GOS 1156010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_431
Annotathon code: GOS_1156010
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : COMSATSISB
Username : Muqaddas
Annotated on : 2010-01-24 16:24:17
  • abid muqaddas

Synopsis

  • Taxonomy: Aeromonas hydrophila (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 644
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order: Aeromonadales
    Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas;

Genomic Sequence

>JCVI_READ_431 GOS_1156010 Genomic DNA
CGGGCTCCAGGATCATCTTGCCCTGCAGCGGTGGCCGCTCTTTTATCTGATCGTTCATCGCTTCTCCTGAAAACAGTCTCCCGGGTACGGCGCAGGCAAC
AAACCCGTGCCGCACACCGGTTATTCGAGGTGATCCCCGAGCAGAAACTCCAGCGCCGCATCGAGCCGGATATGGGGCAGCGCCTGATGGGCGCTCATGG
GCAGTGGGCGAAATGCCTGAAAATCAAAGCCCTGATTGTTCCACCACTGGGCGGGCGGAATATGGGACGGCACCTCGCCCGGAAACAGCAGCAGCGGCTC
ACCGCTCAGGCTGGTGCCACGGATGGCGGGGAACTCGCGGCCATCGGCCACCCCCTTGCCCACCTCGGTCGCCTTGATGGCGGCCAGCGCCAGACACTCG
GTGGCAATCCCCTCAAAACGGGCCTGACCGCGGCCGCTGCGCACCAGATGCTGCAGCAGGGAGACCATGGGGCCGTGCTGTTCGGGGGTGACGTGATCGG
CCTTGCTCGCCACGAACAGCAGCTTGTCGATACGGGGAGAAAAGAGCCGCCGCCACCAGTTGCTCTTGCCGTAGGCAAAGCTCTCCATGATGCGGGCGAT
GGCCTGCTGCATGTCGCCAAAGCTGGCCGCCCCGGCGTTGAGGGGCTGCAGGCAGTCCACCAGCACGATCTGGCGATCGAAACCGGCAAAGTGCTGCTCA
TAAAAACCCTGTACCAGGTGCAGCTTGTACTGCTCGAAGCGCTGCTTGAGGGTGGCGGTAGAGGGTGCCCCTCGGCGGGGCTCGCCAAACAGGCATCGCC
CCACACCCAGGGGCACGAACTGCAACATGGGGGGCGCCCGGCATACTCCCCCCGGGCAGCACGAAG

Translation

[39 - 743/866]   indirect strand
>GOS_1156010 Translation [39-743   indirect strand]
MLQFVPLGVGRCLFGEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRI
DKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLLLFPGEVPSHIPPAQWWNNQG
FDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE

Annotator commentaries

i conclude with srong evidences that my sequence is coding and for that i have following evidences like:

1) presence of longest ORF with start codon ATG present at position 39 and also ORF is complete that is followed by stop codon so translation of it is poosible.

2) presence of good homologs with very low e-value also supports it to be coding.

3) presence of protien domain that is DUF463 bytwo softwares that is INTERPROSCAN and pfam is also a very strong evidence of it to be coding.


The protein is thought to be aminoacid regulated cytosolin protein.The sequence has domian DUF463 whose members are thought to have an ATP-binding domain at their N-terminus. so the protien is thought to have ATP binding activity and so may be involved in so many processes like cell growth, cell signaling pathway, transporter activity etc.



Phylogenetic tree also show great homology of sequence with the best homolog of BLASTp and so it is tought that sequence belong to the group of gamma-proteobacteria which belong to phylum proteobacteria and kingdom is bacteria.


so from all this it is concluded that sequence is coding belong to Aeromonas hydrophila and code for cytosolic protein having ATP binding activity and are involved in many cell processes.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'standard(1)'genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'atg' initiation / 'standard(1)'genetic code



RESULTS ANALYSIS

I obtained 1 ORF on direct strand in reading frame 1 and 2 ORF's on reverse strand in reading frame 1 and 3. i selected ORF of reverse strand in reading frame 3 because it is the longest strand and also its length is multiple of 3 nucleotides so its translation is complete. it also contains start codon at the start and stop codon just after it. so as it fulfilled all the requirements of perfect ORF, so this is coding ORF and i proceed further analysis with this ORF.

RAW RESULTS
a)direct strand
ORF number 1 in reading frame 1 on the direct strand extends from base 172 to base 864.
ATGGGGCAGCGCCTGATGGGCGCTCATGGGCAGTGGGCGAAATGCCTGAAAATCAAAGCC
CTGATTGTTCCACCACTGGGCGGGCGGAATATGGGACGGCACCTCGCCCGGAAACAGCAG
CAGCGGCTCACCGCTCAGGCTGGTGCCACGGATGGCGGGGAACTCGCGGCCATCGGCCAC
CCCCTTGCCCACCTCGGTCGCCTTGATGGCGGCCAGCGCCAGACACTCGGTGGCAATCCC
CTCAAAACGGGCCTGACCGCGGCCGCTGCGCACCAGATGCTGCAGCAGGGAGACCATGGG
GCCGTGCTGTTCGGGGGTGACGTGATCGGCCTTGCTCGCCACGAACAGCAGCTTGTCGAT
ACGGGGAGAAAAGAGCCGCCGCCACCAGTTGCTCTTGCCGTAGGCAAAGCTCTCCATGAT
GCGGGCGATGGCCTGCTGCATGTCGCCAAAGCTGGCCGCCCCGGCGTTGAGGGGCTGCAG
GCAGTCCACCAGCACGATCTGGCGATCGAAACCGGCAAAGTGCTGCTCATAAAAACCCTG
TACCAGGTGCAGCTTGTACTGCTCGAAGCGCTGCTTGAGGGTGGCGGTAGAGGGTGCCCC
TCGGCGGGGCTCGCCAAACAGGCATCGCCCCACACCCAGGGGCACGAACTGCAACATGGG
GGGCGCCCGGCATACTCCCCCCGGGCAGCACGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MGQRLMGAHGQWAKCLKIKALIVPPLGGRNMGRHLARKQQQRLTAQAGATDGGELAAIGH
PLAHLGRLDGGQRQTLGGNPLKTGLTAAAAHQMLQQGDHGAVLFGGDVIGLARHEQQLVD
TGRKEPPPPVALAVGKALHDAGDGLLHVAKAGRPGVEGLQAVHQHDLAIETGKVLLIKTL
YQVQLVLLEALLEGGGRGCPSAGLAKQASPHTQGHELQHGGRPAYSPRAAR

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.



b)reverse strand
ORF number 1 in reading frame 1 on the reverse strand extends from base 166 to base 561.
ATGAGCAGCACTTTGCCGGTTTCGATCGCCAGATCGTGCTGGTGGACTGCCTGCAGCCCC
TCAACGCCGGGGCGGCCAGCTTTGGCGACATGCAGCAGGCCATCGCCCGCATCATGGAGA
GCTTTGCCTACGGCAAGAGCAACTGGTGGCGGCGGCTCTTTTCTCCCCGTATCGACAAGC
TGCTGTTCGTGGCGAGCAAGGCCGATCACGTCACCCCCGAACAGCACGGCCCCATGGTCT
CCCTGCTGCAGCATCTGGTGCGCAGCGGCCGCGGTCAGGCCCGTTTTGAGGGGATTGCCA
CCGAGTGTCTGGCGCTGGCCGCCATCAAGGCGACCGAGGTGGGCAAGGGGGTGGCCGATG
GCCGCGAGTTCCCCGCCATCCGTGGCACCAGCCTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MSSTLPVSIARSCWWTACSPSTPGRPALATCSRPSPASWRALPTARATGGGGSFLPVSTS
CCSWRARPITSPPNSTAPWSPCCSIWCAAAAVRPVLRGLPPSVWRWPPSRRPRWARGWPM
AASSPPSVAPA*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 39 to base 746.
ATGTTGCAGTTCGTGCCCCTGGGTGTGGGGCGATGCCTGTTTGGCGAGCCCCGCCGAGGG
GCACCCTCTACCGCCACCCTCAAGCAGCGCTTCGAGCAGTACAAGCTGCACCTGGTACAG
GGTTTTTATGAGCAGCACTTTGCCGGTTTCGATCGCCAGATCGTGCTGGTGGACTGCCTG
CAGCCCCTCAACGCCGGGGCGGCCAGCTTTGGCGACATGCAGCAGGCCATCGCCCGCATC
ATGGAGAGCTTTGCCTACGGCAAGAGCAACTGGTGGCGGCGGCTCTTTTCTCCCCGTATC
GACAAGCTGCTGTTCGTGGCGAGCAAGGCCGATCACGTCACCCCCGAACAGCACGGCCCC
ATGGTCTCCCTGCTGCAGCATCTGGTGCGCAGCGGCCGCGGTCAGGCCCGTTTTGAGGGG
ATTGCCACCGAGTGTCTGGCGCTGGCCGCCATCAAGGCGACCGAGGTGGGCAAGGGGGTG
GCCGATGGCCGCGAGTTCCCCGCCATCCGTGGCACCAGCCTGAGCGGTGAGCCGCTGCTG
CTGTTTCCGGGCGAGGTGCCGTCCCATATTCCGCCCGCCCAGTGGTGGAACAATCAGGGC
TTTGATTTTCAGGCATTTCGCCCACTGCCCATGAGCGCCCATCAGGCGCTGCCCCATATC
CGGCTCGATGCGGCGCTGGAGTTTCTGCTCGGGGATCACCTCGAATAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MLQFVPLGVGRCLFGEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCL
QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP
MVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLL
LFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE*

Multiple Alignement

PROTOCOL


phylogeny.fr \"A la Carte" Mode \ default parameters except Run Work flow _ "step by step " \


RESULTS ANALYSIS:


i do MSA of my sequence with 15 ingroup and 5 outgroup sequences to find alignment so that i can infer a tree from it. using phylogeny.fr i found good alignment of my sequence which is then used to made phylogenetic tree of it.




Parameters used

Minimum Number Of Sequences For A Conserved Position: 14

Minimum Number Of Sequences For A Flanking Position: 22

Maximum Number Of Contiguous Nonconserved Positions: 4

Minimum Length Of A Block: 5

Allowed Gap Positions: None

Use Similarity Matrices: Yes



Flank positions of the 6 selected block(s)

Flanks: [38 46] [276 345] [347 424] [444 450] [476 483] [499 514]


New number of positions in input.fasta-gb: 188 (36% of the original 515 positions)


RAW RESULTS



MUSCLE (3.7) multiple sequence alignment


ID14529937      --------MIRNKLEQKWSLLQHKATDVVNRVRDRHIRLAVTGLSRSGKTAFITALVNQL
m.s.GOS_11      -----------------------------------MLQFVPLGVGRC-------------
ID11762021      MNGRTGQALILNKLEQQFNRLQHKANDVVNRVRDRHIRLAVTGLSRSGKTAFITALVNQL
IDenteroba      -----------------MKRLQNELTALINRGVDRHLRLAVTGLSRSGKTAFITSLVNQL
g.enteroba      ---------------MAMKRFKNELNSLVNRGVDRHLRLAVTGLSRSGKTAFITAMVNQL
ID19733696      -----------------MSKLAKEMNRWVSRSMDRHVKLAVTGLSRAGKTAFITSLVNQC
ID76803910      -----------------MKRVTQEVNDFINRGMDANVRIAVTGLSRAGKTAFITSLVNQL
ID16380071      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID26996291      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
g.g.proteo      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID15383197      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID15383922      -----------------MKRIKQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID28898645      -----------------MKRIKQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID91224281      -----------------MKRIKKEVNDFINRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID25422814      -----------------MKRIKKEVNDFINRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID26077605      -----------------MKSITQEVNDFINRSVDSHVRVAVTGLSRAGKTAFISSLVNQL
ID26125319      -----------------MKQITQEVNDLISRSMDSHVRIAVTGLSRAGKTAFISSLVNQL
ID26227444      -----------------MKSVKRQVNKWVSRGLDRHVRLAVTGLSRAGKTAFITSLINQL
ID26910239      -----------------MNRLGNEFNKWVNRGLDRHVRLAVTGLSRAGKTAFITSLVNQL
ID90413058      -----------------MNRIGNELNKLVNRSLDRHVRLAVTGLSRSGKTAFITSLINQL
ID54309601      ----MYAISRIKKIRHDMNRIGNELNKLVNRSLDRHVRLAVTGLSRSGKTAFITSLINQL
ID90579456      -----------------MNRISNELNKLVNRSLDRHVRLAVTGLSRAGKTAFITSLINQL
ID89076402      -----------------MNRISNELNKLVNRSLDRHVRLAVTGLSRAGKTAFITSLINQL
g.a.proteo      -----------------MENVQDGVSETF---FEPVIRLGVTGLARSGKTVFITSLVANL
ID14856061      -------MAKLTSFGDEARIALDTLTDRATGLLSPSLRLGVTGLSRAGKTVFISALVHNL
ID22782220      ------MASLLTSFKDGALIAIDNLADRAAGLVSPSLRLGVTGLSRAGKTVFISSLVHNL
                                                    :..   *:.*.             

