZP_00233942.1| glycine betaine/L-proline ABC transport...     114  3e-24
 gb|EAL06241.1| glycine betaine/L-proline ABC transporter, ...     114  3e-24

  Listeria monocytogenes HCC23 [firmicutes] taxid 552536
 ref|YP_002350564.1| glycine betaine transport ATP-binding ...     114  3e-24
 gb|ACK39950.1| glycine betaine transport ATP-binding prote...     114  3e-24

  Listeria monocytogenes Finland 1988 [firmicutes] taxid 393127
 ref|ZP_03669089.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes FSL R2-561 [firmicutes] taxid 393126
 ref|ZP_03670978.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes FSL N3-165 [firmicutes] taxid 393124
 ref|ZP_05232646.1| glycine betaine/L-proline ABC transport...     114  3e-24
 gb|EEW13666.1| glycine betaine/L-proline ABC transporter [...     114  3e-24

  Listeria monocytogenes 10403S [firmicutes] taxid 393133
 ref|ZP_05236894.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes FSL N1-017 [firmicutes] taxid 393123
 ref|ZP_05246053.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes J0161 [firmicutes] taxid 393130
 ref|ZP_05258736.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes J2818 [firmicutes] taxid 393131
 ref|ZP_05261711.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes F6900 [firmicutes] taxid 393128
 ref|ZP_05267722.1| glycine betaine/L-proline ABC transport...     114  3e-24
 gb|EEW21221.1| glycine betaine/L-proline ABC transporter [...     114  3e-24

  Listeria monocytogenes [firmicutes] taxid 1639
 gb|AAD29104.1|AF039835_1 ATPase homolog GbuA [Listeria mon...     114  3e-24

  Bacteroides fragilis 3_1_12 [CFB group bacteria] taxid 457424
 ref|ZP_05282952.1| glycine betaine transport ATP-binding p...     114  3e-24

  Listeria monocytogenes str. 4b F2365 [firmicutes] taxid 265669
 ref|YP_013635.1| glycine betaine/L-proline ABC transporter...     114  3e-24
 gb|AAT03812.1| glycine betaine/L-proline ABC transporter, ...     114  3e-24

  Listeria monocytogenes Clip80459 [firmicutes] taxid 634178
 ref|YP_002757739.1| glycine betaine ABC transporter (ATP-b...     114  3e-24
 emb|CAS04800.1| Putative glycine betaine ABC transporter (...     114  3e-24

  Listeria monocytogenes FSL J1-194 [firmicutes] taxid 393117
 ref|ZP_05228714.1| glycine betaine ABC transporter (ATP-bi...     114  3e-24

  Listeria monocytogenes FSL R2-503 [firmicutes] taxid 393125
 ref|ZP_05241858.1| glycine betaine/L-proline ABC transport...     114  3e-24
 gb|EEW18426.1| glycine betaine/L-proline ABC transporter [...     114  3e-24

  Listeria monocytogenes FSL J2-071 [firmicutes] taxid 393121
 ref|ZP_05251128.1| glycine betaine ABC transporter (ATP-bi...     114  3e-24

  Listeria monocytogenes HPB2262 [firmicutes] taxid 401650
 ref|ZP_05264757.1| glycine betaine ABC transporter (ATP-bi...     114  3e-24

  Listeria monocytogenes FSL J2-064 [firmicutes] taxid 393122
 ref|ZP_05274472.1| glycine betaine ABC transporter (ATP-bi...     114  3e-24

  Listeria monocytogenes FSL J1-175 [firmicutes] taxid 393118
 ref|ZP_05387843.1| glycine betaine ABC transporter (ATP-bi...     114  3e-24

  Listeria welshimeri serovar 6b str. SLCC5334 [firmicutes] taxid 386043
 ref|YP_849197.1| glycine betaine/L-proline ABC transporter...     114  3e-24
 emb|CAK20416.1| gbuA [Listeria welshimeri serovar 6b str. ...     114  3e-24

  Candidatus Pelagibacter ubique HTCC1062 [a-proteobacteria] taxid 335992
 ref|YP_266705.1| glycine betaine/l-proline transport ATP-b...     114  4e-24
 gb|AAZ22101.1| glycine betaine/l-proline transport ATP-bin...     114  4e-24
 ref|YP_266219.1| glycine betaine/L-proline transport ATP-b...     108  2e-22
 gb|AAZ21616.1| glycine betaine/L-proline transport ATP-bin...     108  2e-22

  Candidatus Pelagibacter ubique HTCC1002 [a-proteobacteria] taxid 314261
 ref|ZP_01264916.1| glycine betaine/l-proline transport ATP...     114  4e-24
 gb|EAS85403.1| glycine betaine/l-proline transport ATP-bin...     114  4e-24
 ref|ZP_01264047.1| glycine betaine/L-proline transport ATP...     108  2e-22
 gb|EAS84534.1| glycine betaine/L-proline transport ATP-bin...     108  2e-22

  Listeria monocytogenes str. 4b H7858 [firmicutes] taxid 267410
 ref|ZP_00231695.1| glycine betaine/L-proline ABC transport...     114  4e-24
 gb|EAL08457.1| glycine betaine/L-proline ABC transporter, ...     114  4e-24

  Bacteroides fragilis NCTC 9343 [CFB group bacteria] taxid 272559
 ref|YP_212785.1| putative glycine betaine transport ATP-bi...     114  4e-24
 emb|CAH08867.1| putative glycine betaine transport ATP-bin...     114  4e-24

  Bacteroides fragilis YCH46 [CFB group bacteria] taxid 295405
 ref|YP_100614.1| glycine betaine transport ATP-binding pro...     114  4e-24
 dbj|BAD50080.1| glycine betaine transport ATP-binding prot...     114  4e-24

  Bacteroides sp. 3_2_5 [CFB group bacteria] taxid 457392
 ref|ZP_04842583.1| glycine betaine transport ATP-binding p...     114  4e-24
 gb|EES86969.1| glycine betaine transport ATP-binding prote...     114  4e-24

  Bacteroides sp. 2_1_16 [CFB group bacteria] taxid 469587
 ref|ZP_06093955.1| choline ABC transporter, ATP-binding pr...     114  4e-24
 gb|EEZ25047.1| choline ABC transporter, ATP-binding protei...     114  4e-24

  Trichodesmium erythraeum IMS101 [cyanobacteria] taxid 203124
 ref|YP_723590.1| glycine betaine/L-proline ABC transporter...     114  4e-24
 gb|ABG53117.1| glycine betaine/L-proline ABC transporter, ...     114  4e-24

  Streptomyces sviceus ATCC 29083 [high GC Gram+] taxid 463191
 ref|ZP_05018227.1| glycine betaine ABC transporter ATP-bin...     114  4e-24
 gb|EDY56785.1| glycine betaine ABC transporter ATP-binding...     114  4e-24
 ref|ZP_05022861.1| glycine betaine transport ATP-binding p...     110  5e-23
 gb|EDY61419.1| glycine betaine transport ATP-binding prote...     110  5e-23
 ref|ZP_05020476.1| glycine betaine/L-proline ABC transport...     103  7e-21
 gb|EDY59034.1| glycine betaine/L-proline ABC transporter [...     103  7e-21

  Bacillus amyloliquefaciens FZB42 [firmicutes] taxid 326423
 ref|YP_001419952.1| OpuAA [Bacillus amyloliquefaciens FZB42]      113  5e-24
 gb|ABS72721.1| OpuAA [Bacillus amyloliquefaciens FZB42]           113  5e-24

  Roseovarius nubinhibens ISM [a-proteobacteria] taxid 89187
 ref|ZP_00959020.1| ABC Glycine betaine/L-proline transport...     113  5e-24
 gb|EAP77482.1| ABC Glycine betaine/L-proline transporter, ...     113  5e-24
 ref|ZP_00960513.1| glycine betaine/proline ABC transporter...     107  5e-22
 gb|EAP76084.1| glycine betaine/proline ABC transporter, AT...     107  5e-22
 ref|ZP_00960689.1| glycine betaine/proline ABC transporter...     104  3e-21
 gb|EAP76260.1| glycine betaine/proline ABC transporter, AT...     104  3e-21

  Desulfonatronospira thiodismutans ASO3-1 [d-proteobacteria] taxid 555779
 ref|ZP_03737660.1| glycine betaine/L-proline ABC transport...     113  5e-24
 gb|EEG80805.1| glycine betaine/L-proline ABC transporter, ...     113  5e-24

  Desulfomicrobium baculatum DSM 4028 [d-proteobacteria] taxid 525897
 ref|YP_003159809.1| glycine betaine/L-proline ABC transpor...     113  5e-24
 gb|ACU91393.1| glycine betaine/L-proline ABC transporter, ...     113  5e-24

  Streptococcus uberis 0140J [firmicutes] taxid 218495
 ref|YP_002562991.1| glycine betaine transport ATP-binding ...     113  6e-24
 emb|CAR43644.1| putative glycine betaine transport ATP-bin...     113  6e-24

  Clostridium kluyveri NBRC 12016 [firmicutes] taxid 583346
 ref|YP_002471160.1| hypothetical protein CKR_0695 [Clostri...     113  6e-24
 dbj|BAH05746.1| hypothetical protein [Clostridium kluyveri...     113  6e-24

  Streptococcus equi subsp. zooepidemicus MGCS10565 [firmicutes] taxid 552526
 ref|YP_002122568.1| glycine betaine transport ATP-binding ...     113  7e-24
 gb|ACG61555.1| glycine betaine transport ATP-binding prote...     113  7e-24

  Roseobacter sp. MED193 [a-proteobacteria] taxid 314262
 ref|ZP_01056304.1| glycine betaine/proline ABC transporter...     113  7e-24
 gb|EAQ45519.1| glycine betaine/proline ABC transporter, AT...     113  7e-24

  Streptococcus equi subsp. equi 4047 [firmicutes] taxid 553482
 ref|YP_002745660.1| glycine betaine transport ATP-binding ...     113  7e-24
 emb|CAW92299.1| putative glycine betaine transport ATP-bin...     113  7e-24

  Clostridium kluyveri DSM 555 [firmicutes] taxid 431943
 ref|YP_001394178.1| ProV [Clostridium kluyveri DSM 555]           113  7e-24
 gb|EDK32830.1| ProV [Clostridium kluyveri DSM 555]                113  7e-24

  Streptomyces sp. SPB74 [high GC Gram+] taxid 465543
 ref|ZP_04993427.1| glycine betaine ABC transport ATP-bindi...     113  7e-24
 gb|EDY44701.1| glycine betaine ABC transport ATP-binding p...     113  7e-24

  Desulfovibrio vulgaris str. Hildenborough [d-proteobacteria] taxid 882
 ref|YP_011512.1| glycine/betaine/L-proline ABC transporter...     113  7e-24
 gb|AAS96772.1| glycine/betaine/L-proline ABC transporter, ...     113  7e-24

  Desulfovibrio vulgaris DP4 [d-proteobacteria] taxid 391774
 ref|YP_966404.1| glycine betaine/L-proline ABC transporter...     113  7e-24
 gb|ABM27977.1| glycine betaine/L-proline ABC transporter, ...     113  7e-24

  Desulfovibrio vulgaris RCH1 [d-proteobacteria] taxid 573059
 ref|ZP_04791691.1| glycine betaine/L-proline ABC transport...     113  7e-24
 gb|EER79846.1| glycine betaine/L-proline ABC transporter, ...     113  7e-24

  Bacteroides finegoldii DSM 17565 [CFB group bacteria] taxid 483215
 ref|ZP_05417452.1| glycine betaine/L-proline ABC transport...     113  8e-24
 gb|EEX43271.1| glycine betaine/L-proline ABC transporter, ...     113  8e-24

  Bacteroides sp. 2_2_4 [CFB group bacteria] taxid 469590
 ref|ZP_04553808.1| glycine betaine transport ATP-binding p...     113  8e-24
 gb|EEO53640.1| glycine betaine transport ATP-binding prote...     113  8e-24

  Bordetella pertussis Tohama I [b-proteobacteria] taxid 257313
 ref|NP_880723.1| putative ABC-transporter ATP-binding prot...     113  8e-24
 emb|CAE42336.1| putative ABC-transporter ATP-binding prote...     113  8e-24

  Bordetella bronchiseptica RB50 [b-proteobacteria] taxid 257310
 ref|NP_889900.1| putative ABC-transporter ATP-binding prot...     113  8e-24
 emb|CAE33858.1| putative ABC-transporter ATP-binding prote...     113  8e-24

  Bordetella parapertussis 12822 [b-proteobacteria] taxid 257311
 ref|NP_884016.1| putative ABC-transporter ATP-binding prot...     113  8e-24

  Bordetella parapertussis [b-proteobacteria] taxid 519
 emb|CAE37043.1| putative ABC-transporter ATP-binding prote...     113  8e-24

  Listeria monocytogenes LO28 [firmicutes] taxid 393132
 ref|ZP_05302909.1| glycine betaine transport ATP-binding p...     113  8e-24

  Bacteroides sp. D1 [CFB group bacteria] taxid 556258
 ref|ZP_04544232.1| glycine betaine transport ATP-binding p...     112  9e-24
 gb|EEO51989.1| glycine betaine transport ATP-binding prote...     112  9e-24

  Bacteroides sp. 2_1_22 [CFB group bacteria] taxid 469588
 ref|ZP_06085885.1| choline ABC transporter, ATP-binding pr...     112  9e-24
 gb|EEZ01891.1| choline ABC transporter, ATP-binding protei...     112  9e-24

  Bacteroides ovatus ATCC 8483 [CFB group bacteria] taxid 411476
 ref|ZP_02067485.1| hypothetical protein BACOVA_04493 [Bact...     112  9e-24
 gb|EDO10112.1| hypothetical protein BACOVA_04493 [Bacteroi...     112  9e-24

  Streptococcus equi subsp. zooepidemicus [firmicutes] taxid 40041
 ref|YP_002743716.1| glycine betaine transport ATP-binding ...     112  1e-23
 emb|CAW97835.1| putative glycine betaine transport ATP-bin...     112  1e-23

  Bacteroides sp. D2 [CFB group bacteria] taxid 556259
 ref|ZP_05759825.1| glycine betaine transport ATP-binding p...     112  1e-23

  Bordetella petrii DSM 12804 [b-proteobacteria] taxid 340100
 ref|YP_001631918.1| putative ABC-transporter ATP-binding p...     112  1e-23

  Bordetella petrii [b-proteobacteria] taxid 94624
 emb|CAP43650.1| putative ABC-transporter ATP-binding prote...     112  1e-23

  Paenibacillus sp. JDR-2 [firmicutes] taxid 324057
 ref|YP_003013209.1| glycine betaine/L-proline ABC transpor...     112  1e-23
 gb|ACT03123.1| glycine betaine/L-proline ABC transporter, ...     112  1e-23

  Ruegeria pomeroyi DSS-3 [a-proteobacteria] taxid 246200
 ref|YP_166383.1| glycine betaine/proline ABC transporter, ...     112  1e-23
 gb|AAV94432.1| glycine betaine/proline ABC transporter, AT...     112  1e-23
 ref|YP_165061.1| glycine betaine/proline ABC transporter, ...     111  2e-23
 gb|AAV97366.1| glycine betaine/proline ABC transporter, AT...     111  2e-23
 ref|YP_166790.1| glycine betaine/proline ABC transporter, ...     111  2e-23
 gb|AAV94836.1| glycine betaine/proline ABC transporter, AT...     111  2e-23
 ref|YP_167660.1| glycine betaine/proline ABC transporter, ...     105  1e-21
 gb|AAV95697.1| glycine betaine/proline ABC transporter, AT...     105  1e-21

  Streptomyces sp. SPB78 [high GC Gram+] taxid 591157
 ref|ZP_05485890.1| putative glycine betaine ABC transporte...     112  1e-23

  Bacteroides caccae ATCC 43185 [CFB group bacteria] taxid 411901
 ref|ZP_01961112.1| hypothetical protein BACCAC_02738 [Bact...     112  1e-23
 gb|EDM19983.1| hypothetical protein BACCAC_02738 [Bacteroi...     112  1e-23

  Roseobacter litoralis Och 149 [a-proteobacteria] taxid 391595
 ref|ZP_02139923.1| glycine betaine/L-proline transport ATP...     112  1e-23
 gb|EDQ18162.1| glycine betaine/L-proline transport ATP-bin...     112  1e-23
 ref|ZP_02142033.1| glycine betaine/proline ABC transporter...     104  3e-21
 gb|EDQ16417.1| glycine betaine/proline ABC transporter, AT...     104  3e-21

  Methanosarcina barkeri str. Fusaro [euryarchaeotes] taxid 269797
 ref|YP_305877.1| glycine betaine/L-proline ABC transporter...     112  1e-23
 gb|AAZ71297.1| glycine betaine/L-proline ABC transporter, ...     112  1e-23

  Streptomyces clavuligerus ATCC 27064 [high GC Gram+] taxid 443255
 ref|ZP_05008005.1| glycine betaine transport ATP-binding p...     112  2e-23
 gb|EDY52304.1| glycine betaine transport ATP-binding prote...     112  2e-23

  Bordetella avium 197N [b-proteobacteria] taxid 360910
 ref|YP_786990.1| glycine betaine/L-proline ABC transporter...     112  2e-23
 emb|CAJ50088.1| glycine betaine/L-proline ABC transporter,...     112  2e-23

  uncultured marine microorganism HF4000_133I24 [unclassified] taxid 455522
 gb|ABZ06650.1| putative ABC transporter [uncultured marine...     112  2e-23
 gb|ABZ06663.1| putative ABC transporter [uncultured marine...     107  4e-22

  marine actinobacterium PHSC20C1 [high GC Gram+] taxid 312284
 ref|ZP_01129845.1| putative glycine betaine/proline ABC tr...     112  2e-23
 gb|EAR25565.1| putative glycine betaine/proline ABC transp...     112  2e-23

  uncultured marine microorganism HF4000_001B09 [unclassified] taxid 455502
 gb|ABZ05920.1| putative ABC transporter [uncultured marine...     112  2e-23

  Agrobacterium tumefaciens str. C58 [a-proteobacteria] taxid 176299
 ref|NP_353914.2| ABC transporter, nucleotide binding/ATPas...     112  2e-23
 gb|AAK86699.2| ABC transporter, nucleotide binding/ATPase ...     112  2e-23
 ref|NP_356599.2| ABC transporter, nucleotide binding/ATPas...     110  6e-23
 gb|AAK89384.2| ABC transporter, nucleotide binding/ATPase ...     110  6e-23
 ref|NP_396147.2| ABC transporter, nucleotide binding/ATPas...     107  6e-22
 gb|AAK90588.2| ABC transporter, nucleotide binding/ATPase ...     107  6e-22

  Rhodobacterales bacterium HTCC2150 [a-proteobacteria] taxid 388401
 ref|ZP_01743766.1| glycine betaine/proline ABC transporter...     111  2e-23
 gb|EBA01880.1| glycine betaine/proline ABC transporter, AT...     111  2e-23
 ref|ZP_01742628.1| glycine betaine/L-proline transport ATP...     107  3e-22
 gb|EBA03210.1| glycine betaine/L-proline transport ATP-bin...     107  3e-22
 ref|ZP_01741498.1| glycine betaine/proline ABC transporter...     106  8e-22
 gb|EBA03951.1| glycine betaine/proline ABC transporter, AT...     106  8e-22

  Methanosarcina acetivorans C2A [euryarchaeotes] taxid 188937
 ref|NP_617063.1| glycine betaine/L-proline ABC transporter...     111  2e-23
 gb|AAM05543.1| glycine betaine/L-proline ABC transporter, ...     111  2e-23

  Bacillus clausii KSM-K16 [firmicutes] taxid 66692
 ref|YP_174571.1| glycine betaine ABC transporter ATP-bindi...     111  2e-23
 dbj|BAD63610.1| glycine betaine ABC transporter ATP-bindin...     111  2e-23

  Bacillus cytotoxicus NVH 391-98 [firmicutes] taxid 315749
 ref|YP_001375190.1| glycine betaine/L-proline ABC transpor...     111  2e-23
 gb|ABS22195.1| glycine betaine/L-proline ABC transporter, ...     111  2e-23

  Bacillus thuringiensis serovar israelensis ATCC 35646 [firmicutes] taxid 339854
 ref|ZP_00743176.1| Glycine betaine transport ATP-binding p...     111  2e-23
 gb|EAO52559.1| Glycine betaine transport ATP-binding prote...     111  2e-23

  Bacillus cereus G9842 [firmicutes] taxid 405531
 ref|YP_002446221.1| glycine betaine/L-proline ABC transpor...     111  2e-23
 gb|ACK93073.1| glycine betaine/L-proline ABC transporter, ...     111  2e-23

  Bacillus thuringiensis IBL 4222 [firmicutes] taxid 527020
 ref|ZP_04065519.1| Glycine betaine transport ATP-binding p...     111  2e-23
 gb|EEN02771.1| Glycine betaine transport ATP-binding prote...     111  2e-23

  Bacillus thuringiensis IBL 200 [firmicutes] taxid 527019
 ref|ZP_04072371.1| Glycine betaine transport ATP-binding p...     111  2e-23
 gb|EEM95898.1| Glycine betaine transport ATP-binding prote...     111  2e-23

  Bacillus cereus Rock3-44 [firmicutes] taxid 526986
 ref|ZP_04217811.1| Glycine betaine transport ATP-binding p...     111  2e-23
 gb|EEL50474.1| Glycine betaine transport ATP-binding prote...     111  2e-23

  Bacillus cereus MM3 [firmicutes] taxid 526971
 ref|ZP_04300981.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK67409.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus thuringiensis serovar berliner ATCC 10792 [firmicutes] taxid 527031
 ref|ZP_04102484.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM65886.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus thuringiensis serovar thuringiensis str. T01001 [firmicutes] taxid 527025
 ref|ZP_04133397.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM34993.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus thuringiensis Bt407 [firmicutes] taxid 527021
 ref|ZP_04139717.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM28616.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus mycoides DSM 2048 [firmicutes] taxid 526997
 ref|ZP_04169224.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL98979.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH1273 [firmicutes] taxid 526994
 ref|ZP_04174975.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL93316.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH1272 [firmicutes] taxid 526993
 ref|ZP_04180740.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL87592.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH603 [firmicutes] taxid 526990
 ref|ZP_04197824.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL70465.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus weihenstephanensis KBAB4 [firmicutes] taxid 315730
 ref|YP_001645421.1| glycine betaine/L-proline ABC transpor...     111  3e-23
 gb|ABY43793.1| glycine betaine/L-proline ABC transporter, ...     111  3e-23

  Bacillus cereus BDRD-ST196 [firmicutes] taxid 526976
 ref|ZP_04262501.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL05719.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH621 [firmicutes] taxid 526972
 ref|ZP_04295125.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK73036.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus ATCC 14579 [firmicutes] taxid 226900
 ref|NP_832543.1| glycine betaine transport ATP-binding pro...     111  3e-23
 gb|AAP09744.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH1134 [firmicutes] taxid 405533
 ref|ZP_03232713.1| glycine betaine/L-proline ABC transport...     111  3e-23
 gb|EDZ50322.1| glycine betaine/L-proline ABC transporter, ...     111  3e-23

  Bacillus cereus B4264 [firmicutes] taxid 405532
 ref|YP_002367504.1| glycine betaine/L-proline ABC transpor...     111  3e-23
 gb|ACK62853.1| glycine betaine/L-proline ABC transporter, ...     111  3e-23

  Bacillus thuringiensis serovar kurstaki str. T03a001 [firmicutes] taxid 527023
 ref|ZP_04115180.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM53096.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus AH676 [firmicutes] taxid 526991
 ref|ZP_04192140.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL76149.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus Rock4-2 [firmicutes] taxid 526987
 ref|ZP_04212508.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL55811.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus Rock1-15 [firmicutes] taxid 526982
 ref|ZP_04239811.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL28493.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus BDRD-Cer4 [firmicutes] taxid 526978
 ref|ZP_04257111.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL11260.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus BDRD-ST24 [firmicutes] taxid 526974
 ref|ZP_04273751.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK94642.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus m1550 [firmicutes] taxid 526969
 ref|ZP_04279209.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK89176.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus 172560W [firmicutes] taxid 526967
 ref|ZP_04306429.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK61904.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus ATCC 10876 [firmicutes] taxid 526980
 ref|ZP_04317876.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEK50381.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus thuringiensis serovar pakistani str. T13001 [firmicutes] taxid 527027
 ref|ZP_04120721.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM47597.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus Rock3-29 [firmicutes] taxid 526984
 ref|ZP_04228264.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL40029.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus Rock3-28 [firmicutes] taxid 526983
 ref|ZP_04234072.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL34081.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus pseudomycoides DSM 12442 [firmicutes] taxid 527000
 ref|ZP_04151548.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM16792.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus mycoides Rock1-4 [firmicutes] taxid 526998
 ref|ZP_04166403.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM01923.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus mycoides Rock3-17 [firmicutes] taxid 526999
 ref|ZP_04157316.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM10992.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Jonesia denitrificans DSM 20603 [high GC Gram+] taxid 471856
 ref|YP_003161562.1| glycine betaine/L-proline ABC transpor...     111  3e-23
 gb|ACV09259.1| glycine betaine/L-proline ABC transporter, ...     111  3e-23

  Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 [firmicutes] taxid 527030
 ref|ZP_04084779.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEM83547.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Bacillus cereus Rock1-3 [firmicutes] taxid 526981
 ref|ZP_04245688.1| Glycine betaine transport ATP-binding p...     111  3e-23
 gb|EEL22582.1| Glycine betaine transport ATP-binding prote...     111  3e-23

  Denitrovibrio acetiphilus DSM 12809 [bacteria] taxid 522772
 ref|ZP_03907516.1| glycine betaine/L-proline transport ATP...     111  3e-23
 gb|EEJ22630.1| glycine betaine/L-proline transport ATP bin...     111  3e-23

  Corynebacterium accolens ATCC 49725 [high GC Gram+] taxid 525260
 ref|ZP_03932728.1| quaternary-amine-transporting ATPase [C...     111  3e-23
 gb|EEI14372.1| quaternary-amine-transporting ATPase [Coryn...     111  3e-23

  Staphylococcus haemolyticus JCSC1435 [firmicutes] taxid 279808
 ref|YP_254570.1| hypothetical protein SH2655 [Staphylococc...     111  3e-23
 dbj|BAE05964.1| unnamed protein product [Staphylococcus ha...     111  3e-23

  Bacillus cereus F65185 [firmicutes] taxid 526989
 ref|ZP_04203516.1| Glycine betaine transport ATP-binding p...     110  3e-23
 gb|EEL64755.1| Glycine betaine transport ATP-binding prote...     110  3e-23

  Dinoroseobacter shibae DFL 12 [a-proteobacteria] taxid 398580
 ref|YP_001532780.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ABV93179.1| glycine betaine/L-proline ABC transporter [...     110  4e-23

  Sanguibacter keddieii DSM 10542 [high GC Gram+] taxid 446469
 ref|YP_003313704.1| glycine betaine/L-proline transport AT...     110  4e-23
 gb|ACZ20870.1| glycine betaine/L-proline transport ATP bin...     110  4e-23

  Bacillus anthracis str. A2012 [firmicutes] taxid 191218
 ref|ZP_00393042.1| COG4175: ABC-type proline/glycine betai...     110  4e-23

  Bacillus cereus R309803 [firmicutes] taxid 526968
 ref|ZP_04289640.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEK78751.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Burkholderia phymatum STM815 [b-proteobacteria] taxid 391038
 ref|YP_001859649.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACC72603.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23
 ref|YP_001862927.1| glycine betaine/L-proline ABC transpor...     103  7e-21
 gb|ACC75881.1| glycine betaine/L-proline ABC transporter, ...     103  7e-21

  Bacillus thuringiensis str. Al Hakam [firmicutes] taxid 412694
 ref|YP_895297.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|ABK85790.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus BGSC 6E1 [firmicutes] taxid 526970
 ref|ZP_04312196.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEK56111.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Rubrobacter xylanophilus DSM 9941 [high GC Gram+] taxid 266117
 ref|YP_645314.1| glycine betaine/L-proline transport ATP b...     110  4e-23
 gb|ABG05502.1| glycine betaine/L-proline transport ATP bin...     110  4e-23
 ref|YP_644329.1| glycine betaine/L-proline transport ATP b...     110  4e-23
 gb|ABG04517.1| glycine betaine/L-proline transport ATP bin...     110  4e-23

  Stackebrandtia nassauensis DSM 44728 [high GC Gram+] taxid 446470
 ref|ZP_04484983.1| glycine betaine/L-proline transport ATP...     110  4e-23
 gb|EEP04551.1| glycine betaine/L-proline transport ATP bin...     110  4e-23

  Desulfovibrio vulgaris str. 'Miyazaki F' [d-proteobacteria] taxid 883
 ref|YP_002435468.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACL08000.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Leuconostoc citreum KM20 [firmicutes] taxid 349519
 ref|YP_001728587.1| ABC-type proline/glycine betaine trans...     110  4e-23
 gb|ACA83143.1| ABC-type proline/glycine betaine transport ...     110  4e-23

  Rhodobacterales bacterium HTCC2255 [a-proteobacteria] taxid 367336
 ref|ZP_01446533.1| glycine betaine/L-proline transport ATP...     110  4e-23
 gb|EAU52705.1| glycine betaine/L-proline transport ATP-bin...     110  4e-23
 ref|ZP_01447071.1| glycine betaine/proline ABC transporter...     106  8e-22
 gb|EAU53243.1| glycine betaine/proline ABC transporter, AT...     106  8e-22
 ref|ZP_01447105.1| glycine betaine/proline ABC transporter...     105  2e-21
 gb|EAU53277.1| glycine betaine/proline ABC transporter, AT...     105  2e-21

  Bacillus cereus ATCC 10987 [firmicutes] taxid 222523
 ref|NP_979120.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAS41728.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus H3081.97 [firmicutes] taxid 451708
 ref|ZP_03234704.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDZ59331.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus AH187 [firmicutes] taxid 405534
 ref|YP_002338788.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACJ81238.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus Q1 [firmicutes] taxid 361100
 ref|YP_002530346.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACM13057.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus BDRD-ST26 [firmicutes] taxid 526975
 ref|ZP_04267995.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEL00232.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus anthracis str. Ames [firmicutes] taxid 198094
 ref|NP_845135.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAP26621.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. 'Ames Ancestor' [firmicutes] taxid 261594
 ref|YP_019428.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAT31903.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. Sterne [firmicutes] taxid 260799
 ref|YP_028856.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAT54907.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus thuringiensis serovar konkukian str. 97-27 [firmicutes] taxid 281309
 ref|YP_036875.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAT61331.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus E33L [firmicutes] taxid 288681
 ref|YP_084105.1| glycine betaine/L-proline ABC transporter...     110  4e-23
 gb|AAU17743.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0488 [firmicutes] taxid 486624
 ref|ZP_02213333.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDR20916.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0442 [firmicutes] taxid 486621
 ref|ZP_02390825.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDR95432.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0193 [firmicutes] taxid 486619
 ref|ZP_02396007.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDR89644.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0465 [firmicutes] taxid 486620
 ref|ZP_02876603.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDT21478.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0389 [firmicutes] taxid 486623
 ref|ZP_02895192.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDS99388.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. A0174 [firmicutes] taxid 486622
 ref|ZP_02932564.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDT69694.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis Tsiankovskii-I [firmicutes] taxid 405536
 ref|ZP_03018260.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDV17332.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus W [firmicutes] taxid 405917
 ref|ZP_03099883.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDX59174.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus NVH0597-99 [firmicutes] taxid 451707
 ref|ZP_03108984.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDX66078.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus 03BB108 [firmicutes] taxid 451709
 ref|ZP_03110854.1| glycine betaine/L-proline ABC transport...     110  4e-23
 gb|EDX64594.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus AH820 [firmicutes] taxid 405535
 ref|YP_002451743.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACK90259.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus cereus 03BB102 [firmicutes] taxid 572264
 ref|YP_002750141.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACO27114.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. CDC 684 [firmicutes] taxid 568206
 ref|YP_002814411.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACP15802.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 [firmicutes] taxid 527028
 ref|ZP_04078981.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEM89389.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 [firmicutes] taxid 527029
 ref|ZP_04090886.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEM77490.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 [firmicutes] taxid 527032
 ref|ZP_04096903.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEM71368.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus cereus Rock3-42 [firmicutes] taxid 526985
 ref|ZP_04222990.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEL45327.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus cereus 95/8201 [firmicutes] taxid 526979
 ref|ZP_04251547.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEL16808.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus cereus ATCC 4342 [firmicutes] taxid 526977
 ref|ZP_04284459.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEK83819.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus anthracis str. A0248 [firmicutes] taxid 592021
 ref|YP_002867065.1| glycine betaine/L-proline ABC transpor...     110  4e-23
 gb|ACQ48947.1| glycine betaine/L-proline ABC transporter, ...     110  4e-23

  Bacillus anthracis str. CNEVA-9066 [firmicutes] taxid 280354
 ref|ZP_05149210.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus anthracis str. A1055 [firmicutes] taxid 280355
 ref|ZP_05184546.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus anthracis str. Western North America USA6153 [firmicutes] taxid 212045
 ref|ZP_05195509.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus anthracis str. Kruger B [firmicutes] taxid 205919
 ref|ZP_05200705.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus anthracis str. Vollum [firmicutes] taxid 261591
 ref|ZP_05204157.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus anthracis str. Australia 94 [firmicutes] taxid 280477
 ref|ZP_05212665.1| glycine betaine/L-proline ABC transport...     110  4e-23

  Bacillus cereus m1293 [firmicutes] taxid 526973
 ref|ZP_04323699.1| Glycine betaine transport ATP-binding p...     110  4e-23
 gb|EEK44594.1| Glycine betaine transport ATP-binding prote...     110  4e-23

  Bacillus cereus G9241 [firmicutes] taxid 269801
 ref|ZP_00239740.1| amino acid ABC transporter, ATP-binding...     110  5e-23
 gb|EAL12680.1| amino acid ABC transporter, ATP-binding pro...     110  5e-23

  Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 [firmicutes] taxid 527024
 ref|ZP_04146028.1| Glycine betaine transport ATP-binding p...     110  5e-23
 gb|EEM22227.1| Glycine betaine transport ATP-binding prote...     110  5e-23

  Salinibacter ruber DSM 13855 [CFB group bacteria] taxid 309807
 ref|YP_444576.1| glycine betaine/L-proline transport ATP b...     110  5e-23
 gb|ABC45098.1| glycine betaine/L-proline transport ATP bin...     110  5e-23

  Hahella chejuensis KCTC 2396 [g-proteobacteria] taxid 349521
 ref|YP_432650.1| ABC-type proline/glycine betaine transpor...     110  5e-23
 gb|ABC28225.1| ABC-type proline/glycine betaine transport ...     110  5e-23

  Salinispora arenicola CNS-205 [high GC Gram+] taxid 391037
 ref|YP_001538279.1| glycine betaine/L-proline ABC transpor...     110  6e-23
 gb|ABV99288.1| glycine betaine/L-proline ABC transporter, ...     110  6e-23
 ref|YP_001536509.1| glycine betaine/L-proline ABC transpor...     104  3e-21
 gb|ABV97518.1| glycine betaine/L-proline ABC transporter, ...     104  3e-21

  Vibrio sp. MED222 [g-proteobacteria] taxid 314290
 ref|ZP_01064361.1| putative glycine betaine ABC transporte...     110  6e-23
 gb|EAQ54370.1| putative glycine betaine ABC transporter AT...     110  6e-23

  Vibrio splendidus LGP32 [g-proteobacteria] taxid 575788
 ref|YP_002417137.1| ABC transporter: ATP binding protein [...     110  6e-23
 emb|CAV18694.1| ABC transporter: ATP binding protein [Vibr...     110  6e-23

  Hoeflea phototrophica DFL-43 [a-proteobacteria] taxid 411684
 ref|ZP_02165589.1| glycine betaine/L-proline transport ATP...     110  6e-23
 gb|EDQ35073.1| glycine betaine/L-proline transport ATP-bin...     110  6e-23

  Vibrionales bacterium SWAT-3 [g-proteobacteria] taxid 391574
 ref|ZP_01812874.1| putative glycine betaine ABC transporte...     110  6e-23
 gb|EDK29780.1| putative glycine betaine ABC transporter AT...     110  6e-23

  Vibrio splendidus 12B01 [g-proteobacteria] taxid 314291
 ref|ZP_00988560.1| putative glycine betaine ABC transporte...     110  6e-23
 gb|EAP96361.1| putative glycine betaine ABC transporter AT...     110  6e-23

  Brevibacterium linens BL2 [high GC Gram+] taxid 321955
 ref|ZP_05912917.1| glycine betaine/L-proline ABC transport...     110  6e-23

  Thermobifida fusca YX [high GC Gram+] taxid 269800
 ref|YP_290986.1| glycine betaine/L-proline transport ATP-b...     110  6e-23
 gb|AAZ56963.1| glycine betaine/L-proline transport ATP-bin...     110  6e-23

  Rhodobacter sphaeroides ATCC 17025 [a-proteobacteria] taxid 349102
 ref|YP_001168509.1| ABC transporter related [Rhodobacter s...     109  8e-23
 gb|ABP71204.1| ABC transporter related [Rhodobacter sphaer...     109  8e-23