ID14529937      EHAAIDGRLPLWDAQRQGRILGARRVPQKNAHIPTFAYERGLDALFGDPPAWPDPTRGVA
m.s.GOS_11      --------------------------------------------LFGEPRR---------
ID11762021      EHAAIDGRLPLWDALRQGRILGARRVPQQNAHIPTFAYERGLDALFGDPPAWPEPTRGVA
IDenteroba      TNVHSGARLPLFSAARNQQLLGVKRIPQHNLSIPRFTYDEAMESLYHTPPSWPVPTKGVS
g.enteroba      LNLHTGARLPLLSAAREERLLGVKRVPQRDFGIPRFTYDEGLAQLYGTPPSWPTPTRGVS
ID19733696      LHASTSDKLPLLSASREGRLIGAKRVPQSNLSIPSFTYDDGMDSLLSDPPTWPEPTRDVS
ID76803910      LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID16380071      LHTATHDNLPLLNAARDKRLIGAKREPQANMMVPRFAYDDAMSQIHATPPQWPVPTRDVS
ID26996291      LHTATHDNLPLLNAARDKRLIGAKREPQSNMMVPRFAYDDAMNQIHATPPQWPVPTRDVS
g.g.proteo      LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID15383197      LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID15383922      LHTATHDNLPLLTAARDKRLIGAKREPQTNMMVPRFAYDEAMSQIHANPPQWPVPTRDVS
ID28898645      LHTATHDNLPLLTAARDKRLIGAKREPQTNMMVPRFAYDEAMSQIHANPPQWPVPTRDVS
ID91224281      LHTATHDNLPLLTAARDKRLIGAKREPQSNMMVPRFAYDEAMSQIHATPPQWPVPTRDVS
ID25422814      LHTATHDNLPLLTAARDKRLIGAKREPQANMMVPRFAYDEAMSQIHATPPQWPVPTRDVS
ID26077605      LHTSTHDNLPLLVSARDKRLVGAKREPQANMMVPRFAYDEAMEHVFTQPPKWPEPTRDVS
ID26125319      LHTSTHDSLPLFAASRDKRLVGAKREPQTNMMVPRFAYDDAMEHVHSTPPKWPEPTRDVS
ID26227444      LHSATNPRMPLFAPVREGRVLGARRVQQSQLHIPSFDYDLGIQSLHSRPPTWPAPTRDVS
ID26910239      LHVSTNPRLPLFTPVREGHLLGAKRVPQLDMHIPKFGYDEGMASILSTPPAWPEPTRDVS
ID90413058      LHVSTNPRLPLFTAVRDGNLLGAKRVPQRDMHVPKFGYDEGMGALLSSPPAWPEPTRDVS
ID54309601      LHVSTNPRLPLFTAVRDGNLLGAKRVPQRDMHVPKFGYDESMGSLLSSPPAWPEPTRDVS
ID90579456      LHVSTNARLPMFSAMRDGHLLGAKRVPQLDLHVPKFGYDEGMQSILSTPPEWPEPTRDVS
ID89076402      LHVSTNARLPMFSAMRDGHLLGAKRVPQLDLHVPKFGYDEGMQSIMSMPPEWPEPTRDVS
g.a.proteo      LD---RGRMPGLLAASEGRIEAAFLQPQPDDTVPRFEYENHLAALTGPTPHWPDSTRAIS
ID14856061      VH---GGRLPMFEAYKAGRISRALLEPQPDDAVPRFQYEEHLSALID-ERIWPDSTRAIS
ID22782220      LN---GGRLPLFEPTRSGRVSKVRLEPQPDDAVPRFQYEDHIAALVR-DRVWPDSTRAIS
                                                            :               

ID14529937      EVRLEIRYRTRHPLRKHLGDISTLYVDLVDYPGEWLLDLPLLELSYEQWSEQVRDQLRRP
m.s.GOS_11      ------------------------------------------------------------
ID11762021      EVRLEIRYRTRHPLRKHLGEISTLYVDLVDYPGEWLLDLPLLEMSYEQWSEQVREQLRRP
IDenteroba      EIRLQLRYRSHESLTRFIKETSSLYLEIVDYPGEWLLDLPMLEQDYFEWSEQMNRVNQ--
g.enteroba      EIRLALRFRSNDSLLRHFKDTSTLYLEIVDYPGEWLLDLPMLAQDYLSWSRQMTGLLQ-G
ID19733696      ELRLAIKFKPKSGVLKHFQDSATLFVDIVDYPGEWLLDLPLLDMDYLTWSKQQQANLT-G
ID76803910      EIRLALKYKPNKATKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMNFATWSQTQFEALK-G
ID16380071      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
ID26996291      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
g.g.proteo      EIRLALKYKPNKTTKKLLSKTSVLNVDIIDYPGEWLLDLPLLDTDFATWSQTQFDALK-G
ID15383197      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
ID15383922      EIRLALKYKPKKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDLDFSSWSQTQFDALK-G
ID28898645      EIRLALKYKPKKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMNFSSWSQTQFDALK-G
ID91224281      EIRLALKYKPNKTTKKLLSKTAILNVDIIDYPGEWLLDLPLLDMDFATWSQTQFDALK-G
ID25422814      EIRLALKYKPNKTTKKLLSKTAILNVDIIDYPGEWLLDLPLLDMDFATWSQTQFDALK-G
ID26077605      EIRLAVKYKPTRKSKKLFGSTSTLHIDIIDYPGEWLLDLPLLDMSFHEWSQTQFAALK-G
ID26125319      EIRLALKYKPKKKTKKLFGSTSTLHIDIIDYPGEWLLDLPLLDMDFEQWSQSQFDALT-G
ID26227444      EIRLEIRYRPEKGAMKLLQDTATLYLDIVDYPGEWLLDLPLLSMSFDEWSRKQSGILT-G
ID26910239      QIRLALRYRPQKGALKYLQDTATLYLDIVDYPGEWLLDLPLLDMDFMTWSKQQALVLK-G
ID90413058      QTRLALRYKPQKGPMKLFQETATLYLDIVDYPGEWLLDLPLLDLDFMTWSKQQTKVLK-G
ID54309601      QTRLALRYKPQKGPMKLFQETATLYLDIVDYPGEWLLDLPLLDLDFMAWSKQQTKVLK-G
ID90579456      QTRLALRYKPQKGAMKLFQDTATLYLDIIDYPGEWLLDLPLLDLDFTQWSTQQSQVLK-G
ID89076402      QTRLALRYKPQKGALKLFQDTATLYLDIIDYPGEWLLDLPLLDLDFTQWSVQQSQVLK-G
g.a.proteo      ELRLSLRVRPN-GLLAGFQGPRTVHLDIVDYPGEWLLDLALMDVDYATWSAQVLARIA--
ID14856061      QLRLTIEYETASAWGRWLS-PGRLSVDIVDYPGEWLLDLPLLGKTYAQFSADSFALANEP
ID22782220      QLRITLDYESASGWNRMFS-AGRLSIDIVDYPGEWLLDLPLLAMDFRQFSETTVKRARIG
                                                                            

ID14529937      ELQALAAAWLA--TEWQAEQTFEERPVAELAERYTDYLHACKREL-GLHLIQPGRFVLPG
m.s.GOS_11      ------------------------------------------------------------
ID11762021      ELQALTAGWLA--PEWQADQGFEERPVAQLAERYTAYLHACKQEL-GLHLIQPGRFVLPG
IDenteroba      QRTAPVQQWQSLIKKCDPFAPADETLLAEIAAAYTEYLLACK-KQ-GLHFIQPGRFVLPG
g.enteroba      QRAEWSLKWQELCAGLDPLAPADENRLAAIAQAWTDYLHQCK-KE-GLHFIQPGRFVLPG
ID19733696      HRKVLSEAWLQEAKLLDPLAPVDEKQLARIADAFTDYLHTCKDEK-GLHWVQPGRFVLPG
ID76803910      QRSELAASWLTELEALDLNADLNEKQLEKVAKTYTDYLHACK-ES-GLHWVQPGRFVLPG
ID16380071      RRNELAIDWLSDLEALDVNAALDEKQLESLAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
ID26996291      QRSELAADWLAELETLDLAAELNEKQLEKVAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
g.g.proteo      QRSELAADWLAELDALDLAAELNEKQLEKVAKSYTDYLHACK-DS-GLHWVQPGRFVLPG
ID15383197      QRSELAVDWLAELEALDLTAELNEKQLERVAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
ID15383922      KRKELAQAWLAELEQIELNADADEKQLEKVAHAYTDYLHACK-DA-GLHWVQPGRFVLPG
ID28898645      KRKELAQAWLAELEQIELNADADEKQLEKVAHAYTDYLHACK-DA-GLHWVQPGRFVLPG
ID91224281      QRGDLAKAWLSELEKVDLFAEVNEKLLEKVAHTYTEYLHSCK-DS-GLHWVQPGRFVLPG
ID25422814      QRGDLAKAWLSELEKVDLSAEVNEKLLEKVAHTYTEYLHACK-DA-GLHWVQPGRFVLPG
ID26077605      QRGELAKEWLAKLEQLNLADDVNERELEAIAQSYTQYLHDCK-DT-GLHWVQPGRFVLPG
ID26125319      KRRELAQAWLDKLDNLDISQPLNEKAIADVAQSYTEFLYECK-RE-GLHWVQPGRFVLPG
ID26227444      KRKALADEWLQAVDSFDPLADADEKLIGQIATKFTAYLHACKQEA-GLHWVQPGRFVLPG
ID26910239      KRLELAQEWMALGDEFDPFAPVDEALLEKISQAFTQYLYACKDEG-GLHWVQPGRFVLPG
ID90413058      KRLELAQEWIAMGETFDPFAPADEVLIERISAAFTDYLYKCKAEG-GLHWVQPGRFVLPG
ID54309601      KRLELAQEWMAIGETFDPFAPADEVLIERISAAFTDYLYKCKAEG-GLHWVQPGRFVLPG
ID90579456      KRLELAQNWLAKTEMFDPFAPADEKQIEEISKAFTQYLHQCKAEG-GLHWVQPGRFVLPG
ID89076402      KRLELAQNWLVKIETFDPFAPADEKQIEEISKAFTEYLHQCKAEG-GLHWVQPGRFVLPG
g.a.proteo      -NREEAAGYRALVEGIDPEAALDEPVAQALAASFAEYLQTARAN--GYSDCTPGRFLLPG
ID14856061      THRDLAAAWLAEAKTVAPSEKADELTAQRLARCFTDYLRAGKADERALSTLPPGRFLMPG
ID22782220      ARAALSRDWLALASASGGEMAADEGTARRLAESFTTYLRACKEDDHSLSTLPPGRFLMPG
                                                                            

ID14529937      EYAGAPMLQFVPWMWDKP-----AGEPADGSLYTTLKQRFEQYKQHLVQGFYEQHFAGFD
m.s.GOS_11      ---GAP-------------------------STATLKQRFEQYKLHLVQGFYEQHFAGFD
ID11762021      EYAGAPMLQFVPWVWDKP-----AQEPAEGTLYATLKQRFEQYKQHLVQGFYEQHFAGFD
IDenteroba      ELSGAPVLQFFPWADLTQYDSAKLKNADKKTNIGMLKKRYEYYGQHIVKGFYRDHFQGFD
g.enteroba      EMAGAPALQFFPWPDVDAWGESKLAMADKNTNVGMLRERFNYYCEKVVKGFYKNHFLKFD
ID19733696      ELAGAPVLQFFPFMFLHKYTEEELAKTKKGSNIAVLKQRYKHYQQNVVKKFYNDHFRHFD
ID76803910      ELEGAPVLQFFPCRFDAD------MKPAKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID16380071      ELDGAPVLQFFPCRFDAE------TKPVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID26996291      ELEGAPVLQFFPCRFDAD------VKSVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
g.g.proteo      ELEGAPVLQFFPCRFDAD------TKPVKGSNLAMLEARYHKYQQKVVKAFYKHHFATFD
ID15383197      ELEGAPVLQFFPCRFDAD------VKPVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID15383922      ELAGAPVLQFFPCRFEPE------SKAPKGSNLAMLEARFHEYQQKVVKAFYKHHFATFD
ID28898645      ELAGAPVLQFFPCRFESE------SKAPKGSNLAMLEARFHEYQQKVVKAFYKHHFATFD
ID91224281      ELAGAPVLQFFPCRADSE------SKAPKGSNLAMLEARFQEYQQKVVKAFYKHHFATFD
ID25422814      ELGGAPVLQFFPCRADSE------SKALKGSNLAMLEARFQEYQQKVVKAFYKHHFATFD
ID26077605      ELEGAPVLQFFPCRFDEE------SKASKDSNLAMLKARYQEYQQKVVKAFYKHHFSTFD
ID26125319      ELEGAPVLQFFPCRVDDN------VKAGKGSNLAMLKARYNEYQQKVVKAFYKHHFSTFD
ID26227444      EYAGAPVLQFFPLIGN-QYGEGQLANAPRTSNYAMLKQRYDYYCQHIVKGFYQEHFSKVD
ID26910239      ELAGAPVLQFFPMIWTNKYTEQQLQEADEHSNFAMLKQRYKYYQQHIVKGFYKEHFSKFD
ID90413058      ELAGAPVLQFFPMIWEHNYTEQQLQQADEHSNIGMLKSRYKYYQQHVVKAFYRDHFSKFD
ID54309601      ELAGAPVLQFFPMIWDHNYTEQQLQQADEHSNIGMLKSRYKYYQQHVVKAFYRDHFSKFD
ID90579456      ELAGAPVLQFFPLLWNKKYTEKQLIDADESTNVGMLRNRYKYYQQHVVKAFYNDHFSKFD
ID89076402      ELAGAPVLQFFPLLWNKKYTEKQLIDADENTNVGMLRNRYKYYQQHVVKAFYNDHFSKFD
g.a.proteo      DLAGSPVLTFAPLPG---------GEGPRGSLLREMARRFEAYKRRVVKPFFRDHFARIN
ID14856061      DLDGSPALTFAPLPDLEP------GDFKSGSMAAMMERRYEAYKTYVVKPFFREHIARLD
ID22782220      DLEGSPALTFSPLPNLPE------GRAPKGSLWAMMERRYEAYKTHVVSPFFREHFARLD
                   *:*                             :  *:  *   :*. *:  *:  .:

ID14529937      RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
m.s.GOS_11      RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
ID11762021      RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
IDenteroba      RQIVLVDCLQPLNQGADVFNDMRQALTQLMRSFHYGKRTLLRRLF-SPCIDKLLFAATKA
g.enteroba      RQIVLVDCLQPLNSGPHAFNDMRLALTQLMQSFHYGQRTLFRRLF-SPVIDKLLFAATKA
ID19733696      RQIVLVDCLQPLNAGENSFNDMRQAIDQLMHSFQYGKSSLLKRLF-SPKIDKVLFAATKA
ID76803910      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID16380071      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID26996291      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
g.g.proteo      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID15383197      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID15383922      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID28898645      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID91224281      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID25422814      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID26077605      RQIVLVDCLQPLNAGYESFHDMRHAIEQIMHSFRYGRSNMLKRLF-APRIDKILFAATKA
ID26125319      RQIVLVDCLQPLNAGYESFQDMRHALEQIMHSFRYGRSNLLKRLF-APRIDKILFAATKA
ID26227444      RQIVLVDTLQPLNAGPASFNDMRMALEQLMQSFRYGKSGLLRRLF-APRIDKILFAATKA
ID26910239      RQIILVDCLQPLNAGPESFNDMRQAIDQLMQSFKYGRSSLLRRMF-APRIDKVLFAATKA
ID90413058      RQIILVDCLQPLNAGTESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKS
ID54309601      RQIILVDCLQPLNAGTESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKS
ID90579456      RQIILVDCLQPLNAGPESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKA
ID89076402      RQIILVDCLQPLNAGPESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKA
g.a.proteo      RQVVLVDALGAINQGPRAVEDLRAAMSDILGSFKPGRNGFLTQLLRGKRVEKILFAATKA
ID14856061      RQIVLIDAMQAMNAGGAVVADLERALTDILSCFRPGRSNLLTGLI-QRRIGRILVAATKA
ID22782220      RQIVLVDALQAINRGPEALRDLEQALADVLACFRPGTNSWLSSFL-TRRIDRVLIAATKA
                **::*:* : .:* *   . *:  *:  :: .*  *       ::    : .:*..*:*:

ID14529937      DHVTPEQHGPLVSLFQHLVRSGRGQARFEGITTECLALAAIKATEVGKGVANGREFPAIR
m.s.GOS_11      DHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIR
ID11762021      DHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIR
IDenteroba      DHITPDQHENLVSLLQQLIQDAKQNAIFEGISIDCMGLASIAATESGIVDHHGEKIPAVK
g.enteroba      DHVTVDQHANMVALLQQLVQDAWQNAAFEGISMDCLGLASVQATQSGLIDVNGEKIPALR
ID19733696      DHVTPEQHPNMVSLLQQMIYQTWQETAYEGIKMECMSIASIQATTAGMIDEDGEIFAAIS
ID76803910      DHVTPDQHPHLVSLLQQMVHPSWQTASYENIEMSCMSIASIQATTSGFIASGDKTVPALQ
ID16380071      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTTGFITSGDKSVPALQ
ID26996291      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKTVPALQ
g.g.proteo      DHVTPDQHPHLISLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALK
ID15383197      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALK
ID15383922      DHVTPDQHPHLASLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFITSGDKTISALQ
ID28898645      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFITSGDKTISALQ
ID91224281      DHITPDQHPNLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTTGFISSGDKTIPALQ
ID25422814      DHITPDQHPNLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQSTTTGFISSGDKTIPALQ
ID26077605      DHVTPEQHPNLVSLLQQMVHPAWQTASYENIEMSCISMASIQATKTGFINRGTESVPAIQ
ID26125319      DHVTPEQHPNLVSLLQQMVHPAWQSASYENIEMSCITMASIQATQAGFINKGDQAYPALQ
ID26227444      DHVTPDQHPNLVSLLQQLIHEAWQTAAFEGIDMECISLASIQATEPGLVNHQGESMAALR
ID26910239      DHVTPEQHPNLVNLLQQLVNEAWHTASFEGIEMDCVSLASIQATEPGFVNHHGQQVPALR
ID90413058      DHVTPEQHPNLVSLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVAHQGSQVPALR
ID54309601      DHVTPEQHPNLVSLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVAHQGSQVPALR
ID90579456      DHITPEQHPNLVGLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVNHKGQQVPALR
ID89076402      DHITPEQHPNLVGLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVNHKGQQVPALR
g.a.proteo      DHLHHSQHASLTAIMEALTRDARDRARFAGAQTSAMSLASLRATTEATMTHNGETLEVVR
ID14856061      DHLHHESHDRLQAIVRRLVERAIERADFSGADIDVLAMAAVRATREATVTEGNETLPVIV
ID22782220      DHLHHESHDRLERIATRLVGRAADRIGMSGAGLEVMALASVRATREATVNHDGHPLPVIV
                **:  ..*  :  :   :           .   . : :*:: :*  .          .: 

ID14529937      GTSL-SGEPL-----------LLFPGEVPAHIPPAQW---------WNNQ----GFDFQA
m.s.GOS_11      GTSL-SGEPL-----------LLFPGEVPSHIPPAQW---------WNNQ----GFDFQA
ID11762021      GTSL-SGESL-----------LLFPGEVPSHIPPAQW---------WNNQ----GFDFQA
IDenteroba      GYRLTDNQPL-----------VYFPGEVPKRLPEKAF---------WQKQ----GFSFES
g.enteroba      GNRLSDGEPL-----------TVYPGEVPARLPGQAF---------WQNQ----GFQFEA
ID19733696      GINT-AQQPM-----------MMFPGEVPKRIPSKAY---------WETE----PFNFMS
ID76803910      GTTL-DGEPM-----------TMFPGEVPKKLPNAAF---------WQNS----GFDFTS
ID16380071      GTTL-DGEPM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID26996291      GTTL-EGESI-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
g.g.proteo      GTTL-DGESM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID15383197      GTTL-DGESM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID15383922      GTTL-NGEAM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID28898645      GTTL-NGEAM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID91224281      GTTL-GGEPM-----------TMFPGEVPKKLPNAAY---------WQNN----GFDFTS
ID25422814      GTTL-DGEPM-----------TMFPGEVPKKLPNAAY---------WQNN----GFDFTS
ID26077605      GITL-DEQPM-----------TIFPGEVPKKLPQKSF---------WQNE----GFEFTA
ID26125319      GTTV-DEQAL-----------TVFPGEVPKKLPDQAY---------WQEQ----GFEFTA
ID26227444      GTLE-SGDPI-----------LMYPGDVPARLPNDSF---------WQNN----QFEFRQ
ID26910239      GVSM-DEQPQ-----------TLFPGEVPKRLPNESF---------WQNN----GFEFMN
ID90413058      GCNL-EGEPQ-----------TIFPGEVPRRLPNESF---------WQNN----GFDFVN
ID54309601      GCNL-EGESQ-----------TIFPGEVPRRLPNESF---------WQNN----GFDFVN
ID90579456      GVDL-SGNAQ-----------TLFPGEVPKRLPNVDF---------WQQQ----SFDFIN
ID89076402      GVDL-LGNAQ-----------TLFPGEVPKRLPNVDF---------WQQQ----SFDFIN
g.a.proteo      GSLLDTGKEA-----------AFYPGELPKD-PAHLLSPARAGAKKWLDQ----DYQIMR
ID14856061      GTPL-KGGRIDGEVFDGETETAIFPGDLPKN-PNVIFDPAL-----SQDE---PAIRFVR
ID22782220      GTPI-AGERINGDVFDGERKTAIFPGDLPED-PEVLFEGIAGGGIPAQTEHSMPELNFVR
                *                      :**::*   *                .       :  

ID14529937      FRPLAMSAHQ-----ALPHIRLDAALEFLLGDHLE
m.s.GOS_11      FRPLPMSAHQ-----ALPHIRLDAALEFLLGDHLE
ID11762021      FRPLPMSPHQ-----ALPHIRLDAALEFLLGDHLE
IDenteroba      FRPQQISRDS-----AVPHIRMDSALEFLLGDKLK
g.enteroba      FRPQIMNVDQ-----PLPHIRLDAALEFLIGDKLR
ID19733696      FQPLKNENDK-----PLQHIRMDKAIQFLLGDKLI
ID76803910      FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID16380071      FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID26996291      FRPMPSESDE-----PMKHIRLDKALEYLLGDKLK
g.g.proteo      FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID15383197      FRPMPSATDE-----PMKHIRLDKALEYLLGDKLK
ID15383922      FRPMPSASDE-----PMKHIRLDKALDYLLGDKLK
ID28898645      FRPMPSASDE-----PMKHIRLDKALDYLLGDKLK
ID91224281      FRPMPSPNDE-----PVKHIRLDKALDYLIGDKLK
ID25422814      FRPMPSPNDE-----PVKHIRLDKALDYLIGDKLK
ID26077605      FRPLPSSIDD-----PLPHIRIDKALEYLIGDKLK
ID26125319      FRPRKASSDE-----PLPHIRMDKALEFLIGDKLK
ID26227444      FRPMQTDVDE-----PLPHIRVDKALQYLLGDKVR
ID26910239      FRPLEQQSDE-----PLPHIRMDKALEFLLGDKL-
ID90413058      FRPLAQQSDE-----PLPHIRMDKALQYLLGDKLK
ID54309601      FRPLAQQSDE-----PLPHIRMDKALQYLLGDKLK
ID90579456      FRPLQQQSDE-----PLPHIRMDKALEYLLGDKLQ
ID89076402      FRPLLQQSDE-----PLPHIRMDKALEYLLGDKLQ
g.a.proteo      FAPARLNLRPGD---GPPHIRLDRAAEFLIGDRL-
ID14856061      FRPPRLERTAEGVTLSLPHIRLDRALQFLIGDRLA
ID22782220      FRPPHLEETRGGLKLSVPHIRLDRAMQFLLGDRLA
                * *               ***:* * ::*:**.: 
-------------------------------------------------------------------------------------------------

Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 26
Alignment assumed to be: Protein
New number of positions: 188 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
ID145299373      --------MIRNKLEQKWSLLQHKATDVVNRVRDRHIRLAVTGLSRSGKTAFITALVNQL
m.s.GOS_1156010  -----------------------------------MLQFVPLGVGRC-------------
ID117620218      MNGRTGQALILNKLEQQFNRLQHKANDVVNRVRDRHIRLAVTGLSRSGKTAFITALVNQL
IDenterobacteri  -----------------MKRLQNELTALINRGVDRHLRLAVTGLSRSGKTAFITSLVNQL
g.enterobacteri  ---------------MAMKRFKNELNSLVNRGVDRHLRLAVTGLSRSGKTAFITAMVNQL
ID197336969      -----------------MSKLAKEMNRWVSRSMDRHVKLAVTGLSRAGKTAFITSLVNQC
ID76803910       -----------------MKRVTQEVNDFINRGMDANVRIAVTGLSRAGKTAFITSLVNQL
ID163800710      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID269962913      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
g.g.proteobacte  -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID153831979      -----------------MKRITQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID153839223      -----------------MKRIKQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID28898645       -----------------MKRIKQEVNDFISRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID91224281       -----------------MKRIKKEVNDFINRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID254228147      -----------------MKRIKKEVNDFINRGMDSNVRIAVTGLSRAGKTAFITSLVNQL
ID260776059      -----------------MKSITQEVNDFINRSVDSHVRVAVTGLSRAGKTAFISSLVNQL
ID261253194      -----------------MKQITQEVNDLISRSMDSHVRIAVTGLSRAGKTAFISSLVNQL
ID262274447      -----------------MKSVKRQVNKWVSRGLDRHVRLAVTGLSRAGKTAFITSLINQL
ID269102390      -----------------MNRLGNEFNKWVNRGLDRHVRLAVTGLSRAGKTAFITSLVNQL
ID90413058       -----------------MNRIGNELNKLVNRSLDRHVRLAVTGLSRSGKTAFITSLINQL
ID54309601       ----MYAISRIKKIRHDMNRIGNELNKLVNRSLDRHVRLAVTGLSRSGKTAFITSLINQL
ID90579456       -----------------MNRISNELNKLVNRSLDRHVRLAVTGLSRAGKTAFITSLINQL
ID89076402       -----------------MNRISNELNKLVNRSLDRHVRLAVTGLSRAGKTAFITSLINQL
g.a.proteobacte  -----------------MENVQDGVSETF---FEPVIRLGVTGLARSGKTVFITSLVANL
ID148560616      -------MAKLTSFGDEARIALDTLTDRATGLLSPSLRLGVTGLSRAGKTVFISALVHNL
ID227822201      ------MASLLTSFKDGALIAIDNLADRAAGLVSPSLRLGVTGLSRAGKTVFISSLVHNL
                                                      #########              