  Xylanimonas cellulosilytica DSM 15894 [high GC Gram+] taxid 446471
 ref|YP_003327102.1| glycine betaine/L-proline ABC transpor...     109  9e-23
 gb|ACZ31544.1| glycine betaine/L-proline ABC transporter, ...     109  9e-23

  Rhodobacterales bacterium HTCC2083 [a-proteobacteria] taxid 314270
 ref|ZP_05073980.1| glycine betaine/L-proline ABC transport...     109  1e-22
 gb|EDZ41640.1| glycine betaine/L-proline ABC transporter, ...     109  1e-22
 ref|ZP_05075107.1| glycine betaine transporter, ATP-bindin...     108  2e-22
 gb|EDZ42767.1| glycine betaine transporter, ATP-binding pr...     108  2e-22

  Vibrio orientalis CIP 102891 [g-proteobacteria] taxid 675816
 ref|ZP_05944180.1| L-proline Glycine Betaine ABC transport...     109  1e-22
 gb|EEX94467.1| L-proline Glycine Betaine ABC transport ATP...     109  1e-22

  Octadecabacter antarcticus 307 [a-proteobacteria] taxid 391626
 ref|ZP_05050296.1| glycine betaine/L-proline transport ATP...     108  1e-22
 gb|EDY76562.1| glycine betaine/L-proline transport ATP bin...     108  1e-22
 ref|ZP_05054466.1| ABC transporter, ATP-binding protein [O...     103  5e-21
 gb|EDY75366.1| ABC transporter, ATP-binding protein [Octad...     103  5e-21

  Victivallis vadensis ATCC BAA-548 [bacteria] taxid 340101
 ref|ZP_06244958.1| glycine betaine/L-proline ABC transport...     108  1e-22
 gb|EFA99132.1| glycine betaine/L-proline ABC transporter, ...     108  1e-22

  Rhodospirillum rubrum ATCC 11170 [a-proteobacteria] taxid 269796
 ref|YP_427562.1| glycine betaine/L-proline transport ATP-b...     108  1e-22
 gb|ABC23275.1| Glycine betaine/L-proline transport ATP-bin...     108  1e-22

  Sagittula stellata E-37 [a-proteobacteria] taxid 388399
 ref|ZP_01746580.1| ABC transporter ATP-binding protein [Sa...     108  1e-22
 gb|EBA07992.1| ABC transporter ATP-binding protein [Sagitt...     108  1e-22

  Desulfohalobium retbaense DSM 5692 [d-proteobacteria] taxid 485915
 ref|YP_003199135.1| glycine betaine/L-proline ABC transpor...     108  1e-22
 gb|ACV69557.1| glycine betaine/L-proline ABC transporter, ...     108  1e-22

  Sulfitobacter sp. EE-36 [a-proteobacteria] taxid 52598
 ref|ZP_00955417.1| ABC glycine betaine/L-proline transport...     108  1e-22
 gb|EAP83842.1| ABC glycine betaine/L-proline transporter, ...     108  1e-22

  Roseobacter sp. CCS2 [a-proteobacteria] taxid 391593
 ref|ZP_01750556.1| glycine betaine/L-proline transport ATP...     108  1e-22
 gb|EBA12230.1| glycine betaine/L-proline transport ATP-bin...     108  1e-22

  Vibrio parahaemolyticus 16 [g-proteobacteria] taxid 391586
 ref|ZP_05117720.1| glycine betaine transport ATP-binding p...     108  2e-22
 gb|EED28668.1| glycine betaine transport ATP-binding prote...     108  2e-22

  uncultured marine microorganism HF4000_008G09 [unclassified] taxid 455513
 gb|ABZ06311.1| putative ABC transporter [uncultured marine...     108  2e-22

  Beutenbergia cavernae DSM 12333 [high GC Gram+] taxid 471853
 ref|YP_002881249.1| glycine betaine/L-proline ABC transpor...     108  2e-22
 gb|ACQ79487.1| glycine betaine/L-proline ABC transporter, ...     108  2e-22

  Desulfotalea psychrophila LSv54 [d-proteobacteria] taxid 177439
 ref|YP_063942.1| glycine betaine/L-proline transport ATP-b...     108  2e-22
 emb|CAG34935.1| probable glycine betaine/L-proline transpo...     108  2e-22

  Desulfovibrio desulfuricans subsp. desulfuricans str. G20 [d-proteobacteria] taxid 207559
 ref|YP_387169.1| glycine betaine/L-proline transport ATP b...     108  2e-22
 gb|ABB37474.1| glycine betaine/L-proline transport ATP bin...     108  2e-22

  Dickeya dadantii Ech703 [enterobacteria] taxid 579405
 ref|YP_002986527.1| glycine betaine/L-proline ABC transpor...     108  2e-22
 gb|ACS84705.1| glycine betaine/L-proline ABC transporter, ...     108  2e-22

  Desulfatibacillum alkenivorans AK-01 [d-proteobacteria] taxid 439235
 ref|YP_002430884.1| glycine betaine/L-proline ABC transpor...     108  2e-22
 gb|ACL03416.1| glycine betaine/L-proline ABC transporter, ...     108  2e-22

  Methanococcoides burtonii DSM 6242 [euryarchaeotes] taxid 259564
 ref|YP_565234.1| ABC glycine betaine/L-proline transporter...     108  2e-22
 gb|ABE51484.1| Glycine betaine ABC transporter ATP-binding...     108  2e-22

  Thalassiobium sp. R2A62 [a-proteobacteria] taxid 633131
 ref|ZP_05344070.1| glycine betaine transport ATP-binding p...     108  2e-22
 gb|EET49737.1| glycine betaine transport ATP-binding prote...     108  2e-22

  Streptomyces sp. AA4 [high GC Gram+] taxid 591158
 ref|ZP_05477816.1| glycine betaine/L-proline ABC transport...     108  2e-22

  uncultured marine microorganism HF4000_001L24 [unclassified] taxid 455503
 gb|ABZ05951.1| putative ABC transporter [uncultured marine...     108  2e-22

  Sulfitobacter sp. NAS-14.1 [a-proteobacteria] taxid 314267
 ref|ZP_00962852.1| ABC glycine betaine/L-proline transport...     108  2e-22
 gb|EAP80339.1| ABC glycine betaine/L-proline transporter, ...     108  2e-22

  Roseovarius sp. 217 [a-proteobacteria] taxid 314264
 ref|ZP_01035405.1| ABC glycine betaine/L-proline transport...     108  2e-22
 gb|EAQ26480.1| ABC glycine betaine/L-proline transporter, ...     108  2e-22
 ref|ZP_01035678.1| glycine betaine/proline ABC transporter...     103  4e-21
 gb|EAQ25843.1| glycine betaine/proline ABC transporter, AT...     103  4e-21

  Shewanella halifaxensis HAW-EB4 [g-proteobacteria] taxid 458817
 ref|YP_001676243.1| glycine betaine/L-proline ABC transpor...     108  2e-22
 gb|ABZ78584.1| glycine betaine/L-proline ABC transporter, ...     108  2e-22

  Pyramidobacter piscolens W5455 [bacteria] taxid 352165
 ref|ZP_06265958.1| glycine betaine ABC transporter, ATP-bi...     107  3e-22
 gb|EFB90759.1| glycine betaine ABC transporter, ATP-bindin...     107  3e-22

  Roseovarius sp. TM1035 [a-proteobacteria] taxid 391613
 ref|ZP_01878709.1| ABC glycine betaine/L-proline tranporte...     107  3e-22
 gb|EDM32812.1| ABC glycine betaine/L-proline tranporter, A...     107  3e-22
 ref|ZP_01881670.1| glycine betaine/proline ABC transporter...     107  3e-22
 gb|EDM29867.1| glycine betaine/proline ABC transporter, AT...     107  3e-22
 ref|ZP_01880420.1| glycine betaine/proline ABC transporter...     104  3e-21
 gb|EDM31322.1| glycine betaine/proline ABC transporter, AT...     104  3e-21

  Burkholderia glumae BGR1 [b-proteobacteria] taxid 626418
 ref|YP_002908160.1| Glycine betaine/L-proline ABC transpor...     107  3e-22
 gb|ACR30925.1| Glycine betaine/L-proline ABC transporter, ...     107  3e-22

  Ruegeria sp. R11 [a-proteobacteria] taxid 439497
 ref|ZP_05087967.1| choline ABC transporter, ATP-binding pr...     107  3e-22
 gb|EEB69659.1| choline ABC transporter, ATP-binding protei...     107  3e-22

  Desulfovibrio aespoeensis Aspo-2 [d-proteobacteria] taxid 643562
 ref|ZP_06232677.1| glycine betaine/L-proline ABC transport...     107  3e-22
 gb|EFA66024.1| glycine betaine/L-proline ABC transporter, ...     107  3e-22

  Vibrio metschnikovii CIP 69.14 [g-proteobacteria] taxid 675813
 ref|ZP_05880495.1| L-proline Glycine Betaine ABC transport...     107  3e-22
 gb|EEX38551.1| L-proline Glycine Betaine ABC transport ATP...     107  3e-22

  uncultured marine microorganism HF4000_141F21 [unclassified] taxid 455525
 gb|ABZ06774.1| putative ABC transporter [uncultured marine...     107  3e-22

  Vibrio sp. Ex25 [g-proteobacteria] taxid 150340
 ref|ZP_04921465.1| glycine betaine/L-proline transport ATP...     107  3e-22
 ref|YP_003287838.1| L-proline Glycine Betaine ABC transpor...     107  3e-22
 gb|EDN58359.1| glycine betaine/L-proline transport ATP bin...     107  3e-22
 gb|ACY53373.1| L-proline Glycine Betaine ABC transport ATP...     107  3e-22

  Vibrio harveyi 1DA3 [g-proteobacteria] taxid 673519
 ref|ZP_06177372.1| conserved hypothetical protein [Vibrio ...     107  3e-22
 gb|EEZ86400.1| conserved hypothetical protein [Vibrio harv...     107  3e-22

  Escherichia coli O157:H7 EDL933 [enterobacteria] taxid 155864
 ref|NP_289229.1| glycine betaine transporter ATP-binding s...     107  4e-22
 gb|AAG57787.1|AE005496_10 ATP-binding component of transpo...     107  4e-22

  Escherichia coli O157:H7 str. Sakai [enterobacteria] taxid 386585
 ref|NP_311567.1| glycine betaine transporter ATP-binding s...     107  4e-22
 dbj|BAB36963.1| ATP-binding component of glycine betaine /...     107  4e-22

  Escherichia coli O157:H7 str. EC4113 [enterobacteria] taxid 444452
 ref|ZP_02775942.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU53096.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4401 [enterobacteria] taxid 478004
 ref|ZP_02780429.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU75701.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4501 [enterobacteria] taxid 478006
 ref|ZP_02787479.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU85712.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4486 [enterobacteria] taxid 478005
 ref|ZP_02793775.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU80549.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4196 [enterobacteria] taxid 444451
 ref|ZP_02799798.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU33480.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4076 [enterobacteria] taxid 444453
 ref|ZP_02803666.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU72294.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC869 [enterobacteria] taxid 478008
 ref|ZP_02812939.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU90585.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC508 [enterobacteria] taxid 478007
 ref|ZP_02825569.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDU95584.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4024 [enterobacteria] taxid 444454
 ref|ZP_03083813.1| glycine betaine transporter ATP-binding...     107  4e-22
 ref|ZP_03086208.1| glycine betaine transporter ATP-binding...     106  9e-22

  Escherichia coli O157:H7 str. EC4206 [enterobacteria] taxid 444447
 ref|ZP_03251052.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDZ78117.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4045 [enterobacteria] taxid 444448
 ref|ZP_03254439.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDZ83074.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4042 [enterobacteria] taxid 444449
 ref|ZP_03258824.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDZ86309.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. EC4115 [enterobacteria] taxid 444450
 ref|YP_002272143.1| glycine betaine/L-proline ABC transpor...     107  4e-22
 gb|ACI37270.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. TW14588 [enterobacteria] taxid 502346
 ref|ZP_03444014.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EEC28723.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Escherichia coli O157:H7 str. TW14359 [enterobacteria] taxid 544404
 ref|YP_003079461.1| glycine betaine transporter subunit, A...     107  4e-22
 gb|ACT73385.1| glycine betaine transporter subunit, ATP-bi...     107  4e-22

  Escherichia coli O157:H7 str. FRIK2000 [enterobacteria] taxid 637388
 ref|ZP_05940255.1| glycine betaine transporter subunit, AT...     107  4e-22

  Escherichia coli O157:H7 str. FRIK966 [enterobacteria] taxid 570506
 ref|ZP_05949301.1| glycine betaine transporter subunit, AT...     107  4e-22

  Escherichia coli [enterobacteria] taxid 562
 gb|ACI79427.1| ATP-binding component of glycine betaine / ...     107  4e-22
 gb|ACI79428.1| ATP-binding component of glycine betaine / ...     107  4e-22
 gb|ACI79430.1| ATP-binding component of glycine betaine / ...     107  4e-22
 gb|ACI79426.1| ATP-binding component of glycine betaine / ...     107  6e-22
 gb|AAA24427.1| proV peptide [Escherichia coli]                    107  6e-22
 gb|ACI79429.1| ATP-binding component of glycine betaine / ...     107  6e-22

  Salinispora tropica CNB-440 [high GC Gram+] taxid 369723
 ref|YP_001158484.1| glycine betaine/L-proline ABC transpor...     107  4e-22
 gb|ABP54106.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Paracoccus denitrificans PD1222 [a-proteobacteria] taxid 318586
 ref|YP_918505.1| glycine betaine/L-proline ABC transporter...     107  4e-22
 gb|ABL72809.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Shewanella baltica OS195 [g-proteobacteria] taxid 399599
 ref|YP_001554506.1| glycine betaine/L-proline ABC transpor...     107  4e-22
 gb|ABX49246.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Vibrio harveyi ATCC BAA-1116 [g-proteobacteria] taxid 338187
 ref|YP_001448682.1| glycine betaine ABC transporter ATP-bi...     107  4e-22
 gb|ABU74455.1| hypothetical protein VIBHAR_06564 [Vibrio h...     107  4e-22

  Vibrio harveyi HY01 [g-proteobacteria] taxid 410291
 ref|ZP_01984910.1| BusAA [Vibrio harveyi HY01]                    107  4e-22
 gb|EDL70409.1| BusAA [Vibrio harveyi HY01]                        107  4e-22

  Escherichia albertii TW07627 [enterobacteria] taxid 502347
 ref|ZP_02900753.1| glycine betaine/L-proline ABC transport...     107  4e-22
 gb|EDS94019.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Shewanella baltica OS185 [g-proteobacteria] taxid 402882
 ref|YP_001366234.1| glycine betaine/L-proline ABC transpor...     107  4e-22
 gb|ABS08171.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Silicibacter lacuscaerulensis ITI-1157 [a-proteobacteria] taxid 644107
 ref|ZP_05784925.1| glycine betaine transport ATP-binding p...     107  4e-22
 gb|EEX08041.1| glycine betaine transport ATP-binding prote...     107  4e-22
 ref|ZP_05786631.1| glycine betaine transport ATP-binding p...     106  6e-22
 gb|EEX09747.1| glycine betaine transport ATP-binding prote...     106  6e-22

  Shewanella baltica OS223 [g-proteobacteria] taxid 407976
 ref|YP_002358232.1| glycine betaine/L-proline ABC transpor...     107  4e-22
 gb|ACK46809.1| glycine betaine/L-proline ABC transporter, ...     107  4e-22

  Roseobacter sp. AzwK-3b [a-proteobacteria] taxid 351016
 ref|ZP_01902163.1| glycine betaine/proline ABC transporter...     107  5e-22
 gb|EDM72579.1| glycine betaine/proline ABC transporter, AT...     107  5e-22
 ref|ZP_01902486.1| ABC transporter ATP-binding protein [Ro...     104  4e-21
 gb|EDM72069.1| ABC transporter ATP-binding protein [Roseob...     104  4e-21

  Rhodobacter sphaeroides ATCC 17029 [a-proteobacteria] taxid 349101
 ref|YP_001042734.1| ABC transporter related [Rhodobacter s...     107  5e-22
 gb|ABN75962.1| ABC transporter related [Rhodobacter sphaer...     107  5e-22

  Rhodobacter sphaeroides KD131 [a-proteobacteria] taxid 557760
 ref|YP_002524851.1| ABC transporter related [Rhodobacter s...     107  5e-22
 gb|ACM00350.1| ABC transporter related [Rhodobacter sphaer...     107  5e-22

  Shewanella frigidimarina NCIMB 400 [g-proteobacteria] taxid 318167
 ref|YP_750505.1| glycine betaine/L-proline ABC transporter...     107  5e-22
 gb|ABI71667.1| glycine betaine/L-proline ABC transporter, ...     107  5e-22

  Shewanella baltica OS155 [g-proteobacteria] taxid 325240
 ref|YP_001050661.1| glycine betaine/L-proline ABC transpor...     107  5e-22
 gb|ABN61792.1| glycine betaine/L-proline ABC transporter, ...     107  5e-22

  Shigella flexneri 5 str. 8401 [enterobacteria] taxid 373384
 ref|YP_690210.1| glycine betaine transporter ATP-binding s...     107  5e-22
 gb|ABF04905.1| ATP-binding component of transport system [...     107  5e-22

  Rhodobacter sphaeroides 2.4.1 [a-proteobacteria] taxid 272943
 ref|YP_352232.1| ABC glycine betaine/L-proline tranporter,...     107  5e-22
 gb|ABA78331.1| ABC glycine betaine/L-proline tranporter, A...     107  5e-22
 ref|YP_345205.1| glycine betaine/L-proline ABC transporter...     102  1e-20
 gb|ABA81464.1| ABC Glycine betaine/L-proline transporter, ...     102  1e-20

  Enterobacter sp. 638 [enterobacteria] taxid 399742
 ref|YP_001177872.1| glycine betaine transporter ATP-bindin...     107  5e-22
 gb|ABP61821.1| glycine betaine/L-proline ABC transporter, ...     107  5e-22

  Cronobacter turicensis [enterobacteria] taxid 413502
 ref|YP_003211643.1| Glycine betaine/L-proline transport AT...     107  5e-22

  Cronobacter turicensis z3032 [enterobacteria] taxid 693216
 emb|CBA33175.1| Glycine betaine/L-proline transport ATP-bi...     107  5e-22

  Chryseobacterium gleum ATCC 35910 [CFB group bacteria] taxid 525257
 ref|ZP_03853354.1| quaternary-amine-transporting ATPase [C...     107  5e-22
 gb|EEI41899.1| quaternary-amine-transporting ATPase [Chrys...     107  5e-22

  Cronobacter sakazakii ATCC BAA-894 [enterobacteria] taxid 290339
 ref|YP_001436709.1| hypothetical protein ESA_00589 [Entero...     107  5e-22
 gb|ABU75873.1| hypothetical protein ESA_00589 [Cronobacter...     107  5e-22

  Escherichia coli 53638 [enterobacteria] taxid 344610
 ref|ZP_03000359.1| glycine betaine/L-proline ABC transport...     107  5e-22
 gb|EDU63391.1| glycine betaine/L-proline ABC transporter, ...     107  5e-22

  Escherichia fergusonii ATCC 35469 [enterobacteria] taxid 585054
 ref|YP_002381597.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAQ87954.1| glycine betaine transporter subunit ; ATP-...     107  6e-22

  Escherichia coli O127:H6 str. E2348/69 [enterobacteria] taxid 574521
 ref|YP_002330429.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAS10490.1| glycine betaine transporter subunit [Esche...     107  6e-22

  Escherichia coli HS [enterobacteria] taxid 331112
 ref|YP_001459446.1| glycine betaine transporter ATP-bindin...     107  6e-22
 gb|ABV07063.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Enterobacter cancerogenus ATCC 35316 [enterobacteria] taxid 500639
 ref|ZP_05969983.1| glycine betaine transporter ATP-binding...     107  6e-22

  Brachybacterium faecium DSM 4810 [high GC Gram+] taxid 446465
 ref|YP_003155835.1| glycine betaine/L-proline transport AT...     107  6e-22
 gb|ACU86245.1| glycine betaine/L-proline transport ATP bin...     107  6e-22

  Salmonella enterica subsp. enterica serovar Choleraesuis [enterobacteria] taxid 119912
 gb|ABB89599.1| ProV [Salmonella enterica subsp. enterica s...     107  6e-22

  Shigella dysenteriae Sd197 [enterobacteria] taxid 300267
 ref|YP_404400.1| ATP-binding component of transport system...     107  6e-22
 gb|ABB62909.1| ATP-binding component of transport system f...     107  6e-22

  Escherichia coli IAI39 [enterobacteria] taxid 585057
 ref|YP_002408801.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAR18989.1| glycine betaine transporter subunit ; ATP-...     107  6e-22

  Klebsiella pneumoniae 342 [enterobacteria] taxid 507522
 ref|YP_002236983.1| glycine betaine/L-proline ABC transpor...     107  6e-22
 gb|ACI08649.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Klebsiella variicola At-22 [enterobacteria] taxid 640131
 ref|ZP_06164943.1| glycine betaine/L-proline ABC transport...     107  6e-22
 gb|EEZ66497.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli E110019 [enterobacteria] taxid 340186
 ref|ZP_03051952.1| glycine betaine/L-proline ABC transport...     107  6e-22
 gb|EDV86157.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [enterobacteria] taxid 272620
 ref|YP_001336644.1| ATP-binding component of transport sys...     107  6e-22
 gb|ABR78414.1| ATP-binding component of transport system f...     107  6e-22

  Klebsiella pneumoniae NTUH-K2044 [enterobacteria] taxid 484021
 ref|YP_002920868.1| glycine/betaine/proline transport syst...     107  6e-22
 dbj|BAH64801.1| glycine/betaine/proline transport system A...     107  6e-22

  Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 [enterobacteria] taxid 667127
 ref|ZP_06017007.1| glycine betaine/L-proline ABC superfami...     107  6e-22
 gb|EEW39956.1| glycine betaine/L-proline ABC superfamily A...     107  6e-22

  Escherichia coli str. K-12 substr. MG1655 [enterobacteria] taxid 511145
 ref|NP_417163.1| glycine betaine transporter subunit [Esch...     107  6e-22
 gb|AAC75724.1| glycine betaine transporter subunit [Escher...     107  6e-22

  Shigella boydii Sb227 [enterobacteria] taxid 300268
 ref|YP_409188.1| glycine betaine transporter ATP-binding s...     107  6e-22
 gb|ABB67360.1| ProV [Shigella boydii Sb227]                       107  6e-22

  Escherichia coli str. K-12 substr. W3110 [enterobacteria] taxid 316407
 ref|AP_003250.1| glycine betaine transporter subunit [Esch...     107  6e-22
 dbj|BAA16542.1| glycine betaine transporter subunit [Esche...     107  6e-22

  Escherichia coli E24377A [enterobacteria] taxid 331111
 ref|YP_001463987.1| glycine betaine transporter ATP-bindin...     107  6e-22
 gb|ABV19545.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli ATCC 8739 [enterobacteria] taxid 481805
 ref|YP_001724025.1| glycine betaine transporter ATP-bindin...     107  6e-22
 gb|ACA76698.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Shigella boydii CDC 3083-94 [enterobacteria] taxid 344609
 ref|YP_001881571.1| glycine betaine/L-proline ABC transpor...     107  6e-22
 gb|ACD08027.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli E22 [enterobacteria] taxid 340185
 ref|ZP_03047045.1| glycine betaine/L-proline ABC transport...     107  6e-22
 gb|EDV81035.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli B171 [enterobacteria] taxid 344601
 ref|ZP_03060439.1| glycine betaine/L-proline ABC transport...     107  6e-22
 gb|EDX30402.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli 101-1 [enterobacteria] taxid 358709
 ref|ZP_03071508.1| glycine betaine/L-proline ABC transport...     107  6e-22
 gb|EDX37619.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Escherichia coli SE11 [enterobacteria] taxid 409438
 ref|YP_002294205.1| glycine betaine transporter ATP-bindin...     107  6e-22
 dbj|BAG78454.1| glycine/betaine/proline ABC transporter AT...     107  6e-22

  Escherichia coli IAI1 [enterobacteria] taxid 585034
 ref|YP_002388138.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAQ99599.1| glycine betaine transporter subunit ; ATP-...     107  6e-22

  Escherichia coli ED1a [enterobacteria] taxid 585397
 ref|YP_002399017.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAR09298.2| glycine betaine transporter subunit ; ATP-...     107  6e-22

  Escherichia coli 55989 [enterobacteria] taxid 585055
 ref|YP_002403941.1| glycine betaine transporter ATP-bindin...     107  6e-22
 emb|CAU98823.1| glycine betaine transporter subunit ; ATP-...     107  6e-22

  Escherichia coli BW2952 [enterobacteria] taxid 595496
 ref|YP_002927617.1| glycine betaine transporter subunit [E...     107  6e-22
 gb|ACR63364.1| glycine betaine transporter subunit [Escher...     107  6e-22

  Escherichia coli BL21(DE3) [enterobacteria] taxid 469008
 ref|YP_003035293.1| glycine betaine/L-proline ABC transpor...     107  6e-22
 emb|CAQ33014.1| proV [Escherichia coli BL21(DE3)]                 107  6e-22
 gb|ACT28108.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22
 gb|ACT44352.1| glycine betaine transporter subunit [Escher...     107  6e-22

  Escherichia sp. 1_1_43 [enterobacteria] taxid 457400
 ref|ZP_04871777.1| proV peptide [Escherichia sp. 1_1_43]          107  6e-22
 gb|EEH71364.1| proV peptide [Escherichia sp. 1_1_43]              107  6e-22

  Escherichia coli B str. REL606 [enterobacteria] taxid 413997
 ref|YP_003045722.1| glycine betaine transporter subunit [E...     107  6e-22
 gb|ACT40186.1| glycine betaine transporter subunit [Escher...     107  6e-22

  Shigella sp. D9 [enterobacteria] taxid 556266
 ref|ZP_05433406.1| glycine betaine transporter ATP-binding...     107  6e-22

  Escherichia sp. 4_1_40B [enterobacteria] taxid 457401
 ref|ZP_05438676.1| glycine betaine transporter ATP-binding...     107  6e-22

  Escherichia coli O103:H2 str. 12009 [enterobacteria] taxid 585395
 ref|YP_003223103.1| ATP-binding component of transport sys...     107  6e-22
 dbj|BAI31969.1| ATP-binding component of transport system ...     107  6e-22

  Escherichia coli O26:H11 str. 11368 [enterobacteria] taxid 573235
 ref|YP_003230679.1| ATP-binding component of transport sys...     107  6e-22
 dbj|BAI26939.1| ATP-binding component of transport system ...     107  6e-22

  Escherichia coli O111:H- str. 11128 [enterobacteria] taxid 585396
 ref|YP_003235758.1| ATP-binding component of transport sys...     107  6e-22
 dbj|BAI37207.1| ATP-binding component of transport system ...     107  6e-22

  Escherichia coli K-12 [enterobacteria] taxid 83333
 sp|P14175.1|PROV_ECOLI RecName: Full=Glycine betaine/L-pro...     107  6e-22

  Escherichia coli DH1 [enterobacteria] taxid 536056
 gb|ACX38687.1| glycine betaine/L-proline ABC transporter, ...     107  6e-22

  Agrobacterium radiobacter K84 [a-proteobacteria] taxid 311403
 ref|YP_002545197.1| proline/glycine betaine ABC transporte...     106  6e-22
 gb|ACM27267.1| proline/glycine betaine ABC transporter [Ag...     106  6e-22
 ref|YP_002541082.1| glycine betaine/L-proline ABC transpor...     105  2e-21
 gb|ACM29485.1| glycine betaine/L-proline ABC transporter [...     105  2e-21

  Salmonella enterica subsp. enterica serovar Infantis [enterobacteria] taxid 595
 gb|ABB89591.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Paratyphi C [enterobacteria] taxid 57046
 gb|ABB89592.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22
 gb|ABB89601.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Senftenberg [enterobacteria] taxid 28150
 gb|ABB89594.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Typhimurium [enterobacteria] taxid 90371
 gb|ABB89595.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22
 gb|AAA88621.1| proV [Salmonella enterica subsp. enterica s...     106  6e-22
 sp|P17328.2|PROV_SALTY RecName: Full=Glycine betaine/L-pro...     106  7e-22
 emb|CAA36921.1| unnamed protein product [Salmonella typhim...     106  7e-22

  Salmonella enterica subsp. enterica serovar Paratyphi B [enterobacteria] taxid 57045
 gb|ABB89596.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22
 gb|ABB89598.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Derby [enterobacteria] taxid 28144
 gb|ABB89597.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Schwarzengrund [enterobacteria] taxid 340190
 gb|ABB89600.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Montevideo [enterobacteria] taxid 115981
 gb|ABB89602.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Newport [enterobacteria] taxid 108619
 gb|ABB89603.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Salmonella enterica subsp. enterica serovar Panama [enterobacteria] taxid 29472
 gb|ABB89590.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Shigella dysenteriae 1012 [enterobacteria] taxid 358708
 ref|ZP_03065254.1| glycine betaine/L-proline ABC transport...     106  6e-22
 gb|EDX34784.1| glycine betaine/L-proline ABC transporter, ...     106  6e-22

  Shigella sonnei Ss046 [enterobacteria] taxid 300269
 ref|YP_311667.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|AAZ89432.1| ATP-binding component of transport system f...     106  6e-22

  Shigella flexneri 2a str. 2457T [enterobacteria] taxid 198215
 ref|NP_838215.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|AAP18025.1| glycine betaine/L-proline transport ATP-bin...     106  6e-22

  Shigella flexneri 2a str. 301 [enterobacteria] taxid 198214
 ref|NP_708491.2| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|AAN44198.2| glycine betaine/L-proline transport ATP-bin...     106  6e-22

  Escherichia coli B7A [enterobacteria] taxid 340184
 ref|ZP_03028917.1| glycine betaine/L-proline ABC transport...     106  6e-22
 gb|EDV62606.1| glycine betaine/L-proline ABC transporter, ...     106  6e-22

  Escherichia coli CFT073 [enterobacteria] taxid 199310
 ref|NP_755112.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|AAN81682.1|AE016765_84 Glycine betaine/L-proline transp...     106  6e-22

  Escherichia coli UTI89 [enterobacteria] taxid 364106
 ref|YP_542024.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|ABE08493.1| glycine betaine/L-proline transport ATP-bin...     106  6e-22

  Escherichia coli 536 [enterobacteria] taxid 362663
 ref|YP_670533.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|ABG70632.1| glycine betaine/L-proline transport ATP-bin...     106  6e-22

  Escherichia coli APEC O1 [enterobacteria] taxid 405955
 ref|YP_853854.1| glycine betaine transporter ATP-binding s...     106  6e-22
 gb|ABJ02112.1| ATP-binding component of transport system f...     106  6e-22

  Escherichia coli F11 [enterobacteria] taxid 340197
 ref|ZP_03033007.1| glycine betaine/L-proline ABC transport...     106  6e-22
 gb|EDV67982.1| glycine betaine/L-proline ABC transporter, ...     106  6e-22

  Escherichia coli S88 [enterobacteria] taxid 585035
 ref|YP_002392582.1| glycine betaine transporter ATP-bindin...     106  6e-22
 emb|CAR04190.1| glycine betaine transporter subunit ; ATP-...     106  6e-22

  Escherichia coli UMN026 [enterobacteria] taxid 585056
 ref|YP_002413696.1| glycine betaine transporter ATP-bindin...     106  6e-22
 emb|CAR14174.1| glycine betaine transporter subunit ; ATP-...     106  6e-22

  Escherichia coli 83972 [enterobacteria] taxid 525281
 ref|ZP_04006016.1| quaternary-amine-transporting ATPase [E...     106  6e-22
 gb|EEJ45317.1| quaternary-amine-transporting ATPase [Esche...     106  6e-22

  Shigella flexneri 2002017 [enterobacteria] taxid 591020
 gb|ADA75037.1| Glycine betaine/L-proline transport ATP-bin...     106  6e-22

  Citrobacter sp. 30_2 [enterobacteria] taxid 469595
 ref|ZP_04560117.1| glycine betaine transporter ATP-binding...     106  6e-22
 gb|EEH94160.1| glycine betaine transporter ATP-binding sub...     106  6e-22

  Salmonella enterica subsp. enterica serovar Paratyphi A [enterobacteria] taxid 54388
 gb|ABB89593.1| ProV [Salmonella enterica subsp. enterica s...     106  6e-22

  Escherichia coli SMS-3-5 [enterobacteria] taxid 439855
 ref|YP_001744828.1| glycine betaine/L-proline ABC transpor...     106  6e-22
 gb|ACB15501.1| glycine betaine/L-proline ABC transporter, ...     106  6e-22

  Escherichia coli SE15 [enterobacteria] taxid 431946
 dbj|BAI56014.1| glycine/betaine/proline ABC transporter AT...     106  6e-22

  Vibrio sp. AND4 [g-proteobacteria] taxid 314289
 ref|ZP_02195250.1| putative glycine betaine ABC transporte...     106  6e-22
 gb|EDP59640.1| putative glycine betaine ABC transporter AT...     106  6e-22

  Citrobacter koseri ATCC BAA-895 [enterobacteria] taxid 290338
 ref|YP_001455535.1| glycine betaine transporter ATP-bindin...     106  6e-22
 gb|ABV15099.1| hypothetical protein CKO_04027 [Citrobacter...     106  6e-22

  Rhodobacterales bacterium HTCC2654 [a-proteobacteria] taxid 314271
 ref|ZP_01013614.1| hypothetical protein RB2654_07089 [Rhod...     106  7e-22
 gb|EAQ12856.1| hypothetical protein RB2654_07089 [Rhodobac...     106  7e-22

  Salmonella enterica subsp. enterica serovar Newport str. SL317 [enterobacteria] taxid 454168
 ref|ZP_02697988.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDX52003.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 [enterobacteria] taxid 295319
 ref|YP_151842.1| glycine betaine transporter ATP-binding s...     106  7e-22
 gb|AAV78530.1| ABC superfamily (atp_bind), glycine/betaine...     106  7e-22

  Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 [enterobacteria] taxid 554290
 ref|YP_002143332.1| glycine betaine transporter ATP-bindin...     106  7e-22
 emb|CAR60722.1| ABC superfamily (atp_bind),glycine/betaine...     106  7e-22

  Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [enterobacteria] taxid 99287
 ref|NP_461735.1| glycine betaine transporter ATP-binding s...     106  7e-22
 gb|AAL21694.1| glycine/betaine/proline transport protein [...     106  7e-22

  Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 [enterobacteria] taxid 321314
 ref|YP_217730.1| glycine betaine transporter ATP-binding s...     106  7e-22
 gb|AAX66649.1| ABC superfamily (atp_bind), glycine/betaine...     106  7e-22

  Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- [enterobacteria] taxid 41514
 ref|YP_001569253.1| glycine betaine transporter ATP-bindin...     106  7e-22
 gb|ABX20111.1| hypothetical protein SARI_00164 [Salmonella...     106  7e-22

  Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 [enterobacteria] taxid 272994
 ref|YP_001589669.1| glycine betaine transporter ATP-bindin...     106  7e-22
 gb|ABX68836.1| hypothetical protein SPAB_03489 [Salmonella...     106  7e-22

  Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 [enterobacteria] taxid 439847
 ref|ZP_02346444.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ10506.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 [enterobacteria] taxid 440534
 ref|ZP_02573628.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ16095.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 [enterobacteria] taxid 454231
 ref|ZP_02658828.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ18957.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 [enterobacteria] taxid 454165
 ref|ZP_02663782.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDY27853.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 [enterobacteria] taxid 454164
 ref|ZP_02669538.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ23295.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 [enterobacteria] taxid 465516
 ref|ZP_02684056.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ35642.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 [enterobacteria] taxid 465518
 ref|ZP_02834876.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ27533.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Newport str. SL254 [enterobacteria] taxid 423368
 ref|YP_002042054.1| glycine betaine/L-proline ABC transpor...     106  7e-22
 gb|ACF61130.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 [enterobacteria] taxid 454169
 ref|YP_002046772.1| glycine betaine transporter ATP-bindin...     106  7e-22
 gb|ACF68930.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 [enterobacteria] taxid 439842
 ref|ZP_03076938.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDX46157.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 [enterobacteria] taxid 439843
 ref|YP_002115765.1| glycine betaine/L-proline ABC transpor...     106  7e-22
 gb|ACF91386.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Agona str. SL483 [enterobacteria] taxid 454166
 ref|YP_002147709.1| glycine betaine/L-proline ABC transpor...     106  7e-22
 gb|ACH52148.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 [enterobacteria] taxid 439846
 ref|ZP_03164041.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDY24842.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 [enterobacteria] taxid 439851
 ref|YP_002216785.1| glycine betaine/L-proline ABC transpor...     106  7e-22
 gb|ACH77234.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Virchow str. SL491 [enterobacteria] taxid 465517
 ref|ZP_03215287.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ04318.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 [enterobacteria] taxid 454167
 ref|ZP_03220796.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EDZ06641.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 [enterobacteria] taxid 550538
 ref|YP_002227560.1| glycine betaine transporter ATP-bindin...     106  7e-22
 emb|CAR38526.1| glycine betaine/l-proline transport ATP-bi...     106  7e-22

  Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 [enterobacteria] taxid 550537
 ref|YP_002244729.1| glycine betaine transporter ATP-bindin...     106  7e-22
 emb|CAR34234.1| glycine betaine/l-proline transport ATP-bi...     106  7e-22

  Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 [enterobacteria] taxid 476213
 ref|YP_002638391.1| ABC superfamily (atp_bind), glycine/be...     106  7e-22
 gb|ACN46950.1| ABC superfamily (atp_bind), glycine/betaine...     106  7e-22

  Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 [enterobacteria] taxid 573395
 ref|ZP_04653417.1| glycine betaine transporter ATP-binding...     106  7e-22

  Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 [enterobacteria] taxid 568708
 emb|CBG25783.1| glycine betaine/L-proline transport ATP-bi...     106  7e-22

  Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S [enterobacteria] taxid 588858
 gb|ACY89810.1| glycine betaine transporter ATP-binding sub...     106  7e-22

  Vibrio alginolyticus 40B [g-proteobacteria] taxid 674977
 ref|ZP_06181369.1| conserved hypothetical protein [Vibrio ...     106  7e-22
 gb|EEZ82355.1| conserved hypothetical protein [Vibrio algi...     106  7e-22

  uncultured marine microorganism HF4000_009A22 [unclassified] taxid 455514
 gb|ABZ06360.1| putative ABC transporter [uncultured marine...     106  7e-22

  Saccharopolyspora erythraea NRRL 2338 [high GC Gram+] taxid 405948
 ref|YP_001104455.1| putative glycine betaine/proline ABC t...     106  7e-22
 emb|CAM01530.1| putative glycine betaine/proline ABC trans...     106  7e-22
 ref|YP_001104633.1| putative glycine betaine/proline ABC t...     105  2e-21
 emb|CAM01708.1| putative glycine betaine/proline ABC trans...     105  2e-21

  Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 [enterobacteria] taxid 496068
 ref|ZP_03372671.1| glycine betaine transporter ATP-binding...     106  7e-22

  Pantoea sp. At-9b [enterobacteria] taxid 592316
 ref|ZP_05727855.1| glycine betaine/L-proline ABC transport...     106  7e-22
 gb|EEW04051.1| glycine betaine/L-proline ABC transporter, ...     106  7e-22

  Vibrio alginolyticus 12G01 [g-proteobacteria] taxid 314288
 ref|ZP_01259418.1| putative glycine betaine ABC transporte...     106  7e-22
 gb|EAS77332.1| putative glycine betaine ABC transporter AT...     106  7e-22

  Acidovorax avenae subsp. avenae ATCC 19860 [b-proteobacteria] taxid 643561
 ref|ZP_06208757.1| glycine betaine/L-proline ABC transport...     106  8e-22
 gb|EFA41964.1| glycine betaine/L-proline ABC transporter, ...     106  8e-22

  Vibrio coralliilyticus ATCC BAA-450 [g-proteobacteria] taxid 675814
 ref|ZP_05887068.1| L-proline Glycine Betaine ABC transport...     106  8e-22
 gb|EEX32473.1| L-proline Glycine Betaine ABC transport ATP...     106  8e-22

  Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 [enterobacteria] taxid 497976
 ref|ZP_03349391.1| glycine betaine transporter ATP-binding...     106  8e-22

  Acidovorax citrulli AAC00-1 [b-proteobacteria] taxid 397945
 ref|YP_969861.1| glycine betaine/L-proline ABC transporter...     106  9e-22
 gb|ABM32087.1| glycine betaine/L-proline ABC transporter, ...     106  9e-22

  Desulfitobacterium hafniense DCB-2 [firmicutes] taxid 272564
 ref|YP_002458777.1| glycine betaine/L-proline ABC transpor...     106  9e-22
 gb|ACL20341.1| glycine betaine/L-proline ABC transporter, ...     106  9e-22

  Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 [high GC Gram+] taxid 446468
 ref|ZP_04331052.1| glycine betaine/L-proline transport ATP...     106  1e-21
 gb|EEK36943.1| glycine betaine/L-proline transport ATP bin...     106  1e-21

  Desulfitobacterium hafniense Y51 [firmicutes] taxid 138119
 ref|YP_517454.1| hypothetical protein DSY1221 [Desulfitoba...     105  1e-21
 dbj|BAE83010.1| hypothetical protein [Desulfitobacterium h...     105  1e-21

  Erwinia tasmaniensis Et1/99 [enterobacteria] taxid 465817
 ref|YP_001906879.1| Glycine betaine/L-proline transport AT...     105  1e-21
 emb|CAO95981.1| Glycine betaine/L-proline transport ATP-bi...     105  1e-21

  Erwinia pyrifoliae Ep1/96 [enterobacteria] taxid 634499
 ref|YP_002647943.1| Glycine betaine/L-proline transport AT...     105  1e-21
 emb|CAX54693.1| Glycine betaine/L-proline transport ATP-bi...     105  1e-21

  Rhodobacterales bacterium Y4I [a-proteobacteria] taxid 439496
 ref|ZP_05078031.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDZ46010.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis FV-1 [enterobacteria] taxid 375450
 ref|ZP_02333423.1| glycine betaine/L-proline transport ATP...     105  1e-21

  Yersinia pestis biovar Orientalis str. PEXU2 [enterobacteria] taxid 547046
 ref|ZP_04458359.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|EEO84613.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pseudotuberculosis IP 32953 [enterobacteria] taxid 273123
 ref|YP_071465.1| ABC glycine/betaine/L-proline transporter...     105  1e-21
 emb|CAH22197.1| ABC glycine/betaine/L-proline transporter,...     105  1e-21

  Yersinia pestis Antiqua [enterobacteria] taxid 360102
 ref|YP_652285.1| glycine betaine/L-proline transport ATP-b...     105  1e-21
 gb|ABG14340.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis Nepal516 [enterobacteria] taxid 377628
 ref|YP_647063.1| glycine betaine/L-proline transport ATP-b...     105  1e-21
 ref|ZP_04516663.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|ABG17463.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21
 gb|EEO77564.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis Pestoides F [enterobacteria] taxid 386656
 ref|YP_001162983.1| glycine betaine/L-proline transport AT...     105  1e-21
 gb|ABP40010.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis CA88-4125 [enterobacteria] taxid 412420
 ref|ZP_01887493.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|EDM41945.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pseudotuberculosis IP 31758 [enterobacteria] taxid 349747
 ref|YP_001400042.1| glycine betaine/L-proline ABC transpor...     105  1e-21
 gb|ABS48727.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Orientalis str. F1991016 [enterobacteria] taxid 404214
 ref|ZP_02221105.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR40031.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Orientalis str. IP275 [enterobacteria] taxid 373665
 ref|ZP_02228466.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR30786.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Antiqua str. E1979001 [enterobacteria] taxid 360099
 ref|ZP_02229431.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR45216.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Antiqua str. B42003004 [enterobacteria] taxid 404215
 ref|ZP_02238349.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR50725.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Antiqua str. UG05-0454 [enterobacteria] taxid 404218
 ref|ZP_02304734.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR63122.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Orientalis str. MG05-1020 [enterobacteria] taxid 404217
 ref|ZP_02313114.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR56871.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis biovar Mediaevalis str. K1973002 [enterobacteria] taxid 404216
 ref|ZP_02315545.1| glycine betaine/L-proline ABC transport...     105  1e-21
 gb|EDR67708.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pseudotuberculosis YPIII [enterobacteria] taxid 502800
 ref|YP_001719866.1| glycine betaine/L-proline ABC transpor...     105  1e-21
 gb|ACA67413.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pseudotuberculosis PB1/+ [enterobacteria] taxid 502801
 ref|YP_001873490.1| glycine betaine/L-proline ABC transpor...     105  1e-21
 gb|ACC90033.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Yersinia pestis CO92 [enterobacteria] taxid 214092
 ref|YP_002347599.1| glycine betaine/L-proline transport AT...     105  1e-21
 emb|CAL21268.1| glycine betaine/L-proline transport ATP-bi...     105  1e-21

  Yersinia pestis Pestoides A [enterobacteria] taxid 545431
 ref|ZP_04510626.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|EEO89636.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis biovar Orientalis str. India 195 [enterobacteria] taxid 547047
 ref|ZP_04513833.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|EEO80307.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis KIM D27 [enterobacteria] taxid 687916
 ref|ZP_06206802.1| glycine betaine/L-proline transport ATP...     105  1e-21
 gb|EFA49009.1| glycine betaine/L-proline transport ATP bin...     105  1e-21

  Yersinia pestis D106004 [enterobacteria] taxid 637382
 gb|ACY59284.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis D182038 [enterobacteria] taxid 637385
 gb|ACY62989.1| glycine betaine/L-proline transport ATP-bin...     105  1e-21

  Yersinia pestis Angola [enterobacteria] taxid 349746
 ref|YP_001607864.1| glycine betaine/L-proline transport AT...     105  1e-21
 gb|ABX86761.1| glycine betaine/L-proline ABC transporter, ...     105  1e-21

  Fulvimarina pelagi HTCC2506 [a-proteobacteria] taxid 314231
 ref|ZP_01438252.1| glycine betaine ABC transporter (ATP-bi...     105  1e-21
 gb|EAU43249.1| glycine betaine ABC transporter (ATP-bindin...     105  1e-21
 ref|ZP_01438044.1| ABC glycine betaine/L-proline tranporte...     104  4e-21
 gb|EAU43041.1| ABC glycine betaine/L-proline tranporter, A...     104  4e-21

  Bermanella marisrubri [g-proteobacteria] taxid 207949
 ref|ZP_01307060.1| ABC-type proline/glycine betaine transp...     105  1e-21
 gb|EAT12298.1| ABC-type proline/glycine betaine transport ...     105  1e-21
 ref|ZP_01305511.1| ABC-type proline/glycine betaine transp...     104  2e-21
 gb|EAT13577.1| ABC-type proline/glycine betaine transport ...     104  2e-21

  Anaerococcus hydrogenalis DSM 7454 [firmicutes] taxid 561177
 ref|ZP_03304443.1| hypothetical protein ANHYDRO_00852 [Ana...     105  1e-21
 gb|EEB36551.1| hypothetical protein ANHYDRO_00852 [Anaeroc...     105  1e-21

  Yersinia pestis KIM 10 [enterobacteria] taxid 187410
 ref|NP_668546.1| glycine betaine/L-proline transport ATP-b...     105  2e-21
 gb|AAM84797.1|AE013725_10 ATP-binding component of high af...     105  2e-21

  Yersinia pestis biovar Microtus str. 91001 [enterobacteria] taxid 229193
 ref|NP_993773.1| glycine betaine/L-proline transport ATP-b...     105  2e-21
 gb|AAS62650.1| glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Moritella sp. PE36 [g-proteobacteria] taxid 58051
 ref|ZP_01896937.1| putative glycine betaine ABC transporte...     105  2e-21
 gb|EDM68748.1| putative glycine betaine ABC transporter AT...     105  2e-21

  Yersinia intermedia ATCC 29909 [enterobacteria] taxid 349965
 ref|ZP_04638044.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEQ17773.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Yersinia ruckeri ATCC 29473 [enterobacteria] taxid 527005
 ref|ZP_04617046.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEP98462.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Yersinia frederiksenii ATCC 33641 [enterobacteria] taxid 349966
 ref|ZP_04633907.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEQ13462.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Yersinia kristensenii ATCC 33638 [enterobacteria] taxid 527012
 ref|ZP_04623636.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEP91720.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Yersinia aldovae ATCC 35236 [enterobacteria] taxid 527002
 ref|ZP_04620338.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEP95135.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Yersinia rohdei ATCC 43380 [enterobacteria] taxid 527004
 ref|ZP_04611977.1| Glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEQ03624.1| Glycine betaine/L-proline transport ATP-bin...     105  2e-21

  Variovorax paradoxus S110 [b-proteobacteria] taxid 543728
 ref|YP_002944413.1| glycine betaine/L-proline ABC transpor...     105  2e-21
 gb|ACS19147.1| glycine betaine/L-proline ABC transporter, ...     105  2e-21

  Meiothermus ruber DSM 1279 [bacteria] taxid 504728
 ref|ZP_04039666.1| glycine betaine/L-proline transport ATP...     105  2e-21
 gb|EEJ87489.1| glycine betaine/L-proline transport ATP bin...     105  2e-21

  Shewanella sediminis HAW-EB3 [g-proteobacteria] taxid 425104
 ref|YP_001475969.1| putative glycine betaine ABC transport...     104  2e-21
 gb|ABV38841.1| putative glycine betaine ABC transporter AT...     104  2e-21

  Burkholderia vietnamiensis G4 [b-proteobacteria] taxid 269482
 ref|YP_001115925.1| glycine betaine/L-proline ABC transpor...     104  2e-21
 gb|ABO56460.1| glycine betaine/L-proline ABC transporter, ...     104  2e-21

  Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 [d-proteobacteria] taxid 525146
 ref|YP_002479410.1| glycine betaine/L-proline ABC transpor...     104  2e-21
 gb|ACL48732.1| glycine betaine/L-proline ABC transporter, ...     104  2e-21

  Ralstonia solanacearum GMI1000 [b-proteobacteria] taxid 267608
 ref|NP_521627.1| putative glycine betaine/L-proline ATP-bi...     104  2e-21
 emb|CAD17217.1| putative glycine betaine/l-proline atp-bin...     104  2e-21

  Corynebacterium genitalium ATCC 33030 [high GC Gram+] taxid 585529
 ref|ZP_05708268.1| ABC superfamily ATP binding cassette tr...     104  3e-21
 gb|EEV90434.1| ABC superfamily ATP binding cassette transp...     104  3e-21

  Burkholderia cenocepacia AU 1054 [b-proteobacteria] taxid 331271
 ref|YP_623063.1| glycine betaine/L-proline transport ATP b...     104  3e-21
 gb|ABF78090.1| glycine betaine/L-proline transport ATP bin...     104  3e-21

  Burkholderia cenocepacia HI2424 [b-proteobacteria] taxid 331272
 ref|YP_838798.1| glycine betaine/L-proline ABC transporter...     104  3e-21
 gb|ABK11905.1| glycine betaine/L-proline ABC transporter, ...     104  3e-21

  Burkholderia cenocepacia MC0-3 [b-proteobacteria] taxid 406425
 ref|YP_001778727.1| glycine betaine/L-proline ABC transpor...     104  3e-21
 gb|ACA94237.1| glycine betaine/L-proline ABC transporter, ...     104  3e-21

  Populus trichocarpa (black cottonwood, ...) [eudicots] taxid 3694
 gb|EEF11067.1| predicted protein [Populus trichocarpa]            104  3e-21

  Desulfuromonas acetoxidans DSM 684 [d-proteobacteria] taxid 281689
 ref|ZP_01311395.1| glycine betaine/L-proline transport ATP...     104  3e-21
 gb|EAT17090.1| glycine betaine/L-proline transport ATP bin...     104  3e-21

  Citrobacter rodentium ICC168 [enterobacteria] taxid 637910
 emb|CBG89858.1| glycine betaine/L-proline ABC transporter,...     104  3e-21

  Burkholderia ubonensis Bu [b-proteobacteria] taxid 441166
 ref|ZP_02376483.1| ABC glycine betaine/L-proline transport...     104  3e-21

  Chromohalobacter salexigens DSM 3043 [g-proteobacteria] taxid 290398
 ref|YP_573954.1| glycine betaine/L-proline transport ATP b...     104  3e-21
 gb|ABE59255.1| glycine betaine/L-proline transport ATP bin...     104  3e-21

  Yersinia enterocolitica subsp. enterocolitica 8081 [enterobacteria] taxid 393305
 ref|YP_001005263.1| glycine betaine/L-proline transport AT...     104  3e-21
 emb|CAL11026.1| glycine betaine/L-proline transport ATP-bi...     104  3e-21

  Yersinia enterocolitica [enterobacteria] taxid 630
 gb|AAS78507.1| glycine betaine/L-proline transport protein...     104  3e-21

  Agrobacterium vitis S4 [a-proteobacteria] taxid 311402
 ref|YP_002549857.1| ABC transporter nucleotide binding/ATP...     104  3e-21
 gb|ACM36849.1| ABC transporter nucleotide binding/ATPase p...     104  3e-21

  Reinekea blandensis MED297 [g-proteobacteria] taxid 314283
 ref|ZP_01115122.1| ABC-type proline/glycine betaine transp...     104  3e-21
 gb|EAR08830.1| ABC-type proline/glycine betaine transport ...     104  3e-21
 ref|ZP_01116735.1| ABC glycine/betaine/L-proline transport...     103  6e-21
 gb|EAR07300.1| ABC glycine/betaine/L-proline transporter, ...     103  6e-21

  Burkholderia cenocepacia PC184 [b-proteobacteria] taxid 350702
 ref|ZP_04943234.1| Glycine betaine/L-proline transport ATP...     104  3e-21
 gb|EAY66405.1| Glycine betaine/L-proline transport ATP-bin...     104  3e-21

  Dickeya zeae Ech1591 [enterobacteria] taxid 561229
 ref|YP_003003223.1| glycine betaine/L-proline ABC transpor...     104  4e-21
 gb|ACT05744.1| glycine betaine/L-proline ABC transporter, ...     104  4e-21

  Photorhabdus luminescens subsp. laumondii TTO1 [enterobacteria] taxid 243265
 ref|NP_928594.1| glycine betaine/L-proline transport ATP-b...     104  4e-21
 emb|CAE13577.1| Glycine betaine/L-proline transport ATP-bi...     104  4e-21

  Halorhodospira halophila SL1 [g-proteobacteria] taxid 349124
 ref|YP_001001829.1| glycine betaine/L-proline ABC transpor...     104  4e-21
 gb|ABM61027.1| glycine betaine/L-proline ABC transporter, ...     104  4e-21

  Marinomonas sp. MED121 [g-proteobacteria] taxid 314277
 ref|ZP_01076576.1| putative glycine betaine ABC transporte...     103  4e-21
 gb|EAQ65183.1| putative glycine betaine ABC transporter AT...     103  4e-21
 ref|ZP_01077881.1| glycine betaine/L-proline ABC transport...     103  4e-21
 gb|EAQ64074.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Escherichia sp. 3_2_53FAA [enterobacteria] taxid 469598
 ref|ZP_04537182.1| glycine betaine/L-proline transport ATP...     103  4e-21
 gb|EEH86000.1| glycine betaine/L-proline transport ATP-bin...     103  4e-21

  Shewanella woodyi ATCC 51908 [g-proteobacteria] taxid 392500
 ref|YP_001760226.1| glycine betaine/L-proline ABC transpor...     103  4e-21
 gb|ACA86131.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Chelativorans sp. BNC1 [a-proteobacteria] taxid 266779
 ref|YP_675078.1| glycine betaine/L-proline ABC transporter...     103  4e-21
 gb|ABG63913.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Geodermatophilus obscurus DSM 43160 [high GC Gram+] taxid 526225
 ref|ZP_03891384.1| glycine betaine/L-proline transport ATP...     103  4e-21
 gb|EEI32310.1| glycine betaine/L-proline transport ATP bin...     103  4e-21

  Dickeya dadantii Ech586 [enterobacteria] taxid 590409
 ref|YP_003334819.1| glycine betaine/L-proline ABC transpor...     103  4e-21
 gb|ACZ78113.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Desulfococcus oleovorans Hxd3 [d-proteobacteria] taxid 96561
 ref|YP_001530645.1| glycine betaine/L-proline ABC transpor...     103  4e-21
 gb|ABW68568.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Delftia acidovorans SPH-1 [b-proteobacteria] taxid 398578
 ref|YP_001563691.1| glycine betaine/L-proline ABC transpor...     103  4e-21
 gb|ABX35306.1| glycine betaine/L-proline ABC transporter, ...     103  4e-21

  Burkholderia sp. 383 [b-proteobacteria] taxid 269483
 ref|YP_371213.1| ABC glycine betaine/L-proline transporter...     103  4e-21
 gb|ABB10569.1| ABC glycine betaine/L-proline transporter, ...     103  4e-21

  Burkholderia ambifaria MEX-5 [b-proteobacteria] taxid 396597
 ref|ZP_02906066.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EDT42843.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Shewanella pealeana ATCC 700345 [g-proteobacteria] taxid 398579
 ref|YP_001500118.1| glycine betaine/L-proline ABC transpor...     103  5e-21
 gb|ABV85583.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Burkholderia sp. CCGE1001 [b-proteobacteria] taxid 640510
 ref|ZP_06295416.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EFB09030.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Photobacterium profundum 3TCK [g-proteobacteria] taxid 314280
 ref|ZP_01218076.1| putative glycine betaine ABC transporte...     103  5e-21
 gb|EAS45669.1| putative glycine betaine ABC transporter AT...     103  5e-21

  Rhizobium leguminosarum bv. viciae 3841 [a-proteobacteria] taxid 216596
 ref|YP_770374.1| putative glycine betaine/L-proline transp...     103  5e-21
 emb|CAK10304.1| putative glycine betaine/L-proline transpo...     103  5e-21
 ref|YP_769115.1| putative ATP-binding component of ABC tra...     103  5e-21
 emb|CAK09023.1| putative ATP-binding component of ABC tran...     103  5e-21
 ref|YP_765037.1| putative ATP-binding component of ABC tra...     102  9e-21
 emb|CAK12241.1| putative ATP-binding component of ABC tran...     102  9e-21

  Burkholderia multivorans CGD2M [b-proteobacteria] taxid 513053
 ref|ZP_03573308.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EEE12012.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21
 ref|ZP_03573743.1| glycine betaine/L-proline transport ATP...     103  5e-21
 gb|EEE11680.1| glycine betaine/L-proline transport ATP-bin...     103  5e-21

  Burkholderia multivorans CGD2 [b-proteobacteria] taxid 513052
 ref|ZP_03578960.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EEE06391.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21
 ref|ZP_03579909.1| glycine betaine/L-proline transport ATP...     103  5e-21
 gb|EEE05408.1| glycine betaine/L-proline transport ATP-bin...     103  5e-21

  Burkholderia multivorans CGD1 [b-proteobacteria] taxid 513051
 ref|ZP_03582285.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EEE02458.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Burkholderia multivorans ATCC 17616 [b-proteobacteria] taxid 395019
 ref|YP_001583461.1| glycine betaine/L-proline ABC transpor...     103  5e-21
 ref|YP_001949412.1| glycine betaine/proline transport syst...     103  5e-21
 gb|ABX17169.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21
 dbj|BAG46876.1| glycine betaine/proline transport system A...     103  5e-21

  Burkholderia graminis C4D1M [b-proteobacteria] taxid 396598
 ref|ZP_02886821.1| glycine betaine/L-proline ABC transport...     103  5e-21
 gb|EDT07662.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Pectobacterium carotovorum subsp. carotovorum PC1 [enterobacteria] taxid 561230
 ref|YP_003018872.1| glycine betaine/L-proline ABC transpor...     103  5e-21
 gb|ACT14336.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21

  Pectobacterium carotovorum subsp. carotovorum WPP14 [enterobacteria] taxid 558270
 ref|ZP_03833923.1| glycine betaine/L-proline transport ATP...     103  5e-21

  Burkholderia ambifaria AMMD [b-proteobacteria] taxid 339670
 ref|YP_777643.1| glycine betaine/L-proline ABC transporter...     103  5e-21
 gb|ABI91309.1| glycine betaine/L-proline ABC transporter, ...     103  5e-21
 ref|YP_776451.1| glycine betaine/L-proline ABC transporter...     103  7e-21
 gb|ABI90117.1| glycine betaine/L-proline ABC transporter, ...     103  7e-21

  Serratia odorifera 4Rx13 [enterobacteria] taxid 682634
 ref|ZP_06193624.1| transporter [Serratia odorifera 4Rx13]         103  6e-21
 gb|EFA13870.1| transporter [Serratia odorifera 4Rx13]             103  6e-21

  Rhizobium leguminosarum bv. trifolii WSM1325 [a-proteobacteria] taxid 395491
 ref|YP_002976889.1| ABC transporter related [Rhizobium leg...     103  6e-21
 gb|ACS57350.1| ABC transporter related [Rhizobium legumino...     103  6e-21
 ref|YP_002973028.1| glycine betaine/L-proline ABC transpor...     102  9e-21
 gb|ACS59067.1| glycine betaine/L-proline ABC transporter, ...     102  9e-21

  Neptuniibacter caesariensis [g-proteobacteria] taxid 207954
 ref|ZP_01168318.1| putative glycine betaine ABC transporte...     103  6e-21
 gb|EAR59600.1| putative glycine betaine ABC transporter AT...     103  6e-21

  Providencia stuartii ATCC 25827 [enterobacteria] taxid 471874
 ref|ZP_02959587.1| hypothetical protein PROSTU_01457 [Prov...     103  6e-21
 gb|EDU58291.1| hypothetical protein PROSTU_01457 [Providen...     103  6e-21

  Rhizobium etli CIAT 652 [a-proteobacteria] taxid 491916
 ref|YP_001985203.1| probable glycine betaine/L-proline ABC...     103  6e-21
 gb|ACE94653.1| probable glycine betaine/L-proline ABC tran...     103  6e-21
 ref|YP_001979371.1| proline/glycine betaine ABC transporte...     102  1e-20
 gb|ACE92193.1| proline/glycine betaine ABC transporter, AT...     102  1e-20

  Roseobacter sp. GAI101 [a-proteobacteria] taxid 391589
 ref|ZP_05101742.1| choline ABC transporter, ATP-binding pr...     103  6e-21
 gb|EEB86044.1| choline ABC transporter, ATP-binding protei...     103  6e-21

  Photobacterium profundum SS9 [g-proteobacteria] taxid 298386
 ref|YP_133447.1| putative glycine betaine ABC transporter ...     103  6e-21
 emb|CAG23647.1| putative glycine betaine ABC transporter A...     103  6e-21

  Burkholderia sp. H160 [b-proteobacteria] taxid 516466
 ref|ZP_03269605.1| glycine betaine/L-proline ABC transport...     103  6e-21
 gb|EDZ98823.1| glycine betaine/L-proline ABC transporter, ...     103  6e-21

  Serratia proteamaculans 568 [enterobacteria] taxid 399741
 ref|YP_001479957.1| glycine betaine/L-proline ABC transpor...     103  6e-21
 gb|ABV42829.1| glycine betaine/L-proline ABC transporter, ...     103  6e-21
 ref|YP_001477034.1| ABC transporter-related protein [Serra...     103  8e-21
 gb|ABV39906.1| ABC transporter-related protein [Serratia p...     103  8e-21

  Pectobacterium atrosepticum SCRI1043 [enterobacteria] taxid 218491
 ref|YP_051590.1| glycine betaine/L-proline transport ATP-b...     103  6e-21
 emb|CAG76400.1| glycine betaine/L-proline transport ATP-bi...     103  6e-21

  Pectobacterium wasabiae WPP163 [enterobacteria] taxid 561231
 ref|YP_003260820.1| glycine betaine/L-proline ABC transpor...     103  6e-21
 gb|ACX89213.1| glycine betaine/L-proline ABC transporter, ...     103  6e-21

  Rhizobium etli GR56 [a-proteobacteria] taxid 526947
 ref|ZP_03520692.1| probable glycine betaine/L-proline ABC ...     103  7e-21

  Photobacterium damselae subsp. damselae CIP 102761 [g-proteobacteria] taxid 675817
 ref|ZP_06157582.1| L-proline Glycine Betaine ABC transport...     103  7e-21
 gb|EEZ40023.1| L-proline Glycine Betaine ABC transport ATP...     103  7e-21

  alpha proteobacterium BAL199 [a-proteobacteria] taxid 331869
 ref|ZP_02189870.1| putative lycine betaine/L-proline ABC t...     103  7e-21
 gb|EDP63475.1| putative lycine betaine/L-proline ABC trans...     103  7e-21

  Vibrio fischeri MJ11 [g-proteobacteria] taxid 388396
 ref|YP_002155548.1| glycine betaine transport ATP-binding ...     103  7e-21
 gb|ACH67197.1| glycine betaine transport ATP-binding prote...     103  7e-21

  Providencia rettgeri DSM 1131 [enterobacteria] taxid 521000
 ref|ZP_06124647.1| glycine betaine/L-proline ABC transport...     103  7e-21

  Burkholderia ambifaria MC40-6 [b-proteobacteria] taxid 398577
 ref|YP_001811754.1| glycine betaine/L-proline ABC transpor...     103  7e-21
 gb|ACB67538.1| glycine betaine/L-proline ABC transporter, ...     103  7e-21

  Vibrio fischeri ES114 [g-proteobacteria] taxid 312309
 ref|YP_204170.1| glycine betaine transporter subunit [Vibr...     103  7e-21
 gb|AAW85282.1| glycine betaine transporter subunit [Vibrio...     103  7e-21

  Burkholderia ambifaria IOP40-10 [b-proteobacteria] taxid 396596
 ref|ZP_02888632.1| glycine betaine/L-proline ABC transport...     103  7e-21
 gb|EDT05803.1| glycine betaine/L-proline ABC transporter, ...     103  7e-21

  Burkholderia xenovorans LB400 [b-proteobacteria] taxid 266265
 ref|YP_553698.1| ABC proline/glycine betaine transporter, ...     103  7e-21
 gb|ABE34348.1| ABC proline/glycine betaine transporter, AT...     103  7e-21

  Burkholderia phytofirmans PsJN [b-proteobacteria] taxid 398527
 ref|YP_001888774.1| glycine betaine/L-proline ABC transpor...     103  8e-21
 gb|ACD19404.1| glycine betaine/L-proline ABC transporter, ...     103  8e-21

  Ochrobactrum intermedium LMG 3301 [a-proteobacteria] taxid 641118
 ref|ZP_04680790.1| choline ABC transporter, ATP-binding pr...     103  8e-21
 gb|EEQ96296.1| choline ABC transporter, ATP-binding protei...     103  8e-21

  Photobacterium sp. SKA34 [g-proteobacteria] taxid 121723
 ref|ZP_01158926.1| putative glycine betaine ABC transporte...     103  8e-21
 gb|EAR57331.1| putative glycine betaine ABC transporter AT...     103  8e-21

  Burkholderia cenocepacia J2315 [b-proteobacteria] taxid 216591
 ref|YP_002235012.1| putative glycine betaine/L-proline ABC...     102  9e-21
 emb|CAR56274.1| putative glycine betaine/L-proline ABC tra...     102  9e-21

  Photobacterium angustum S14 [g-proteobacteria] taxid 314292
 ref|ZP_01233121.1| putative glycine betaine ABC transporte...     102  9e-21
 gb|EAS65576.1| putative glycine betaine ABC transporter AT...     102  9e-21

  Rhizobium etli Brasil 5 [a-proteobacteria] taxid 526949
 ref|ZP_03505321.1| probable glycine betaine/L-proline ABC ...     102  9e-21

  Ralstonia eutropha JMP134 [b-proteobacteria] taxid 264198
 ref|YP_299003.1| glycine betaine/L-proline transport ATP-b...     102  9e-21
 gb|AAZ64159.1| Glycine betaine/L-proline transport ATP-bin...     102  9e-21

  Burkholderia sp. CCGE1002 [b-proteobacteria] taxid 640511
 ref|ZP_06228127.1| ABC proline/glycine betaine transporter...     102  9e-21
 gb|EFA52648.1| ABC proline/glycine betaine transporter, AT...     102  9e-21

  Fusobacterium varium ATCC 27725 [fusobacteria] taxid 469618
 ref|ZP_04859583.1| glycine betaine/L-proline ABC transport...     102  9e-21
 gb|EES64437.1| glycine betaine/L-proline ABC transporter [...     102  9e-21

  Haliangium ochraceum DSM 14365 [d-proteobacteria] taxid 502025
 ref|YP_003269842.1| glycine betaine/L-proline ABC transpor...     102  1e-20
 gb|ACY17949.1| glycine betaine/L-proline ABC transporter, ...     102  1e-20

  Mannheimia succiniciproducens MBEL55E [g-proteobacteria] taxid 221988
 ref|YP_087741.1| ProV protein [Mannheimia succiniciproduce...     102  1e-20
 gb|AAU37156.1| ProV protein [Mannheimia succiniciproducens...     102  1e-20

  Erwinia chrysanthemi [enterobacteria] taxid 556
 gb|AAQ06630.1| osmoprotectant transport protein OusBV [Erw...     102  1e-20

  Rhizobium etli IE4771 [a-proteobacteria] taxid 526946
 ref|ZP_03517597.1| choline ABC transporter, ATP-binding pr...     102  1e-20

  Fusobacterium ulcerans ATCC 49185 [fusobacteria] taxid 469617
 ref|ZP_05632471.1| glycine betaine/L-proline ABC transport...     102  1e-20

  Aeromonas salmonicida subsp. salmonicida A449 [g-proteobacteria] taxid 382245
 ref|YP_001140815.1| glycine betaine/L-proline transport sy...     102  1e-20
 gb|ABO89067.1| glycine betaine/L-proline transport system,...     102  1e-20


Taxonomy Report

root .......................................................................................  1428 hits  664 orgs 
. cellular organisms .......................................................................  1421 hits  658 orgs 
. . Bacteria ...............................................................................  1406 hits  650 orgs 
. . . Proteobacteria .......................................................................   757 hits  332 orgs 
. . . . Alphaproteobacteria ................................................................   213 hits   57 orgs 
. . . . . Candidatus Pelagibacter ..........................................................    14 hits    3 orgs [Rickettsiales; SAR11 cluster]
. . . . . . Candidatus Pelagibacter sp. HTCC7211 ...........................................     6 hits    1 orgs 
. . . . . . Candidatus Pelagibacter ubique .................................................     8 hits    2 orgs 
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 ......................................     4 hits    1 orgs 
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 ......................................     4 hits    1 orgs 
. . . . . Rhodobacterales ..................................................................   142 hits   36 orgs 
. . . . . . Rhodobacteraceae ...............................................................   122 hits   31 orgs 
. . . . . . . Roseobacter ..................................................................    24 hits    6 orgs 
. . . . . . . . Roseobacter sp. SK209-2-6 ..................................................    10 hits    1 orgs 
. . . . . . . . Roseobacter sp. MED193 .....................................................     2 hits    1 orgs 
. . . . . . . . Roseobacter litoralis Och 149 ..............................................     4 hits    1 orgs [Roseobacter litoralis]
. . . . . . . . Roseobacter sp. CCS2 .......................................................     2 hits    1 orgs 
. . . . . . . . Roseobacter sp. AzwK-3b ....................................................     4 hits    1 orgs 
. . . . . . . . Roseobacter sp. GAI101 .....................................................     2 hits    1 orgs 
. . . . . . . Phaeobacter gallaeciensis ....................................................    12 hits    2 orgs [Phaeobacter]
. . . . . . . . Phaeobacter gallaeciensis BS107 ............................................     8 hits    1 orgs 
. . . . . . . . Phaeobacter gallaeciensis 2.10 .............................................     4 hits    1 orgs 
. . . . . . . Pseudovibrio sp. JE062 .......................................................     6 hits    1 orgs [Pseudovibrio]
. . . . . . . Rhodobacteraceae bacterium KLH11 .............................................     6 hits    1 orgs [unclassified Rhodobacteraceae]
. . . . . . . Octadecabacter antarcticus ...................................................    14 hits    2 orgs [Octadecabacter]
. . . . . . . . Octadecabacter antarcticus 238 .............................................    10 hits    1 orgs 
. . . . . . . . Octadecabacter antarcticus 307 .............................................     4 hits    1 orgs 
. . . . . . . Rhodobacter ..................................................................    12 hits    5 orgs 
. . . . . . . . Rhodobacter sp. SW2 ........................................................     2 hits    1 orgs 
. . . . . . . . Rhodobacter sphaeroides ....................................................    10 hits    4 orgs 
. . . . . . . . . Rhodobacter sphaeroides ATCC 17025 .......................................     2 hits    1 orgs 
. . . . . . . . . Rhodobacter sphaeroides ATCC 17029 .......................................     2 hits    1 orgs 
. . . . . . . . . Rhodobacter sphaeroides KD131 ............................................     2 hits    1 orgs 
. . . . . . . . . Rhodobacter sphaeroides 2.4.1 ............................................     4 hits    1 orgs 
. . . . . . . Roseovarius ..................................................................    20 hits    4 orgs 
. . . . . . . . Roseovarius sp. HTCC2601 ...................................................     4 hits    1 orgs 
. . . . . . . . Roseovarius nubinhibens ISM ................................................     6 hits    1 orgs [Roseovarius nubinhibens]
. . . . . . . . Roseovarius sp. 217 ........................................................     4 hits    1 orgs 
. . . . . . . . Roseovarius sp. TM1035 .....................................................     6 hits    1 orgs 
. . . . . . . Labrenzia alexandrii DFL-11 ..................................................     2 hits    1 orgs [Labrenzia; Labrenzia alexandrii]
. . . . . . . Ruegeria .....................................................................    14 hits    3 orgs 
. . . . . . . . Ruegeria pomeroyi DSS-3 ....................................................     8 hits    1 orgs [Ruegeria pomeroyi]
. . . . . . . . Ruegeria sp. R11 ...........................................................     2 hits    1 orgs 
. . . . . . . . Silicibacter lacuscaerulensis ITI-1157 .....................................     4 hits    1 orgs [Ruegeria lacuscaerulensis]
. . . . . . . Dinoroseobacter shibae DFL 12 ................................................     2 hits    1 orgs [Dinoroseobacter; Dinoroseobacter shibae]
. . . . . . . Sagittula stellata E-37 ......................................................     2 hits    1 orgs [Sagittula; Sagittula stellata]
. . . . . . . Sulfitobacter ................................................................     4 hits    2 orgs 
. . . . . . . . Sulfitobacter sp. EE-36 ....................................................     2 hits    1 orgs 
. . . . . . . . Sulfitobacter sp. NAS-14.1 .................................................     2 hits    1 orgs 
. . . . . . . Thalassiobium sp. R2A62 ......................................................     2 hits    1 orgs [Thalassobium]
. . . . . . . Paracoccus denitrificans PD1222 ..............................................     2 hits    1 orgs [Paracoccus; Paracoccus denitrificans]
. . . . . . unclassified Rhodobacterales ...................................................    20 hits    5 orgs 
. . . . . . . Rhodobacterales bacterium HTCC2150 ...........................................     6 hits    1 orgs 
. . . . . . . Rhodobacterales bacterium HTCC2255 ...........................................     6 hits    1 orgs 
. . . . . . . Rhodobacterales bacterium HTCC2083 ...........................................     4 hits    1 orgs 
. . . . . . . Rhodobacterales bacterium HTCC2654 ...........................................     2 hits    1 orgs 
. . . . . . . Rhodobacterales bacterium Y4I ................................................     2 hits    1 orgs 
. . . . . Rhizobiales ......................................................................    53 hits   16 orgs 
. . . . . . Phyllobacteriaceae .............................................................    12 hits    4 orgs 
. . . . . . . Mesorhizobium ................................................................     8 hits    2 orgs 
. . . . . . . . Mesorhizobium opportunistum WSM2075 ........................................     4 hits    1 orgs [Mesorhizobium opportunistum]
. . . . . . . . Mesorhizobium loti MAFF303099 ..............................................     4 hits    1 orgs [Mesorhizobium loti]
. . . . . . . Hoeflea phototrophica DFL-43 .................................................     2 hits    1 orgs [Hoeflea; Hoeflea phototrophica]
. . . . . . . Chelativorans sp. BNC1 .......................................................     2 hits    1 orgs [Chelativorans]
. . . . . . Rhizobium/Agrobacterium group ..................................................    35 hits   10 orgs [Rhizobiaceae]
. . . . . . . Rhizobium ....................................................................    23 hits    7 orgs 
. . . . . . . . Rhizobium leguminosarum ....................................................    16 hits    3 orgs 
. . . . . . . . . Rhizobium leguminosarum bv. trifolii .....................................    10 hits    2 orgs 
. . . . . . . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................     6 hits    1 orgs 
. . . . . . . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...........................     4 hits    1 orgs 
. . . . . . . . . Rhizobium leguminosarum bv. viciae 3841 ..................................     6 hits    1 orgs [Rhizobium leguminosarum bv. viciae]
. . . . . . . . Rhizobium etli .............................................................     7 hits    4 orgs 
. . . . . . . . . Rhizobium etli CIAT 652 ..................................................     4 hits    1 orgs 
. . . . . . . . . Rhizobium etli GR56 ......................................................     1 hits    1 orgs 
. . . . . . . . . Rhizobium etli Brasil 5 ..................................................     1 hits    1 orgs 
. . . . . . . . . Rhizobium etli IE4771 ....................................................     1 hits    1 orgs 
. . . . . . . Agrobacterium ................................................................    12 hits    3 orgs 
. . . . . . . . Agrobacterium tumefaciens ..................................................    10 hits    2 orgs 
. . . . . . . . . Agrobacterium tumefaciens str. C58 .......................................     6 hits    1 orgs 
. . . . . . . . . Agrobacterium radiobacter K84 ............................................     4 hits    1 orgs 
. . . . . . . . Agrobacterium vitis S4 .....................................................     2 hits    1 orgs [Agrobacterium vitis]
. . . . . . Fulvimarina pelagi HTCC2506 ....................................................     4 hits    1 orgs [Aurantimonadaceae; Fulvimarina; Fulvimarina pelagi]
. . . . . . Ochrobactrum intermedium LMG 3301 ..............................................     2 hits    1 orgs [Brucellaceae; Ochrobactrum; Ochrobactrum intermedium]
. . . . . Rhodospirillum rubrum ATCC 11170 .................................................     2 hits    1 orgs [Rhodospirillales; Rhodospirillaceae; Rhodospirillum; Rhodospirillum rubrum]
. . . . . alpha proteobacterium BAL199 .....................................................     2 hits    1 orgs [unclassified Alphaproteobacteria; unclassified Alphaproteobacteria (miscellaneous)]
. . . . Deltaproteobacteria ................................................................    38 hits   18 orgs [delta/epsilon subdivisions]
. . . . . Myxococcales .....................................................................     4 hits    2 orgs 
. . . . . . Myxococcus xanthus DK 1622 .....................................................     2 hits    1 orgs [Cystobacterineae; Myxococcaceae; Myxococcus; Myxococcus xanthus]
. . . . . . Haliangium ochraceum DSM 14365 .................................................     2 hits    1 orgs [Nannocystineae; Haliangiaceae; Haliangium; Haliangium ochraceum]
. . . . . Desulfovibrionales ...............................................................    24 hits   11 orgs 
. . . . . . Desulfovibrio ..................................................................    18 hits    8 orgs [Desulfovibrionaceae]
. . . . . . . Desulfovibrio salexigens DSM 2638 ............................................     4 hits    1 orgs [Desulfovibrio salexigens]
. . . . . . . Desulfovibrio vulgaris .......................................................     8 hits    4 orgs 
. . . . . . . . Desulfovibrio vulgaris str. Hildenborough ..................................     2 hits    1 orgs 
. . . . . . . . Desulfovibrio vulgaris DP4 .................................................     2 hits    1 orgs 
. . . . . . . . Desulfovibrio vulgaris RCH1 ................................................     2 hits    1 orgs 
. . . . . . . . Desulfovibrio vulgaris str. 'Miyazaki F' ...................................     2 hits    1 orgs 
. . . . . . . Desulfovibrio desulfuricans subsp. desulfuricans .............................     4 hits    2 orgs [Desulfovibrio desulfuricans]
. . . . . . . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ..................     2 hits    1 orgs 
. . . . . . . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 ...........     2 hits    1 orgs 
. . . . . . . Desulfovibrio aespoeensis Aspo-2 .............................................     2 hits    1 orgs [Desulfovibrio aespoeensis]
. . . . . . Desulfohalobiaceae .............................................................     4 hits    2 orgs 
. . . . . . . Desulfonatronospira thiodismutans ASO3-1 .....................................     2 hits    1 orgs [Desulfonatronospira; Desulfonatronospira thiodismutans]
. . . . . . . Desulfohalobium retbaense DSM 5692 ...........................................     2 hits    1 orgs [Desulfohalobium; Desulfohalobium retbaense]
. . . . . . Desulfomicrobium baculatum DSM 4028 ............................................     2 hits    1 orgs [Desulfomicrobiaceae; Desulfomicrobium; Desulfomicrobium baculatum]
. . . . . Desulfobacterales ................................................................     8 hits    4 orgs 
. . . . . . Desulfobacteraceae .............................................................     6 hits    3 orgs 
. . . . . . . Desulfobacterium autotrophicum HRM2 ..........................................     2 hits    1 orgs [Desulfobacterium; Desulfobacterium autotrophicum]
. . . . . . . Desulfatibacillum alkenivorans AK-01 .........................................     2 hits    1 orgs [Desulfatibacillum; Desulfatibacillum alkenivorans]
. . . . . . . Desulfococcus oleovorans Hxd3 ................................................     2 hits    1 orgs [Desulfococcus; Desulfococcus oleovorans]
. . . . . . Desulfotalea psychrophila LSv54 ................................................     2 hits    1 orgs [Desulfobulbaceae; Desulfotalea; Desulfotalea psychrophila]
. . . . . Desulfuromonas acetoxidans DSM 684 ...............................................     2 hits    1 orgs [Desulfuromonadales; Desulfuromonadaceae; Desulfuromonas; Desulfuromonas acetoxidans]
. . . . Gammaproteobacteria ................................................................   427 hits  220 orgs 
. . . . . Ectothiorhodospiraceae ...........................................................     4 hits    2 orgs [Chromatiales]
. . . . . . Alkalilimnicola ehrlichii MLHE-1 ...............................................     2 hits    1 orgs [Alkalilimnicola; Alkalilimnicola ehrlichii]
. . . . . . Halorhodospira halophila SL1 ...................................................     2 hits    1 orgs [Halorhodospira; Halorhodospira halophila]
. . . . . Alteromonadales ..................................................................    24 hits   12 orgs 
. . . . . . Psychromonas ingrahamii 37 .....................................................     2 hits    1 orgs [Psychromonadaceae; Psychromonas; Psychromonas ingrahamii]
. . . . . . Marinobacter sp. ELB17 .........................................................     2 hits    1 orgs [Alteromonadaceae; Marinobacter]
. . . . . . Shewanella .....................................................................    18 hits    9 orgs [Shewanellaceae]
. . . . . . . Shewanella halifaxensis HAW-EB4 ..............................................     2 hits    1 orgs [Shewanella halifaxensis]
. . . . . . . Shewanella baltica ...........................................................     8 hits    4 orgs 
. . . . . . . . Shewanella baltica OS195 ...................................................     2 hits    1 orgs 
. . . . . . . . Shewanella baltica OS185 ...................................................     2 hits    1 orgs 
. . . . . . . . Shewanella baltica OS223 ...................................................     2 hits    1 orgs 
. . . . . . . . Shewanella baltica OS155 ...................................................     2 hits    1 orgs 
. . . . . . . Shewanella frigidimarina NCIMB 400 ...........................................     2 hits    1 orgs [Shewanella frigidimarina]
. . . . . . . Shewanella sediminis HAW-EB3 .................................................     2 hits    1 orgs [Shewanella sediminis]
. . . . . . . Shewanella woodyi ATCC 51908 .................................................     2 hits    1 orgs [Shewanella woodyi]
. . . . . . . Shewanella pealeana ATCC 700345 ..............................................     2 hits    1 orgs [Shewanella pealeana]
. . . . . . Moritella sp. PE36 .............................................................     2 hits    1 orgs [Moritellaceae; Moritella]
. . . . . Oceanospirillales ................................................................    14 hits    5 orgs 
. . . . . . Hahella chejuensis KCTC 2396 ...................................................     2 hits    1 orgs [Hahellaceae; Hahella; Hahella chejuensis]
. . . . . . Oceanospirillaceae .............................................................    10 hits    3 orgs 
. . . . . . . Bermanella marisrubri ........................................................     4 hits    1 orgs [Bermanella]
. . . . . . . Marinomonas sp. MED121 .......................................................     4 hits    1 orgs [Marinomonas]
. . . . . . . Neptuniibacter caesariensis ..................................................     2 hits    1 orgs [Neptuniibacter]
. . . . . . Chromohalobacter salexigens DSM 3043 ...........................................     2 hits    1 orgs [Halomonadaceae; Chromohalobacter; Chromohalobacter salexigens]
. . . . . Vibrionales ......................................................................    46 hits   22 orgs 
. . . . . . Vibrionaceae ...................................................................    44 hits   21 orgs 
. . . . . . . Vibrio .......................................................................    30 hits   14 orgs 
. . . . . . . . Vibrio sp. MED222 ..........................................................     2 hits    1 orgs 
. . . . . . . . Vibrio splendidus ..........................................................     4 hits    2 orgs 
. . . . . . . . . Vibrio splendidus LGP32 ..................................................     2 hits    1 orgs 
. . . . . . . . . Vibrio splendidus 12B01 ..................................................     2 hits    1 orgs 
. . . . . . . . Vibrio orientalis CIP 102891 ...............................................     2 hits    1 orgs [Vibrio orientalis]
. . . . . . . . Vibrio parahaemolyticus 16 .................................................     2 hits    1 orgs [Vibrio parahaemolyticus]
. . . . . . . . Vibrio metschnikovii CIP 69.14 .............................................     2 hits    1 orgs [Vibrio metschnikovii]
. . . . . . . . Vibrio sp. Ex25 ............................................................     4 hits    1 orgs 
. . . . . . . . Vibrio harveyi .............................................................     6 hits    3 orgs 
. . . . . . . . . Vibrio harveyi 1DA3 ......................................................     2 hits    1 orgs 
. . . . . . . . . Vibrio harveyi ATCC BAA-1116 .............................................     2 hits    1 orgs 
. . . . . . . . . Vibrio harveyi HY01 ......................................................     2 hits    1 orgs 
. . . . . . . . Vibrio sp. AND4 ............................................................     2 hits    1 orgs 
. . . . . . . . Vibrio alginolyticus .......................................................     4 hits    2 orgs 
. . . . . . . . . Vibrio alginolyticus 40B .................................................     2 hits    1 orgs 
. . . . . . . . . Vibrio alginolyticus 12G01 ...............................................     2 hits    1 orgs 
. . . . . . . . Vibrio coralliilyticus ATCC BAA-450 ........................................     2 hits    1 orgs [Vibrio coralliilyticus]
. . . . . . . Photobacterium ...............................................................    10 hits    5 orgs 
. . . . . . . . Photobacterium profundum ...................................................     4 hits    2 orgs 
. . . . . . . . . Photobacterium profundum 3TCK ............................................     2 hits    1 orgs 
. . . . . . . . . Photobacterium profundum SS9 .............................................     2 hits    1 orgs 
. . . . . . . . Photobacterium damselae subsp. damselae CIP 102761 .........................     2 hits    1 orgs [Photobacterium damselae; Photobacterium damselae subsp. damselae]
. . . . . . . . Photobacterium sp. SKA34 ...................................................     2 hits    1 orgs 
. . . . . . . . Photobacterium angustum S14 ................................................     2 hits    1 orgs [Photobacterium angustum]
. . . . . . . Vibrio fischeri ..............................................................     4 hits    2 orgs [Aliivibrio]
. . . . . . . . Vibrio fischeri MJ11 .......................................................     2 hits    1 orgs 
. . . . . . . . Vibrio fischeri ES114 ......................................................     2 hits    1 orgs 
. . . . . . Vibrionales bacterium SWAT-3 ...................................................     2 hits    1 orgs [unclassified Vibrionales]
. . . . . Enterobacteriaceae ...............................................................   331 hits  176 orgs [Enterobacteriales]
. . . . . . Dickeya ........................................................................     7 hits    4 orgs 
. . . . . . . Dickeya dadantii .............................................................     4 hits    2 orgs 
. . . . . . . . Dickeya dadantii Ech703 ....................................................     2 hits    1 orgs 
. . . . . . . . Dickeya dadantii Ech586 ....................................................     2 hits    1 orgs 
. . . . . . . Dickeya zeae Ech1591 .........................................................     2 hits    1 orgs [Dickeya zeae]
. . . . . . . Erwinia chrysanthemi .........................................................     1 hits    1 orgs 
. . . . . . Escherichia ....................................................................   120 hits   60 orgs 
. . . . . . . Escherichia coli .............................................................   111 hits   55 orgs 
. . . . . . . . Escherichia coli O157:H7 EDL933 ............................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli O157:H7 ...................................................    34 hits   18 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. Sakai ......................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4113 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4401 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4501 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4486 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4196 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4076 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC869 ......................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC508 ......................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4024 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4206 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4045 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4042 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. EC4115 .....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. TW14588 ....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. TW14359 ....................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. FRIK2000 ...................................     1 hits    1 orgs 
. . . . . . . . . Escherichia coli O157:H7 str. FRIK966 ....................................     1 hits    1 orgs 
. . . . . . . . Escherichia coli 53638 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli O127:H6 str. E2348/69 .....................................     2 hits    1 orgs [Escherichia coli O127:H6]
. . . . . . . . Escherichia coli HS ........................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli IAI39 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli E110019 ...................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli K-12 ......................................................     7 hits    4 orgs 
. . . . . . . . . Escherichia coli str. K-12 substr. MG1655 ................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli str. K-12 substr. W3110 .................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli BW2952 ..................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli E24377A ...................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli ATCC 8739 .................................................     2 hits    1 orgs [Escherichia coli C]
. . . . . . . . Escherichia coli O103:H2 ...................................................     4 hits    2 orgs 
. . . . . . . . . Escherichia coli E22 .....................................................     2 hits    1 orgs 
. . . . . . . . . Escherichia coli O103:H2 str. 12009 ......................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli B171 ......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli 101-1 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli SE11 ......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli IAI1 ......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli ED1a ......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli 55989 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli BL21(DE3) .................................................     4 hits    1 orgs 
. . . . . . . . Escherichia coli B str. REL606 .............................................     2 hits    1 orgs [Escherichia coli B]
. . . . . . . . Escherichia coli O26:H11 str. 11368 ........................................     2 hits    1 orgs [Escherichia coli O26:H11]
. . . . . . . . Escherichia coli O111:H- str. 11128 ........................................     2 hits    1 orgs [Escherichia coli O111:H-]
. . . . . . . . Escherichia coli DH1 .......................................................     1 hits    1 orgs 
. . . . . . . . Escherichia coli B7A .......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli CFT073 ....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli UTI89 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli 536 .......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli APEC O1 ...................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli F11 .......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli S88 .......................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli UMN026 ....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli 83972 .....................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli SMS-3-5 ...................................................     2 hits    1 orgs 
. . . . . . . . Escherichia coli SE15 ......................................................     1 hits    1 orgs 
. . . . . . . Escherichia albertii TW07627 .................................................     2 hits    1 orgs [Escherichia albertii]
. . . . . . . Escherichia fergusonii ATCC 35469 ............................................     2 hits    1 orgs [Escherichia fergusonii]
. . . . . . . Escherichia sp. 1_1_43 .......................................................     2 hits    1 orgs 
. . . . . . . Escherichia sp. 4_1_40B ......................................................     1 hits    1 orgs 
. . . . . . . Escherichia sp. 3_2_53FAA ....................................................     2 hits    1 orgs 
. . . . . . Shigella .......................................................................    18 hits   10 orgs 
. . . . . . . Shigella flexneri ............................................................     7 hits    4 orgs 
. . . . . . . . Shigella flexneri 5 str. 8401 ..............................................     2 hits    1 orgs [Shigella flexneri 5]
. . . . . . . . Shigella flexneri 2a .......................................................     4 hits    2 orgs 
. . . . . . . . . Shigella flexneri 2a str. 2457T ..........................................     2 hits    1 orgs 
. . . . . . . . . Shigella flexneri 2a str. 301 ............................................     2 hits    1 orgs 
. . . . . . . . Shigella flexneri 2002017 ..................................................     1 hits    1 orgs 
. . . . . . . Shigella dysenteriae .........................................................     4 hits    2 orgs 
. . . . . . . . Shigella dysenteriae Sd197 .................................................     2 hits    1 orgs 
. . . . . . . . Shigella dysenteriae 1012 ..................................................     2 hits    1 orgs 
. . . . . . . Shigella boydii ..............................................................     4 hits    2 orgs 
. . . . . . . . Shigella boydii Sb227 ......................................................     2 hits    1 orgs 
. . . . . . . . Shigella boydii CDC 3083-94 ................................................     2 hits    1 orgs 
. . . . . . . Shigella sp. D9 ..............................................................     1 hits    1 orgs 
. . . . . . . Shigella sonnei Ss046 ........................................................     2 hits    1 orgs [Shigella sonnei]
. . . . . . Enterobacter ...................................................................     3 hits    2 orgs 
. . . . . . . Enterobacter sp. 638 .........................................................     2 hits    1 orgs 
. . . . . . . Enterobacter cancerogenus ATCC 35316 .........................................     1 hits    1 orgs [Enterobacter cancerogenus]
. . . . . . Cronobacter ....................................................................     4 hits    3 orgs 
. . . . . . . Cronobacter turicensis .......................................................     2 hits    2 orgs 
. . . . . . . . Cronobacter turicensis z3032 ...............................................     1 hits    1 orgs 
. . . . . . . Cronobacter sakazakii ATCC BAA-894 ...........................................     2 hits    1 orgs [Cronobacter sakazakii]
. . . . . . Salmonella enterica ............................................................    74 hits   43 orgs [Salmonella]
. . . . . . . Salmonella enterica subsp. enterica ..........................................    72 hits   42 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Choleraesuis ...................     3 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Infantis .......................     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi C ....................     4 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Senftenberg ....................     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Typhimurium ....................     8 hits    4 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........     3 hits    2 orgs 
. . . . . . . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ....     1 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi B ....................     4 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Derby ..........................     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund .................     5 hits    3 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Montevideo .....................     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Newport ........................     5 hits    3 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Panama .........................     1 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi A ....................     5 hits    3 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Saintpaul ......................     4 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 .....     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
. . . . . . . . Salmonella enterica subsp. enterica serovar Kentucky .......................     4 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Heidelberg .....................     4 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........     2 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........     2 hits    1 orgs 
. . . . . . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 ...........     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Hadar]
. . . . . . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ....     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Weltevreden]
. . . . . . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 ...............     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Agona]
. . . . . . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ........     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Dublin]
. . . . . . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 .............     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Virchow]
. . . . . . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 .....     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Javiana]
. . . . . . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .........     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Gallinarum]
. . . . . . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .......     2 hits    1 orgs [Salmonella enterica subsp. enterica serovar Enteritidis]
. . . . . . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ......     1 hits    1 orgs [Salmonella enterica subsp. enterica serovar Tennessee]
. . . . . . . . Salmonella enterica subsp. enterica serovar Typhi ..........................     2 hits    2 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........     1 hits    1 orgs 
. . . . . . . . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........     1 hits    1 orgs 
. . . . . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .....................     2 hits    1 orgs [Salmonella enterica subsp. arizonae]
. . . . . . Klebsiella .....................................................................    10 hits    5 orgs 
. . . . . . . Klebsiella pneumoniae ........................................................     8 hits    4 orgs 
. . . . . . . . Klebsiella pneumoniae 342 ..................................................     2 hits    1 orgs 
. . . . . . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ..........................     2 hits    1 orgs [Klebsiella pneumoniae subsp. pneumoniae]
. . . . . . . . Klebsiella pneumoniae NTUH-K2044 ...........................................     2 hits    1 orgs 
. . . . . . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 ...................     2 hits    1 orgs [Klebsiella pneumoniae subsp. rhinoscleromatis]
. . . . . . . Klebsiella variicola At-22 ...................................................     2 hits    1 orgs [Klebsiella variicola]
. . . . . . Citrobacter ....................................................................     5 hits    3 orgs 
. . . . . . . Citrobacter sp. 30_2 .........................................................     2 hits    1 orgs 
. . . . . . . Citrobacter koseri ATCC BAA-895 ..............................................     2 hits    1 orgs [Citrobacter koseri]
. . . . . . . Citrobacter rodentium ICC168 .................................................     1 hits    1 orgs [Citrobacter rodentium]
. . . . . . Pantoea sp. At-9b ..............................................................     2 hits    1 orgs [Pantoea]
. . . . . . Erwinia ........................................................................     4 hits    2 orgs 
. . . . . . . Erwinia tasmaniensis Et1/99 ..................................................     2 hits    1 orgs [Erwinia tasmaniensis]
. . . . . . . Erwinia pyrifoliae Ep1/96 ....................................................     2 hits    1 orgs [Erwinia pyrifoliae]
. . . . . . Yersinia .......................................................................    66 hits   34 orgs 
. . . . . . . Yersinia pestis ..............................................................    43 hits   22 orgs 
. . . . . . . . Yersinia pestis FV-1 .......................................................     1 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Orientalis str. PEXU2 ...............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis Antiqua ....................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis Nepal516 ...................................................     4 hits    1 orgs 
. . . . . . . . Yersinia pestis Pestoides F ................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis CA88-4125 ..................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Orientalis str. F1991016 ............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Orientalis str. IP275 ...............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Antiqua str. E1979001 ...............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Antiqua str. B42003004 ..............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Antiqua str. UG05-0454 ..............................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Orientalis str. MG05-1020 ...........................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Mediaevalis str. K1973002 ...........................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis CO92 .......................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis Pestoides A ................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Orientalis str. India 195 ...........................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis KIM 10 .....................................................     4 hits    2 orgs 
. . . . . . . . . Yersinia pestis KIM D27 ..................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis D106004 ....................................................     1 hits    1 orgs 
. . . . . . . . Yersinia pestis D182038 ....................................................     1 hits    1 orgs 
. . . . . . . . Yersinia pestis Angola .....................................................     2 hits    1 orgs 
. . . . . . . . Yersinia pestis biovar Microtus str. 91001 .................................     2 hits    1 orgs 
. . . . . . . Yersinia pseudotuberculosis ..................................................     8 hits    4 orgs 
. . . . . . . . Yersinia pseudotuberculosis IP 32953 .......................................     2 hits    1 orgs 
. . . . . . . . Yersinia pseudotuberculosis IP 31758 .......................................     2 hits    1 orgs 
. . . . . . . . Yersinia pseudotuberculosis YPIII ..........................................     2 hits    1 orgs 
. . . . . . . . Yersinia pseudotuberculosis PB1/+ ..........................................     2 hits    1 orgs 
. . . . . . . Yersinia intermedia ATCC 29909 ...............................................     2 hits    1 orgs [Yersinia intermedia]
. . . . . . . Yersinia ruckeri ATCC 29473 ..................................................     2 hits    1 orgs [Yersinia ruckeri]
. . . . . . . Yersinia frederiksenii ATCC 33641 ............................................     2 hits    1 orgs [Yersinia frederiksenii]
. . . . . . . Yersinia kristensenii ATCC 33638 .............................................     2 hits    1 orgs [Yersinia kristensenii]
. . . . . . . Yersinia aldovae ATCC 35236 ..................................................     2 hits    1 orgs [Yersinia aldovae]
. . . . . . . Yersinia rohdei ATCC 43380 ...................................................     2 hits    1 orgs [Yersinia rohdei]
. . . . . . . Yersinia enterocolitica ......................................................     3 hits    2 orgs 
. . . . . . . . Yersinia enterocolitica subsp. enterocolitica 8081 .........................     2 hits    1 orgs [Yersinia enterocolitica subsp. enterocolitica]
. . . . . . Photorhabdus luminescens subsp. laumondii TTO1 .................................     2 hits    1 orgs [Photorhabdus; Photorhabdus luminescens; Photorhabdus luminescens subsp. laumondii]
. . . . . . Pectobacterium .................................................................     7 hits    4 orgs 
. . . . . . . Pectobacterium carotovorum subsp. carotovorum ................................     3 hits    2 orgs [Pectobacterium carotovorum]
. . . . . . . . Pectobacterium carotovorum subsp. carotovorum PC1 ..........................     2 hits    1 orgs 
. . . . . . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ........................     1 hits    1 orgs 
. . . . . . . Pectobacterium atrosepticum SCRI1043 .........................................     2 hits    1 orgs [Pectobacterium atrosepticum]
. . . . . . . Pectobacterium wasabiae WPP163 ...............................................     2 hits    1 orgs [Pectobacterium wasabiae]
. . . . . . Serratia .......................................................................     6 hits    2 orgs 
. . . . . . . Serratia odorifera 4Rx13 .....................................................     2 hits    1 orgs [Serratia odorifera]
. . . . . . . Serratia proteamaculans 568 ..................................................     4 hits    1 orgs [Serratia proteamaculans]
. . . . . . Providencia ....................................................................     3 hits    2 orgs 
. . . . . . . Providencia stuartii ATCC 25827 ..............................................     2 hits    1 orgs [Providencia stuartii]
. . . . . . . Providencia rettgeri DSM 1131 ................................................     1 hits    1 orgs [Providencia rettgeri]
. . . . . Reinekea blandensis MED297 .......................................................     4 hits    1 orgs [unclassified Gammaproteobacteria; Reinekea; Reinekea blandensis]
. . . . . Mannheimia succiniciproducens MBEL55E ............................................     2 hits    1 orgs [Pasteurellales; Pasteurellaceae; Basfia; Mannheimia succiniciproducens]
. . . . . Aeromonas salmonicida subsp. salmonicida A449 ....................................     2 hits    1 orgs [Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas salmonicida; Aeromonas salmonicida subsp. salmonicida]
. . . . Burkholderiales ....................................................................    79 hits   37 orgs [Betaproteobacteria]
. . . . . Bordetella .......................................................................    10 hits    7 orgs [Alcaligenaceae]
. . . . . . Bordetella pertussis Tohama I ..................................................     2 hits    1 orgs [Bordetella pertussis]
. . . . . . Bordetella bronchiseptica RB50 .................................................     2 hits    1 orgs [Bordetella bronchiseptica]
. . . . . . Bordetella parapertussis .......................................................     2 hits    2 orgs 
. . . . . . . Bordetella parapertussis 12822 ...............................................     1 hits    1 orgs 
. . . . . . Bordetella petrii ..............................................................     2 hits    2 orgs 
. . . . . . . Bordetella petrii DSM 12804 ..................................................     1 hits    1 orgs 
. . . . . . Bordetella avium 197N ..........................................................     2 hits    1 orgs [Bordetella avium]
. . . . . Burkholderiaceae .................................................................    61 hits   26 orgs 
. . . . . . Burkholderia ...................................................................    57 hits   24 orgs 
. . . . . . . Burkholderia phymatum STM815 .................................................     4 hits    1 orgs [Burkholderia phymatum]
. . . . . . . Burkholderia glumae BGR1 .....................................................     2 hits    1 orgs [Burkholderia glumae]
. . . . . . . Burkholderia cepacia complex .................................................    38 hits   15 orgs 
. . . . . . . . Burkholderia vietnamiensis G4 ..............................................     2 hits    1 orgs [Burkholderia vietnamiensis]
. . . . . . . . Burkholderia cenocepacia ...................................................    10 hits    5 orgs 
. . . . . . . . . Burkholderia cenocepacia AU 1054 .........................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia cenocepacia HI2424 ..........................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia cenocepacia MC0-3 ...........................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia cenocepacia PC184 ...........................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia cenocepacia J2315 ...........................................     2 hits    1 orgs 
. . . . . . . . Burkholderia sp. 383 .......................................................     2 hits    1 orgs 
. . . . . . . . Burkholderia ambifaria .....................................................    10 hits    4 orgs 
. . . . . . . . . Burkholderia ambifaria MEX-5 .............................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia ambifaria AMMD ..............................................     4 hits    1 orgs 
. . . . . . . . . Burkholderia ambifaria MC40-6 ............................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia ambifaria IOP40-10 ..........................................     2 hits    1 orgs 
. . . . . . . . Burkholderia multivorans ...................................................    14 hits    4 orgs 
. . . . . . . . . Burkholderia multivorans CGD2M ...........................................     4 hits    1 orgs 
. . . . . . . . . Burkholderia multivorans CGD2 ............................................     4 hits    1 orgs 
. . . . . . . . . Burkholderia multivorans CGD1 ............................................     2 hits    1 orgs 
. . . . . . . . . Burkholderia multivorans ATCC 17616 ......................................     4 hits    1 orgs 
. . . . . . . Burkholderia ubonensis Bu ....................................................     1 hits    1 orgs [Burkholderia ubonensis]
. . . . . . . Burkholderia sp. CCGE1001 ....................................................     2 hits    1 orgs 
. . . . . . . Burkholderia graminis C4D1M ..................................................     2 hits    1 orgs [Burkholderia graminis]
. . . . . . . Burkholderia sp. H160 ........................................................     2 hits    1 orgs 
. . . . . . . Burkholderia xenovorans LB400 ................................................     2 hits    1 orgs [Burkholderia xenovorans]
. . . . . . . Burkholderia phytofirmans PsJN ...............................................     2 hits    1 orgs [Burkholderia phytofirmans]
. . . . . . . Burkholderia sp. CCGE1002 ....................................................     2 hits    1 orgs 
. . . . . . Ralstonia solanacearum GMI1000 .................................................     2 hits    1 orgs [Ralstonia; Ralstonia solanacearum]
. . . . . . Ralstonia eutropha JMP134 ......................................................     2 hits    1 orgs [Cupriavidus; Cupriavidus pinatubonensis]
. . . . . Comamonadaceae ...................................................................     8 hits    4 orgs 
. . . . . . Acidovorax .....................................................................     4 hits    2 orgs 
. . . . . . . Acidovorax avenae subsp. avenae ATCC 19860 ...................................     2 hits    1 orgs [Acidovorax avenae; Acidovorax avenae subsp. avenae]