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
ID145299373      EHAAIDGRLPLWDAQRQGRILGARRVPQKNAHIPTFAYERGLDALFGDPPAWPDPTRGVA
m.s.GOS_1156010  --------------------------------------------LFGEPRR---------
ID117620218      EHAAIDGRLPLWDALRQGRILGARRVPQQNAHIPTFAYERGLDALFGDPPAWPEPTRGVA
IDenterobacteri  TNVHSGARLPLFSAARNQQLLGVKRIPQHNLSIPRFTYDEAMESLYHTPPSWPVPTKGVS
g.enterobacteri  LNLHTGARLPLLSAAREERLLGVKRVPQRDFGIPRFTYDEGLAQLYGTPPSWPTPTRGVS
ID197336969      LHASTSDKLPLLSASREGRLIGAKRVPQSNLSIPSFTYDDGMDSLLSDPPTWPEPTRDVS
ID76803910       LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID163800710      LHTATHDNLPLLNAARDKRLIGAKREPQANMMVPRFAYDDAMSQIHATPPQWPVPTRDVS
ID269962913      LHTATHDNLPLLNAARDKRLIGAKREPQSNMMVPRFAYDDAMNQIHATPPQWPVPTRDVS
g.g.proteobacte  LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID153831979      LHTATHDNLPLLNAARDKRLIGAKREPQTNMMVPRFAYDDAMSQIHAMPPQWPVPTRDVS
ID153839223      LHTATHDNLPLLTAARDKRLIGAKREPQTNMMVPRFAYDEAMSQIHANPPQWPVPTRDVS
ID28898645       LHTATHDNLPLLTAARDKRLIGAKREPQTNMMVPRFAYDEAMSQIHANPPQWPVPTRDVS
ID91224281       LHTATHDNLPLLTAARDKRLIGAKREPQSNMMVPRFAYDEAMSQIHATPPQWPVPTRDVS
ID254228147      LHTATHDNLPLLTAARDKRLIGAKREPQANMMVPRFAYDEAMSQIHATPPQWPVPTRDVS
ID260776059      LHTSTHDNLPLLVSARDKRLVGAKREPQANMMVPRFAYDEAMEHVFTQPPKWPEPTRDVS
ID261253194      LHTSTHDSLPLFAASRDKRLVGAKREPQTNMMVPRFAYDDAMEHVHSTPPKWPEPTRDVS
ID262274447      LHSATNPRMPLFAPVREGRVLGARRVQQSQLHIPSFDYDLGIQSLHSRPPTWPAPTRDVS
ID269102390      LHVSTNPRLPLFTPVREGHLLGAKRVPQLDMHIPKFGYDEGMASILSTPPAWPEPTRDVS
ID90413058       LHVSTNPRLPLFTAVRDGNLLGAKRVPQRDMHVPKFGYDEGMGALLSSPPAWPEPTRDVS
ID54309601       LHVSTNPRLPLFTAVRDGNLLGAKRVPQRDMHVPKFGYDESMGSLLSSPPAWPEPTRDVS
ID90579456       LHVSTNARLPMFSAMRDGHLLGAKRVPQLDLHVPKFGYDEGMQSILSTPPEWPEPTRDVS
ID89076402       LHVSTNARLPMFSAMRDGHLLGAKRVPQLDLHVPKFGYDEGMQSIMSMPPEWPEPTRDVS
g.a.proteobacte  LD---RGRMPGLLAASEGRIEAAFLQPQPDDTVPRFEYENHLAALTGPTPHWPDSTRAIS
ID148560616      VH---GGRLPMFEAYKAGRISRALLEPQPDDAVPRFQYEEHLSALID-ERIWPDSTRAIS
ID227822201      LN---GGRLPLFEPTRSGRVSKVRLEPQPDDAVPRFQYEDHIAALVR-DRVWPDSTRAIS
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
ID145299373      EVRLEIRYRTRHPLRKHLGDISTLYVDLVDYPGEWLLDLPLLELSYEQWSEQVRDQLRRP
m.s.GOS_1156010  ------------------------------------------------------------
ID117620218      EVRLEIRYRTRHPLRKHLGEISTLYVDLVDYPGEWLLDLPLLEMSYEQWSEQVREQLRRP
IDenterobacteri  EIRLQLRYRSHESLTRFIKETSSLYLEIVDYPGEWLLDLPMLEQDYFEWSEQMNRVNQ--
g.enterobacteri  EIRLALRFRSNDSLLRHFKDTSTLYLEIVDYPGEWLLDLPMLAQDYLSWSRQMTGLLQ-G
ID197336969      ELRLAIKFKPKSGVLKHFQDSATLFVDIVDYPGEWLLDLPLLDMDYLTWSKQQQANLT-G
ID76803910       EIRLALKYKPNKATKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMNFATWSQTQFEALK-G
ID163800710      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
ID269962913      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
g.g.proteobacte  EIRLALKYKPNKTTKKLLSKTSVLNVDIIDYPGEWLLDLPLLDTDFATWSQTQFDALK-G
ID153831979      EIRLALKYKPNKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMDFATWSQTQFEALK-G
ID153839223      EIRLALKYKPKKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDLDFSSWSQTQFDALK-G
ID28898645       EIRLALKYKPKKTTKKLLSKTAVLNVDIIDYPGEWLLDLPLLDMNFSSWSQTQFDALK-G
ID91224281       EIRLALKYKPNKTTKKLLSKTAILNVDIIDYPGEWLLDLPLLDMDFATWSQTQFDALK-G
ID254228147      EIRLALKYKPNKTTKKLLSKTAILNVDIIDYPGEWLLDLPLLDMDFATWSQTQFDALK-G
ID260776059      EIRLAVKYKPTRKSKKLFGSTSTLHIDIIDYPGEWLLDLPLLDMSFHEWSQTQFAALK-G
ID261253194      EIRLALKYKPKKKTKKLFGSTSTLHIDIIDYPGEWLLDLPLLDMDFEQWSQSQFDALT-G
ID262274447      EIRLEIRYRPEKGAMKLLQDTATLYLDIVDYPGEWLLDLPLLSMSFDEWSRKQSGILT-G
ID269102390      QIRLALRYRPQKGALKYLQDTATLYLDIVDYPGEWLLDLPLLDMDFMTWSKQQALVLK-G
ID90413058       QTRLALRYKPQKGPMKLFQETATLYLDIVDYPGEWLLDLPLLDLDFMTWSKQQTKVLK-G
ID54309601       QTRLALRYKPQKGPMKLFQETATLYLDIVDYPGEWLLDLPLLDLDFMAWSKQQTKVLK-G
ID90579456       QTRLALRYKPQKGAMKLFQDTATLYLDIIDYPGEWLLDLPLLDLDFTQWSTQQSQVLK-G
ID89076402       QTRLALRYKPQKGALKLFQDTATLYLDIIDYPGEWLLDLPLLDLDFTQWSVQQSQVLK-G
g.a.proteobacte  ELRLSLRVRPN-GLLAGFQGPRTVHLDIVDYPGEWLLDLALMDVDYATWSAQVLARIA--
ID148560616      QLRLTIEYETASAWGRWLS-PGRLSVDIVDYPGEWLLDLPLLGKTYAQFSADSFALANEP
ID227822201      QLRITLDYESASGWNRMFS-AGRLSIDIVDYPGEWLLDLPLLAMDFRQFSETTVKRARIG
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
ID145299373      ELQALAAAWLA--TEWQAEQTFEERPVAELAERYTDYLHACKREL-GLHLIQPGRFVLPG
m.s.GOS_1156010  ------------------------------------------------------------
ID117620218      ELQALTAGWLA--PEWQADQGFEERPVAQLAERYTAYLHACKQEL-GLHLIQPGRFVLPG
IDenterobacteri  QRTAPVQQWQSLIKKCDPFAPADETLLAEIAAAYTEYLLACK-KQ-GLHFIQPGRFVLPG
g.enterobacteri  QRAEWSLKWQELCAGLDPLAPADENRLAAIAQAWTDYLHQCK-KE-GLHFIQPGRFVLPG
ID197336969      HRKVLSEAWLQEAKLLDPLAPVDEKQLARIADAFTDYLHTCKDEK-GLHWVQPGRFVLPG
ID76803910       QRSELAASWLTELEALDLNADLNEKQLEKVAKTYTDYLHACK-ES-GLHWVQPGRFVLPG
ID163800710      RRNELAIDWLSDLEALDVNAALDEKQLESLAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
ID269962913      QRSELAADWLAELETLDLAAELNEKQLEKVAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
g.g.proteobacte  QRSELAADWLAELDALDLAAELNEKQLEKVAKSYTDYLHACK-DS-GLHWVQPGRFVLPG
ID153831979      QRSELAVDWLAELEALDLTAELNEKQLERVAKTYTDYLHACK-DS-GLHWVQPGRFVLPG
ID153839223      KRKELAQAWLAELEQIELNADADEKQLEKVAHAYTDYLHACK-DA-GLHWVQPGRFVLPG
ID28898645       KRKELAQAWLAELEQIELNADADEKQLEKVAHAYTDYLHACK-DA-GLHWVQPGRFVLPG
ID91224281       QRGDLAKAWLSELEKVDLFAEVNEKLLEKVAHTYTEYLHSCK-DS-GLHWVQPGRFVLPG
ID254228147      QRGDLAKAWLSELEKVDLSAEVNEKLLEKVAHTYTEYLHACK-DA-GLHWVQPGRFVLPG
ID260776059      QRGELAKEWLAKLEQLNLADDVNERELEAIAQSYTQYLHDCK-DT-GLHWVQPGRFVLPG
ID261253194      KRRELAQAWLDKLDNLDISQPLNEKAIADVAQSYTEFLYECK-RE-GLHWVQPGRFVLPG
ID262274447      KRKALADEWLQAVDSFDPLADADEKLIGQIATKFTAYLHACKQEA-GLHWVQPGRFVLPG
ID269102390      KRLELAQEWMALGDEFDPFAPVDEALLEKISQAFTQYLYACKDEG-GLHWVQPGRFVLPG
ID90413058       KRLELAQEWIAMGETFDPFAPADEVLIERISAAFTDYLYKCKAEG-GLHWVQPGRFVLPG
ID54309601       KRLELAQEWMAIGETFDPFAPADEVLIERISAAFTDYLYKCKAEG-GLHWVQPGRFVLPG
ID90579456       KRLELAQNWLAKTEMFDPFAPADEKQIEEISKAFTQYLHQCKAEG-GLHWVQPGRFVLPG
ID89076402       KRLELAQNWLVKIETFDPFAPADEKQIEEISKAFTEYLHQCKAEG-GLHWVQPGRFVLPG
g.a.proteobacte  -NREEAAGYRALVEGIDPEAALDEPVAQALAASFAEYLQTARAN--GYSDCTPGRFLLPG
ID148560616      THRDLAAAWLAEAKTVAPSEKADELTAQRLARCFTDYLRAGKADERALSTLPPGRFLMPG
ID227822201      ARAALSRDWLALASASGGEMAADEGTARRLAESFTTYLRACKEDDHSLSTLPPGRFLMPG
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
ID145299373      EYAGAPMLQFVPWMWDKP-----AGEPADGSLYTTLKQRFEQYKQHLVQGFYEQHFAGFD
m.s.GOS_1156010  ---GAP-------------------------STATLKQRFEQYKLHLVQGFYEQHFAGFD
ID117620218      EYAGAPMLQFVPWVWDKP-----AQEPAEGTLYATLKQRFEQYKQHLVQGFYEQHFAGFD
IDenterobacteri  ELSGAPVLQFFPWADLTQYDSAKLKNADKKTNIGMLKKRYEYYGQHIVKGFYRDHFQGFD
g.enterobacteri  EMAGAPALQFFPWPDVDAWGESKLAMADKNTNVGMLRERFNYYCEKVVKGFYKNHFLKFD
ID197336969      ELAGAPVLQFFPFMFLHKYTEEELAKTKKGSNIAVLKQRYKHYQQNVVKKFYNDHFRHFD
ID76803910       ELEGAPVLQFFPCRFDAD------MKPAKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID163800710      ELDGAPVLQFFPCRFDAE------TKPVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID269962913      ELEGAPVLQFFPCRFDAD------VKSVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
g.g.proteobacte  ELEGAPVLQFFPCRFDAD------TKPVKGSNLAMLEARYHKYQQKVVKAFYKHHFATFD
ID153831979      ELEGAPVLQFFPCRFDAD------VKPVKGSNLAMLEARYHEYQQKVVKAFYKHHFATFD
ID153839223      ELAGAPVLQFFPCRFEPE------SKAPKGSNLAMLEARFHEYQQKVVKAFYKHHFATFD
ID28898645       ELAGAPVLQFFPCRFESE------SKAPKGSNLAMLEARFHEYQQKVVKAFYKHHFATFD
ID91224281       ELAGAPVLQFFPCRADSE------SKAPKGSNLAMLEARFQEYQQKVVKAFYKHHFATFD
ID254228147      ELGGAPVLQFFPCRADSE------SKALKGSNLAMLEARFQEYQQKVVKAFYKHHFATFD
ID260776059      ELEGAPVLQFFPCRFDEE------SKASKDSNLAMLKARYQEYQQKVVKAFYKHHFSTFD
ID261253194      ELEGAPVLQFFPCRVDDN------VKAGKGSNLAMLKARYNEYQQKVVKAFYKHHFSTFD
ID262274447      EYAGAPVLQFFPLIGN-QYGEGQLANAPRTSNYAMLKQRYDYYCQHIVKGFYQEHFSKVD
ID269102390      ELAGAPVLQFFPMIWTNKYTEQQLQEADEHSNFAMLKQRYKYYQQHIVKGFYKEHFSKFD
ID90413058       ELAGAPVLQFFPMIWEHNYTEQQLQQADEHSNIGMLKSRYKYYQQHVVKAFYRDHFSKFD
ID54309601       ELAGAPVLQFFPMIWDHNYTEQQLQQADEHSNIGMLKSRYKYYQQHVVKAFYRDHFSKFD
ID90579456       ELAGAPVLQFFPLLWNKKYTEKQLIDADESTNVGMLRNRYKYYQQHVVKAFYNDHFSKFD
ID89076402       ELAGAPVLQFFPLLWNKKYTEKQLIDADENTNVGMLRNRYKYYQQHVVKAFYNDHFSKFD
g.a.proteobacte  DLAGSPVLTFAPLPG---------GEGPRGSLLREMARRFEAYKRRVVKPFFRDHFARIN
ID148560616      DLDGSPALTFAPLPDLEP------GDFKSGSMAAMMERRYEAYKTYVVKPFFREHIARLD
ID227822201      DLEGSPALTFSPLPNLPE------GRAPKGSLWAMMERRYEAYKTHVVSPFFREHFARLD
                                                    #########################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
ID145299373      RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
m.s.GOS_1156010  RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
ID117620218      RQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLF-SPRIDKLLFVASKA
IDenterobacteri  RQIVLVDCLQPLNQGADVFNDMRQALTQLMRSFHYGKRTLLRRLF-SPCIDKLLFAATKA
g.enterobacteri  RQIVLVDCLQPLNSGPHAFNDMRLALTQLMQSFHYGQRTLFRRLF-SPVIDKLLFAATKA
ID197336969      RQIVLVDCLQPLNAGENSFNDMRQAIDQLMHSFQYGKSSLLKRLF-SPKIDKVLFAATKA
ID76803910       RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID163800710      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID269962913      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
g.g.proteobacte  RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID153831979      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDRVLFAATKA
ID153839223      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID28898645       RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID91224281       RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID254228147      RQIVLVDCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLF-SPKIDKVLFAATKA
ID260776059      RQIVLVDCLQPLNAGYESFHDMRHAIEQIMHSFRYGRSNMLKRLF-APRIDKILFAATKA
ID261253194      RQIVLVDCLQPLNAGYESFQDMRHALEQIMHSFRYGRSNLLKRLF-APRIDKILFAATKA
ID262274447      RQIVLVDTLQPLNAGPASFNDMRMALEQLMQSFRYGKSGLLRRLF-APRIDKILFAATKA
ID269102390      RQIILVDCLQPLNAGPESFNDMRQAIDQLMQSFKYGRSSLLRRMF-APRIDKVLFAATKA
ID90413058       RQIILVDCLQPLNAGTESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKS
ID54309601       RQIILVDCLQPLNAGTESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKS
ID90579456       RQIILVDCLQPLNAGPESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKA
ID89076402       RQIILVDCLQPLNAGPESFNDMRQALDQLMQSFKYGRSSLLRRLF-SPRIDKVLFAATKA
g.a.proteobacte  RQVVLVDALGAINQGPRAVEDLRAAMSDILGSFKPGRNGFLTQLLRGKRVEKILFAATKA
ID148560616      RQIVLIDAMQAMNAGGAVVADLERALTDILSCFRPGRSNLLTGLI-QRRIGRILVAATKA
ID227822201      RQIVLVDALQAINRGPEALRDLEQALADVLACFRPGTNSWLSSFL-TRRIDRVLIAATKA
                 ############################################# ##############