. . . . . . . Acidovorax citrulli AAC00-1 ..................................................     2 hits    1 orgs [Acidovorax citrulli]
. . . . . . Variovorax paradoxus S110 ......................................................     2 hits    1 orgs [Variovorax; Variovorax paradoxus]
. . . . . . Delftia acidovorans SPH-1 ......................................................     2 hits    1 orgs [Delftia; Delftia acidovorans]
. . . Firmicutes ...........................................................................   462 hits  237 orgs 
. . . . Bacilli ............................................................................   434 hits  224 orgs 
. . . . . Bacillales .......................................................................   247 hits  130 orgs 
. . . . . . Bacillaceae ....................................................................   195 hits   98 orgs 
. . . . . . . Oceanobacillus iheyensis HTE831 ..............................................     6 hits    1 orgs [Oceanobacillus; Oceanobacillus iheyensis]
. . . . . . . Bacillus .....................................................................   186 hits   95 orgs 
. . . . . . . . Bacillus sp. SG-1 ..........................................................     2 hits    1 orgs 
. . . . . . . . Bacillus sp. B14905 ........................................................     4 hits    1 orgs 
. . . . . . . . Bacillus subtilis group ....................................................    15 hits    7 orgs 
. . . . . . . . . Bacillus licheniformis ATCC 14580 ........................................     4 hits    1 orgs [Bacillus licheniformis]
. . . . . . . . . Bacillus subtilis ........................................................     9 hits    5 orgs 
. . . . . . . . . . Bacillus subtilis subsp. subtilis ......................................     6 hits    4 orgs 
. . . . . . . . . . . Bacillus subtilis subsp. subtilis str. 168 ...........................     3 hits    1 orgs 
. . . . . . . . . . . Bacillus subtilis subsp. subtilis str. NCIB 3610 .....................     1 hits    1 orgs 
. . . . . . . . . . . Bacillus subtilis subsp. subtilis str. JH642 .........................     1 hits    1 orgs 
. . . . . . . . . . . Bacillus subtilis subsp. subtilis str. SMY ...........................     1 hits    1 orgs 
. . . . . . . . . Bacillus amyloliquefaciens FZB42 .........................................     2 hits    1 orgs [Bacillus amyloliquefaciens]
. . . . . . . . Bacillus sp. NRRL B-14911 ..................................................     2 hits    1 orgs 
. . . . . . . . Bacillus selenitireducens MLS10 ............................................     2 hits    1 orgs [Bacillus selenitireducens]
. . . . . . . . Bacillus pumilus ...........................................................     4 hits    2 orgs 
. . . . . . . . . Bacillus pumilus SAFR-032 ................................................     2 hits    1 orgs 
. . . . . . . . . Bacillus pumilus ATCC 7061 ...............................................     2 hits    1 orgs 
. . . . . . . . Bacillus clausii KSM-K16 ...................................................     2 hits    1 orgs [Bacillus clausii]
. . . . . . . . Bacillus cereus group ......................................................   153 hits   80 orgs 
. . . . . . . . . Bacillus cytotoxicus NVH 391-98 ..........................................     2 hits    1 orgs [Bacillus cytotoxicus]
. . . . . . . . . Bacillus thuringiensis ...................................................    30 hits   15 orgs 
. . . . . . . . . . Bacillus thuringiensis serovar israelensis ATCC 35646 ..................     2 hits    1 orgs [Bacillus thuringiensis serovar israelensis]
. . . . . . . . . . Bacillus thuringiensis IBL 4222 ........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus thuringiensis IBL 200 .........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus thuringiensis serovar berliner ATCC 10792 .....................     2 hits    1 orgs [Bacillus thuringiensis serovar berliner]
. . . . . . . . . . Bacillus thuringiensis serovar thuringiensis str. T01001 ...............     2 hits    1 orgs [Bacillus thuringiensis serovar thuringiensis]
. . . . . . . . . . Bacillus thuringiensis Bt407 ...........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus thuringiensis serovar kurstaki str. T03a001 ...................     2 hits    1 orgs [Bacillus thuringiensis serovar kurstaki]
. . . . . . . . . . Bacillus thuringiensis serovar pakistani str. T13001 ...................     2 hits    1 orgs [Bacillus thuringiensis serovar pakistani]
. . . . . . . . . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .................     2 hits    1 orgs [Bacillus thuringiensis serovar huazhongensis]
. . . . . . . . . . Bacillus thuringiensis str. Al Hakam ...................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus thuringiensis serovar konkukian str. 97-27 ....................     2 hits    1 orgs [Bacillus thuringiensis serovar konkukian]
. . . . . . . . . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ....................     2 hits    1 orgs [Bacillus thuringiensis serovar pulsiensis]
. . . . . . . . . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ...............     2 hits    1 orgs [Bacillus thuringiensis serovar pondicheriensis]
. . . . . . . . . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ................     2 hits    1 orgs [Bacillus thuringiensis serovar andalousiensis]
. . . . . . . . . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ...................     2 hits    1 orgs [Bacillus thuringiensis serovar tochigiensis]
. . . . . . . . . Bacillus cereus ..........................................................    82 hits   41 orgs 
. . . . . . . . . . Bacillus cereus G9842 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock3-44 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus MM3 ....................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH1273 .................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH1272 .................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH603 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus BDRD-ST196 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH621 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus ATCC 14579 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH1134 .................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus B4264 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH676 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock4-2 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock1-15 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus BDRD-Cer4 ..............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus BDRD-ST24 ..............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus m1550 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus 172560W ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus ATCC 10876 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock3-29 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock3-28 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock1-3 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus F65185 .................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus R309803 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus BGSC 6E1 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus ATCC 10987 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus H3081.97 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH187 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Q1 .....................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus BDRD-ST26 ..............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus E33L ...................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus W ......................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus NVH0597-99 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus 03BB108 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus AH820 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus 03BB102 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus Rock3-42 ...............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus 95/8201 ................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus ATCC 4342 ..............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus m1293 ..................................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus cereus G9241 ..................................................     2 hits    1 orgs 
. . . . . . . . . Bacillus mycoides ........................................................     6 hits    3 orgs 
. . . . . . . . . . Bacillus mycoides DSM 2048 .............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus mycoides Rock1-4 ..............................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus mycoides Rock3-17 .............................................     2 hits    1 orgs 
. . . . . . . . . Bacillus weihenstephanensis KBAB4 ........................................     2 hits    1 orgs [Bacillus weihenstephanensis]
. . . . . . . . . Bacillus anthracis .......................................................    31 hits   19 orgs 
. . . . . . . . . . Bacillus anthracis str. A2012 ..........................................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Ames ...........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. 'Ames Ancestor' ................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Sterne .........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0488 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0442 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0193 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0465 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0389 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0174 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis Tsiankovskii-I ......................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. CDC 684 ........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A0248 ..........................................     2 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. CNEVA-9066 .....................................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. A1055 ..........................................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Western North America USA6153 ..................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Kruger B .......................................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Vollum .........................................     1 hits    1 orgs 
. . . . . . . . . . Bacillus anthracis str. Australia 94 ...................................     1 hits    1 orgs 
. . . . . . . . Bacillus pseudomycoides DSM 12442 ..........................................     2 hits    1 orgs [Bacillus pseudomycoides]
. . . . . . . Geobacillus sp. Y412MC10 .....................................................     2 hits    1 orgs [Geobacillus]
. . . . . . . Halobacillus trueperi ........................................................     1 hits    1 orgs [Halobacillus]
. . . . . . Paenibacillaceae ...............................................................     9 hits    4 orgs 
. . . . . . . Brevibacillus brevis NBRC 100599 .............................................     4 hits    1 orgs [Brevibacillus; Brevibacillus brevis]
. . . . . . . Paenibacillus ................................................................     5 hits    3 orgs 
. . . . . . . . Paenibacillus sp. oral taxon 786 str. D14 ..................................     2 hits    1 orgs [Paenibacillus sp. oral taxon 786]
. . . . . . . . Paenibacillus larvae subsp. larvae BRL-230010 ..............................     1 hits    1 orgs [Paenibacillus larvae; Paenibacillus larvae subsp. larvae]
. . . . . . . . Paenibacillus sp. JDR-2 ....................................................     2 hits    1 orgs 
. . . . . . Lysinibacillus sphaericus C3-41 ................................................     2 hits    1 orgs [Planococcaceae; Lysinibacillus; Lysinibacillus sphaericus]
. . . . . . Listeria .......................................................................    39 hits   26 orgs [Listeriaceae]
. . . . . . . Listeria grayi DSM 20601 .....................................................     4 hits    1 orgs [Listeria grayi]
. . . . . . . Listeria innocua .............................................................     2 hits    2 orgs 
. . . . . . . . Listeria innocua Clip11262 .................................................     1 hits    1 orgs 
. . . . . . . Listeria monocytogenes .......................................................    31 hits   22 orgs 
. . . . . . . . Listeria monocytogenes EGD-e ...............................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes str. 1/2a F6854 .....................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes HCC23 ...............................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes Finland 1988 ........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL R2-561 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL N3-165 ..........................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes 10403S ..............................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL N1-017 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes J0161 ...............................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes J2818 ...............................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes F6900 ...............................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes str. 4b F2365 .......................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes Clip80459 ...........................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL J1-194 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL R2-503 ..........................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL J2-071 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes HPB2262 .............................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL J2-064 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes FSL J1-175 ..........................................     1 hits    1 orgs 
. . . . . . . . Listeria monocytogenes str. 4b H7858 .......................................     2 hits    1 orgs 
. . . . . . . . Listeria monocytogenes LO28 ................................................     1 hits    1 orgs 
. . . . . . . Listeria welshimeri serovar 6b str. SLCC5334 .................................     2 hits    1 orgs [Listeria welshimeri]
. . . . . . Staphylococcus haemolyticus JCSC1435 ...........................................     2 hits    1 orgs [Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus]
. . . . . Lactobacillales ..................................................................   187 hits   94 orgs 
. . . . . . Enterococcus ...................................................................    78 hits   39 orgs [Enterococcaceae]
. . . . . . . Enterococcus gallinarum EG2 ..................................................     2 hits    1 orgs [Enterococcus gallinarum]
. . . . . . . Enterococcus casseliflavus ...................................................     6 hits    3 orgs 
. . . . . . . . Enterococcus casseliflavus EC20 ............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus casseliflavus EC30 ............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus casseliflavus EC10 ............................................     2 hits    1 orgs 
. . . . . . . Enterococcus faecium .........................................................    26 hits   13 orgs 
. . . . . . . . Enterococcus faecium Com15 .................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium TX1330 ................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,141,733 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium Com12 .................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium DO ....................................................     3 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,230,933 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,231,502 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,231,501 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,231,410 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium 1,231,408 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium C68 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecium TC 6 ..................................................     2 hits    1 orgs 
. . . . . . . Enterococcus faecalis ........................................................    44 hits   22 orgs 
. . . . . . . . Enterococcus faecalis HH22 .................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis TX1322 ...............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis V583 .................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis TX0104 ...............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis ATCC 29200 ...........................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis T1 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis T2 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis ATCC 4200 ............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis T3 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis T8 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis DS5 ..................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis Merz96 ...............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis HIP11704 .............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis JH1 ..................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis E1Sol ................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis Fly1 .................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis D6 ...................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis CH188 ................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis AR01/DG ..............................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis T11 ..................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis X98 ..................................................     2 hits    1 orgs 
. . . . . . . . Enterococcus faecalis TUSoD Ef11 ...........................................     2 hits    1 orgs 
. . . . . . Streptococcaceae ...............................................................    74 hits   38 orgs 
. . . . . . . Streptococcus ................................................................    62 hits   32 orgs 
. . . . . . . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ..................     2 hits    1 orgs [Streptococcus infantarius; Streptococcus infantarius subsp. infantarius]
. . . . . . . . Streptococcus mutans .......................................................     3 hits    2 orgs 
. . . . . . . . . Streptococcus mutans NN2025 ..............................................     1 hits    1 orgs 
. . . . . . . . . Streptococcus mutans UA159 ...............................................     2 hits    1 orgs 
. . . . . . . . Streptococcus sp. 2_1_36FAA ................................................     2 hits    1 orgs 
. . . . . . . . Streptococcus sanguinis SK36 ...............................................     2 hits    1 orgs [Streptococcus sanguinis]
. . . . . . . . Streptococcus pyogenes .....................................................    27 hits   14 orgs 
. . . . . . . . . Streptococcus pyogenes MGAS10394 .........................................     2 hits    1 orgs [Streptococcus pyogenes serotype M6]
. . . . . . . . . Streptococcus pyogenes serotype M12 ......................................     4 hits    2 orgs 
. . . . . . . . . . Streptococcus pyogenes MGAS2096 ........................................     2 hits    1 orgs 
. . . . . . . . . . Streptococcus pyogenes MGAS9429 ........................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus pyogenes serotype M49 ......................................     3 hits    2 orgs 
. . . . . . . . . . Streptococcus pyogenes NZ131 ...........................................     2 hits    1 orgs 
. . . . . . . . . . Streptococcus pyogenes M49 591 .........................................     1 hits    1 orgs 
. . . . . . . . . Streptococcus pyogenes serotype M1 .......................................     4 hits    2 orgs 
. . . . . . . . . . Streptococcus pyogenes M1 GAS ..........................................     2 hits    1 orgs 
. . . . . . . . . . Streptococcus pyogenes MGAS5005 ........................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus pyogenes MGAS8232 ..........................................     2 hits    1 orgs [Streptococcus pyogenes serotype M18]
. . . . . . . . . Streptococcus pyogenes serotype M3 .......................................     4 hits    2 orgs 
. . . . . . . . . . Streptococcus pyogenes MGAS315 .........................................     2 hits    1 orgs 
. . . . . . . . . . Streptococcus pyogenes SSI-1 ...........................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus pyogenes MGAS6180 ..........................................     2 hits    1 orgs [Streptococcus pyogenes serotype M28]
. . . . . . . . . Streptococcus pyogenes MGAS10270 .........................................     2 hits    1 orgs [Streptococcus pyogenes serotype M2]
. . . . . . . . . Streptococcus pyogenes str. Manfredo .....................................     2 hits    1 orgs [Streptococcus pyogenes serotype M5]
. . . . . . . . . Streptococcus pyogenes MGAS10750 .........................................     2 hits    1 orgs [Streptococcus pyogenes serotype M4]
. . . . . . . . Streptococcus dysgalactiae group ...........................................     8 hits    4 orgs 
. . . . . . . . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ....................     2 hits    1 orgs [Streptococcus dysgalactiae; Streptococcus dysgalactiae subsp. equisimilis]
. . . . . . . . . Streptococcus equi .......................................................     6 hits    3 orgs 
. . . . . . . . . . Streptococcus equi subsp. zooepidemicus ................................     4 hits    2 orgs 
. . . . . . . . . . . Streptococcus equi subsp. zooepidemicus MGCS10565 ....................     2 hits    1 orgs 
. . . . . . . . . . Streptococcus equi subsp. equi 4047 ....................................     2 hits    1 orgs [Streptococcus equi subsp. equi]
. . . . . . . . Streptococcus agalactiae ...................................................    16 hits    8 orgs 
. . . . . . . . . Streptococcus agalactiae 2603V/R .........................................     2 hits    1 orgs [Streptococcus agalactiae serogroup V]
. . . . . . . . . Streptococcus agalactiae 18RS21 ..........................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus agalactiae A909 ............................................     2 hits    1 orgs [Streptococcus agalactiae serogroup Ia]
. . . . . . . . . Streptococcus agalactiae H36B ............................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus agalactiae COH1 ............................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus agalactiae NEM316 ..........................................     2 hits    1 orgs [Streptococcus agalactiae serogroup III]
. . . . . . . . . Streptococcus agalactiae CJB111 ..........................................     2 hits    1 orgs 
. . . . . . . . . Streptococcus agalactiae 515 .............................................     2 hits    1 orgs 
. . . . . . . . Streptococcus uberis 0140J .................................................     2 hits    1 orgs [Streptococcus uberis]
. . . . . . . Lactococcus ..................................................................    12 hits    6 orgs 
. . . . . . . . Lactococcus lactis .........................................................    12 hits    6 orgs 
. . . . . . . . . Lactococcus lactis subsp. lactis .........................................     5 hits    3 orgs 
. . . . . . . . . . Lactococcus lactis subsp. lactis KF147 .................................     2 hits    1 orgs 
. . . . . . . . . . Lactococcus lactis subsp. lactis Il1403 ................................     2 hits    1 orgs 
. . . . . . . . . Lactococcus lactis subsp. cremoris .......................................     5 hits    2 orgs 
. . . . . . . . . . Lactococcus lactis subsp. cremoris SK11 ................................     2 hits    1 orgs 
. . . . . . . . . . Lactococcus lactis subsp. cremoris MG1363 ..............................     3 hits    1 orgs 
. . . . . . Leuconostocaceae ...............................................................     8 hits    4 orgs 
. . . . . . . Weissella paramesenteroides ATCC 33313 .......................................     2 hits    1 orgs [Weissella; Weissella paramesenteroides]
. . . . . . . Leuconostoc ..................................................................     6 hits    3 orgs 
. . . . . . . . Leuconostoc mesenteroides ..................................................     4 hits    2 orgs 
. . . . . . . . . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 .................     2 hits    1 orgs [Leuconostoc mesenteroides subsp. mesenteroides]
. . . . . . . . . Leuconostoc mesenteroides subsp. cremoris ATCC 19254 .....................     2 hits    1 orgs [Leuconostoc mesenteroides subsp. cremoris]
. . . . . . . . Leuconostoc citreum KM20 ...................................................     2 hits    1 orgs [Leuconostoc citreum]
. . . . . . Lactobacillus ..................................................................    25 hits   12 orgs [Lactobacillaceae]
. . . . . . . Lactobacillus casei group ....................................................     8 hits    4 orgs 
. . . . . . . . Lactobacillus casei ........................................................     4 hits    2 orgs 
. . . . . . . . . Lactobacillus casei ATCC 334 .............................................     2 hits    1 orgs 
. . . . . . . . . Lactobacillus casei BL23 .................................................     2 hits    1 orgs 
. . . . . . . . Lactobacillus paracasei subsp. paracasei ...................................     4 hits    2 orgs [Lactobacillus paracasei]
. . . . . . . . . Lactobacillus paracasei subsp. paracasei ATCC 25302 ......................     2 hits    1 orgs 
. . . . . . . . . Lactobacillus paracasei subsp. paracasei 8700:2 ..........................     2 hits    1 orgs 
. . . . . . . Lactobacillus rhamnosus ......................................................     9 hits    4 orgs 
. . . . . . . . Lactobacillus rhamnosus HN001 ..............................................     2 hits    1 orgs 
. . . . . . . . Lactobacillus rhamnosus GG .................................................     3 hits    1 orgs 
. . . . . . . . Lactobacillus rhamnosus LMS2-1 .............................................     2 hits    1 orgs 
. . . . . . . . Lactobacillus rhamnosus Lc 705 .............................................     2 hits    1 orgs 
. . . . . . . Lactobacillus brevis subsp. gravesensis ATCC 27305 ...........................     2 hits    1 orgs [Lactobacillus brevis; Lactobacillus brevis subsp. gravesensis]
. . . . . . . Lactobacillus buchneri ATCC 11577 ............................................     2 hits    1 orgs [Lactobacillus buchneri]
. . . . . . . Lactobacillus hilgardii ATCC 8290 ............................................     2 hits    1 orgs [Lactobacillus hilgardii]
. . . . . . . Lactobacillus sakei subsp. sakei 23K .........................................     2 hits    1 orgs [Lactobacillus sakei; Lactobacillus sakei subsp. sakei]
. . . . . . Carnobacterium sp. AT7 .........................................................     2 hits    1 orgs [Carnobacteriaceae; Carnobacterium]
. . . . Clostridia .........................................................................    28 hits   13 orgs 
. . . . . Clostridiales ....................................................................    22 hits   11 orgs 
. . . . . . Clostridiaceae .................................................................    10 hits    5 orgs 
. . . . . . . Alkaliphilus .................................................................     4 hits    2 orgs 
. . . . . . . . Alkaliphilus oremlandii OhILAs .............................................     2 hits    1 orgs [Alkaliphilus oremlandii]
. . . . . . . . Alkaliphilus metalliredigens QYMF ..........................................     2 hits    1 orgs [Alkaliphilus metalliredigens]
. . . . . . . Clostridium ..................................................................     6 hits    3 orgs 
. . . . . . . . Clostridium tetani E88 .....................................................     2 hits    1 orgs [Clostridium tetani]
. . . . . . . . Clostridium kluyveri .......................................................     4 hits    2 orgs 
. . . . . . . . . Clostridium kluyveri NBRC 12016 ..........................................     2 hits    1 orgs 
. . . . . . . . . Clostridium kluyveri DSM 555 .............................................     2 hits    1 orgs 
. . . . . . Dethiobacter alkaliphilus AHT 1 ................................................     2 hits    1 orgs [Syntrophomonadaceae; Dethiobacter; Dethiobacter alkaliphilus]
. . . . . . Peptococcaceae .................................................................     8 hits    4 orgs 
. . . . . . . Desulfotomaculum .............................................................     4 hits    2 orgs 
. . . . . . . . Desulfotomaculum reducens MI-1 .............................................     2 hits    1 orgs [Desulfotomaculum reducens]
. . . . . . . . Desulfotomaculum acetoxidans DSM 771 .......................................     2 hits    1 orgs [Desulfotomaculum acetoxidans]
. . . . . . . Desulfitobacterium hafniense .................................................     4 hits    2 orgs [Desulfitobacterium]
. . . . . . . . Desulfitobacterium hafniense DCB-2 .........................................     2 hits    1 orgs 
. . . . . . . . Desulfitobacterium hafniense Y51 ...........................................     2 hits    1 orgs 
. . . . . . Anaerococcus hydrogenalis DSM 7454 .............................................     2 hits    1 orgs [Clostridiales incertae sedis; Clostridiales Family XI. Incertae Sedis; Anaerococcus; Anaerococcus hydrogenalis]
. . . . . Halothermothrix orenii H 168 .....................................................     2 hits    1 orgs [Halanaerobiales; Halanaerobiaceae; Halothermothrix; Halothermothrix orenii]
. . . . . Natranaerobius thermophilus JW/NM-WN-LF ..........................................     4 hits    1 orgs [Natranaerobiales; Natranaerobiaceae; Natranaerobius; Natranaerobius thermophilus]
. . . Actinobacteria (class) ...............................................................   115 hits   45 orgs [Actinobacteria]
. . . . Actinomycetales ....................................................................   109 hits   43 orgs [Actinobacteridae]
. . . . . Streptomyces .....................................................................    63 hits   22 orgs [Streptomycineae; Streptomycetaceae]
. . . . . . Streptomyces sp. ACT-1 .........................................................     4 hits    1 orgs 
. . . . . . Streptomyces griseus subsp. griseus NBRC 13350 .................................     4 hits    1 orgs [Streptomyces griseus group; Streptomyces griseus; Streptomyces griseus subsp. griseus]
. . . . . . Streptomyces filamentosus ......................................................     4 hits    2 orgs 
. . . . . . . Streptomyces roseosporus NRRL 15998 ..........................................     2 hits    1 orgs 
. . . . . . . Streptomyces roseosporus NRRL 11379 ..........................................     2 hits    1 orgs 
. . . . . . Streptomyces sp. C .............................................................     2 hits    1 orgs 
. . . . . . Streptomyces flavogriseus ATCC 33331 ...........................................     4 hits    1 orgs [Streptomyces flavogriseus]
. . . . . . Streptomyces avermitilis MA-4680 ...............................................     4 hits    1 orgs [Streptomyces avermitilis]
. . . . . . Streptomyces hygroscopicus ATCC 53653 ..........................................     2 hits    1 orgs [Streptomyces hygroscopicus]
. . . . . . Streptomyces sp. ACTE ..........................................................     4 hits    1 orgs 
. . . . . . Streptomyces albus J1074 .......................................................     2 hits    1 orgs [Streptomyces albus]
. . . . . . Streptomyces lividans TK24 .....................................................     2 hits    1 orgs [Streptomyces lividans]
. . . . . . Streptomyces viridochromogenes DSM 40736 .......................................     3 hits    1 orgs [Streptomyces viridochromogenes]
. . . . . . Streptomyces griseoflavus Tu4000 ...............................................     2 hits    1 orgs [Streptomyces griseoflavus]
. . . . . . Streptomyces ghanaensis ATCC 14672 .............................................     2 hits    1 orgs [Streptomyces ghanaensis]
. . . . . . Streptomyces coelicolor A3(2) ..................................................     4 hits    1 orgs [Streptomyces coelicolor]
. . . . . . Streptomyces sp. Mg1 ...........................................................     4 hits    1 orgs 
. . . . . . Streptomyces pristinaespiralis ATCC 25486 ......................................     4 hits    1 orgs [Streptomyces pristinaespiralis]
. . . . . . Streptomyces sviceus ATCC 29083 ................................................     6 hits    1 orgs [Streptomyces sviceus]
. . . . . . Streptomyces sp. SPB74 .........................................................     2 hits    1 orgs 
. . . . . . Streptomyces sp. SPB78 .........................................................     1 hits    1 orgs 
. . . . . . Streptomyces clavuligerus ATCC 27064 ...........................................     2 hits    1 orgs [Streptomyces clavuligerus]
. . . . . . Streptomyces sp. AA4 ...........................................................     1 hits    1 orgs 
. . . . . Propionibacterium acnes ..........................................................     6 hits    3 orgs [Propionibacterineae; Propionibacteriaceae; Propionibacterium]
. . . . . . Propionibacterium acnes J139 ...................................................     2 hits    1 orgs 
. . . . . . Propionibacterium acnes KPA171202 ..............................................     2 hits    1 orgs 
. . . . . . Propionibacterium acnes SK137 ..................................................     2 hits    1 orgs 
. . . . . Corynebacterium ..................................................................     7 hits    3 orgs [Corynebacterineae; Corynebacteriaceae]
. . . . . . Corynebacterium aurimucosum ATCC 700975 ........................................     3 hits    1 orgs [Corynebacterium aurimucosum]
. . . . . . Corynebacterium accolens ATCC 49725 ............................................     2 hits    1 orgs [Corynebacterium accolens]
. . . . . . Corynebacterium genitalium ATCC 33030 ..........................................     2 hits    1 orgs [Corynebacterium genitalium]
. . . . . Pseudonocardiaceae ...............................................................     6 hits    2 orgs [Pseudonocardineae]
. . . . . . Saccharomonospora viridis DSM 43017 ............................................     2 hits    1 orgs [Saccharomonospora; Saccharomonospora viridis]
. . . . . . Saccharopolyspora erythraea NRRL 2338 ..........................................     4 hits    1 orgs [Saccharopolyspora; Saccharopolyspora erythraea]
. . . . . Streptosporangineae ..............................................................     6 hits    3 orgs 
. . . . . . Streptosporangium roseum DSM 43021 .............................................     2 hits    1 orgs [Streptosporangiaceae; Streptosporangium; Streptosporangium roseum]
. . . . . . Nocardiopsaceae ................................................................     4 hits    2 orgs 
. . . . . . . Thermobifida fusca YX ........................................................     2 hits    1 orgs [Thermobifida; Thermobifida fusca]
. . . . . . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ......................     2 hits    1 orgs [Nocardiopsis; Nocardiopsis dassonvillei; Nocardiopsis dassonvillei subsp. dassonvillei]
. . . . . Micrococcineae ...................................................................    11 hits    6 orgs 
. . . . . . Jonesia denitrificans DSM 20603 ................................................     2 hits    1 orgs [Jonesiaceae; Jonesia; Jonesia denitrificans]
. . . . . . Sanguibacter keddieii DSM 10542 ................................................     2 hits    1 orgs [Sanguibacteraceae; Sanguibacter; Sanguibacter keddieii]
. . . . . . Brevibacterium linens BL2 ......................................................     1 hits    1 orgs [Brevibacteriaceae; Brevibacterium; Brevibacterium linens]
. . . . . . Xylanimonas cellulosilytica DSM 15894 ..........................................     2 hits    1 orgs [Promicromonosporaceae; Xylanimonas; Xylanimonas cellulosilytica]
. . . . . . Beutenbergia cavernae DSM 12333 ................................................     2 hits    1 orgs [Beutenbergiaceae; Beutenbergia; Beutenbergia cavernae]
. . . . . . Brachybacterium faecium DSM 4810 ...............................................     2 hits    1 orgs [Dermabacteraceae; Brachybacterium; Brachybacterium faecium]
. . . . . Stackebrandtia nassauensis DSM 44728 .............................................     2 hits    1 orgs [Glycomycineae; Glycomycetaceae; Stackebrandtia; Stackebrandtia nassauensis]
. . . . . Salinispora ......................................................................     6 hits    2 orgs [Micromonosporineae; Micromonosporaceae]
. . . . . . Salinispora arenicola CNS-205 ..................................................     4 hits    1 orgs [Salinispora arenicola]
. . . . . . Salinispora tropica CNB-440 ....................................................     2 hits    1 orgs [Salinispora tropica]
. . . . . Geodermatophilus obscurus DSM 43160 ..............................................     2 hits    1 orgs [Frankineae; Geodermatophilaceae; Geodermatophilus; Geodermatophilus obscurus]
. . . . marine actinobacterium PHSC20C1 ....................................................     2 hits    1 orgs [unclassified Actinobacteria; unclassified Actinobacteria (miscellaneous)]
. . . . Rubrobacter xylanophilus DSM 9941 ..................................................     4 hits    1 orgs [Rubrobacteridae; Rubrobacterales; Rubrobacterineae; Rubrobacteraceae; Rubrobacter; Rubrobacter xylanophilus]
. . . Bacteroidetes ........................................................................    59 hits   29 orgs [Bacteroidetes/Chlorobi group]
. . . . Bacteroidales ......................................................................    54 hits   26 orgs [Bacteroidia]
. . . . . Parabacteroides ..................................................................    10 hits    4 orgs [Porphyromonadaceae]
. . . . . . Parabacteroides johnsonii DSM 18315 ............................................     2 hits    1 orgs [Parabacteroides johnsonii]
. . . . . . Parabacteroides merdae ATCC 43184 ..............................................     2 hits    1 orgs [Parabacteroides merdae]
. . . . . . Parabacteroides sp. D13 ........................................................     2 hits    1 orgs 
. . . . . . Parabacteroides distasonis ATCC 8503 ...........................................     4 hits    1 orgs [Parabacteroides distasonis]
. . . . . Bacteroides ......................................................................    44 hits   22 orgs [Bacteroidaceae]
. . . . . . Bacteroides sp. 2_1_33B ........................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 2_1_7 ..........................................................     2 hits    1 orgs 
. . . . . . Bacteroides thetaiotaomicron VPI-5482 ..........................................     2 hits    1 orgs [Bacteroides thetaiotaomicron]
. . . . . . Bacteroides sp. 1_1_6 ..........................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 4_3_47FAA ......................................................     2 hits    1 orgs 
. . . . . . Bacteroides vulgatus ATCC 8482 .................................................     2 hits    1 orgs [Bacteroides vulgatus]
. . . . . . Bacteroides sp. 9_1_42FAA ......................................................     4 hits    1 orgs 
. . . . . . Bacteroides dorei ..............................................................     4 hits    2 orgs 
. . . . . . . Bacteroides dorei 5_1_36/D4 ..................................................     2 hits    1 orgs 
. . . . . . . Bacteroides dorei DSM 17855 ..................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 3_1_33FAA ......................................................     2 hits    1 orgs 
. . . . . . Bacteroides fragilis ...........................................................     5 hits    3 orgs 
. . . . . . . Bacteroides fragilis 3_1_12 ..................................................     1 hits    1 orgs 
. . . . . . . Bacteroides fragilis NCTC 9343 ...............................................     2 hits    1 orgs 
. . . . . . . Bacteroides fragilis YCH46 ...................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 3_2_5 ..........................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 2_1_16 .........................................................     2 hits    1 orgs 
. . . . . . Bacteroides finegoldii DSM 17565 ...............................................     2 hits    1 orgs [Bacteroides finegoldii]
. . . . . . Bacteroides sp. 2_2_4 ..........................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. D1 .............................................................     2 hits    1 orgs 
. . . . . . Bacteroides sp. 2_1_22 .........................................................     2 hits    1 orgs 
. . . . . . Bacteroides ovatus ATCC 8483 ...................................................     2 hits    1 orgs [Bacteroides ovatus]
. . . . . . Bacteroides sp. D2 .............................................................     1 hits    1 orgs 
. . . . . . Bacteroides caccae ATCC 43185 ..................................................     2 hits    1 orgs [Bacteroides caccae]
. . . . Flavobacteriaceae ..................................................................     3 hits    2 orgs [Flavobacteria; Flavobacteriales]
. . . . . Psychroflexus torquis ATCC 700755 ................................................     1 hits    1 orgs [Psychroflexus; Psychroflexus torquis]
. . . . . Chryseobacterium gleum ATCC 35910 ................................................     2 hits    1 orgs [Chryseobacterium; Chryseobacterium gleum]
. . . . Salinibacter ruber DSM 13855 .......................................................     2 hits    1 orgs [Sphingobacteria; Sphingobacteriales; Rhodothermaceae; Salinibacter; Salinibacter ruber]
. . . Trichodesmium erythraeum IMS101 ......................................................     2 hits    1 orgs [Cyanobacteria; Oscillatoriales; Trichodesmium; Trichodesmium erythraeum]
. . . Denitrovibrio acetiphilus DSM 12809 ..................................................     2 hits    1 orgs [Deferribacteres; Deferribacteres (class); Deferribacterales; Deferribacteraceae; Denitrovibrio; Denitrovibrio acetiphilus]
. . . Victivallis vadensis ATCC BAA-548 ....................................................     2 hits    1 orgs [Chlamydiae/Verrucomicrobia group; Lentisphaerae; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis]
. . . Pyramidobacter piscolens W5455 .......................................................     2 hits    1 orgs [Synergistetes; Synergistia; Synergistales; Synergistaceae; Pyramidobacter; Pyramidobacter piscolens]
. . . Meiothermus ruber DSM 1279 ...........................................................     2 hits    1 orgs [Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; Meiothermus; Meiothermus ruber]
. . . Fusobacterium ........................................................................     3 hits    2 orgs [Fusobacteria; Fusobacteria (class); Fusobacteriales; Fusobacteriaceae]
. . . . Fusobacterium varium ATCC 27725 ....................................................     2 hits    1 orgs [Fusobacterium varium]
. . . . Fusobacterium ulcerans ATCC 49185 ..................................................     1 hits    1 orgs [Fusobacterium ulcerans]
. . Methanomicrobia ........................................................................    14 hits    7 orgs [Archaea; Euryarchaeota]
. . . Methanomicrobiales ...................................................................     4 hits    2 orgs 
. . . . Methanoculleus marisnigri JR1 ......................................................     2 hits    1 orgs [Methanomicrobiaceae; Methanoculleus; Methanoculleus marisnigri]
. . . . Methanocorpusculum labreanum Z .....................................................     2 hits    1 orgs [Methanocorpusculaceae; Methanocorpusculum; Methanocorpusculum labreanum]
. . . Methanosarcinaceae ...................................................................    10 hits    5 orgs [Methanosarcinales]
. . . . Methanosarcina .....................................................................     7 hits    3 orgs 
. . . . . Methanosarcina mazei Go1 .........................................................     3 hits    1 orgs [Methanosarcina mazei]
. . . . . Methanosarcina barkeri str. Fusaro ...............................................     2 hits    1 orgs [Methanosarcina barkeri]
. . . . . Methanosarcina acetivorans C2A ...................................................     2 hits    1 orgs [Methanosarcina acetivorans]
. . . . Methanohalophilus portucalensis FDF-1 ..............................................     1 hits    1 orgs [Methanohalophilus; Methanohalophilus portucalensis]
. . . . Methanococcoides burtonii DSM 6242 .................................................     2 hits    1 orgs [Methanococcoides; Methanococcoides burtonii]
. . Populus trichocarpa ....................................................................     1 hits    1 orgs [Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus]
. prokaryotic environmental samples ........................................................     7 hits    6 orgs [unclassified sequences; environmental samples]
. . uncultured marine microorganism HF4000_133I24 ..........................................     2 hits    1 orgs 
. . uncultured marine microorganism HF4000_001B09 ..........................................     1 hits    1 orgs 
. . uncultured marine microorganism HF4000_008G09 ..........................................     1 hits    1 orgs 
. . uncultured marine microorganism HF4000_001L24 ..........................................     1 hits    1 orgs 
. . uncultured marine microorganism HF4000_141F21 ..........................................     1 hits    1 orgs 
. . uncultured marine microorganism HF4000_009A22 ..........................................     1 hits    1 orgs 

NCBI | NLM | NIH | DHHS

Copyright | Disclaimer | Privacy | Accessibility | Contact | Send feedback

BLAST

PROTOCOL

BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


First I did Blast for longest ORF on direct strand with 500 bases but its result showed poor homology i.e 64% so I did Blast again for 2nd longest ORF on indirect strand with 467 bases and its result showed better homology .


The best hit found is:

glycine betaine transport ATP-binding protein opuAA [Candidatus

Pelagibacter sp. HTCC7211]

Length_348

Score _ 248 bits (633), Expect _ 1e-64, Method: Compositional matrix adjust.

Identities _ 116/151 (76%), Positives _ 138/151 (91%), Gaps _ 0/151 (0%)


Molecular Function:ATP binding, amino acid transmembrane transporter activity and quaternary-ammonium-compound-transporting ATPase activity





Sequences producing significant alignments:                       (Bits)  Value
04697465
ref|ZP_05069346.1|  glycine betaine transport ATP-binding prot...   248    1e-64
ref|ZP_01756350.1|  ABC transporter ATP-binding protein [Roseo...   133    6e-30
ref|ZP_02145033.1|  ABC transporter ATP-binding protein [Phaeo...   131    2e-29
ref|ZP_05808665.1|  glycine betaine/L-proline ABC transporter,...   127    5e-28
ref|NP_691920.1|  glycine betaine ABC transporter ATP-binding ...   125    1e-27 Gene info
ref|NP_107673.1|  ABC transporter ATP-binding protein [Mesorhi...   125    2e-27 Gene info
ref|ZP_06279808.1|  glycine betaine/L-proline ABC transporter,...   124    3e-27
ref|ZP_05649820.1|  glycine betaine/L-proline transporter ATP-...   124    3e-27
ref|ZP_05082602.1|  glycine betaine transport ATP-binding prot...   124    3e-27
ref|YP_001822594.1|  putative glycine betaine ABC transporter ...   124    3e-27 Gene info
ref|ZP_01860474.1|  glycine betaine ABC transporter ATP-bindin...   124    3e-27
ref|ZP_04697465.1|  putative glycine betaine ABC transporter A...   124    4e-27
ref|ZP_05511217.1|  glycine betaine ABC transporter ATP-bindin...   123    6e-27
ref|ZP_05657144.1|  glycine betaine/L-proline transporter ATP-...   123    7e-27
ref|ZP_05647062.1|  glycine betaine/L-proline transporter ATP-...   123    7e-27
ref|YP_002774552.1|  glycine betaine ABC transporter ATP-bindi...   123    8e-27 Gene info
ref|ZP_05679301.1|  glycine betaine/L-proline transporter ATP-...   122    1e-26
ref|ZP_03982601.1|  quaternary-amine-transporting ATPase [Ente...   122    1e-26
ref|ZP_00603730.1|  Glycine betaine/L-proline transport ATP-bi...   122    1e-26
ref|ZP_05923680.1|  glycine betaine/L-proline transport ATP-bi...   122    1e-26
ref|ZP_04854307.1|  glycine betaine/L-proline ABC transporter ...   122    2e-26
ref|ZP_03984180.1|  quaternary-amine-transporting ATPase [Ente...   121    2e-26
ref|ZP_05125345.1|  glycine betaine/L-proline transport ATP-bi...   121    2e-26
ref|ZP_03476257.1|  hypothetical protein PRABACTJOHN_01923 [Pa...   121    3e-26
ref|ZP_04433720.1|  quaternary-amine-transporting ATPase [Ente...   121    3e-26
ref|NP_816279.1|  glycine betaine/L-proline ABC transporter, A...   121    3e-26 Gene info
ref|ZP_04647452.1|  glycine betaine transport ATP-binding prot...   121    3e-26
ref|YP_001513554.1|  glycine betaine/L-proline ABC transporter...   121    3e-26 Gene info
ref|ZP_05806874.1|  glycine betaine/L-proline ABC transporter,...   120    3e-26
ref|YP_001046909.1|  glycine betaine/L-proline ABC transporter...   120    3e-26 Gene info
ref|YP_001697474.1|  glycine betaine transport ATP-binding pro...   120    3e-26 Gene info
ref|ZP_01722327.1|  glycine betaine/L-proline ABC transporter,...   120    4e-26
ref|NP_632064.1|  glycine betaine transporter, ATP-binding pro...   120    4e-26 Gene info
ref|ZP_05066248.1|  glycine betaine/L-proline ABC transporter,...   120    5e-26
ref|YP_003245288.1|  glycine betaine/L-proline ABC transporter...   120    6e-26 Gene info
ref|ZP_02030915.1|  hypothetical protein PARMER_00891 [Parabac...   120    6e-26
ref|ZP_02919855.1|  hypothetical protein STRINF_00707 [Strepto...   120    6e-26
ref|ZP_03734791.1|  glycine betaine/L-proline ABC transporter,...   120    7e-26
ref|NP_824609.1|  glycine betaine ABC transporter ATP-binding ...   119    7e-26 Gene info
ref|ZP_05804833.1|  glycine betaine/L-proline ABC transporter,...   119    7e-26
ref|NP_827891.1|  glycine betaine ABC transport ATP-binding pr...   119    8e-26 Gene info
ref|ZP_05516988.1|  putative glycine betaine ABC transporter A...   119    8e-26
ref|ZP_02327352.1|  glycine betaine/L-proline ABC transporter,...   119    9e-26
dbj|BAH87999.1|  putative ABC transporter ATP-binding protein ...   119    9e-26
ref|NP_721455.1|  putative ABC transporter, ATP-binding protei...   119    1e-25 Gene info
ref|ZP_06059692.1|  amino acid ABC transporter [Streptococcus ...   119    1e-25
ref|YP_001034388.1|  glycine-betaine ABC transporter, ATPase c...   119    1e-25 Gene info
ref|YP_003353988.1|  Glycine betaine/carnitine/choline ABC tra...   119    1e-25 Gene info
ref|YP_059521.1|  glycine betaine transport ATP-binding protei...   119    1e-25 Gene info
ref|ZP_06263958.1|  glycine betaine/L-proline transport ATP bi...   119    1e-25
ref|NP_267608.1|  betaine ABC transporter ATP binding protein ...   119    1e-25 Gene info
ref|YP_056182.1|  putative glycine betaine/proline ABC transpo...   119    1e-25 Gene info
ref|ZP_06273362.1|  glycine betaine/L-proline ABC transporter,...   119    1e-25
ref|YP_809471.1|  ABC-type proline/glycine betaine transport s...   119    1e-25 Gene info
ref|YP_630470.1|  glycine betaine/L-proline ABC transporter, A...   119    1e-25 Gene info
ref|ZP_04702424.1|  glycine betaine ABC transporter ATP-bindin...   119    1e-25
ref|ZP_04783316.1|  ABC superfamily ATP binding cassette trans...   119    1e-25
ref|YP_599763.1|  glycine betaine transport ATP-binding protei...   119    1e-25 Gene info
ref|YP_002285205.1|  L-proline Glycine Betaine ABC transport A...   118    2e-25 Gene info
gb|AAV48565.1|  OpuAA [Halobacillus trueperi]                       118    2e-25
ref|YP_079781.1|  glycine betaine ABC transporter ATP-binding ...   118    2e-25 Gene info
ref|YP_741576.1|  glycine betaine/L-proline ABC transporter, A...   118    2e-25 Gene info
ref|NP_268562.1|  putative glycine betaine/proline ABC transpo...   118    2e-25 Gene info
ref|ZP_05524123.1|  glycine betaine ABC transport system ATP-b...   118    2e-25
ref|YP_601657.1|  Glycine betaine transport ATP-binding protei...   118    2e-25 Gene info
ref|ZP_01169657.1|  OpuAA [Bacillus sp. NRRL B-14911] >gb|EAR6...   118    2e-25
ref|ZP_00365590.1|  COG4175: ABC-type proline/glycine betaine ...   118    2e-25
ref|YP_002834151.1|  glycine betaine ABC transporter ATP-bindi...   118    2e-25 Gene info
ref|ZP_05533747.1|  glycine betaine ABC transporter ATP-bindin...   118    2e-25
ref|ZP_05843137.1|  glycine betaine/L-proline ABC transporter,...   118    2e-25
ref|NP_693866.1|  glycine betaine ABC transporter ATP-binding ...   118    2e-25 Gene info
ref|YP_002509891.1|  glycine betaine/L-proline ABC transporter...   118    2e-25 Gene info
ref|ZP_01256638.1|  ABC transporter ATP-binding protein [Psych...   118    2e-25
ref|YP_002997700.1|  putative glycine betaine transport ATP-bi...   118    2e-25 Gene info
ref|YP_807336.1|  ABC-type proline/glycine betaine transport s...   118    2e-25 Gene info
ref|YP_001917784.1|  glycine betaine/L-proline ABC transporter...   118    2e-25 Gene info
ref|ZP_01443618.1|  ABC Glycine betaine/L-proline transporter,...   118    2e-25
ref|NP_694378.1|  glycine betaine ABC transporter ATP-binding ...   118    3e-25 Gene info
ref|YP_001114536.1|  glycine betaine/L-proline ABC transporter...   117    3e-25 Gene info
ref|ZP_04444377.1|  ABC superfamily ATP binding cassette trans...   117    3e-25
ref|NP_688787.1|  amino acid ABC transporter, ATP-binding prot...   117    3e-25 Gene info
ref|YP_002283921.1|  glycine betaine/L-proline ABC transporter...   117    3e-25 Gene info
ref|YP_330415.1|  glycine betaine/proline ABC transporter, ATP...   117    4e-25 Gene info
ref|YP_817853.1|  ABC-type proline/glycine betaine transport s...   117    4e-25 Gene info
ref|ZP_06077939.1|  glycine betaine transport ATP-binding prot...   117    4e-25
ref|ZP_05288626.1|  glycine betaine transport ATP-binding prot...   117    4e-25
ref|ZP_03914643.1|  quaternary-amine-transporting ATPase [Leuc...   117    4e-25
ref|ZP_05542285.1|  glycine betaine transport ATP-binding prot...   117    4e-25
ref|NP_736273.1|  hypothetical protein gbs1839 [Streptococcus ...   117    4e-25 Gene info
ref|YP_001301513.1|  glycine betaine transport ATP-binding pro...   117    4e-25 Gene info
ref|YP_001320617.1|  glycine betaine/L-proline ABC transporter...   117    4e-25 Gene info
ref|YP_944709.1|  ABC transporter ATP-binding protein [Psychro...   117    4e-25 Gene info
ref|ZP_00788346.1|  amino acid ABC transporter, ATP-binding pr...   117    4e-25
gb|AAF40473.1|AF184955_1  OpuAA [Lactococcus lactis subsp. cre...   117    4e-25
ref|YP_001918201.1|  glycine betaine/L-proline ABC transporter...   117    5e-25 Gene info
ref|ZP_06273775.1|  glycine betaine/L-proline ABC transporter,...   117    5e-25
ref|ZP_04689251.1|  glycine betaine transport ATP-binding prot...   117    5e-25
ref|ZP_03210865.1|  ABC-type proline/glycine betaine transport...   117    5e-25
ref|YP_003171894.1|  glycine betaine/L-proline ABC transporter...   117    5e-25 Gene info
gb|AAX73263.2|  ATP-binding protein [Methanohalophilus portuca...   117    5e-25
ref|NP_628986.1|  glycine betaine ABC transport system ATP-bin...   117    5e-25 Gene info
ref|ZP_03940027.1|  quaternary-amine-transporting ATPase [Lact...   117    6e-25
ref|ZP_02185274.1|  glycine betaine ABC transporter ATP-bindin...   117    6e-25
ref|ZP_04441767.1|  quaternary-amine-transporting ATPase [Lact...   116    6e-25
ref|ZP_03942961.1|  ABC superfamily ATP binding cassette trans...   116    6e-25
ref|YP_003190058.1|  glycine betaine/L-proline ABC transporter...   116    6e-25 Gene info
ref|ZP_03953089.1|  ABC superfamily ATP binding cassette trans...   116    6e-25
ref|YP_002990281.1|  glycine betaine/L-proline ABC transporter...   116    6e-25 Gene info
ref|YP_003132028.1|  glycine betaine/L-proline transport ATP b...   116    8e-25 Gene info
ref|ZP_05114116.1|  glycine betaine/L-proline transport ATP bi...   116    8e-25
ref|ZP_05539255.1|  glycine betaine ABC transport system ATP-b...   116    8e-25
ref|ZP_05124734.1|  glycine betaine/proline ABC transporter, A...   116    9e-25
dbj|BAA08932.1|  glycine betain/L-proline transport ATPase [Ba...   115    1e-24
ref|ZP_03589961.1|  glycine betaine ABC transporter ATP-bindin...   115    1e-24 Gene info
ref|ZP_04686320.1|  glycine betaine ABC transporter ATP-bindin...   115    1e-24
ref|ZP_02168951.1|  ABC-type proline/glycine betaine transport...   115    1e-24
ref|NP_810664.1|  glycine betaine transport ATP-binding protei...   115    1e-24 Gene info
ref|YP_003337529.1|  glycine betaine/proline ABC transporter, ...   115    1e-24 Gene info
ref|ZP_05519134.1|  putative glycine betaine ABC transporter A...   115    1e-24
ref|ZP_01736894.1|  glycine betaine/l-proline transport ATP-bi...   115    1e-24
ref|ZP_04701071.1|  putative glycine betaine ABC transporter A...   115    1e-24
ref|YP_001485528.1|  glycine betaine ABC transporter ATP-bindi...   115    2e-24 Gene info
ref|ZP_04999671.1|  glycine betaine ABC transporter ATP-bindin...   115    2e-24
ref|NP_782881.1|  glycine betaine transport ATP-binding protei...   115    2e-24 Gene info
ref|ZP_05254752.1|  glycine betaine transport ATP-binding prot...   115    2e-24
ref|ZP_03056072.1|  glycine betaine transport ATP-binding prot...   115    2e-24
ref|YP_001030496.1|  hypothetical protein Mlab_1060 [Methanoco...   115    2e-24 Gene info
ref|YP_001300521.1|  glycine betaine transport ATP-binding pro...   115    2e-24 Gene info
ref|YP_001827402.1|  putative glycine betaine ABC transporter ...   115    2e-24 Gene info
ref|YP_396309.1|  putative glycine/betaine/carnitine ABC trans...   115    2e-24 Gene info
ref|YP_002605032.1|  ProV [Desulfobacterium autotrophicum HRM2...   115    2e-24 Gene info
ref|ZP_04540441.1|  glycine betaine transport ATP-binding prot...   115    2e-24
ref|ZP_03301345.1|  hypothetical protein BACDOR_02727 [Bactero...   115    2e-24
ref|ZP_05010582.1|  glycine betaine ABC transport ATP-binding ...   115    2e-24
ref|NP_470350.1|  hypothetical protein lin1013 [Listeria innoc...   114    3e-24 Gene info
ref|ZP_00790073.1|  amino acid ABC transporter, ATP-binding pr...   114    3e-24
ref|NP_464539.1|  hypothetical protein lmo1014 [Listeria monoc...   114    3e-24 Gene info
ref|ZP_05282952.1|  glycine betaine transport ATP-binding prot...   114    3e-24
ref|YP_013635.1|  glycine betaine/L-proline ABC transporter, A...   114    3e-24 Gene info
ref|ZP_05530323.1|  glycine betaine transport ATP-binding prot...   114    3e-24
ref|YP_849197.1|  glycine betaine/L-proline ABC transporter, A...   114    3e-24 Gene info
ref|YP_266705.1|  glycine betaine/l-proline transport ATP-bind...   114    4e-24 Gene info
ref|ZP_00231695.1|  glycine betaine/L-proline ABC transporter,...   114    4e-24
ref|YP_001305162.1|  glycine betaine transport ATP-binding pro...   114    4e-24 Gene info
ref|YP_212785.1|  putative glycine betaine transport ATP-bindi...   114    4e-24 Gene info
ref|YP_100614.1|  glycine betaine transport ATP-binding protei...   114    4e-24 Gene info
ref|YP_723590.1|  glycine betaine/L-proline ABC transporter, A...   114    4e-24 Gene info
ref|ZP_05018227.1|  glycine betaine ABC transporter ATP-bindin...   114    4e-24
ref|ZP_01755756.1|  glycine betaine/proline ABC transporter, A...   114    5e-24
ref|YP_002990423.1|  glycine betaine/L-proline ABC transporter...   114    5e-24 Gene info
ref|ZP_04692006.1|  putative glycine betaine ABC transporter A...   114    5e-24
ref|YP_001419952.1|  OpuAA [Bacillus amyloliquefaciens FZB42] ...   113    5e-24 Gene info
ref|ZP_00959020.1|  ABC Glycine betaine/L-proline transporter,...   113    5e-24
ref|ZP_03737660.1|  glycine betaine/L-proline ABC transporter,...   113    5e-24
ref|YP_003159809.1|  glycine betaine/L-proline ABC transporter...   113    5e-24 Gene info
ref|YP_002562991.1|  glycine betaine transport ATP-binding pro...   113    6e-24 Gene info
ref|ZP_05287711.1|  glycine betaine transport ATP-binding prot...   113    6e-24
ref|YP_002471160.1|  hypothetical protein CKR_0695 [Clostridiu...   113    6e-24 Gene info
ref|YP_002122568.1|  glycine betaine transport ATP-binding pro...   113    7e-24 Gene info
ref|ZP_01056304.1|  glycine betaine/proline ABC transporter, A...   113    7e-24
ref|YP_002745660.1|  glycine betaine transport ATP-binding pro...   113    7e-24 Gene info
ref|YP_001394178.1|  ProV [Clostridium kluyveri DSM 555] >gb|E...   113    7e-24 Gene info
ref|ZP_04993427.1|  glycine betaine ABC transport ATP-binding ...   113    7e-24
ref|YP_011512.1|  glycine/betaine/L-proline ABC transporter, A...   113    7e-24 Gene info
ref|ZP_05417452.1|  glycine betaine/L-proline ABC transporter,...   113    8e-24
ref|ZP_01753241.1|  glycine betaine/proline ABC transporter, A...   113    8e-24
ref|ZP_04553808.1|  glycine betaine transport ATP-binding prot...   113    8e-24
ref|NP_880723.1|  putative ABC-transporter ATP-binding protein...   113    8e-24 Gene info
ref|NP_884016.1|  putative ABC-transporter ATP-binding protein...   113    8e-24 Gene info
ref|ZP_05302909.1|  glycine betaine transport ATP-binding prot...   113    8e-24
ref|ZP_04544232.1|  glycine betaine transport ATP-binding prot...   112    9e-24
ref|ZP_02067485.1|  hypothetical protein BACOVA_04493 [Bactero...   112    9e-24
ref|YP_002743716.1|  glycine betaine transport ATP-binding pro...   112    1e-23 Gene info
ref|ZP_05759825.1|  glycine betaine transport ATP-binding prot...   112    1e-23
ref|YP_001631918.1|  putative ABC-transporter ATP-binding prot...   112    1e-23 Gene info
ref|YP_003013209.1|  glycine betaine/L-proline ABC transporter...   112    1e-23 Gene info
ref|YP_166383.1|  glycine betaine/proline ABC transporter, ATP...   112    1e-23 Gene info
ref|NP_625896.1|  glycine betaine transport ATP-binding protei...   112    1e-23 Gene info
ref|ZP_05485890.1|  putative glycine betaine ABC transporter A...   112    1e-23
ref|ZP_01961112.1|  hypothetical protein BACCAC_02738 [Bactero...   112    1e-23
ref|ZP_05510547.1|  putative glycine betaine ABC transporter A...   112    1e-23
ref|ZP_02139923.1|  glycine betaine/L-proline transport ATP-bi...   112    1e-23
ref|ZP_05009453.1|  glycine betaine ABC transporter ATP-bindin...   112    1e-23
ref|YP_305877.1|  glycine betaine/L-proline ABC transporter, A...   112    1e-23 Gene info
ref|ZP_05008005.1|  glycine betaine transport ATP-binding prot...   112    2e-23
ref|YP_786990.1|  glycine betaine/L-proline ABC transporter,AT...   112    2e-23 Gene info
gb|ABZ06650.1|  putative ABC transporter [uncultured marine mi...   112    2e-23
ref|ZP_01129845.1|  putative glycine betaine/proline ABC trans...   112    2e-23
gb|ABZ05920.1|  putative ABC transporter [uncultured marine mi...   112    2e-23
ref|NP_353914.2|  ABC transporter, nucleotide binding/ATPase p...   112    2e-23 Gene info
ref|ZP_01743766.1|  glycine betaine/proline ABC transporter, A...   111    2e-23
ref|NP_617063.1|  glycine betaine/L-proline ABC transporter, A...   111    2e-23 Gene info
ref|YP_165061.1|  glycine betaine/proline ABC transporter, ATP...   111    2e-23 Gene info
ref|YP_174571.1|  glycine betaine ABC transporter ATP-binding ...   111    2e-23 Gene info
ref|YP_166790.1|  glycine betaine/proline ABC transporter, ATP...   111    2e-23 Gene info
ref|YP_001375190.1|  glycine betaine/L-proline ABC transporter...   111    2e-23 Gene info
ref|ZP_00743176.1|  Glycine betaine transport ATP-binding prot...   111    2e-23
ref|ZP_04217811.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04300981.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04102484.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04169224.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04197824.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|YP_001645421.1|  glycine betaine/L-proline ABC transporter...   111    3e-23 Gene info
ref|NP_832543.1|  glycine betaine transport ATP-binding protei...   111    3e-23 Gene info
ref|ZP_04120721.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_05069647.1|  glycine betaine transporter, ATP-binding p...   111    3e-23
ref|ZP_04228264.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04151548.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04157316.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04443925.1|  ABC superfamily ATP binding cassette trans...   111    3e-23
ref|YP_003161562.1|  glycine betaine/L-proline ABC transporter...   111    3e-23 Gene info
ref|ZP_04084779.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_04245688.1|  Glycine betaine transport ATP-binding prot...   111    3e-23
ref|ZP_03907516.1|  glycine betaine/L-proline transport ATP bi...   111    3e-23
ref|ZP_03932728.1|  quaternary-amine-transporting ATPase [Cory...   111    3e-23
ref|YP_254570.1|  hypothetical protein SH2655 [Staphylococcus ...   111    3e-23 Gene info
ref|ZP_04203516.1|  Glycine betaine transport ATP-binding prot...   110    3e-23
ref|ZP_05070116.1|  glycine betaine transporter, ATP-binding p...   110    3e-23
ref|YP_001532780.1|  glycine betaine/L-proline ABC transporter...   110    4e-23 Gene info
ref|YP_003313704.1|  glycine betaine/L-proline transport ATP b...   110    4e-23 Gene info
ref|ZP_00393042.1|  COG4175: ABC-type proline/glycine betaine ...   110    4e-23
ref|ZP_04289640.1|  Glycine betaine transport ATP-binding prot...   110    4e-23
ref|YP_001859649.1|  glycine betaine/L-proline ABC transporter...   110    4e-23 Gene info
ref|YP_895297.1|  glycine betaine/L-proline ABC transporter, A...   110    4e-23 Gene info
ref|YP_645314.1|  glycine betaine/L-proline transport ATP bind...   110    4e-23 Gene info
ref|ZP_04484983.1|  glycine betaine/L-proline transport ATP bi...   110    4e-23
ref|YP_002769857.1|  probable glycine betaine ABC transporter ...   110    4e-23 Gene info
ref|YP_002435468.1|  glycine betaine/L-proline ABC transporter...   110    4e-23 Gene info
ref|YP_001728587.1|  ABC-type proline/glycine betaine transpor...   110    4e-23 Gene info
ref|ZP_01446533.1|  glycine betaine/L-proline transport ATP-bi...   110    4e-23
ref|YP_644329.1|  glycine betaine/L-proline transport ATP bind...   110    4e-23 Gene info
ref|NP_979120.1|  glycine betaine/L-proline ABC transporter, A...   110    4e-23 Gene info
ref|NP_845135.1|  glycine betaine/L-proline ABC transporter, A...   110    4e-23 Gene info
ref|ZP_04323699.1|  Glycine betaine transport ATP-binding prot...   110    4e-23
ref|ZP_00239740.1|  amino acid ABC transporter, ATP-binding pr...   110    5e-23
ref|ZP_05022861.1|  glycine betaine transport ATP-binding prot...   110    5e-23
ref|YP_444576.1|  glycine betaine/L-proline transport ATP bind...   110    5e-23 Gene info
ref|YP_432650.1|  ABC-type proline/glycine betaine transport s...   110    5e-23 Gene info
ref|ZP_05002637.1|  glycine betaine ABC transport ATP-binding ...   110    5e-23
ref|YP_001538279.1|  glycine betaine/L-proline ABC transporter...   110    6e-23 Gene info
ref|ZP_01064361.1|  putative glycine betaine ABC transporter A...   110    6e-23
ref|YP_002417137.1|  ABC transporter: ATP binding protein [Vib...   110    6e-23 Gene info
ref|ZP_02165589.1|  glycine betaine/L-proline transport ATP-bi...   110    6e-23
ref|ZP_02145275.1|  glycine betaine/L-proline transport ATP-bi...   110    6e-23
ref|ZP_01812874.1|  putative glycine betaine ABC transporter A...   110    6e-23
ref|ZP_00988560.1|  putative glycine betaine ABC transporter A...   110    6e-23
ref|ZP_05912917.1|  glycine betaine/L-proline ABC transporter,...   110    6e-23
ref|NP_356599.2|  ABC transporter, nucleotide binding/ATPase p...   110    6e-23 Gene info
ref|YP_290986.1|  glycine betaine/L-proline transport ATP-bind...   110    6e-23 Gene info
ref|YP_001168509.1|  ABC transporter related [Rhodobacter spha...   109    8e-23 Gene info
ref|ZP_05066127.1|  glycine betaine/proline ABC transporter, A...   109    8e-23
ref|YP_003327102.1|  glycine betaine/L-proline ABC transporter...   109    9e-23
ref|ZP_05073980.1|  glycine betaine/L-proline ABC transporter,...   109    1e-22
ref|ZP_05944180.1|  L-proline Glycine Betaine ABC transport AT...   109    1e-22
ref|ZP_02151024.1|  glycine betaine/proline ABC transporter, A...   109    1e-22
ref|ZP_01754776.1|  glycine betaine/L-proline transport ATP-bi...   108    1e-22
ref|ZP_05050296.1|  glycine betaine/L-proline transport ATP bi...   108    1e-22
ref|ZP_06244958.1|  glycine betaine/L-proline ABC transporter,...   108    1e-22
ref|YP_427562.1|  glycine betaine/L-proline transport ATP-bind...   108    1e-22 Gene info
ref|ZP_01746580.1|  ABC transporter ATP-binding protein [Sagit...   108    1e-22
ref|YP_003199135.1|  glycine betaine/L-proline ABC transporter...   108    1e-22 Gene info
ref|ZP_02144981.1|  glycine betaine/proline ABC transporter, A...   108    1e-22
ref|ZP_05085925.1|  glycine betaine transport ATP-binding prot...   108    1e-22
ref|ZP_00955417.1|  ABC glycine betaine/L-proline transporter,...   108    1e-22
ref|ZP_05065607.1|  glycine betaine/L-proline ABC transporter,...   108    1e-22
ref|ZP_01750556.1|  glycine betaine/L-proline transport ATP-bi...   108    1e-22
ref|ZP_05117720.1|  glycine betaine transport ATP-binding prot...   108    2e-22
gb|ABZ06311.1|  putative ABC transporter [uncultured marine mi...   108    2e-22
ref|YP_002881249.1|  glycine betaine/L-proline ABC transporter...   108    2e-22 Gene info
ref|YP_063942.1|  glycine betaine/L-proline transport ATP-bind...   108    2e-22 Gene info
ref|YP_266219.1|  glycine betaine/L-proline transport ATP-bind...   108    2e-22 Gene info
ref|YP_387169.1|  glycine betaine/L-proline transport ATP bind...   108    2e-22 Gene info
ref|YP_002986527.1|  glycine betaine/L-proline ABC transporter...   108    2e-22 Gene info
ref|YP_002430884.1|  glycine betaine/L-proline ABC transporter...   108    2e-22 Gene info
ref|ZP_01264047.1|  glycine betaine/L-proline transport ATP-bi...   108    2e-22
ref|YP_565234.1|  ABC glycine betaine/L-proline transporter, A...   108    2e-22 Gene info
ref|ZP_05344070.1|  glycine betaine transport ATP-binding prot...   108    2e-22
ref|ZP_05477816.1|  glycine betaine/L-proline ABC transporter,...   108    2e-22
gb|ABZ05951.1|  putative ABC transporter [uncultured marine mi...   108    2e-22
ref|ZP_00962852.1|  ABC glycine betaine/L-proline transporter,...   108    2e-22
ref|ZP_05075107.1|  glycine betaine transporter, ATP-binding p...   108    2e-22
ref|ZP_01035405.1|  ABC glycine betaine/L-proline transporter,...   108    2e-22
ref|YP_001676243.1|  glycine betaine/L-proline ABC transporter...   108    2e-22 Gene info
ref|ZP_06265958.1|  glycine betaine ABC transporter, ATP-bindi...   107    3e-22
ref|ZP_01878709.1|  ABC glycine betaine/L-proline tranporter, ...   107    3e-22
ref|YP_002908160.1|  Glycine betaine/L-proline ABC transporter...   107    3e-22 Gene info
ref|ZP_05087967.1|  choline ABC transporter, ATP-binding prote...   107    3e-22
ref|ZP_06232677.1|  glycine betaine/L-proline ABC transporter,...   107    3e-22
ref|ZP_05880495.1|  L-proline Glycine Betaine ABC transport AT...   107    3e-22
gb|ABZ06774.1|  putative ABC transporter [uncultured marine mi...   107    3e-22
ref|ZP_01881670.1|  glycine betaine/proline ABC transporter, A...   107    3e-22
ref|ZP_04921465.1|  glycine betaine/L-proline transport ATP bi...   107    3e-22 Gene info
ref|ZP_01742628.1|  glycine betaine/L-proline transport ATP-bi...   107    3e-22
ref|ZP_06177372.1|  conserved hypothetical protein [Vibrio har...   107    3e-22
ref|NP_289229.1|  glycine betaine transporter ATP-binding subu...   107    4e-22 Gene info
ref|YP_001158484.1|  glycine betaine/L-proline ABC transporter...   107    4e-22 Gene info
ref|YP_918505.1|  glycine betaine/L-proline ABC transporter, A...   107    4e-22 Gene info
gb|ABZ06663.1|  putative ABC transporter [uncultured marine mi...   107    4e-22
ref|YP_001554506.1|  glycine betaine/L-proline ABC transporter...   107    4e-22 Gene info
ref|YP_001448682.1|  glycine betaine ABC transporter ATP-bindi...   107    4e-22 Gene info
ref|ZP_01984910.1|  BusAA [Vibrio harveyi HY01] >gb|EDL70409.1...   107    4e-22
ref|ZP_02900753.1|  glycine betaine/L-proline ABC transporter,...   107    4e-22
ref|YP_001366234.1|  glycine betaine/L-proline ABC transporter...   107    4e-22 Gene info
ref|ZP_05784925.1|  glycine betaine transport ATP-binding prot...   107    4e-22
ref|YP_002358232.1|  glycine betaine/L-proline ABC transporter...   107    4e-22 Gene info
ref|ZP_01902163.1|  glycine betaine/proline ABC transporter, A...   107    5e-22
ref|YP_001042734.1|  ABC transporter related [Rhodobacter spha...   107    5e-22 Gene info
ref|YP_750505.1|  glycine betaine/L-proline ABC transporter, A...   107    5e-22 Gene info
ref|YP_001050661.1|  glycine betaine/L-proline ABC transporter...   107    5e-22 Gene info
ref|YP_352232.1|  ABC glycine betaine/L-proline tranporter, AT...   107    5e-22 Gene info
ref|ZP_00960513.1|  glycine betaine/proline ABC transporter, A...   107    5e-22
ref|YP_001177872.1|  glycine betaine transporter ATP-binding s...   107    5e-22 Gene info
ref|YP_003211643.1|  Glycine betaine/L-proline transport ATP-b...   107    5e-22 Gene info
ref|ZP_03853354.1|  quaternary-amine-transporting ATPase [Chry...   107    5e-22
ref|YP_001436709.1|  hypothetical protein ESA_00589 [Enterobac...   107    5e-22 Gene info
ref|ZP_03000359.1|  glycine betaine/L-proline ABC transporter,...   107    5e-22
gb|ACI79426.1|  ATP-binding component of glycine betaine / pro...   107    6e-22
ref|YP_002381597.1|  glycine betaine transporter ATP-binding s...   107    6e-22 Gene info
ref|YP_002330429.1|  glycine betaine transporter ATP-binding s...   107    6e-22 Gene info
ref|YP_001459446.1|  glycine betaine transporter ATP-binding s...   107    6e-22 Gene info
ref|ZP_05969983.1|  glycine betaine transporter ATP-binding su...   107    6e-22
ref|YP_003155835.1|  glycine betaine/L-proline transport ATP b...   107    6e-22 Gene info
gb|ABB89599.1|  ProV [Salmonella enterica subsp. enterica sero...   107    6e-22
ref|YP_404400.1|  ATP-binding component of transport system fo...   107    6e-22 Gene info
ref|YP_002408801.1|  glycine betaine transporter ATP-binding s...   107    6e-22 Gene info
ref|YP_002236983.1|  glycine betaine/L-proline ABC transporter...   107    6e-22 Gene info
ref|ZP_03051952.1|  glycine betaine/L-proline ABC transporter,...   107    6e-22
ref|YP_001336644.1|  ATP-binding component of transport system...   107    6e-22 Gene info
ref|NP_417163.1|  glycine betaine transporter subunit [Escheri...   107    6e-22 Gene info
ref|NP_396147.2|  ABC transporter, nucleotide binding/ATPase p...   107    6e-22 Gene info
ref|YP_002545197.1|  proline/glycine betaine ABC transporter [...   106    6e-22 Gene info
gb|ABB89591.1|  ProV [Salmonella enterica subsp. enterica sero...   106    6e-22
gb|ABB89590.1|  ProV [Salmonella enterica subsp. enterica sero...   106    6e-22
ref|ZP_03065254.1|  glycine betaine/L-proline ABC transporter,...   106    6e-22
ref|YP_311667.1|  glycine betaine transporter ATP-binding subu...   106    6e-22 Gene info
ref|NP_838215.1|  glycine betaine transporter ATP-binding subu...   106    6e-22 Gene info
ref|ZP_03028917.1|  glycine betaine/L-proline ABC transporter,...   106    6e-22
ref|NP_755112.1|  glycine betaine transporter ATP-binding subu...   106    6e-22 Gene info
ref|ZP_04560117.1|  glycine betaine transporter ATP-binding su...   106    6e-22
gb|ABB89593.1|  ProV [Salmonella enterica subsp. enterica sero...   106    6e-22
gb|AAA88621.1|  proV [Salmonella enterica subsp. enterica sero...   106    6e-22
ref|YP_001744828.1|  glycine betaine/L-proline ABC transporter...   106    6e-22 Gene info
dbj|BAI56014.1|  glycine/betaine/proline ABC transporter ATP-b...   106    6e-22
ref|ZP_02195250.1|  putative glycine betaine ABC transporter A...   106    6e-22
ref|YP_001455535.1|  glycine betaine transporter ATP-binding s...   106    6e-22 Gene info
ref|ZP_05786631.1|  glycine betaine transport ATP-binding prot...   106    6e-22
ref|ZP_01013614.1|  hypothetical protein RB2654_07089 [Rhodoba...   106    7e-22
ref|ZP_02697988.1|  glycine betaine/L-proline ABC transporter,...   106    7e-22
ref|YP_151842.1|  glycine betaine transporter ATP-binding subu...   106    7e-22 Gene info
ref|NP_461735.1|  glycine betaine transporter ATP-binding subu...   106    7e-22 Gene info
ref|ZP_06181369.1|  conserved hypothetical protein [Vibrio alg...   106    7e-22
gb|ABZ06360.1|  putative ABC transporter [uncultured marine mi...   106    7e-22
ref|YP_001104455.1|  putative glycine betaine/proline ABC tran...   106    7e-22 Gene info
ref|ZP_03372671.1|  glycine betaine transporter ATP-binding su...   106    7e-22
ref|ZP_05727855.1|  glycine betaine/L-proline ABC transporter,...   106    7e-22
emb|CAA36921.1|  unnamed protein product [Salmonella typhimurium]   106    7e-22
ref|ZP_01259418.1|  putative glycine betaine ABC transporter A...   106    7e-22
ref|ZP_05123263.1|  glycine betaine/L-proline ABC transporter,...   106    8e-22
ref|ZP_06208757.1|  glycine betaine/L-proline ABC transporter,...   106    8e-22
ref|ZP_01741498.1|  glycine betaine/proline ABC transporter, A...   106    8e-22
ref|ZP_01447071.1|  glycine betaine/proline ABC transporter, A...   106    8e-22
ref|ZP_05887068.1|  L-proline Glycine Betaine ABC transport AT...   106    8e-22
ref|ZP_03349391.1|  glycine betaine transporter ATP-binding su...   106    8e-22
ref|YP_969861.1|  glycine betaine/L-proline ABC transporter, A...   106    9e-22 Gene info
ref|ZP_03086208.1|  glycine betaine transporter ATP-binding su...   106    9e-22
ref|YP_002458777.1|  glycine betaine/L-proline ABC transporter...   106    9e-22 Gene info
ref|ZP_04331052.1|  glycine betaine/L-proline transport ATP bi...   106    1e-21
ref|YP_517454.1|  hypothetical protein DSY1221 [Desulfitobacte...   105    1e-21 Gene info
ref|YP_001906879.1|  Glycine betaine/L-proline transport ATP-b...   105    1e-21 Gene info
ref|YP_002647943.1|  Glycine betaine/L-proline transport ATP-b...   105    1e-21 Gene info
ref|ZP_05078031.1|  glycine betaine/L-proline ABC transporter,...   105    1e-21
ref|YP_167660.1|  glycine betaine/proline ABC transporter, ATP...   105    1e-21 Gene info
ref|ZP_05085839.1|  choline ABC transporter, ATP-binding prote...   105    1e-21
ref|ZP_02333423.1|  glycine betaine/L-proline transport ATP-bi...   105    1e-21
ref|ZP_04458359.1|  glycine betaine/L-proline transport ATP-bi...   105    1e-21
ref|YP_071465.1|  ABC glycine/betaine/L-proline transporter, A...   105    1e-21 Gene info
ref|YP_001607864.1|  glycine betaine/L-proline transport ATP-b...   105    1e-21 Gene info
ref|ZP_01438252.1|  glycine betaine ABC transporter (ATP-bindi...   105    1e-21
ref|ZP_01307060.1|  ABC-type proline/glycine betaine transport...   105    1e-21
ref|ZP_03304443.1|  hypothetical protein ANHYDRO_00852 [Anaero...   105    1e-21
ref|NP_668546.1|  glycine betaine/L-proline transport ATP-bind...   105    2e-21 Gene info
ref|ZP_01896937.1|  putative glycine betaine ABC transporter A...   105    2e-21
ref|ZP_04638044.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_04617046.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_04633907.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_04623636.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_04620338.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_04611977.1|  Glycine betaine/L-proline transport ATP-bi...   105    2e-21
ref|ZP_01447105.1|  glycine betaine/proline ABC transporter, A...   105    2e-21
ref|YP_002944413.1|  glycine betaine/L-proline ABC transporter...   105    2e-21 Gene info
ref|YP_001104633.1|  putative glycine betaine/proline ABC tran...   105    2e-21 Gene info
ref|YP_002541082.1|  glycine betaine/L-proline ABC transporter...   105    2e-21 Gene info
ref|ZP_05068554.1|  glycine betaine/L-proline ABC transporter,...   105    2e-21
ref|ZP_04039666.1|  glycine betaine/L-proline transport ATP bi...   105    2e-21
ref|ZP_01305511.1|  ABC-type proline/glycine betaine transport...   104    2e-21
ref|YP_001475969.1|  putative glycine betaine ABC transporter ...   104    2e-21 Gene info
ref|YP_001115925.1|  glycine betaine/L-proline ABC transporter...   104    2e-21 Gene info
ref|YP_002479410.1|  glycine betaine/L-proline ABC transporter...   104    2e-21 Gene info
ref|NP_521627.1|  putative glycine betaine/L-proline ATP-bindi...   104    2e-21 Gene info
ref|YP_001536509.1|  glycine betaine/L-proline ABC transporter...   104    3e-21 Gene info
ref|ZP_01880420.1|  glycine betaine/proline ABC transporter, A...   104    3e-21
ref|ZP_05708268.1|  ABC superfamily ATP binding cassette trans...   104    3e-21
ref|YP_623063.1|  glycine betaine/L-proline transport ATP bind...   104    3e-21 Gene info
gb|EEF11067.1|  predicted protein [Populus trichocarpa]             104    3e-21
ref|ZP_01311395.1|  glycine betaine/L-proline transport ATP bi...   104    3e-21
ref|ZP_01722955.1|  hypothetical protein BB14905_04493 [Bacill...   104    3e-21
emb|CBG89858.1|  glycine betaine/L-proline ABC transporter, AT...   104    3e-21
ref|ZP_02376483.1|  ABC glycine betaine/L-proline transporter,...   104    3e-21
ref|YP_573954.1|  glycine betaine/L-proline transport ATP bind...   104    3e-21 Gene info
ref|YP_001005263.1|  glycine betaine/L-proline transport ATP-b...   104    3e-21 Gene info
ref|ZP_02142033.1|  glycine betaine/proline ABC transporter, A...   104    3e-21
ref|YP_690210.1|  glycine betaine transporter ATP-binding subu...   104    3e-21 Gene info
ref|YP_002549857.1|  ABC transporter nucleotide binding/ATPase...   104    3e-21 Gene info
ref|ZP_01115122.1|  ABC-type proline/glycine betaine transport...   104    3e-21
ref|ZP_00960689.1|  glycine betaine/proline ABC transporter, A...   104    3e-21
ref|ZP_04943234.1|  Glycine betaine/L-proline transport ATP-bi...   104    4e-21
ref|ZP_01902486.1|  ABC transporter ATP-binding protein [Roseo...   104    4e-21
ref|YP_003003223.1|  glycine betaine/L-proline ABC transporter...   104    4e-21 Gene info
ref|ZP_05063115.1|  choline ABC transporter, ATP-binding prote...   104    4e-21
gb|ADA75037.1|  Glycine betaine/L-proline transport ATP-bindin...   104    4e-21
ref|ZP_01438044.1|  ABC glycine betaine/L-proline tranporter, ...   104    4e-21
ref|NP_928594.1|  glycine betaine/L-proline transport ATP-bind...   104    4e-21 Gene info
ref|YP_001001829.1|  glycine betaine/L-proline ABC transporter...   104    4e-21 Gene info
ref|ZP_01076576.1|  putative glycine betaine ABC transporter A...   103    4e-21
ref|ZP_04537182.1|  glycine betaine/L-proline transport ATP-bi...   103    4e-21
ref|YP_001760226.1|  glycine betaine/L-proline ABC transporter...   103    4e-21 Gene info
ref|YP_675078.1|  glycine betaine/L-proline ABC transporter, A...   103    4e-21 Gene info
ref|ZP_03891384.1|  glycine betaine/L-proline transport ATP bi...   103    4e-21
ref|YP_003334819.1|  glycine betaine/L-proline ABC transporter...   103    4e-21 Gene info
ref|YP_001530645.1|  glycine betaine/L-proline ABC transporter...   103    4e-21 Gene info
ref|ZP_01077881.1|  glycine betaine/L-proline ABC transporter,...   103    4e-21
ref|ZP_01035678.1|  glycine betaine/proline ABC transporter, A...   103    4e-21
ref|YP_001563691.1|  glycine betaine/L-proline ABC transporter...   103    4e-21 Gene info
ref|YP_371213.1|  ABC glycine betaine/L-proline transporter, A...   103    4e-21 Gene info
ref|ZP_02906066.1|  glycine betaine/L-proline ABC transporter,...   103    5e-21
ref|YP_001500118.1|  glycine betaine/L-proline ABC transporter...   103    5e-21 Gene info
ref|ZP_06295416.1|  glycine betaine/L-proline ABC transporter,...   103    5e-21
ref|ZP_01218076.1|  putative glycine betaine ABC transporter A...   103    5e-21
ref|YP_770374.1|  putative glycine betaine/L-proline transport...   103    5e-21 Gene info
ref|ZP_03573308.1|  glycine betaine/L-proline ABC transporter,...   103    5e-21
ref|YP_001583461.1|  glycine betaine/L-proline ABC transporter...   103    5e-21 Gene info
ref|ZP_03573743.1|  glycine betaine/L-proline transport ATP-bi...   103    5e-21
ref|YP_769115.1|  putative ATP-binding component of ABC transp...   103    5e-21 Gene info
ref|ZP_05054466.1|  ABC transporter, ATP-binding protein [Octa...   103    5e-21
ref|ZP_02886821.1|  glycine betaine/L-proline ABC transporter,...   103    5e-21
ref|YP_003018872.1|  glycine betaine/L-proline ABC transporter...   103    5e-21 Gene info
ref|ZP_03833923.1|  glycine betaine/L-proline transport ATP-bi...   103    5e-21
ref|YP_777643.1|  glycine betaine/L-proline ABC transporter, A...   103    5e-21 Gene info
ref|ZP_06193624.1|  transporter [Serratia odorifera 4Rx13] >gb...   103    6e-21
ref|YP_002976889.1|  ABC transporter related [Rhizobium legumi...   103    6e-21 Gene info
ref|ZP_01168318.1|  putative glycine betaine ABC transporter A...   103    6e-21
ref|ZP_05810766.1|  glycine betaine/L-proline ABC transporter,...   103    6e-21
ref|ZP_02959587.1|  hypothetical protein PROSTU_01457 [Provide...   103    6e-21
ref|ZP_01116735.1|  ABC glycine/betaine/L-proline transporter,...   103    6e-21
ref|YP_001985203.1|  probable glycine betaine/L-proline ABC tr...   103    6e-21 Gene info
ref|NP_104013.1|  ABC transporter ATP-binding protein [Mesorhi...   103    6e-21 Gene info
ref|ZP_05101742.1|  choline ABC transporter, ATP-binding prote...   103    6e-21
ref|ZP_01755978.1|  glycine betaine/proline ABC transporter, A...   103    6e-21
ref|YP_133447.1|  putative glycine betaine ABC transporter ATP...   103    6e-21 Gene info
ref|ZP_03269605.1|  glycine betaine/L-proline ABC transporter,...   103    6e-21
ref|YP_001479957.1|  glycine betaine/L-proline ABC transporter...   103    6e-21 Gene info
ref|YP_051590.1|  glycine betaine/L-proline transport ATP-bind...   103    6e-21 Gene info
ref|YP_003260820.1|  glycine betaine/L-proline ABC transporter...   103    6e-21 Gene info
ref|ZP_03520692.1|  probable glycine betaine/L-proline ABC tra...   103    7e-21
ref|ZP_06157582.1|  L-proline Glycine Betaine ABC transport AT...   103    7e-21
ref|ZP_02189870.1|  putative lycine betaine/L-proline ABC tran...   103    7e-21
ref|YP_002279204.1|  glycine betaine/L-proline ABC transporter...   103    7e-21 Gene info
ref|ZP_05020476.1|  glycine betaine/L-proline ABC transporter ...   103    7e-21
ref|YP_002155548.1|  glycine betaine transport ATP-binding pro...   103    7e-21 Gene info
ref|ZP_06124647.1|  glycine betaine/L-proline ABC transporter,...   103    7e-21
ref|YP_001811754.1|  glycine betaine/L-proline ABC transporter...   103    7e-21 Gene info
ref|YP_204170.1|  glycine betaine transporter subunit [Vibrio ...   103    7e-21 Gene info
ref|ZP_02888632.1|  glycine betaine/L-proline ABC transporter,...   103    7e-21
ref|YP_001862927.1|  glycine betaine/L-proline ABC transporter...   103    7e-21 Gene info
ref|YP_553698.1|  ABC proline/glycine betaine transporter, ATP...   103    7e-21 Gene info
ref|YP_776451.1|  glycine betaine/L-proline ABC transporter, A...   103    7e-21 Gene info
ref|YP_001888774.1|  glycine betaine/L-proline ABC transporter...   103    8e-21 Gene info
ref|ZP_04680790.1|  choline ABC transporter, ATP-binding prote...   103    8e-21
ref|ZP_01442216.1|  ABC glycine betaine/L-proline tranporter, ...   103    8e-21
ref|YP_001477034.1|  ABC transporter-related protein [Serratia...   103    8e-21 Gene info
ref|ZP_01158926.1|  putative glycine betaine ABC transporter A...   103    8e-21
ref|YP_002235012.1|  putative glycine betaine/L-proline ABC tr...   102    9e-21 Gene info
ref|ZP_01233121.1|  putative glycine betaine ABC transporter A...   102    9e-21
ref|YP_002973028.1|  glycine betaine/L-proline ABC transporter...   102    9e-21 Gene info
ref|ZP_03505321.1|  probable glycine betaine/L-proline ABC tra...   102    9e-21
ref|YP_765037.1|  putative ATP-binding component of ABC transp...   102    9e-21 Gene info
ref|YP_299003.1|  glycine betaine/L-proline transport ATP-bind...   102    9e-21 Gene info
ref|ZP_06228127.1|  ABC proline/glycine betaine transporter, A...   102    1e-20
ref|ZP_04859583.1|  glycine betaine/L-proline ABC transporter ...   102    1e-20
ref|YP_003269842.1|  glycine betaine/L-proline ABC transporter...   102    1e-20 Gene info
ref|YP_087741.1|  ProV protein [Mannheimia succiniciproducens ...   102    1e-20 Gene info
ref|YP_002282321.1|  choline ABC transporter, ATP-binding prot...   102    1e-20 Gene info
gb|AAQ06630.1|  osmoprotectant transport protein OusBV [Erwini...   102    1e-20
ref|ZP_03517597.1|  choline ABC transporter, ATP-binding prote...   102    1e-20
ref|ZP_05535969.1|  glycine betaine/L-proline ABC transporter,...   102    1e-20