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
ID145299373      DHVTPEQHGPLVSLFQHLVRSGRGQARFEGITTECLALAAIKATEVGKGVANGREFPAIR
m.s.GOS_1156010  DHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIR
ID117620218      DHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIR
IDenterobacteri  DHITPDQHENLVSLLQQLIQDAKQNAIFEGISIDCMGLASIAATESGIVDHHGEKIPAVK
g.enterobacteri  DHVTVDQHANMVALLQQLVQDAWQNAAFEGISMDCLGLASVQATQSGLIDVNGEKIPALR
ID197336969      DHVTPEQHPNMVSLLQQMIYQTWQETAYEGIKMECMSIASIQATTAGMIDEDGEIFAAIS
ID76803910       DHVTPDQHPHLVSLLQQMVHPSWQTASYENIEMSCMSIASIQATTSGFIASGDKTVPALQ
ID163800710      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTTGFITSGDKSVPALQ
ID269962913      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKTVPALQ
g.g.proteobacte  DHVTPDQHPHLISLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALK
ID153831979      DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALK
ID153839223      DHVTPDQHPHLASLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFITSGDKTISALQ
ID28898645       DHVTPDQHPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFITSGDKTISALQ
ID91224281       DHITPDQHPNLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTTGFISSGDKTIPALQ
ID254228147      DHITPDQHPNLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQSTTTGFISSGDKTIPALQ
ID260776059      DHVTPEQHPNLVSLLQQMVHPAWQTASYENIEMSCISMASIQATKTGFINRGTESVPAIQ
ID261253194      DHVTPEQHPNLVSLLQQMVHPAWQSASYENIEMSCITMASIQATQAGFINKGDQAYPALQ
ID262274447      DHVTPDQHPNLVSLLQQLIHEAWQTAAFEGIDMECISLASIQATEPGLVNHQGESMAALR
ID269102390      DHVTPEQHPNLVNLLQQLVNEAWHTASFEGIEMDCVSLASIQATEPGFVNHHGQQVPALR
ID90413058       DHVTPEQHPNLVSLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVAHQGSQVPALR
ID54309601       DHVTPEQHPNLVSLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVAHQGSQVPALR
ID90579456       DHITPEQHPNLVGLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVNHKGQQVPALR
ID89076402       DHITPEQHPNLVGLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVNHKGQQVPALR
g.a.proteobacte  DHLHHSQHASLTAIMEALTRDARDRARFAGAQTSAMSLASLRATTEATMTHNGETLEVVR
ID148560616      DHLHHESHDRLQAIVRRLVERAIERADFSGADIDVLAMAAVRATREATVTEGNETLPVIV
ID227822201      DHLHHESHDRLERIATRLVGRAADRIGMSGAGLEVMALASVRATREATVNHDGHPLPVIV
                 ############################################################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
ID145299373      GTSL-SGEPL-----------LLFPGEVPAHIPPAQW---------WNNQ----GFDFQA
m.s.GOS_1156010  GTSL-SGEPL-----------LLFPGEVPSHIPPAQW---------WNNQ----GFDFQA
ID117620218      GTSL-SGESL-----------LLFPGEVPSHIPPAQW---------WNNQ----GFDFQA
IDenterobacteri  GYRLTDNQPL-----------VYFPGEVPKRLPEKAF---------WQKQ----GFSFES
g.enterobacteri  GNRLSDGEPL-----------TVYPGEVPARLPGQAF---------WQNQ----GFQFEA
ID197336969      GINT-AQQPM-----------MMFPGEVPKRIPSKAY---------WETE----PFNFMS
ID76803910       GTTL-DGEPM-----------TMFPGEVPKKLPNAAF---------WQNS----GFDFTS
ID163800710      GTTL-DGEPM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID269962913      GTTL-EGESI-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
g.g.proteobacte  GTTL-DGESM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID153831979      GTTL-DGESM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID153839223      GTTL-NGEAM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID28898645       GTTL-NGEAM-----------TMFPGEVPKKLPNAAY---------WQNS----GFDFTS
ID91224281       GTTL-GGEPM-----------TMFPGEVPKKLPNAAY---------WQNN----GFDFTS
ID254228147      GTTL-DGEPM-----------TMFPGEVPKKLPNAAY---------WQNN----GFDFTS
ID260776059      GITL-DEQPM-----------TIFPGEVPKKLPQKSF---------WQNE----GFEFTA
ID261253194      GTTV-DEQAL-----------TVFPGEVPKKLPDQAY---------WQEQ----GFEFTA
ID262274447      GTLE-SGDPI-----------LMYPGDVPARLPNDSF---------WQNN----QFEFRQ
ID269102390      GVSM-DEQPQ-----------TLFPGEVPKRLPNESF---------WQNN----GFEFMN
ID90413058       GCNL-EGEPQ-----------TIFPGEVPRRLPNESF---------WQNN----GFDFVN
ID54309601       GCNL-EGESQ-----------TIFPGEVPRRLPNESF---------WQNN----GFDFVN
ID90579456       GVDL-SGNAQ-----------TLFPGEVPKRLPNVDF---------WQQQ----SFDFIN
ID89076402       GVDL-LGNAQ-----------TLFPGEVPKRLPNVDF---------WQQQ----SFDFIN
g.a.proteobacte  GSLLDTGKEA-----------AFYPGELPKD-PAHLLSPARAGAKKWLDQ----DYQIMR
ID148560616      GTPL-KGGRIDGEVFDGETETAIFPGDLPKN-PNVIFDPAL-----SQDE---PAIRFVR
ID227822201      GTPI-AGERINGDVFDGERKTAIFPGDLPED-PEVLFEGIAGGGIPAQTEHSMPELNFVR
                 ####                   #######                         #####


                        490       500       510
                 =========+=========+=========+=====
ID145299373      FRPLAMSAHQ-----ALPHIRLDAALEFLLGDHLE
m.s.GOS_1156010  FRPLPMSAHQ-----ALPHIRLDAALEFLLGDHLE
ID117620218      FRPLPMSPHQ-----ALPHIRLDAALEFLLGDHLE
IDenterobacteri  FRPQQISRDS-----AVPHIRMDSALEFLLGDKLK
g.enterobacteri  FRPQIMNVDQ-----PLPHIRLDAALEFLIGDKLR
ID197336969      FQPLKNENDK-----PLQHIRMDKAIQFLLGDKLI
ID76803910       FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID163800710      FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID269962913      FRPMPSESDE-----PMKHIRLDKALEYLLGDKLK
g.g.proteobacte  FRPMPSETDE-----PMKHIRLDKALEYLLGDKLK
ID153831979      FRPMPSATDE-----PMKHIRLDKALEYLLGDKLK
ID153839223      FRPMPSASDE-----PMKHIRLDKALDYLLGDKLK
ID28898645       FRPMPSASDE-----PMKHIRLDKALDYLLGDKLK
ID91224281       FRPMPSPNDE-----PVKHIRLDKALDYLIGDKLK
ID254228147      FRPMPSPNDE-----PVKHIRLDKALDYLIGDKLK
ID260776059      FRPLPSSIDD-----PLPHIRIDKALEYLIGDKLK
ID261253194      FRPRKASSDE-----PLPHIRMDKALEFLIGDKLK
ID262274447      FRPMQTDVDE-----PLPHIRVDKALQYLLGDKVR
ID269102390      FRPLEQQSDE-----PLPHIRMDKALEFLLGDKL-
ID90413058       FRPLAQQSDE-----PLPHIRMDKALQYLLGDKLK
ID54309601       FRPLAQQSDE-----PLPHIRMDKALQYLLGDKLK
ID90579456       FRPLQQQSDE-----PLPHIRMDKALEYLLGDKLQ
ID89076402       FRPLLQQSDE-----PLPHIRMDKALEYLLGDKLQ
g.a.proteobacte  FAPARLNLRPGD---GPPHIRLDRAAEFLIGDRL-
ID148560616      FRPPRLERTAEGVTLSLPHIRLDRALQFLIGDRLA
ID227822201      FRPPHLEETRGGLKLSVPHIRLDRAMQFLLGDRLA
                 ###               ################ 






Parameters used
Minimum Number Of Sequences For A Conserved Position: 14
Minimum Number Of Sequences For A Flanking Position: 22
Maximum Number Of Contiguous Nonconserved Positions: 4
Minimum Length Of A Block: 5
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 6 selected block(s)
Flanks: [38  46]  [276  345]  [347  424]  [444  450]  [476  483]  [499  514]  

New number of positions in input.fasta-gb:  188  (36% of the original 515 positions)




Protein Domains

PROTOCOL

a)InterProScan / default parameters at EMBL-EBI

b)Pfam / default parameters


RESULTS ANALYSIS:


A protein domain is a part of protein sequence and structure that can evolve, function, and exist independently of the rest of the protein chain.


with Interproscan i found 1 domain in my ORF with very good e-value and that is DUF463 and Some members of this family are thought to possess an ATP-binding domain towards their N terminus.