ref|ZP_02145270.1|  D-cysteine desulfhydrase [Phaeobacter gall...   102    1e-20
ref|ZP_05632471.1|  glycine betaine/L-proline ABC transporter,...   102    1e-20
ref|YP_001140815.1|  glycine betaine/L-proline transport syste...   102    1e-20 Gene info
ref|YP_345205.1|  glycine betaine/L-proline ABC transporter AT...   102    1e-20 Gene info
ref|YP_001979371.1|  proline/glycine betaine ABC transporter, ...   102    1e-20 Gene info
ref|ZP_01738703.1|  ABC-type proline/glycine betaine transport...   102    1e-20
ref|ZP_02154110.1|  ABC transporter related protein [Oceanibul...   102    1e-20
ref|ZP_01439822.1|  probable amino acid ABC transporter, ATP-b...   102    1e-20
ref|ZP_04628826.1|  Glycine betaine/L-proline transport ATP-bi...   102    1e-20
ref|ZP_03861981.1|  glycine betaine/L-proline transport ATP bi...   102    1e-20
ref|YP_002541736.1|  amino acid ABC transporter [Agrobacterium...   102    2e-20 Gene info
emb|CBG67890.1|  putative glycine betaine ABC transport system...   102    2e-20
ref|ZP_03794713.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_02486032.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|YP_105325.1|  glycine betaine/L-proline ABC transporter, A...   102    2e-20 Gene info
ref|ZP_00516538.1|  Quaternary-amine-transporting ATPase [Croc...   102    2e-20
ref|ZP_05843916.1|  ABC transporter related protein [Rhodobact...   102    2e-20
ref|ZP_04520914.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|YP_857865.1|  glycine betaine/L-proline ABC transporter, A...   102    2e-20 Gene info
ref|ZP_02494177.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_01747590.1|  ABC transporter ATP-binding protein [Sagit...   102    2e-20
ref|YP_470580.1|  proline/glycine betaine ABC transporter, ATP...   102    2e-20 Gene info
ref|ZP_03456905.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_04890421.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_04810650.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_04972006.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_04915344.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_00438557.2|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|YP_001075967.1|  glycine betaine/L-proline ABC transporter...   102    2e-20 Gene info
ref|YP_001063022.1|  glycine betaine/L-proline ABC transporter...   102    2e-20 Gene info
ref|YP_001024717.1|  glycine betaine/L-proline ABC transporter...   102    2e-20 Gene info
ref|ZP_05068780.1|  glycine betaine transport ATP-binding prot...   102    2e-20
ref|ZP_05779851.1|  choline ABC transporter, ATP-binding prote...   102    2e-20
ref|ZP_02466728.1|  glycine betaine/L-proline ABC transporter,...   102    2e-20
ref|ZP_02370478.1|  glycine betaine/L-proline ABC transporter,...   101    2e-20
ref|ZP_02167780.1|  hypothetical protein HPDFL43_12628 [Hoefle...   101    2e-20
ref|NP_356685.2|  ABC transporter, nucleotide binding/ATPase p...   101    2e-20 Gene info
ref|YP_943425.1|  glycine betaine/L-proline ABC transporter, A...   101    2e-20 Gene info
ref|YP_432172.1|  ABC-type proline/glycine betaine transport s...   101    2e-20 Gene info
ref|ZP_05637074.1|  glycine/betaine/L-proline ABC transporter,...   101    2e-20
ref|ZP_04640155.1|  Glycine betaine/L-proline transport ATP-bi...   101    2e-20
ref|YP_276849.1|  glycine/betaine/L-proline ABC transporter, A...   101    2e-20 Gene info
ref|YP_439163.1|  glycine betaine/L-proline ABC transporter, A...   101    2e-20 Gene info
ref|YP_001697987.1|  glycine betaine/carnitine/choline transpo...   101    2e-20 Gene info
ref|ZP_03827270.1|  glycine betaine/L-proline transport ATP-bi...   101    2e-20
ref|ZP_02905503.1|  glycine betaine/L-proline ABC transporter,...   101    2e-20
ref|ZP_01447304.1|  probable amino acid ABC transporter, ATP-b...   101    2e-20
ref|NP_798105.1|  glycine/betaine/proline ABC transporter [Vib...   101    3e-20 Gene info
ref|YP_350968.1|  glycine betaine/L-proline transport ATP-bind...   101    3e-20 Gene info
ref|YP_002416793.1|  ABC-type proline/glycine betaine transpor...   101    3e-20 Gene info
ref|ZP_00992752.1|  glycine betaine/L-proline transport ATP-bi...   101    3e-20
ref|ZP_01066107.1|  glycine betaine/L-proline transport ATP-bi...   101    3e-20
ref|YP_001751759.1|  choline ABC transporter, ATP-binding prot...   101    3e-20 Gene info
ref|ZP_03520603.1|  proline/glycine betaine ABC transporter, A...   101    3e-20
ref|YP_262822.1|  glycine/betaine/L-proline ABC transporter, A...   101    3e-20 Gene info
ref|NP_792854.1|  glycine betaine/L-proline ABC transporter, A...   101    3e-20 Gene info
ref|YP_002875175.1|  putative glycine betaine/L-proline ABC tr...   101    3e-20 Gene info
ref|ZP_01467386.1|  glycine betaine transport ATP-binding prot...   101    3e-20
ref|YP_001370132.1|  ABC transporter related [Ochrobactrum ant...   101    3e-20 Gene info
ref|YP_680440.1|  glycine betaine transporter, ATP-binding pro...   100    3e-20 Gene info
ref|ZP_03268931.1|  glycine betaine/L-proline ABC transporter,...   100    3e-20
ref|ZP_06051754.1|  L-proline Glycine Betaine ABC transport AT...   100    4e-20
ref|ZP_02138896.1|  glycine betaine transporter, ATP-binding p...   100    4e-20
ref|YP_237776.1|  glycine betaine/L-proline transport ATP-bind...   100    4e-20 Gene info
ref|ZP_01259116.1|  ABC superfamily (glycine/betaine/proline t...   100    4e-20
ref|YP_003042007.1|  glycine betaine/l-proline transport atp-b...   100    4e-20 Gene info
ref|NP_355235.1|  ABC transporter, nucleotide binding/ATPase p...   100    4e-20 Gene info
ref|ZP_06296750.1|  glycine betaine/L-proline ABC transporter,...   100    4e-20
ref|ZP_04921742.1|  glycine betaine/L-proline transport ATP bi...   100    4e-20 Gene info
ref|YP_473011.1|  glycine betaine/L-proline ABC transporter, A...   100    4e-20 Gene info
ref|YP_002422754.1|  glycine betaine/L-proline ABC transporter...   100    4e-20 Gene info
ref|YP_003070138.1|  glycine/betaine/proline transporter, ATP-...   100    4e-20 Gene info
ref|ZP_03544374.1|  glycine betaine/L-proline ABC transporter,...   100    4e-20
ref|YP_683140.1|  glycine betaine transporter, ATP-binding pro...   100    4e-20 Gene info
ref|YP_001749162.1|  glycine betaine/L-proline ABC transporter...   100    4e-20 Gene info
ref|ZP_02165674.1|  ATP/GTP-binding site motif A (P-loop):ABC ...   100    4e-20
ref|YP_915692.1|  ABC transporter related [Paracoccus denitrif...   100    4e-20 Gene info
ref|YP_001327974.1|  ABC transporter related [Sinorhizobium me...   100    5e-20 Gene info
ref|YP_002965033.1|  glycine/betaine/proline transporter, ATP-...   100    5e-20 Gene info
ref|YP_002544841.1|  amino acid ABC transporter [Agrobacterium...   100    5e-20 Gene info
ref|YP_001641176.1|  glycine betaine/L-proline ABC transporter...   100    5e-20 Gene info
ref|ZP_01747959.1|  ABC glycine betaine/L-proline tranporter, ...   100    5e-20
ref|ZP_04590845.1|  glycine betaine/L-proline transport ATP-bi...   100    5e-20
ref|ZP_02366030.1|  glycine betaine/L-proline ABC transporter,...   100    5e-20
ref|ZP_02358994.1|  glycine betaine/L-proline ABC transporter,...   100    5e-20
ref|NP_790311.1|  glycine/betaine/L-proline ABC transporter, A...   100    5e-20 Gene info
ref|ZP_03398481.1|  glycine betaine/L-proline ABC transporter,...   100    6e-20
ref|ZP_04947876.1|  Type I secretion system ATPase [Burkholder...   100    6e-20
ref|ZP_01226242.1|  ATP-binding protein, ABC-type glycine/beta...   100    6e-20
ref|ZP_05344071.1|  glycine betaine transport ATP-binding prot...   100    7e-20
ref|YP_002550363.1|  ABC transporter nucleotide binding/ATPase...   100    7e-20 Gene info
ref|ZP_05782131.1|  glycine betaine transport ATP-binding prot...  99.8    7e-20
ref|YP_003277437.1|  glycine betaine/L-proline ABC transporter...  99.8    8e-20 Gene info
ref|ZP_03500823.1|  probable glycine betaine/L-proline ABC tra...  99.8    8e-20
ref|YP_743907.1|  glycine betaine/L-proline transport ATP-bind...  99.8    8e-20 Gene info
ref|YP_002826878.1|  putative glycine betaine/L-proline ABC tr...  99.8    9e-20 Gene info
ref|YP_346097.1|  ABC transporter-like [Pseudomonas fluorescen...  99.4    1e-19 Gene info
ref|YP_001327438.1|  glycine betaine/L-proline ABC transporter...  99.4    1e-19 Gene info
ref|YP_002150184.1|  glycine betaine/L-proline ABC transporter...  99.4    1e-19 Gene info
ref|YP_002870045.1|  putative histidine ABC transport system, ...  99.4    1e-19 Gene info
ref|YP_257549.1|  amino acid ABC transporter, ATP-binding prot...  99.4    1e-19 Gene info
ref|YP_001265671.1|  glycine betaine/L-proline ABC transporter...  99.4    1e-19 Gene info
ref|NP_742461.1|  glycine betaine/L-proline ABC transporter, A...  99.4    1e-19 Gene info
ref|ZP_01903837.1|  ABC glycine betaine/L-proline tranporter, ...  99.4    1e-19
ref|YP_001666568.1|  choline ABC transporter, ATP-binding prot...  99.4    1e-19 Gene info
ref|ZP_03583649.1|  glycine betaine/L-proline ABC transporter,...  99.0    1e-19
ref|ZP_01002674.1|  ABC glycine betaine/L-proline transporter,...  99.0    1e-19
ref|ZP_02621224.1|  glycine betaine transport ATP-binding prot...  99.0    1e-19
ref|YP_373598.1|  ABC proline/glycine betaine transporter, ATP...  99.0    1e-19 Gene info
ref|YP_608200.1|  glycine betaine ABC transporter, ATP-binding...  99.0    1e-19 Gene info
ref|YP_754406.1|  putative glycine betaine ABC transporter ATP...  99.0    1e-19 Gene info
ref|YP_002973010.1|  ABC transporter related [Rhizobium legumi...  99.0    1e-19 Gene info
ref|YP_509443.1|  ABC transporter related [Jannaschia sp. CCS1...  99.0    1e-19 Gene info
ref|YP_003134435.1|  glycine betaine/L-proline transport ATP b...  99.0    2e-19 Gene info
ref|NP_386507.1|  putative glycine betaine transport ATP-bindi...  98.6    2e-19 Gene info
ref|YP_001628236.1|  ABC transporter related [Brucella suis AT...  98.6    2e-19 Gene info
ref|ZP_03780292.1|  hypothetical protein CLOHYLEM_07394 [Clost...  98.6    2e-19
ref|YP_765019.1|  putative ATP-binding component of ABC transp...  98.6    2e-19 Gene info
ref|YP_914754.1|  glycine betaine/L-proline ABC transporter, A...  98.6    2e-19 Gene info
ref|NP_470796.1|  hypothetical protein lin1460 [Listeria innoc...  98.6    2e-19 Gene info
ref|YP_914994.1|  glycine betaine/L-proline ABC transporter, A...  98.6    2e-19 Gene info
ref|YP_001985222.1|  probable glycine betaine/L-proline ABC tr...  98.6    2e-19 Gene info
ref|YP_002826343.1|  putative ATP-binding component of ABC tra...  98.2    2e-19 Gene info
ref|YP_002539643.1|  ABC transporter nucleotide binding/ATPase...  98.2    2e-19 Gene info
ref|ZP_01866861.1|  putative glycine betaine ABC transporter A...  98.2    2e-19
ref|ZP_04340775.1|  ABC-type proline/glycine betaine transport...  98.2    2e-19
ref|ZP_03806560.1|  hypothetical protein PROPEN_04972 [Proteus...  98.2    2e-19
ref|YP_002283944.1|  ABC transporter related [Rhizobium legumi...  98.2    2e-19 Gene info
ref|YP_002495017.1|  choline ABC transporter, ATP-binding prot...  98.2    2e-19 Gene info
ref|YP_001234125.1|  glycine betaine/L-proline ABC transporter...  98.2    2e-19 Gene info
ref|YP_001668926.1|  glycine betaine/L-proline ABC transporter...  98.2    3e-19 Gene info
ref|ZP_05454904.1|  choline ABC transporter, ATP-binding prote...  98.2    3e-19
ref|NP_386072.1|  putative glycine betaine transport ATP-bindi...  97.8    3e-19 Gene info
ref|YP_002278883.1|  ABC transporter related [Rhizobium legumi...  97.8    3e-19 Gene info
ref|ZP_03674878.1|  glycine betaine, L-proline ABC transporter...  97.8    3e-19
ref|YP_002552459.1|  glycine betaine/L-proline ABC transporter...  97.8    3e-19 Gene info
ref|YP_473029.1|  amino acid ABC transporter ATP-binding prote...  97.8    3e-19 Gene info
ref|ZP_05451770.1|  choline ABC transporter, ATP-binding prote...  97.8    3e-19
ref|YP_985376.1|  glycine betaine/L-proline ABC transporter, A...  97.8    3e-19 Gene info
ref|NP_539356.1|  glycine betaine/L-proline transport ATP-bind...  97.8    3e-19 Gene info
ref|ZP_05176607.1|  choline ABC transporter, ATP-binding prote...  97.8    3e-19
ref|YP_001259452.1|  putative glycine betaine/L-proline ABC tr...  97.8    3e-19 Gene info
ref|ZP_01368396.1|  hypothetical protein PaerPA_01005555 [Pseu...  97.8    3e-19
ref|YP_001593409.1|  ABC transporter related [Brucella canis A...  97.8    3e-19 Gene info
ref|YP_001351472.1|  choline ABC transporter, ATP-binding prot...  97.8    3e-19 Gene info
ref|ZP_01288936.1|  Glycine betaine/L-proline transport ATP-bi...  97.8    3e-19
ref|NP_698572.1|  glycine betaine/L-proline ABC transporter, A...  97.8    3e-19 Gene info
ref|NP_254063.1|  ABC transporter ATP-binding protein [Pseudom...  97.8    3e-19 Gene info
ref|YP_610600.1|  glycine betaine/L-proline ABC transporter, A...  97.8    3e-19 Gene info
ref|ZP_02154464.1|  glycine betaine/proline ABC transporter, A...  97.8    3e-19
ref|YP_002822703.1|  predicted ABC-type proline/glycine betain...  97.4    4e-19 Gene info
gb|AAT51022.1|  PA5094 [synthetic construct]                       97.4    4e-19
ref|YP_271574.1|  amino acid ABC transporter, ATP-binding prot...  97.4    4e-19 Gene info
ref|ZP_04682503.1|  glycine betaine/L-proline transport ATP bi...  97.4    5e-19
ref|ZP_03054999.1|  glycine betaine/carnitine/choline transpor...  97.4    5e-19
ref|ZP_05452371.1|  glycine betaine/L-proline transport ATP bi...  97.1    5e-19
ref|YP_001351147.1|  ABC transporter ATP-binding protein [Pseu...  97.1    5e-19 Gene info
ref|ZP_05962224.1|  glycine betaine/L-proline ABC transporter ...  97.1    5e-19
ref|ZP_04937347.1|  hypothetical protein PA2G_04858 [Pseudomon...  97.1    5e-19
ref|ZP_05449289.1|  glycine betaine/L-proline transport ATP bi...  97.1    5e-19
ref|NP_253781.1|  ABC transporter ATP-binding protein [Pseudom...  97.1    5e-19 Gene info
ref|ZP_01158132.1|  ABC glycine betaine/L-proline transporter,...  97.1    5e-19
ref|YP_793564.1|  putative ATP-binding component of ABC transp...  97.1    5e-19 Gene info
ref|NP_795004.1|  histidine ABC transporter, ATP-binding prote...  97.1    5e-19 Gene info
ref|YP_276956.1|  histidine ABC transporter, ATP-binding prote...  97.1    5e-19 Gene info
ref|YP_003105513.1|  glycine betaine/L-proline ABC transporter...  97.1    5e-19 Gene info
ref|ZP_05157601.1|  glycine betaine/L-proline transport ATP bi...  97.1    5e-19
ref|ZP_06105409.1|  glycine betaine/L-proline ABC transporter ...  97.1    5e-19
ref|ZP_05154172.1|  glycine betaine/L-proline transport ATP-bi...  97.1    5e-19
ref|ZP_05637900.1|  histidine ABC transporter, ATP-binding pro...  97.1    5e-19
ref|YP_001257692.1|  glycine betaine/L-proline ABC transporter...  97.1    5e-19 Gene info
ref|ZP_01368108.1|  hypothetical protein PaerPA_01005263 [Pseu...  97.1    5e-19
ref|ZP_05930466.1|  glycine betaine/L-proline ABC transporter ...  97.1    5e-19
ref|YP_237896.1|  ABC transporter [Pseudomonas syringae pv. sy...  97.1    6e-19 Gene info
ref|NP_541526.1|  glycine betaine/L-proline transport ATP-bind...  97.1    6e-19 Gene info
ref|ZP_05461639.1|  ATP/GTP-binding site motif A (P-loop) [Bru...  97.1    6e-19
ref|YP_709587.1|  glycine betaine, L-proline ABC transporter, ...  97.1    6e-19 Gene info
ref|ZP_04590726.1|  histidine ABC transporter, ATP-binding pro...  96.7    6e-19
ref|YP_001372423.1|  glycine betaine/L-proline ABC transporter...  96.7    6e-19 Gene info
ref|YP_418690.1|  glycine betaine/L-proline ABC transporter AT...  96.7    6e-19 Gene info
ref|ZP_06098041.1|  glycine betaine/L-proline ABC transporter ...  96.7    7e-19
ref|ZP_05114644.1|  ABC transporter, ATP-binding protein [Labr...  96.7    7e-19
ref|YP_001755170.1|  glycine betaine/L-proline ABC transporter...  96.7    7e-19 Gene info
ref|ZP_05878336.1|  L-proline Glycine Betaine ABC transport AT...  96.7    7e-19
ref|ZP_04431156.1|  glycine betaine/L-proline ABC transporter,...  96.7    8e-19
ref|ZP_05114049.1|  ABC transporter, ATP-binding protein [Labr...  96.7    8e-19
ref|ZP_05181421.1|  choline ABC transporter, ATP-binding prote...  96.3    8e-19
ref|YP_003064753.1|  proline/glycine betaine ABC transporter, ...  96.3    1e-18 Gene info
ref|ZP_01233442.1|  putative ATP-binding component of ABC tran...  95.9    1e-18
ref|ZP_05838461.1|  ATP/GTP-binding site-containing protein A ...  95.9    1e-18
ref|YP_776205.1|  glycine betaine/L-proline ABC transporter, A...  95.9    1e-18 Gene info
ref|YP_001594685.1|  glycine betaine/L-proline transport ATP b...  95.9    1e-18 Gene info
ref|NP_212280.1|  glycine betaine, L-proline ABC transporter, ...  95.9    1e-18 Gene info
ref|NP_699917.1|  glycine betaine/L-proline ABC transporter, A...  95.5    1e-18 Gene info
ref|ZP_03772887.1|  glycine betaine, L-proline ABC transporter...  95.5    1e-18
ref|ZP_05997403.1|  glycine betaine/L-proline ABC transporter ...  95.5    1e-18
ref|ZP_05164907.1|  glycine betaine/L-proline ABC transporter,...  95.5    1e-18
ref|ZP_03588869.1|  glycine betaine, L-proline ABC transporter...  95.5    1e-18
ref|ZP_03623671.1|  glycine betaine, L-proline ABC transporter...  95.5    2e-18
ref|YP_001883587.1|  transporter [Borrelia hermsii DAH] >gb|AA...  95.5    2e-18 Gene info
ref|ZP_03770268.1|  glycine betaine, L-proline ABC transporter...  95.5    2e-18
ref|ZP_01014161.1|  ABC glycine betaine/L-proline transporter,...  95.5    2e-18
ref|YP_001524103.1|  ABC transporter ATP-binding protein [Azor...  95.5    2e-18 Gene info
ref|ZP_05443005.1|  glycine betaine/L-proline transport ATP bi...  95.1    2e-18
ref|ZP_05167606.1|  glycine betaine/L-proline transport ATP bi...  95.1    2e-18
ref|ZP_03539733.1|  glycine betaine, L-proline ABC transporter...  95.1    2e-18
ref|YP_072596.1|  glycine betaine, L-proline ABC transporter, ...  95.1    2e-18 Gene info
ref|ZP_03540699.1|  glycine betaine, L-proline ABC transporter...  95.1    2e-18
ref|ZP_01545661.1|  ABC transporter, nucleotide binding/ATPase...  95.1    2e-18
ref|ZP_06098951.1|  glycine betaine/L-proline ABC transporter ...  95.1    2e-18
ref|ZP_03787250.1|  glycine betaine/L-proline transport ATP bi...  95.1    2e-18
ref|YP_001185989.1|  glycine betaine/L-proline ABC transporter...  95.1    2e-18 Gene info
ref|ZP_01171691.1|  glycine betaine/L-proline ABC transporter,...  95.1    2e-18
ref|ZP_01985869.1|  glycine betaine transport ATP-binding prot...  94.7    2e-18
ref|ZP_03672176.1|  glycine betaine, L-proline ABC transporter...  94.7    3e-18
ref|YP_001169021.1|  ABC transporter related [Rhodobacter spha...  94.7    3e-18 Gene info
ref|ZP_03697519.1|  glycine betaine/L-proline ABC transporter,...  94.4    3e-18
ref|YP_675090.1|  ABC transporter related [Mesorhizobium sp. B...  94.4    3e-18 Gene info
ref|ZP_05920407.1|  glycine betaine/L-proline ABC superfamily ...  94.4    3e-18
ref|YP_001488921.1|  glycine betaine/L-proline ABC transporter...  94.4    4e-18 Gene info
ref|ZP_00989131.1|  putative ATP-binding component of ABC tran...  94.4    4e-18
ref|YP_001017708.1|  ABC transporter, ATP binding component, g...  94.0    4e-18 Gene info
ref|ZP_01750860.1|  ABC transporter related protein [Roseobact...  94.0    4e-18
ref|YP_945157.1|  glycine betaine transport ATP-binding protei...  94.0    5e-18 Gene info
ref|NP_356820.1|  ABC transporter, nucleotide binding/ATPase p...  94.0    5e-18 Gene info
ref|ZP_02195557.1|  putative ATP-binding component of ABC tran...  94.0    5e-18
ref|NP_894386.1|  glycine betaine/proline ABC transporter ATP-...  94.0    5e-18 Gene info
ref|ZP_03266108.1|  glycine betaine/L-proline ABC transporter,...  93.6    5e-18
ref|NP_386808.1|  histidine transport ATP-binding ABC transpor...  93.6    6e-18 Gene info
ref|ZP_06197150.1|  glycine betaine/proline transport system A...  93.6    6e-18
ref|YP_917620.1|  ABC transporter related [Paracoccus denitrif...  93.2    7e-18 Gene info
ref|ZP_01218121.1|  putative ATP-binding component of ABC tran...  93.2    7e-18
ref|YP_002394664.1|  ABC transporter: ATP binding protein [Vib...  93.2    8e-18 Gene info
ref|ZP_05332658.1|  glycine betaine/L-proline ABC transporter,...  93.2    8e-18
ref|YP_133402.1|  putative ATP-binding component of ABC transp...  93.2    9e-18 Gene info
ref|ZP_06174370.1|  conserved hypothetical protein [Vibrio har...  92.8    9e-18
ref|ZP_01035960.1|  glycine betaine/proline ABC transporter, A...  92.8    1e-17
ref|ZP_01063071.1|  putative ATP-binding component of ABC tran...  92.8    1e-17
ref|ZP_01226020.1|  ATP-binding protein, ABC-type proline/glyc...  92.8    1e-17
ref|ZP_01811736.1|  putative ATP-binding component of ABC tran...  92.8    1e-17
ref|ZP_05886704.1|  L-proline Glycine Betaine ABC transport AT...  92.4    1e-17
ref|ZP_01547203.1|  ABC glycine betaine/L-proline tranporter, ...  92.4    1e-17
ref|YP_002221811.1|  glycine betaine/L-proline transport syste...  92.4    1e-17 Gene info
ref|YP_002222625.1|  glycine betaine/L-proline transport syste...  92.4    1e-17 Gene info
ref|ZP_01014445.1|  hypothetical protein RB2654_07666 [Rhodoba...  92.0    2e-17
ref|ZP_01162839.1|  putative ATP-binding component of ABC tran...  92.0    2e-17
ref|YP_001329334.1|  glycine betaine/L-proline ABC transporter...  92.0    2e-17 Gene info
ref|ZP_02421159.1|  hypothetical protein ANACAC_03813 [Anaeros...  91.7    2e-17
ref|ZP_04921044.1|  glycine betaine/L-proline transport ATP bi...  91.7    2e-17 Gene info
ref|ZP_05068566.1|  choline ABC transporter, ATP-binding prote...  91.7    2e-17
ref|YP_354575.1|  ABC proline/glycine betaine transporter, ATP...  91.7    3e-17 Gene info
ref|NP_987988.1|  ABC transporter ATPase [Methanococcus maripa...  91.7    3e-17 Gene info
ref|NP_632321.1|  glycine betaine transporter, ATP-binding pro...  91.7    3e-17 Gene info
ref|YP_001045637.1|  ABC transporter related [Rhodobacter spha...  91.7    3e-17 Gene info
ref|YP_002520164.1|  ABC transporter related [Rhodobacter spha...  91.3    3e-17 Gene info
ref|YP_942068.1|  glycine betaine/L-proline ABC transporter, A...  91.3    3e-17 Gene info
ref|ZP_05876429.1|  L-proline Glycine Betaine ABC transport AT...  90.9    3e-17
ref|YP_001448295.1|  ATP-binding component of ABC transporter ...  90.9    4e-17 Gene info
ref|YP_002541268.1|  proline/glycine betaine ABC transporter [...  90.9    4e-17 Gene info
ref|ZP_01894192.1|  glycine betaine/proline ABC transporter, A...  90.9    4e-17
ref|YP_849635.1|  glycine betaine/L-proline ABC transporter, A...  90.9    4e-17 Gene info
ref|ZP_05117852.1|  choline ABC transporter, ATP-binding prote...  90.9    4e-17
ref|ZP_02192318.1|  glycine betaine/L-proline ABC transporter,...  90.9    4e-17
ref|YP_003321592.1|  glycine betaine/L-proline ABC transporter...  90.9    4e-17
ref|ZP_01260011.1|  putative ATP-binding component of ABC tran...  90.5    6e-17
ref|ZP_06178620.1|  putative ATP-binding component of ABC tran...  90.1    6e-17
ref|NP_761992.1|  ABC-type proline/glycine betaine transport s...  90.1    6e-17 Gene info
ref|NP_936567.1|  ABC-type proline/glycine betaine transport s...  90.1    6e-17 Gene info
ref|ZP_05944628.1|  L-proline Glycine Betaine ABC transport AT...  90.1    6e-17
ref|YP_001662831.1|  glycine betaine/L-proline ABC transporter...  90.1    7e-17 Gene info
ref|ZP_05711620.1|  LOW QUALITY PROTEIN: glycine betaine/L-pro...  90.1    7e-17
ref|ZP_01866684.1|  putative ATP-binding component of ABC tran...  90.1    7e-17
ref|YP_001322578.1|  glycine betaine/L-proline ABC transporter...  90.1    7e-17 Gene info
ref|YP_001549831.1|  glycine betaine/L-proline ABC transporter...  89.7    8e-17 Gene info
ref|YP_001097199.1|  glycine betaine/L-proline ABC transporter...  89.7    8e-17 Gene info
ref|ZP_05294621.1|  glycine betaine/carnitine/choline transpor...  89.7    9e-17
ref|YP_014038.1|  glycine betaine/L-proline ABC transporter, A...  89.7    9e-17 Gene info
ref|ZP_05553114.1|  choline ABC transporter, ATP-binding prote...  89.4    1e-16
ref|ZP_01471808.1|  ABC transporter superfamily for glycine be...  89.4    1e-16
ref|YP_001557246.1|  glycine betaine/L-proline ABC transporter...  89.4    1e-16 Gene info
ref|ZP_05075014.1|  glycine betaine transporter, ATP-binding p...  89.4    1e-16
ref|YP_002350109.1|  glycine betaine/carnitine/choline transpo...  89.0    1e-16 Gene info
ref|NP_464946.1|  hypothetical protein lmo1421 [Listeria monoc...  89.0    1e-16 Gene info
ref|YP_002509588.1|  glycine betaine/L-proline ABC transporter...  88.6    2e-16 Gene info
ref|ZP_01744639.1|  glycine betaine/proline ABC transporter, A...  88.2    3e-16
gb|EAY85922.1|  hypothetical protein OsI_07285 [Oryza sativa I...  88.2    3e-16
ref|ZP_04289236.1|  Glycine betaine ABC transporter, ATP-bindi...  87.8    3e-16
ref|YP_001309973.1|  glycine betaine/L-proline ABC transporter...  87.8    3e-16 Gene info
ref|YP_998782.1|  glycine betaine/L-proline ABC transporter, A...  87.4    4e-16 Gene info
ref|ZP_04186063.1|  Glycine betaine ABC transporter, ATP-bindi...  87.4    4e-16
ref|ZP_00232982.1|  glycine betaine/L-proline ABC transporter,...  87.4    5e-16
ref|ZP_05911424.1|  putative ATP-binding component of ABC tran...  87.0    5e-16
ref|ZP_01989393.1|  glycine betaine transport ATP-binding prot...  87.0    5e-16
ref|YP_794453.1|  ABC-type proline/glycine betaine transport s...  87.0    6e-16 Gene info
ref|NP_800619.1|  putative ATP-binding component of ABC transp...  87.0    6e-16 Gene info
ref|ZP_03225863.1|  glycine betaine/L-proline ABC transporter,...  87.0    6e-16
ref|YP_002459264.1|  glycine betaine/L-proline ABC transporter...  87.0    6e-16 Gene info
ref|ZP_02996176.1|  hypothetical protein CLOSPO_03299 [Clostri...  87.0    6e-16
ref|NP_069814.1|  osmoprotection protein (proV) [Archaeoglobus...  86.7    7e-16 Gene info
ref|YP_002995287.1|  Osmoprotection protein (proV) [Thermococc...  86.7    7e-16 Gene info
ref|YP_001488257.1|  glycine betaine/carnitine/choline ABC tra...  86.7    7e-16 Gene info
ref|YP_001812993.1|  glycine betaine/L-proline ABC transporter...  86.7    7e-16 Gene info
ref|ZP_03053942.1|  glycine betaine/carnitine/choline transpor...  86.7    7e-16
ref|ZP_02429772.1|  hypothetical protein CLORAM_03195 [Clostri...  86.7    8e-16
ref|YP_001701968.1|  ABC transporter ATP-binding protein [Myco...  86.7    8e-16 Gene info
ref|ZP_04860466.1|  glycine betaine/L-proline ABC transporter ...  86.3    1e-15
ref|ZP_01075448.1|  putative ATP-binding component of ABC tran...  86.3    1e-15
ref|NP_978624.1|  glycine betaine/L-proline ABC transporter, A...  86.3    1e-15 Gene info
ref|YP_887245.1|  glycine betaine/carnitine/choline transport ...  85.9    1e-15 Gene info
ref|YP_517891.1|  hypothetical protein DSY1658 [Desulfitobacte...  85.9    1e-15 Gene info
ref|YP_765258.1|  putative ATP-binding component of ABC transp...  85.9    1e-15 Gene info
ref|YP_001254138.1|  glycine betaine/L-proline ABC transporter...  85.5    2e-15 Gene info
ref|NP_898006.1|  glycine betaine/proline ABC transporter ATP-...  85.5    2e-15 Gene info
ref|ZP_05495093.1|  glycine betaine/L-proline ABC transporter,...  85.1    2e-15
ref|ZP_06163516.1|  glycine betaine/L-proline ABC transporter,...  85.1    2e-15
ref|ZP_02330171.1|  Glycine betaine/carnitine/choline ABC tran...  85.1    2e-15
ref|NP_464953.1|  hypothetical protein lmo1428 [Listeria monoc...  85.1    2e-15 Gene info
ref|ZP_05631880.1|  glycine betaine/L-proline ABC transporter,...  84.7    3e-15
ref|ZP_04444369.1|  ABC superfamily ATP binding cassette trans...  84.7    3e-15
ref|YP_001781269.1|  glycine betaine/L-proline ABC transporter...  84.7    3e-15 Gene info
ref|YP_001787040.1|  glycine betaine/L-proline ABC transporter...  84.7    3e-15 Gene info
ref|YP_001342354.1|  ABC transporter related [Marinomonas sp. ...  84.7    3e-15 Gene info
ref|YP_076459.1|  glycine betaine/carnitine/choline ABC transp...  84.7    3e-15 Gene info
ref|YP_002804054.1|  glycine betaine/L-proline ABC transporter...  84.7    3e-15 Gene info
ref|ZP_02619377.1|  glycine betaine/L-proline ABC transporter,...  84.7    3e-15
ref|YP_001390973.1|  glycine betaine/L-proline ABC transporter...  84.7    3e-15 Gene info
ref|YP_803782.1|  ABC-type proline/glycine betaine transport s...  84.7    3e-15 Gene info
ref|ZP_04102024.1|  Glycine betaine ABC transporter, ATP-bindi...  84.3    4e-15
ref|ZP_03989268.1|  glycine betaine transporter [Acidaminococc...  84.3    4e-15
ref|ZP_05299231.1|  hypothetical protein LmonocytFSL_14543 [Li...  84.3    4e-15
ref|NP_781074.1|  glycine/betaine transport ATP-binding protei...  84.3    4e-15 Gene info
ref|ZP_05129835.1|  glycine betaine/L-proline ABC transporter ...  84.0    4e-15
ref|ZP_05015974.1|  ABC transporter ATP-binding protein [Strep...  84.0    4e-15
ref|NP_391253.1|  choline ABC transporter (ATP-binding protein...  84.0    5e-15 Gene info
ref|ZP_04485741.1|  glycine betaine/L-proline transport ATP bi...  83.6    6e-15
ref|YP_003244552.1|  glycine betaine/L-proline ABC transporter...  83.6    6e-15 Gene info
ref|NP_831997.1|  glycine betaine transport ATP-binding protei...  83.6    6e-15 Gene info
ref|NP_692611.1|  choline ABC transporter ATP-binding protein ...  83.6    6e-15 Gene info
gb|AAB01532.1|  ProV [Bacillus subtilis]                           83.6    6e-15
ref|YP_002466408.1|  glycine betaine/L-proline ABC transporter...  83.6    7e-15 Gene info
ref|ZP_00960068.1|  glycine betaine/proline ABC transporter, A...  83.2    7e-15
ref|ZP_05482909.1|  putative ABC transporter ATP-binding subun...  83.2    7e-15
ref|ZP_03906156.1|  glycine betaine/L-proline transport ATP bi...  83.2    7e-15
ref|NP_349453.1|  proline/glycine betaine ABC-type transport s...  83.2    8e-15 Gene info
ref|NP_391263.1|  glycine betaine/carnitine/choline/choline su...  83.2    8e-15 Gene info
ref|ZP_04151219.1|  Glycine betaine ABC transporter, ATP-bindi...  83.2    8e-15
ref|YP_675518.1|  ABC transporter related [Mesorhizobium sp. B...  83.2    9e-15 Gene info
emb|CAD91242.1|  hypothetical protein [Nonomuraea sp. ATCC 39727]  83.2    9e-15
ref|YP_001568168.1|  glycine betaine/L-proline ABC transporter...  83.2    9e-15 Gene info
ref|ZP_04156982.1|  Glycine betaine ABC transporter, ATP-bindi...  83.2    9e-15
ref|ZP_02620461.1|  glycine betaine transport ATP-binding prot...  83.2    9e-15
ref|YP_396481.1|  putative glycine betaine/carnitine/choline A...  82.8    9e-15 Gene info
ref|ZP_04162718.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    9e-15
ref|ZP_05489348.1|  ABC transporter ATP-binding protein [Strep...  82.8    9e-15
ref|YP_002948490.1|  glycine betaine/L-proline ABC transporter...  82.8    9e-15 Gene info
ref|ZP_04256665.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|YP_001853886.1|  putative ABC transporter ATP-binding prot...  82.8    1e-14 Gene info
ref|ZP_04203090.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_06045195.1|  putative ABC transporter ATP-binding subun...  82.8    1e-14
ref|ZP_04278718.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04211989.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04317362.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04191713.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_00392544.1|  COG1125: ABC-type proline/glycine betaine ...  82.8    1e-14
ref|ZP_04114696.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04273269.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04300524.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04306011.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_05184058.1|  glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04120267.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_00743683.1|  Glycine betaine transport ATP-binding prot...  82.8    1e-14
ref|YP_879095.1|  glycine betaine/carnitine/choline transport ...  82.8    1e-14 Gene info
ref|ZP_04084328.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04222489.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|ZP_04078489.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|NP_844665.1|  glycine betaine/L-proline ABC transporter, A...  82.8    1e-14 Gene info
ref|ZP_04071892.1|  Glycine betaine ABC transporter, ATP-bindi...  82.8    1e-14
ref|YP_083651.1|  glycine betaine ABC transporter, ATP-binding...  82.8    1e-14 Gene info
ref|ZP_04691446.1|  ABC transporter ATP-binding protein [Strep...  82.4    1e-14
ref|YP_002366979.1|  glycine betaine/L-proline ABC transporter...  82.4    1e-14 Gene info
ref|YP_002445658.1|  glycine betaine/L-proline ABC transporter...  82.4    1e-14 Gene info
ref|ZP_03232517.1|  glycine betaine/L-proline ABC transporter,...  82.4    1e-14
ref|ZP_04217463.1|  Glycine betaine ABC transporter, ATP-bindi...  82.4    1e-14
ref|ZP_05803085.1|  glycine betaine/L-proline ABC transporter,...  82.4    1e-14
ref|YP_001916306.1|  glycine betaine/L-proline ABC transporter...  82.4    1e-14 Gene info
ref|YP_002548354.1|  ABC transporter nucleotide binding/ATPase...  82.4    1e-14 Gene info
ref|YP_001224085.1|  ABC-type glycine betaine/L-proline transp...  82.4    1e-14 Gene info
ref|ZP_03963012.1|  ABC superfamily ATP binding cassette trans...  82.4    1e-14
ref|ZP_04294855.1|  Glycine betaine ABC transporter, ATP-bindi...  82.4    1e-14
ref|ZP_04261944.1|  Glycine betaine ABC transporter, ATP-bindi...  82.4    1e-14
ref|NP_561473.1|  glycine betaine/carnitine/choline ABC transp...  82.4    1e-14 Gene info
ref|ZP_04168734.1|  Glycine betaine ABC transporter, ATP-bindi...  82.4    1e-14
ref|ZP_04197318.1|  Glycine betaine ABC transporter, ATP-bindi...  82.4    2e-14
ref|YP_003308306.1|  glycine betaine/L-proline ABC transporter...  82.0    2e-14 Gene info
ref|ZP_04267561.1|  Glycine betaine ABC transporter, ATP-bindi...  82.0    2e-14
ref|ZP_03668068.1|  glycine betaine/carnitine/choline transpor...  82.0    2e-14
ref|ZP_05232403.1|  glycine betaine/L-proline ABC transporter ...  82.0    2e-14
ref|YP_014045.1|  glycine betaine/L-proline ABC transporter, A...  82.0    2e-14 Gene info
ref|YP_807790.1|  ABC-type proline/glycine betaine transport s...  82.0    2e-14 Gene info
ref|ZP_04430865.1|  glycine betaine/L-proline ABC transporter,...  82.0    2e-14
ref|NP_470803.1|  hypothetical protein lin1467 [Listeria innoc...  82.0    2e-14 Gene info
ref|ZP_02952893.1|  glycine betaine/L-proline transport, ATP-b...  82.0    2e-14
ref|YP_849642.1|  glycine betaine/L-proline ABC transporter, A...  82.0    2e-14 Gene info
ref|ZP_02634490.1|  glycine betaine/L-proline transport, ATP-b...  82.0    2e-14
ref|YP_694991.1|  glycine betaine/L-proline transport, ATP-bin...  82.0    2e-14 Gene info
ref|ZP_00236677.1|  glycine betaine/carnitine/choline ABC tran...  82.0    2e-14
ref|ZP_04174487.1|  Glycine betaine ABC transporter, ATP-bindi...  82.0    2e-14
ref|YP_002507603.1|  glycine betaine/L-proline ABC transporter...  82.0    2e-14 Gene info
ref|YP_002338342.1|  glycine betaine/L-proline ABC transporter...  82.0    2e-14 Gene info
ref|YP_001644952.1|  glycine betaine/L-proline ABC transporter...  82.0    2e-14 Gene info
ref|ZP_02863988.1|  glycine betaine/L-proline transport, ATP-b...  82.0    2e-14
ref|ZP_03234502.1|  glycine betaine/L-proline ABC transporter,...  82.0    2e-14
ref|ZP_04323251.1|  Glycine betaine ABC transporter, ATP-bindi...  82.0    2e-14
ref|ZP_02862492.1|  hypothetical protein ANASTE_01711 [Anaerof...  82.0    2e-14
ref|ZP_04672401.1|  glycine betaine transport ATP-binding prot...  82.0    2e-14
ref|ZP_04145534.1|  Glycine betaine ABC transporter, ATP-bindi...  82.0    2e-14
ref|ZP_04283968.1|  Glycine betaine ABC transporter, ATP-bindi...  82.0    2e-14
ref|YP_493409.1|  putative osmoprotectant ABC transporter, ATP...  82.0    2e-14 Gene info
ref|ZP_05540998.1|  ABC transporter ATP-binding protein [Strep...  82.0    2e-14
ref|ZP_02040167.1|  hypothetical protein RUMGNA_00930 [Ruminoc...  82.0    2e-14
ref|YP_002604208.1|  ABC-type glycine betaine/proline transpor...  81.6    2e-14 Gene info
ref|ZP_06272966.1|  ABC transporter related protein [Streptomy...  81.6    2e-14
ref|NP_645501.1|  hypothetical protein MW0684 [Staphylococcus ...  81.6    2e-14 Gene info
ref|ZP_04866999.1|  ABC superfamily ATP binding cassette trans...  81.6    2e-14
ref|ZP_02638183.1|  glycine betaine/L-proline transport, ATP-b...  81.6    2e-14
ref|ZP_01171697.1|  glycine betaine/carnitine/choline ABC tran...  81.6    2e-14
ref|NP_824682.1|  ABC transporter ATP-binding protein [Strepto...  81.6    3e-14 Gene info
ref|YP_176524.1|  proline/glycine betaine ABC transporter ATP-...  81.6    3e-14 Gene info
gb|AAD29279.1|AF112365_2  ProVL [Streptomyces coelicolor A3(2)]    81.6    3e-14
ref|NP_826323.1|  ABC transporter ATP-binding protein [Strepto...  81.3    3e-14 Gene info
ref|ZP_05531816.1|  ABC transporter ATP-binding protein [Strep...  81.3    3e-14
ref|YP_813079.1|  ABC-type proline/glycine betaine transport s...  81.3    3e-14 Gene info
ref|YP_619084.1|  glycine betaine ABC transporter, ATP-binding...  81.3    3e-14 Gene info
ref|NP_627157.1|  ABC transporter ATP-binding protein [Strepto...  81.3    3e-14 Gene info
ref|ZP_01080892.1|  ABC transporter, ATP binding component, gl...  81.3    3e-14
ref|ZP_01123472.1|  ABC transporter, ATP binding component, gl...  81.3    3e-14
ref|ZP_06277693.1|  glycine betaine/L-proline ABC transporter,...  81.3    3e-14
ref|YP_001826121.1|  putative ABC transporter ATP-binding prot...  81.3    3e-14 Gene info
ref|ZP_05328989.1|  glycine betaine/carnitine/choline ABC tran...  81.3    3e-14
ref|YP_001848360.1|  osmoprotectant (glycine betaine/carnitine...  81.3    3e-14 Gene info
ref|YP_002541279.1|  proline/glycine betaine ABC transporter [...  81.3    3e-14 Gene info
ref|ZP_04693540.1|  putative ABC transporter ATP-binding prote...  81.3    3e-14
ref|ZP_05400359.1|  glycine betaine/carnitine/choline ABC tran...  80.9    3e-14
ref|YP_001087374.1|  glycine betaine/carnitine/choline ABC tra...  80.9    4e-14 Gene info
ref|YP_001691446.1|  sugar ABC transporter ATP-binding protein...  80.9    4e-14 Gene info
ref|ZP_01736878.1|  glycine betaine/proline ABC transporter, A...  80.9    4e-14
ref|YP_001417479.1|  spermidine/putrescine ABC transporter ATP...  80.9    4e-14 Gene info
ref|YP_697849.1|  glycine betaine/carnitine/choline transport ...  80.9    4e-14 Gene info
ref|ZP_02949197.1|  glycine betaine transport ATP-binding prot...  80.9    4e-14
ref|ZP_03292599.1|  hypothetical protein CLOHIR_00542 [Clostri...  80.9    4e-14
ref|ZP_05678448.1|  ABC transporter [Enterococcus faecium Com1...  80.9    4e-14
ref|YP_001124405.1|  glycine betaine/carnitine/choline ABC tra...  80.9    4e-14 Gene info
ref|YP_565221.1|  glycine betaine/L-proline ABC transporter, A...  80.9    4e-14 Gene info
ref|YP_001887113.1|  glycine betaine/L-proline ABC transporter...  80.9    4e-14 Gene info
ref|ZP_03149186.1|  glycine betaine/L-proline ABC transporter,...  80.9    4e-14
ref|ZP_05018842.1|  ABC transporter ATP-binding protein [Strep...  80.9    4e-14
ref|YP_904279.1|  osmoprotectant (glycine betaine/carnitine/ch...  80.9    4e-14 Gene info
ref|YP_003164326.1|  ABC transporter related [Leptotrichia buc...  80.9    4e-14 Gene info
ref|YP_001922049.1|  glycine betaine/L-proline ABC transporter...  80.9    4e-14 Gene info
ref|YP_003010385.1|  glycine betaine/L-proline ABC transporter...  80.9    4e-14 Gene info
ref|ZP_04821954.1|  glycine betaine/L-proline ABC transporter,...  80.9    5e-14
ref|ZP_03981267.1|  ABC superfamily ATP binding cassette trans...  80.5    5e-14
ref|ZP_01968556.1|  hypothetical protein RUMTOR_02133 [Ruminoc...  80.5    5e-14
ref|YP_548003.1|  glycine betaine/L-proline transport ATP bind...  80.5    5e-14 Gene info
ref|ZP_05022946.1|  ABC transporter ATP-binding protein [Strep...  80.5    5e-14
ref|ZP_04393992.1|  glycine betaine/L-proline ABC transporter,...  80.5    5e-14
ref|ZP_05686262.1|  glycine betaine/carnitine/choline ATP-bind...  80.5    5e-14
ref|YP_003197641.1|  glycine betaine/L-proline ABC transporter...  80.5    5e-14 Gene info
ref|YP_001371327.1|  spermidine/putrescine ABC transporter ATP...  80.5    5e-14 Gene info
ref|ZP_05809194.1|  ABC transporter related protein [Mesorhizo...  80.5    5e-14
ref|ZP_04685159.1|  ABC transporter ATP-binding protein [Strep...  80.5    5e-14
ref|YP_146167.1|  glycine betaine/carnitine/choline ABC transp...  80.5    5e-14 Gene info
ref|YP_002472953.1|  hypothetical protein CKR_2488 [Clostridiu...  80.5    6e-14 Gene info
ref|YP_001396180.1|  ABC transporter ATPase [Clostridium kluyv...  80.5    6e-14 Gene info
ref|YP_040202.1|  ABC transporter ATP-binding protein [Staphyl...  80.5    6e-14 Gene info
ref|ZP_05601268.1|  ABC transporter ATP-binding protein [Staph...  80.1    6e-14
ref|YP_002559876.1|  ABC transporter ATP-binding protein homol...  80.1    7e-14 Gene info
ref|YP_185656.1|  osmoprotectant ABC transporter, ATP-binding ...  80.1    7e-14 Gene info
ref|ZP_04855387.1|  spermidine/putrescine ABC transporter ATPa...  80.1    7e-14
ref|ZP_04207941.1|  Glycine betaine ABC transporter, ATP-bindi...  80.1    7e-14
ref|ZP_06323823.1|  osmoprotectant transport system ATP-bindin...  80.1    7e-14
ref|ZP_04227747.1|  Glycine betaine ABC transporter, ATP-bindi...  80.1    7e-14
ref|YP_001625045.1|  glycine betaine transport ATP-binding pro...  80.1    7e-14 Gene info
ref|ZP_03735253.1|  glycine betaine/L-proline ABC transporter,...  80.1    7e-14
ref|NP_769881.1|  ABC transporter ATP-binding protein [Bradyrh...  80.1    7e-14 Gene info
ref|NP_371246.1|  choline transport ATP-binding protein [Staph...  80.1    8e-14 Gene info
ref|YP_001422672.1|  opuCA [Bacillus amyloliquefaciens FZB42] ...  79.7    8e-14 Gene info
ref|ZP_00605070.1|  ABC transporter [Enterococcus faecium DO] ...  79.7    8e-14
emb|CBG75134.1|  putative ABC transporter ATP-binding subunit ...  79.7    8e-14
ref|ZP_03226445.1|  glycine betaine/carnitine/choline ABC tran...  79.7    8e-14
ref|YP_001246124.1|  ABC transporter related [Staphylococcus a...  79.7    8e-14 Gene info
ref|ZP_03808453.1|  ABC-type proline/glycine betaine transport...  79.7    8e-14
ref|YP_814534.1|  ABC-type proline/glycine betaine transport s...  79.7    9e-14 Gene info
ref|ZP_01076083.1|  Probable ABC transporter ATP binding prote...  79.7    9e-14
ref|ZP_04644556.1|  ABC-type proline/glycine betaine transport...  79.7    1e-13
ref|ZP_05003225.1|  glycine betaine/L-proline ABC transporter ...  79.7    1e-13
ref|ZP_03951345.1|  ABC superfamily ATP binding cassette trans...  79.7    1e-13
ref|ZP_03488924.1|  hypothetical protein EUBIFOR_01510 [Eubact...  79.3    1e-13
ref|ZP_04922785.1|  glycine betaine/carnitine/choline transpor...  79.3    1e-13 Gene info
ref|ZP_05535014.1|  ABC transporter ATP-binding protein [Strep...  79.3    1e-13
ref|ZP_05922316.1|  ABC transporter [Enterococcus faecium TC 6...  79.3    1e-13
ref|ZP_00994511.1|  putative ABC transporter ATP-binding subun...  79.3    1e-13
ref|YP_001710383.1|  putative ABC transporter ATP-binding prot...  79.3    1e-13 Gene info
ref|ZP_01880181.1|  ABC permidine/putrescine transporter, ATPa...  79.3    1e-13
ref|ZP_01260755.1|  Probable ABC transporter ATP binding prote...  79.3    1e-13

>ref|ZP_05069346.1|  glycine betaine transport ATP-binding protein opuAA [Candidatus 
Pelagibacter sp. HTCC7211]
 gb|EDZ60345.1|  glycine betaine transport ATP-binding protein opuAA [Candidatus 
Pelagibacter sp. HTCC7211]
Length=348

 Score =  248 bits (633),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/151 (76%), Positives = 138/151 (91%), Gaps = 0/151 (0%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDELL +Q+KLQ+TMVFITHDFLEAIKMGDHIAIMKDGE+SQVGTPEEIV
Sbjct  196  ALDPLIRREMQDELLKLQEKLQKTMVFITHDFLEAIKMGDHIAIMKDGEVSQVGTPEEIV  255

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
            ANP D+YVKDFCEDVPKYKVLSAGKVMRKEC D++KKL+ DK+ CI +N+KIETLID++ 
Sbjct  256  ANPKDQYVKDFCEDVPKYKVLSAGKVMRKECCDDTKKLYGDKSHCILDNSKIETLIDKLV  315

Query  124  EDDTAYPIINAQSGELVGEIDRTIVMKSMKS  154
            + D ++P++ + +G+L+GEIDR IVMKSMKS
Sbjct  316  DSDKSFPVVCSDTGDLLGEIDRAIVMKSMKS  346


>ref|ZP_01756350.1|  ABC transporter ATP-binding protein [Roseobacter sp. SK209-2-6]
 gb|EBA14895.1|  ABC transporter ATP-binding protein [Roseobacter sp. SK209-2-6]
Length=340

 Score =  133 bits (335),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 89/145 (61%), Gaps = 9/145 (6%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDE L +Q +L +T+VFITHDF EA+++ D IAIMKDGEI QV TPEE+V
Sbjct  194  ALDPLIRREMQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGEIIQVATPEELV  253

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             NP   YV +F   +P+ KVLS G +M  E + E           I +  +I  + ++I 
Sbjct  254  LNPASDYVAEFTRHIPRSKVLSVGGIMSAELTGEGDP--------IPQVTRISAVAEEII  305

Query  124  EDDTAYPIINAQSGELVGEIDRTIV  148
              D+  P+ +   G ++G I R  V
Sbjct  306  SADSPRPVCDGD-GRIIGSIGRNAV  329


>ref|ZP_02145033.1|  ABC transporter ATP-binding protein [Phaeobacter gallaeciensis 
BS107]
 ref|ZP_02148203.1|  ABC transporter ATP-binding protein [Phaeobacter gallaeciensis 
2.10]
 gb|EDQ10177.1|  ABC transporter ATP-binding protein [Phaeobacter gallaeciensis 
2.10]
 gb|EDQ13494.1|  ABC transporter ATP-binding protein [Phaeobacter gallaeciensis 
BS107]
Length=353

 Score =  131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 9/149 (6%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDE L +Q +L +T+VFITHDF EA+++ D IAIMKDG I Q+ TPEE+V
Sbjct  203  ALDPLIRREMQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKDGHIIQIATPEELV  262

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             NP   YV +F   +P+ KVL+ G +M      E           + + A++  + +QI 
Sbjct  263  LNPATDYVAEFTRHIPRSKVLTVGGIMASGTDGEGTP--------VPQTARVSDVAEQII  314

Query  124  EDDTAYPIINAQSGELVGEIDRTIVMKSM  152
              D   P+ +  SG ++G I+R  V + +
Sbjct  315  AADAPRPVCD-DSGRIIGSINRQAVARVL  342


>ref|ZP_05808665.1|  glycine betaine/L-proline ABC transporter, ATPase subunit [Mesorhizobium 
opportunistum WSM2075]
 gb|EEW35317.1|  glycine betaine/L-proline ABC transporter, ATPase subunit [Mesorhizobium 
opportunistum WSM2075]
Length=359

 Score =  127 bits (318),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (62%), Gaps = 8/140 (5%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDEL+ +Q  L +T+VFITHDF EAI++ D IAIMKDGE+ Q+GTPEE+V
Sbjct  209  ALDPLIRREMQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELV  268

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             NP   YV +F  DV + KV+SA  +MR  C        S+    +   AKI +    I 
Sbjct  269  VNPATDYVAEFTRDVDRAKVISARGLMRA-CDG------SEHGGTVAPEAKIASFSADIV  321

Query  124  EDDTAYPIINAQSGELVGEI  143
                 + ++N  +G+ +GE+
Sbjct  322  SSGKPFAVVNG-TGKPIGEV  340


>ref|NP_691920.1| Gene info glycine betaine ABC transporter ATP-binding protein [Oceanobacillus 
iheyensis HTE831]
 dbj|BAC12955.1| Gene info glycine betaine ABC transporter ATP-binding protein [Oceanobacillus 
iheyensis HTE831]
Length=398

 GENE ID: 1016850 OB0999 | glycine betaine ABC transporter ATP-binding protein
[Oceanobacillus iheyensis HTE831] (10 or fewer PubMed links)

 Score =  125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIR+EMQDELL +Q  L +T++FITHD  EA+K+GD IAIMKDGEI QVGT E
Sbjct  190  AFSALDPLIRKEMQDELLKLQNTLNKTILFITHDLDEALKLGDRIAIMKDGEIVQVGTSE  249

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVMRK  92
            EI+ NP ++YV +F +DV + KVL AG VMRK
Sbjct  250  EILENPANEYVSNFVKDVDRSKVLDAGTVMRK  281


>ref|NP_107673.1| Gene info ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
 dbj|BAB53459.1| Gene info ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
Length=359

 GENE ID: 1230328 mll7330 | ABC transporter ATP-binding protein
[Mesorhizobium loti MAFF303099] (10 or fewer PubMed links)

 Score =  125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 8/140 (5%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDEL+ +Q  L +T+VFITHDF EAI++ D IAIMKDGE+ Q+GTPEE+V
Sbjct  209  ALDPLIRREMQDELMRLQTMLHKTIVFITHDFDEAIRLADRIAIMKDGEVIQIGTPEELV  268

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             NP   YV +F  +V + KV+SA  +MR  C        ++    +  +AKI +    I 
Sbjct  269  VNPATDYVAEFTRNVDRAKVISARSLMRA-CDG------AEHGGTVAPDAKIASFSASIV  321

Query  124  EDDTAYPIINAQSGELVGEI  143
                 + ++N  +G+ +GE+
Sbjct  322  SAGKPFAVVNG-TGKPIGEV  340


>ref|ZP_06279808.1|  glycine betaine/L-proline ABC transporter, ATPase subunit [Streptomyces 
sp. ACT-1]
 gb|EFB81296.1|  glycine betaine/L-proline ABC transporter, ATPase subunit [Streptomyces 
sp. ACT-1]
Length=386

 Score =  124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDE++ + ++  RTMVFITHD  EA+++G  IA+M+DG I Q+GTPEEIV
Sbjct  210  ALDPLIRREMQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIV  269

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             +P D YV++F  DVP+ +VL+    MR   + E     S++   +   A +   I+ + 
Sbjct  270  GSPADDYVREFVRDVPREQVLTVATAMRPALAGE-----SERGPAVRPEATVAEAIEAVS  324

Query  124  ED-DTAYPIINAQSGELVGEIDRTIVM  149
               D A  +++   G LVG +D   ++
Sbjct  325  RSGDPAARVMDG--GRLVGVVDHACLL  349
>ref|ZP_05649820.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
gallinarum EG2]
 gb|EEV33153.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
gallinarum EG2]
Length=403

 Score =  124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 73/90 (81%), Gaps = 0/90 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIRREMQDELL++Q  +Q+T++FITHD  EA+++GD IA+MKDG+I Q+GT E
Sbjct  190  AFSALDPLIRREMQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGE  249

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVM  90
            EI+ NP ++YV+DF EDV + KVL+A  +M
Sbjct  250  EILTNPANQYVRDFVEDVDRSKVLTAQNIM  279


>ref|ZP_05082602.1|  glycine betaine transport ATP-binding protein opuAA [Pseudovibrio 
sp. JE062]
 gb|EEA96227.1|  glycine betaine transport ATP-binding protein opuAA [Pseudovibrio 
sp. JE062]
Length=343

 Score =  124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 94/149 (63%), Gaps = 7/149 (4%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQ+E L +Q KL +T++FITHDF EAI++ D IA+MKDGEI Q+ TPE++V
Sbjct  195  ALDPLIRREMQNEFLRLQSKLHKTIIFITHDFEEAIRLADRIAVMKDGEIVQIATPEQLV  254

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             +P  +YV++F + +PK KV+    +M   CS  S       +  +  + K+  +  Q+ 
Sbjct  255  THPATEYVEEFTQHIPKTKVIQLATIMEPGCSAGS------YSGDLSTHLKVADVAVQVG  308

Query  124  EDDTAYPIINAQSGELVGEIDRTIVMKSM  152
            + +  + ++N   GE +G IDR  ++  M
Sbjct  309  KSNRPFRVMN-DDGEPIGTIDRDRIVSLM  336


>ref|YP_001822594.1| Gene info putative glycine betaine ABC transporter ATP-binding protein 
[Streptomyces griseus subsp. griseus NBRC 13350]
 dbj|BAG17911.1| Gene info putative glycine betaine ABC transporter ATP-binding protein 
[Streptomyces griseus subsp. griseus NBRC 13350]
Length=386

 GENE ID: 6210764 SGR_1082 | putative glycine betaine ABC transporter
ATP-binding protein [Streptomyces griseus subsp. griseus NBRC 13350]
(10 or fewer PubMed links)

 Score =  124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDE++ + ++  RTMVFITHD  EA+++G  IA+M+DG I Q+GTPEEIV
Sbjct  210  ALDPLIRREMQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIV  269

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             +P D YV++F  DVP+ +VL+    MR   + E     S++   +   A +   I+ + 
Sbjct  270  GSPADDYVREFVRDVPREQVLTVATAMRPALAGE-----SERGPAVRPEATVAEAIEAVS  324

Query  124  ED-DTAYPIINAQSGELVGEIDRTIVM  149
               D A  +++   G LVG +D   ++
Sbjct  325  RSGDPAARVMDG--GRLVGVVDHACLL  349


>ref|ZP_01860474.1|  glycine betaine ABC transporter ATP-binding protein [Bacillus 
sp. SG-1]
 gb|EDL64495.1|  glycine betaine ABC transporter ATP-binding protein [Bacillus 
sp. SG-1]
Length=410

 Score =  124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIR+EMQDELL++Q KL +T++FITHD  EA+K+GD IAIMK+G I QVGT E
Sbjct  201  AFSALDPLIRKEMQDELLNLQSKLGKTILFITHDLDEALKLGDRIAIMKNGSIVQVGTAE  260

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVMRK  92
            EI+ NP ++YV +F EDV + KVL AG VM+K
Sbjct  261  EILENPANEYVYNFVEDVDRSKVLVAGNVMKK  292


>ref|ZP_04697465.1|  putative glycine betaine ABC transporter ATP-binding protein 
[Streptomyces roseosporus NRRL 15998]
 ref|ZP_04712660.1|  putative glycine betaine ABC transporter ATP-binding protein 
[Streptomyces roseosporus NRRL 11379]
Length=388

 Score =  124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 90/147 (61%), Gaps = 8/147 (5%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRREMQDE++ + ++  RTMVFITHD  EA+++G  IA+M+DG I Q+GTPEEIV
Sbjct  216  ALDPLIRREMQDEVVRLHREEGRTMVFITHDLSEALRLGTRIALMRDGGIVQLGTPEEIV  275

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             +P D YV++F  DVP+ +VL+    MR   + E     S++   +  +A +   I+ + 
Sbjct  276  GSPADDYVREFVRDVPREQVLTVATAMRPALAGE-----SERGPAVRPDATVSEAIEAVS  330

Query  124  EDDTAYPIINAQ-SGELVGEIDRTIVM  149
               +  P+      G LVG +D   ++
Sbjct  331  R--SGDPVARVMDGGRLVGVVDHACLL  355


>ref|ZP_05511217.1|  glycine betaine ABC transporter ATP-binding protein [Streptomyces 
sp. C]
Length=385

 Score =  123 bits (309),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 92/146 (63%), Gaps = 7/146 (4%)

Query  4    CLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPEEIV  63
             LDPLIRR+MQ+E++ + ++  RTMVFITHD  EA+++GD IA+M+DG I Q+GTPEEIV
Sbjct  232  ALDPLIRRDMQEEVVRLHREEGRTMVFITHDLGEALRLGDRIALMRDGRIVQLGTPEEIV  291

Query  64   ANPVDKYVKDFCEDVPKYKVLSAGKVMRKECSDESKKLFSDKTKCIDENAKIETLIDQIC  123
             +P D YV+DF  DVP+ +VL+    MR   + E+          +  +A +   I+ + 
Sbjct  292  GSPADDYVRDFVRDVPREQVLTVRSAMRPARNGEAA-----AGPALAPSATVHEAIEAVA  346

Query  124  EDDTAYPIINAQSGELVGEIDRTIVM  149
                   ++  ++G  +G +D+T+++
Sbjct  347  RSGETARVV--ENGRCLGVVDQTVLL  370


>ref|ZP_05657144.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC20]
 gb|EEV40477.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC20]
Length=399

 Score =  123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 73/90 (81%), Gaps = 0/90 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIRREMQDELL++Q  +Q+T++FITHD  EA+++GD IA+MKDG+I Q+GT E
Sbjct  185  AFSALDPLIRREMQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGE  244

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVM  90
            +I+ NP ++YV+DF EDV + KVL+A  +M
Sbjct  245  DILTNPANQYVRDFVEDVDRSKVLTAQNIM  274


>ref|ZP_05647062.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC30]
 ref|ZP_05653393.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC10]
 gb|EEV30395.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC30]
 gb|EEV36726.1|  glycine betaine/L-proline transporter ATP-binding subunit [Enterococcus 
casseliflavus EC10]
Length=404

 Score =  123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 73/90 (81%), Gaps = 0/90 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIRREMQDELL++Q  +Q+T++FITHD  EA+++GD IA+MKDG+I Q+GT E
Sbjct  190  AFSALDPLIRREMQDELLELQANVQKTIIFITHDLNEALRIGDRIALMKDGQIMQIGTGE  249

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVM  90
            +I+ NP ++YV+DF EDV + KVL+A  +M
Sbjct  250  DILTNPANQYVRDFVEDVDRSKVLTAQNIM  279


>ref|YP_002774552.1| Gene info glycine betaine ABC transporter ATP-binding protein [Brevibacillus 
brevis NBRC 100599]
 dbj|BAH46048.1| Gene info glycine betaine ABC transporter ATP-binding protein [Brevibacillus 
brevis NBRC 100599]
Length=408

 GENE ID: 7716478 opuAA | glycine betaine ABC transporter ATP-binding protein
[Brevibacillus brevis NBRC 100599]

 Score =  123 bits (308),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 75/92 (81%), Gaps = 0/92 (0%)

Query  1    AVFCLDPLIRREMQDELLDIQKKLQRTMVFITHDFLEAIKMGDHIAIMKDGEISQVGTPE  60
            A   LDPLIR++MQDELL++Q  +Q+T++FITHD  EA+K+GD IA+MKDG I Q+G+PE
Sbjct  190  AFSALDPLIRKDMQDELLELQSTMQKTIIFITHDLDEALKIGDRIALMKDGAIVQIGSPE  249

Query  61   EIVANPVDKYVKDFCEDVPKYKVLSAGKVMRK  92
            EI+ NP ++YV+ F EDV + KVLSA KVM++