I found similar results with pfam also with very good e-value so its confirmed that my ORF contain this domain DUF463.

as with both pfam and interproscan i go same domain so this is strong evidence that ORF is coding.

RAW RESULTS
a)InterProScan:

GOS_1156010	D3F75B84BA13BA39	235	HMMPfam	PF04317	DUF463	5	234	3e-46	T	27-Dec-2009	IPR007413	Protein of unknown function DUF463, YcjX-like protein	
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
b)Pfam:

DUF463: domain 1 of 1, from 1 to 234: score 51.2, E = 7.8e-18
                   *->mnrvrkElntlinRGtGLlDrhLRLAVTGLSRsGKTAFITsLVNQLL
                             + +++  G                                
  GOS_115601     1    -------MLQFVPLG-------------------------------- 8    

                   hinsharQnLPLfeAaRegrilgvKRvpQsdlaVPRFdYeenlaeLvqdP
                       ++r                                      L + P
  GOS_115601     9 ----VGR-------------------------------------CLFGEP 17   

                   PaWPdsTRgVSEiRLAIrYksnsgllRhlkesgTLYLDIvDYPGEWLLDL
                                                                     
  GOS_115601     - -------------------------------------------------- -    

                   PLLeldYaqWSreAmekatlgvReeLakaWraaveeLDlsaeAdEdtLAr
                              r                                      
  GOS_115601    18 -----------RR------------------------------------- 19   

                   iAasyTDYLhaCKLDeqGLhfiQPGRFVLPGdLEGAPALQFFPllhlste
                                                     GAP             
  GOS_115601    20 ----------------------------------GAP------------- 22   

                   gwakLdqrsKqgSyfAmLtrRYeyYrnkVVKaFYkdyFstFDRQIVLvDC
                             +    A L++R+e Y+ + V +FY+ +F+ FDRQIVLvDC
  GOS_115601    23 ----------S---TATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDC 59   

                   LqPLNhGpqAFlDMrrALtQllksFhYGrrtLLtRLFSPrIDkllFaATK
                   LqPLN+G  +F DM++A+  +++sF YG+++  +RLFSPrIDkllF+A K
  GOS_115601    60 LQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASK 109  

                   ADHvThdQhpNLVSLlrQLiqeAwqhaaFEGIdmdcvamAaVRATrsGiv
                   ADHvT++Qh  +VSLl+ L+  +   a FEGI ++c+a+Aa++AT+ G  
  GOS_115601   110 ADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKG 159  

                   nQggekipAirGvrlaDEKinGEtFDGkqeiTlyPGeVPsKLDAvFEvsE
                      g ++pAirG+ l+           ++++ l+PGeVPs +        
  GOS_115601   160 VADGREFPAIRGTSLS-----------GEPLLLFPGEVPSHI-------- 190  

                   PdqrfWqkQpaFdFdaFrPqpleRtdEGvtLslPHiRlDaaLqFLiGDkL
                   P ++ W  Q+ FdF aFrP+p+          lPHiRlDaaL+FL+GD+L
  GOS_115601   191 PPAQWWNNQG-FDFQAFRPLPMS-AHQ----ALPHIRLDAALEFLLGDHL 234  

                   <-*
                      
  GOS_115601

Phylogeny

PROTOCOL

Phylogeny.fr / PhyML method / bootstrap / default substitution model / out group: a-protobacteria and enterobacteria


RESULTS ANALYSIS:

i made phylogenetic tree using bootstraping technique and tree is coherent with the reference phylogeny of species. and metagenomic sequence appear to belong with g-proteobacteria.



RAW RESULTS

                                      +-----------------gi_a-proteobacteria2_148560616_ref_YP_001258974.1_hypothetical_p
                       +--------------+
                       |              +---------------gi_a-proteobacteria3_227822201_ref_YP_002826172.1_hypothetical_p
 +---------------------+
 |                     +---------------------------gi_a-proteobacteria1_83954541_ref_ZP_00963252.1_hypothetical_pro
 |
 |                                              +-gi_g-proteobacteria2_145299373_ref_YP_001142214.1_hypothetical_p
 |                                              |
 |                 +----------------------------++---my-sequence_GOS_1156010_Translation_39-743_indirect_strand
 |                 |                            ||
 |                 |                            ++
 |                 |                             +gi_g-proteobacteria1_117620218_ref_YP_856412.1_amino_acid_regula
 |                 |
 |                 |                    +-----------gi_enterobacteria1_197285231_ref_YP_002151103.1_ATP-binding_prot
 |                 |         +----------+
 +-----------------+      +--+          +---------------gi_enterobacteria2_146311806_ref_YP_001176880.1_protein_of_unkno
                   |      |  |
                   |      |  +-------------gi_g-proteobacteria17_262274447_ref_ZP_06052258.1_putative_ATPas
                   |      |
                   |      |    +----gi_g-proteobacteria3_269102390_ref_ZP_06155087.1_putative_ATPase
                   |      |    |
                   |      |    |       +gi_g-proteobacteria4_90413058_ref_ZP_01221055.1_putative_ATPase
                   +------++---+  +----+
                          ||   |  |    +gi_g-proteobacteria7_54309601_ref_YP_130621.1_putative_ATPase_Ph
                          ||   +--+
                          ||      |  +gi_g-proteobacteria10_90579456_ref_ZP_01235265.1_putative_ATPase
                          ||      +--+
                          ||         |
                          ++         +gi_g-proteobacteria18_89076402_ref_ZP_01162731.1_putative_ATPase
                           |
                           |     +-------------------gi_g-proteobacteria20_197336969_ref_YP_002157907.1_amino_acid_re
                           |     |
                           |     |              +---gi_g-proteobacteria5_260776059_ref_ZP_05884954.1_putative_ATP-bi
                           |     |         +----+
                           +-----+         |    +----gi_g-proteobacteria19_261253194_ref_ZP_05945767.1_putative_ATP-b
                                 |         |
                                 |         |        +gi_g-proteobacteria12_153839223_ref_ZP_01991890.1_amino_acid_reg
                                 |         |       ++
                                 +---------+       |+gi_g-proteobacteria16_28898645_ref_NP_798250.1_hypothetical_prot
                                           |     +-+
                                           |     | | +gi_g-proteobacteria13_91224281_ref_ZP_01259543.1_hypothetical_pr
                                           |     | +-+
                                           |     |   +gi_g-proteobacteria14_254228147_ref_ZP_04921576.1_amino_acid_reg
                                           +-----+
                                                 |
                                                 |+gi_g-proteobacteria6_163800710_ref_ZP_02194610.1_asparaginyl-tRN
                                                 ||
                                                 +++-gi_g-proteobacteria11_156974202_ref_YP_001445109.1_hypothetical
                                                  |+
                                                  |+gi_g-proteobacteria9_153831979_ref_ZP_01984646.1_amino_acid_regu
                                                  |
                                                  |+-gi_g-proteobacteria8_76803910_gb_ABA55853.1_hypothetical_protein
                                                  ++
                                                   +gi_g-proteobacteria15_269962913_ref_ZP_06177252.1_conserved_hypo

Taxonomy report

PROTOCOL

1) BLASTp vs SWISSPROT/ NCBI default parameters

2) BLASTp versus NR / NCBI default parameters apart from "Max target sequences_500"



RESULTS ANALYSIS



Ingroup: g-proteobacteria


ref|YP_856412.1| amino acid regulated cytosolic protein [Aero... 429 1e-118 Gene info

ref|YP_001142214.1| hypothetical protein ASA_2422 [Aeromonas ... 427 5e-118 Gene info

ref|ZP_06155087.1| putative ATPase [Photobacterium damselae s... 259 2e-67

ref|ZP_01221055.1| putative ATPase [Photobacterium profundum ... 257 9e-67

ref|ZP_05884954.1| putative ATP-binding protein [Vibrio coral... 255 2e-66

ref|ZP_02194610.1| asparaginyl-tRNA synthetase [Vibrio sp. AN... 254 4e-66

ref|YP_130621.1| putative ATPase [Photobacterium profundum SS... 254 5e-66 Gene info

gb|ABA55853.1| hypothetical protein [Vibrio sp. DAT722] 253 1e-65

ref|ZP_01984646.1| amino acid regulated cytosolic protein [Vi... 251 3e-65

ref|ZP_01235265.1| putative ATPase [Vibrio angustum S14] >gb|... 251 3e-65

ref|YP_001445109.1| hypothetical protein VIBHAR_01917 [Vibrio... 250 7e-65 Gene info

ref|ZP_01991890.1| amino acid regulated cytosolic protein [Vi... 250 1e-64

ref|ZP_01259543.1| hypothetical protein V12G01_16627 [Vibrio ... 249 1e-64

ref|ZP_04921576.1| amino acid regulated cytosolic protein [Vi... 249 2e-64 Gene info

ref|ZP_06177252.1| conserved hypothetical protein [Vibrio har... 249 2e-64

ref|NP_798250.1| hypothetical protein VP1871 [Vibrio parahaem... 248 2e-64 Gene info

ref|ZP_06052258.1| putative ATPase [Grimontia hollisae CIP 10... 248 3e-64

ref|ZP_01162731.1| putative ATPase [Photobacterium sp. SKA34]... 248 4e-64

ref|ZP_05945767.1| putative ATP-binding protein [Vibrio orien... 244 7e-63

ref|YP_002157907.1| amino acid regulated cytosolic protein [V... 243 8e-63 Gene info




Outgroup: enterobacteria and a-proteobacteria


ref|YP_002151103.1| ATP-binding protein [Proteus mirabilis HI... 252 2e-65 Gene info

ref|YP_001176880.1| protein of unknown function DUF463, YcjX ... 248 5e-64 Gene info

ref|YP_002826172.1| hypothetical protein NGR_c16540 [Rhizob..... 140 1e-31 Gene info

ref|YP_001258974.1| hypothetical protein BOV_1000 [Brucella .... 140 1e-31 Gene info

ref|ZP_00963252.1| hypothetical protein NAS141_15008 [Sulfito... 140 1e-31





RAW RESULTS:

1) BLASTp vs SWISSPROT:

Lineage Report

cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Gammaproteobacteria [g-proteobacteria]
. . . . Enterobacteriaceae  [enterobacteria]
. . . . . Escherichia coli K-12 -----------------------------  241 1 hit  [enterobacteria]    RecName: Full=Uncharacterized protein ycjX
. . . . . Pectobacterium carotovorum subsp. carotovorum PC1 .   30 1 hit  [enterobacteria]    RecName: Full=UPF0176 protein PC1_2519
. . . . Haemophilus influenzae ------------------------------  201 1 hit  [g-proteobacteria]  RecName: Full=Uncharacterized protein HI1637
. . . Geobacter sp. M21 -------------------------------------   32 1 hit  [d-proteobacteria]  RecName: Full=Probable O-sialoglycoprotein endopeptidase; S
. . . Methylobacterium extorquens PA1 .......................   30 1 hit  [a-proteobacteria]  RecName: Full=Sulfate adenylyltransferase subunit 1; AltNam
. . . Methylobacterium chloromethanicum CM4 .................   30 1 hit  [a-proteobacteria]  RecName: Full=Sulfate adenylyltransferase subunit 1; AltNam
. . . Methylobacterium populi BJ001 .........................   30 1 hit  [a-proteobacteria]  RecName: Full=Sulfate adenylyltransferase subunit 1; AltNam
. . Lactobacillus casei BL23 --------------------------------   32 1 hit  [firmicutes]        RecName: Full=Ribosomal protein L11 methyltransferase; Shor
. . Lactobacillus casei ATCC 334 ............................   31 1 hit  [firmicutes]        RecName: Full=Ribosomal protein L11 methyltransferase; Shor
. Drosophila melanogaster -----------------------------------   35 1 hit  [flies]             RecName: Full=Retrovirus-related Gag polyprotein from trans
. Sinapis alba (bai jie) ....................................   32 1 hit  [eudicots]          RecName: Full=DNA-directed RNA polymerase subunit beta''; A
. Arabidopsis thaliana (thale-cress) ........................   31 1 hit  [eudicots]          RecName: Full=Isoamylase 3, chloroplastic; Short=AtISA3; Fl
. Debaryomyces hansenii .....................................   31 1 hit  [ascomycetes]       RecName: Full=Crossover junction endonuclease MUS81



----------------------------------------------------------------------------------------------------------------------------------------------
2) BLASTp versus NR:

Lineage Report

Proteobacteria      [proteobacteria]
. Gammaproteobacteria [g-proteobacteria]
. . Aeromonadaceae      [g-proteobacteria]
. . . Aeromonas           [g-proteobacteria]
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 ---------------------  429 2 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Aeromonas hydrophil
. . . . Aeromonas salmonicida subsp. salmonicida A449 ........................  427 2 hits [g-proteobacteria]  hypothetical protein ASA_2422 [Aeromonas salmonicida subsp.
. . . Tolumonas auensis DSM 9187 ---------------------------------------------  238 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Tol
. . Photobacterium damselae subsp. damselae CIP 102761 -----------------------  259 2 hits [g-proteobacteria]  putative ATPase [Photobacterium damselae subsp. damselae CI
. . Photobacterium profundum 3TCK ............................................  257 2 hits [g-proteobacteria]  putative ATPase [Photobacterium profundum 3TCK] >gi|9032590
. . Vibrio coralliilyticus ATCC BAA-450 ......................................  255 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio coralliilyticus ATCC B
. . Vibrio sp. AND4 ..........................................................  254 2 hits [g-proteobacteria]  asparaginyl-tRNA synthetase [Vibrio sp. AND4] >gi|159175059
. . Photobacterium profundum SS9 .............................................  254 2 hits [g-proteobacteria]  putative ATPase [Photobacterium profundum SS9] >gi|46914039
. . Vibrio sp. DAT722 ........................................................  253 1 hit  [g-proteobacteria]  hypothetical protein [Vibrio sp. DAT722]
. . Proteus mirabilis HI4320 .................................................  252 2 hits [enterobacteria]    ATP-binding protein [Proteus mirabilis HI4320] >gi|22735565
. . Proteus mirabilis ATCC 29906 .............................................  252 2 hits [enterobacteria]    ATP-binding protein [Proteus mirabilis HI4320] >gi|22735565
. . Vibrio harveyi HY01 ......................................................  251 2 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio harveyi HY01
. . Photobacterium angustum S14 ..............................................  251 2 hits [g-proteobacteria]  putative ATPase [Vibrio angustum S14] >gi|90439030|gb|EAS64
. . Vibrio harveyi ATCC BAA-1116 .............................................  250 2 hits [g-proteobacteria]  hypothetical protein VIBHAR_01917 [Vibrio harveyi ATCC BAA-
. . Vibrio parahaemolyticus AQ3810 ...........................................  250 2 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio parahaemolyt
. . Vibrio parahaemolyticus AQ4037 ...........................................  250 1 hit  [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio parahaemolyt
. . Vibrio alginolyticus 12G01 ...............................................  249 2 hits [g-proteobacteria]  hypothetical protein V12G01_16627 [Vibrio alginolyticus 12G
. . Vibrio alginolyticus 40B .................................................  249 2 hits [g-proteobacteria]  hypothetical protein V12G01_16627 [Vibrio alginolyticus 12G
. . Vibrio sp. Ex25 ..........................................................  249 4 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio sp. Ex25] >g
. . Vibrio harveyi 1DA3 ......................................................  249 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio harveyi 1DA3] >gi|26
. . Vibrio parahaemolyticus RIMD 2210633 .....................................  248 2 hits [g-proteobacteria]  hypothetical protein VP1871 [Vibrio parahaemolyticus RIMD 2
. . Vibrio parahaemolyticus K5030 ............................................  248 1 hit  [g-proteobacteria]  hypothetical protein VP1871 [Vibrio parahaemolyticus RIMD 2
. . Vibrio parahaemolyticus AN-5034 ..........................................  248 1 hit  [g-proteobacteria]  hypothetical protein VP1871 [Vibrio parahaemolyticus RIMD 2
. . Vibrio parahaemolyticus Peru-466 .........................................  248 1 hit  [g-proteobacteria]  hypothetical protein VP1871 [Vibrio parahaemolyticus RIMD 2
. . Grimontia hollisae CIP 101886 ............................................  248 2 hits [g-proteobacteria]  putative ATPase [Grimontia hollisae CIP 101886] >gi|2622210
. . Photobacterium sp. SKA34 .................................................  248 2 hits [g-proteobacteria]  putative ATPase [Photobacterium sp. SKA34] >gi|89047918|gb|
. . Enterobacter sp. 638 .....................................................  248 2 hits [enterobacteria]    protein of unknown function DUF463, YcjX family protein [En
. . Providencia rettgeri DSM 1131 ............................................  247 1 hit  [enterobacteria]    hypothetical protein PretD1_17529 [Providencia rettgeri DSM
. . Providencia rustigianii DSM 4541 .........................................  246 2 hits [enterobacteria]    hypothetical protein PROVRUST_05148 [Providencia rustigiani
. . Enterobacter cancerogenus ATCC 35316 .....................................  244 1 hit  [enterobacteria]    hypothetical protein EcanA3_05940 [Enterobacter cancerogenu
. . Vibrio orientalis CIP 102891 .............................................  244 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio orientalis CIP 102891]
. . Vibrio fischeri MJ11 .....................................................  243 2 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio fischeri MJ1
. . Proteus penneri ATCC 35198 ...............................................  243 2 hits [enterobacteria]    hypothetical protein PROPEN_04205 [Proteus penneri ATCC 351
. . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  243 2 hits [enterobacteria]    putative ATPase [Salmonella enterica subsp. enterica serova
. . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  243 2 hits [enterobacteria]    putative ATPase [Salmonella enterica subsp. enterica serova
. . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  243 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar Heidelber
. . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  243 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar Heidelber
. . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  243 2 hits [enterobacteria]    putative ATPase [Salmonella typhimurium LT2] >gi|16420212|g
. . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  243 1 hit  [enterobacteria]    putative ATPase [Salmonella typhimurium LT2] >gi|16420212|g
. . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  243 1 hit  [enterobacteria]    putative ATPase [Salmonella typhimurium LT2] >gi|16420212|g
. . Vibrio fischeri ES114 ....................................................  243 2 hits [g-proteobacteria]  hypothetical protein VF_A0314 [Vibrio fischeri ES114] >gi|5
. . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  243 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar 4,[5],12:
. . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  243 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar 4,[5],12:
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Citrobacter sp. 30_2 .....................................................  243 2 hits [enterobacteria]    conserved hypothetical protein [Citrobacter sp. 30_2] >gi|2
. . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  243 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Typhi ........................  243 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  242 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  242 2 hits [enterobacteria]    hypothetical protein plu2582 [Photorhabdus luminescens subs
. . Aliivibrio salmonicida LFI1238 ...........................................  242 2 hits [g-proteobacteria]  hypothetical protein VSAL_II0484 [Aliivibrio salmonicida LF
. . Citrobacter rodentium ICC168 .............................................  242 1 hit  [enterobacteria]    putative ATP-binding protein [Citrobacter rodentium ICC168]
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  241 1 hit  [enterobacteria]    hypothetical protein SentesTyph_16143 [Salmonella enterica 
. . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  241 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar Newport s
. . Escherichia coli SE15 ....................................................  241 1 hit  [enterobacteria]    conserved hypothetical protein [Escherichia coli SE15]
. . Shigella dysenteriae Sd197 ...............................................  241 2 hits [enterobacteria]    putative YcjX [Shigella dysenteriae Sd197] >gi|81240833|gb|
. . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  241 2 hits [enterobacteria]    putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MG
. . Klebsiella pneumoniae NTUH-K2044 .........................................  241 2 hits [enterobacteria]    putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MG
. . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  241 2 hits [enterobacteria]    putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MG
. . Escherichia coli 536 .....................................................  241 2 hits [enterobacteria]    hypothetical protein ECP_1374 [Escherichia coli 536] >gi|11
. . Shigella dysenteriae 1012 ................................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Shigella dysenteriae 1012] 
. . Shigella sonnei Ss046 ....................................................  241 2 hits [enterobacteria]    putative enzyme [Shigella sonnei Ss046] >gi|73855790|gb|AAZ
. . Shigella boydii Sb227 ....................................................  241 2 hits [enterobacteria]    YcjX [Shigella boydii Sb227] >gi|187732603|ref|YP_001880154
. . Shigella boydii CDC 3083-94 ..............................................  241 2 hits [enterobacteria]    YcjX [Shigella boydii Sb227] >gi|187732603|ref|YP_001880154
. . Escherichia coli 55989 ...................................................  241 2 hits [enterobacteria]    YcjX [Shigella boydii Sb227] >gi|187732603|ref|YP_001880154
. . Escherichia coli UMN026 ..................................................  241 2 hits [enterobacteria]    YcjX [Shigella boydii Sb227] >gi|187732603|ref|YP_001880154
. . Escherichia coli E24377A .................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli B7A .....................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli E110019 .................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli B171 ....................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli SE11 ....................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli IAI1 ....................................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli O103:H2 str. 12009 ......................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli O26:H11 str. 11368 ......................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia coli O111:H- str. 11128 ......................................  241 2 hits [enterobacteria]    hypothetical protein EcE24377A_1532 [Escherichia coli E2437
. . Escherichia albertii TW07627 .............................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Escherichia albertii TW0762
. . Shigella dysenteriae .....................................................  241 1 hit  [enterobacteria]    YcjX [Shigella dysenteriae]
. . Escherichia coli E22 .....................................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Escherichia coli E22] >gi|1
. . Escherichia coli DH1 .....................................................  241 1 hit  [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Esc
. . Escherichia coli 101-1 ...................................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Escherichia coli 101-1] >gi
. . Escherichia coli BL21(DE3) ...............................................  241 4 hits [enterobacteria]    conserved hypothetical protein [Escherichia coli 101-1] >gi
. . Escherichia coli B str. REL606 ...........................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Escherichia coli 101-1] >gi
. . Escherichia coli str. K-12 substr. MG1655 ................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli str. K-12 substr. W3110 .................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli HS ......................................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli ATCC 8739 ...............................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli str. K-12 substr. DH10B .................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli 53638 ...................................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli BW2952 ..................................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia sp. 4_1_40B ..................................................  241 1 hit  [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli K-12 ....................................................  241 1 hit  [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Escherichia coli O157:H7 EDL933 ..........................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. Sakai ......................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4113 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4401 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4501 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4486 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4196 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4076 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC869 ......................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC508 ......................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4024 .....................................  241 1 hit  [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4206 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4045 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4042 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. EC4115 .....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. TW14588 ....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. TW14359 ....................................  241 2 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. FRIK2000 ...................................  241 1 hit  [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli O157:H7 str. FRIK966 ....................................  241 1 hit  [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli .........................................................  241 5 hits [enterobacteria]    hypothetical protein Z2458 [Escherichia coli O157:H7 EDL933
. . Escherichia coli IAI39 ...................................................  241 2 hits [enterobacteria]    conserved hypothetical protein; putative nucleoside triphos
. . Escherichia coli SMS-3-5 .................................................  241 2 hits [enterobacteria]    hypothetical protein EcSMS35_1801 [Escherichia coli SMS-3-5
. . Escherichia coli O127:H6 str. E2348/69 ...................................  241 2 hits [enterobacteria]    conserved protein with nucleoside triphosphate hydrolase do
. . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  241 2 hits [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Escherichia fergusonii ATCC 35469 ........................................  241 2 hits [enterobacteria]    conserved hypothetical protein; putative nucleoside triphos
. . Escherichia coli F11 .....................................................  241 2 hits [enterobacteria]    conserved hypothetical protein [Escherichia coli F11] >gi|1
. . Escherichia coli ED1a ....................................................  241 2 hits [enterobacteria]    conserved hypothetical protein; putative nucleoside triphos
. . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  241 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar Kentucky 
. . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  241 2 hits [enterobacteria]    YcjX [Salmonella enterica subsp. enterica serovar Kentucky 
. . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  241 2 hits [enterobacteria]    hypothetical protein SARI_01296 [Salmonella enterica subsp.
. . Citrobacter koseri ATCC BAA-895 ..........................................  241 2 hits [enterobacteria]    hypothetical protein CKO_01391 [Citrobacter koseri ATCC BAA
. . Klebsiella pneumoniae 342 ................................................  241 2 hits [enterobacteria]    hypothetical protein KPK_3111 [Klebsiella pneumoniae 342] >
. . Klebsiella variicola At-22 ...............................................  241 2 hits [enterobacteria]    hypothetical protein KPK_3111 [Klebsiella pneumoniae 342] >
. . Escherichia coli S88 .....................................................  241 2 hits [enterobacteria]    conserved hypothetical protein; putative nucleoside triphos
. . Vibrio parahaemolyticus 16 ...............................................  241 2 hits [g-proteobacteria]  amino acid regulated cytosolic protein [Vibrio parahaemolyt
. . Shigella sp. D9 ..........................................................  240 1 hit  [enterobacteria]    hypothetical protein ShiD9_05907 [Shigella sp. D9]
. . Escherichia coli 83972 ...................................................  240 2 hits [enterobacteria]    ATPase [Escherichia coli 83972] >gi|227836447|gb|EEJ46913.1
. . Escherichia coli APEC O1 .................................................  240 2 hits [enterobacteria]    hypothetical protein APECO1_474 [Escherichia coli APEC O1] 
. . Escherichia sp. 3_2_53FAA ................................................  240 2 hits [enterobacteria]    hypothetical protein APECO1_474 [Escherichia coli APEC O1] 
. . Vibrio vulnificus YJ016 ..................................................  240 2 hits [g-proteobacteria]  ATPase [Vibrio vulnificus YJ016] >gi|37199008|dbj|BAC94841.
. . Escherichia coli CFT073 ..................................................  239 2 hits [enterobacteria]    hypothetical protein c1793 [Escherichia coli CFT073] >gi|26
. . Shigella flexneri 5 str. 8401 ............................................  238 2 hits [enterobacteria]    hypothetical protein SFV_1337 [Shigella flexneri 5 str. 840
. . Escherichia coli UTI89 ...................................................  238 2 hits [enterobacteria]    hypothetical protein UTI89_C1592 [Escherichia coli UTI89] >
. . Vibrio vulnificus CMCP6 ..................................................  238 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio vulnificus CMCP6] >gi|
. . Serratia proteamaculans 568 ..............................................  237 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Ser
. . Serratia odorifera 4Rx13 .................................................  236 2 hits [enterobacteria]    hypothetical protein SOD_b02800 [Serratia odorifera 4Rx13] 
. . Edwardsiella tarda EIB202 ................................................  236 2 hits [enterobacteria]    predicted ATPase [Edwardsiella tarda EIB202] >gi|267984871|
. . Vibrio shilonii AK1 ......................................................  235 2 hits [g-proteobacteria]  hypothetical protein VSAK1_07149 [Vibrio shilonii AK1] >gi|
. . Vibrio splendidus 12B01 ..................................................  234 2 hits [g-proteobacteria]  hypothetical protein V12B01_03938 [Vibrio splendidus 12B01]
. . Yersinia rohdei ATCC 43380 ...............................................  234 2 hits [enterobacteria]    hypothetical protein yrohd0001_27040 [Yersinia rohdei ATCC 
. . Vibrio sp. MED222 ........................................................  234 2 hits [g-proteobacteria]  hypothetical protein MED222_16166 [Vibrio sp. MED222] >gi|8
. . Cronobacter sakazakii ATCC BAA-894 .......................................  234 2 hits [enterobacteria]    hypothetical protein ESA_01652 [Enterobacter sakazakii ATCC
. . Cronobacter turicensis ...................................................  234 1 hit  [enterobacteria]    Uncharacterized protein ycjX [Cronobacter turicensis] >gi|2
. . Cronobacter turicensis z3032 .............................................  234 1 hit  [enterobacteria]    Uncharacterized protein ycjX [Cronobacter turicensis] >gi|2
. . Yersinia mollaretii ATCC 43969 ...........................................  234 2 hits [enterobacteria]    hypothetical protein ymoll0001_22300 [Yersinia mollaretii A
. . Yersinia ruckeri ATCC 29473 ..............................................  234 2 hits [enterobacteria]    hypothetical protein yruck0001_13200 [Yersinia ruckeri ATCC
. . Vibrio splendidus LGP32 ..................................................  234 2 hits [g-proteobacteria]  hypothetical protein VS_1795 [Vibrio splendidus LGP32] >gi|
. . Erwinia pyrifoliae Ep1/96 ................................................  233 2 hits [enterobacteria]    hypothetical protein EpC_17100 [Erwinia pyrifoliae Ep1/96] 
. . Shigella flexneri 2a str. 301 ............................................  233 2 hits [enterobacteria]    putative enzyme [Shigella flexneri 2a str. 301] >gi|3006283
. . Shigella flexneri 2a str. 2457T ..........................................  233 2 hits [enterobacteria]    putative enzyme [Shigella flexneri 2a str. 301] >gi|3006283
. . Shigella flexneri 2002017 ................................................  233 1 hit  [enterobacteria]    hypothetical protein SFxv_1503 [Shigella flexneri 2002017]
. . Vibrionales bacterium SWAT-3 .............................................  233 2 hits [g-proteobacteria]  hypothetical protein VSWAT3_05666 [Vibrionales bacterium SW
. . Photorhabdus asymbiotica .................................................  233 2 hits [enterobacteria]    hypothetical protein PAU_01953 [Photorhabdus asymbiotica] >
. . Erwinia tasmaniensis Et1/99 ..............................................  233 2 hits [enterobacteria]    Putative ATP-binding protein [Erwinia tasmaniensis Et1/99] 
. . Providencia stuartii ATCC 25827 ..........................................  232 2 hits [enterobacteria]    hypothetical protein PROSTU_02332 [Providencia stuartii ATC
. . Yersinia frederiksenii ATCC 33641 ........................................  232 2 hits [enterobacteria]    hypothetical protein yfred0001_6670 [Yersinia frederiksenii
. . Yersinia pseudotuberculosis IP 31758 .....................................  232 2 hits [enterobacteria]    hypothetical protein YpsIP31758_1790 [Yersinia pseudotuberc
. . Yersinia pseudotuberculosis YPIII ........................................  232 2 hits [enterobacteria]    hypothetical protein YpsIP31758_1790 [Yersinia pseudotuberc
. . Yersinia pseudotuberculosis PB1/+ ........................................  232 2 hits [enterobacteria]    hypothetical protein YpsIP31758_1790 [Yersinia pseudotuberc
. . Edwardsiella ictaluri 93-146 .............................................  232 2 hits [enterobacteria]    hypothetical protein NT01EI_1836 [Edwardsiella ictaluri 93-
. . Yersinia bercovieri ATCC 43970 ...........................................  231 2 hits [enterobacteria]    hypothetical protein yberc0001_22690 [Yersinia bercovieri A
. . Yersinia intermedia ATCC 29909 ...........................................  231 2 hits [enterobacteria]    hypothetical protein yinte0001_17540 [Yersinia intermedia A
. . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  231 2 hits [enterobacteria]    hypothetical protein YE2118 [Yersinia enterocolitica subsp.
. . Yersinia enterocolitica ..................................................  231 1 hit  [enterobacteria]    hypothetical protein YE2118 [Yersinia enterocolitica subsp.
. . Yersinia pestis D182038 ..................................................  231 1 hit  [enterobacteria]    hypothetical protein YPD8_1450 [Yersinia pestis D182038]
. . Dickeya zeae Ech1591 .....................................................  231 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Dic
. . Yersinia pestis KIM 10 ...................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Microtus str. 91001 ...............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pseudotuberculosis IP 32953 .....................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis Antiqua ..................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis Nepal516 .................................................  231 4 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis CA88-4125 ................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis Angola ...................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Orientalis str. F1991016 ..........................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Orientalis str. IP275 .............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Antiqua str. E1979001 .............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Antiqua str. B42003004 ............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis FV-1 .....................................................  231 1 hit  [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis CO92 .....................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Orientalis str. PEXU2 .............................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis Pestoides A ..............................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis biovar Orientalis str. India 195 .........................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia pestis KIM D27 ..................................................  231 2 hits [enterobacteria]    hypothetical protein y1984 [Yersinia pestis KIM] >gi|454419
. . Yersinia aldovae ATCC 35236 ..............................................  231 2 hits [enterobacteria]    hypothetical protein yaldo0001_14900 [Yersinia aldovae ATCC
. . Dickeya dadantii Ech703 ..................................................  230 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Dic
. . Yersinia pestis Pestoides F ..............................................  230 2 hits [enterobacteria]    hypothetical protein YPDSF_0795 [Yersinia pestis Pestoides 
. . Vibrio mimicus VM573 .....................................................  230 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio mimicus VM573] >gi|2
. . Vibrio sp. RC341 .........................................................  230 2 hits [g-proteobacteria]  predicted ATPase [Vibrio sp. RC341] >gi|260839942|gb|EEX665
. . Yersinia kristensenii ATCC 33638 .........................................  229 2 hits [enterobacteria]    hypothetical protein ykris0001_41970 [Yersinia kristensenii
. . Pectobacterium wasabiae WPP163 ...........................................  229 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Pec
. . Providencia alcalifaciens DSM 30120 ......................................  228 2 hits [enterobacteria]    hypothetical protein PROVALCAL_03121 [Providencia alcalifac
. . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  228 1 hit  [enterobacteria]    hypothetical protein PcarbP_02787 [Pectobacterium carotovor
. . Dickeya dadantii Ech586 ..................................................  228 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Dic
. . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  228 2 hits [enterobacteria]    hypothetical protein PC1_2327 [Pectobacterium carotovorum s
. . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  227 1 hit  [enterobacteria]    hypothetical protein PcarcW_03224 [Pectobacterium carotovor
. . Vibrio sp. RC586 .........................................................  226 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio sp. RC586] >gi|2623511
. . Vibrio mimicus VM223 .....................................................  226 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio mimicus VM223] >gi|262
. . Vibrio cholerae CT 5369-93 ...............................................  226 2 hits [g-proteobacteria]  predicted ATPase [Vibrio cholerae CT 5369-93] >gi|262033175
. . Vibrio mimicus VM603 .....................................................  226 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio mimicus VM603] >gi|2
. . Vibrio cholerae 1587 .....................................................  226 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae 1587] >gi|1
. . Vibrio cholerae TMA 21 ...................................................  225 2 hits [g-proteobacteria]  hypothetical protein VCB_003340 [Vibrio cholerae TMA 21] >g
. . Vibrio cholerae AM-19226 .................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae AM-19226] >
. . Vibrio cholerae RC385 ....................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae RC385] >gi|
. . Vibrio cholerae MZO-2 ....................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|
. . Vibrio cholerae bv. albensis VL426 .......................................  225 2 hits [g-proteobacteria]  hypothetical protein VCA_003544 [Vibrio cholerae bv. albens
. . Vibrio furnissii CIP 102972 ..............................................  225 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio furnissii CIP 102972] 
. . Vibrio cholerae V51 ......................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae V51] >gi|12
. . Pectobacterium atrosepticum SCRI1043 .....................................  225 2 hits [enterobacteria]    hypothetical protein ECA1986 [Pectobacterium atrosepticum S
. . Vibrio cholerae 623-39 ...................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae 623-39] >gi
. . Vibrio cholerae TM 11079-80 ..............................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae 623-39] >gi
. . Vibrio cholerae 12129(1) .................................................  225 2 hits [g-proteobacteria]  hypothetical protein VCG_002707 [Vibrio cholerae 12129(1)] 
. . Vibrio cholerae MZO-3 ....................................................  225 2 hits [g-proteobacteria]  conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|
. . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae 2740-80 ..................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae V52 ......................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae O395 .....................................................  224 3 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae NCTC 8457 ................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae B33 ......................................................  224 4 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae M66-2 ....................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae BX 330286 ................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae RC9 ......................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae MJ-1236 ..................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae MO10 .....................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholera CIRS 101 ..................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae INDRE 91/1 ...............................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio cholerae RC27 .....................................................  224 2 hits [g-proteobacteria]  hypothetical protein VC1306 [Vibrio cholerae O1 biovar El T
. . Vibrio mimicus MB-451 ....................................................  224 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio mimicus MB-451] >gi|26
. . Shewanella woodyi ATCC 51908 .............................................  223 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Vibrio metschnikovii CIP 69.14 ...........................................  222 2 hits [g-proteobacteria]  putative ATP-binding protein [Vibrio metschnikovii CIP 69.1
. . Shewanella halifaxensis HAW-EB4 ..........................................  221 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Pantoea sp. At-9b ........................................................  218 2 hits [enterobacteria]    protein of unknown function DUF463 YcjX family protein [Pan
. . Shewanella loihica PV-4 ..................................................  217 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Shewanella benthica KT99 .................................................  216 2 hits [g-proteobacteria]  hypothetical ATPase [Shewanella benthica KT99] >gi|16132823
. . Colwellia psychrerythraea 34H ............................................  214 2 hits [g-proteobacteria]  hypothetical protein CPS_3769 [Colwellia psychrerythraea 34
. . Pseudoalteromonas atlantica T6c ..........................................  211 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Pseu
. . Shewanella pealeana ATCC 700345 ..........................................  210 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Shewanella sediminis HAW-EB3 .............................................  210 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Pasteurella dagmatis ATCC 43325 ..........................................  207 2 hits [g-proteobacteria]  conserved hypothetical protein [Pasteurella dagmatis ATCC 4
. . Haemophilus influenzae PittAA ............................................  207 2 hits [g-proteobacteria]  tRNA pseudouridine synthase A [Haemophilus influenzae PittA
. . Haemophilus influenzae 22.4-21 ...........................................  206 2 hits [g-proteobacteria]  predicted ATPase [Haemophilus influenzae R3021] >gi|1452739
. . Haemophilus influenzae NT127 .............................................  206 2 hits [g-proteobacteria]  ATPase [Haemophilus influenzae NT127] >gi|260094789|gb|EEW7
. . Haemophilus influenzae R2866 .............................................  206 1 hit  [g-proteobacteria]  COG3106: Predicted ATPase [Haemophilus influenzae R2866] >g
. . Haemophilus influenzae PittII ............................................  206 2 hits [g-proteobacteria]  COG3106: Predicted ATPase [Haemophilus influenzae R2866] >g
. . Pasteurella multocida subsp. multocida str. Pm70 .........................  206 2 hits [g-proteobacteria]  hypothetical protein PM0910 [Pasteurella multocida subsp. m
. . Aggregatibacter aphrophilus NJ8700 .......................................  205 2 hits [g-proteobacteria]  tRNA pseudouridine synthase A [Aggregatibacter aphrophilus 
. . Haemophilus influenzae PittGG ............................................  205 2 hits [g-proteobacteria]  tRNA pseudouridine synthase A [Haemophilus influenzae PittG
. . Haemophilus influenzae 22.1-21 ...........................................  205 2 hits [g-proteobacteria]  hypothetical protein CGSHi22121_02050 [Haemophilus influenz
. . Haemophilus influenzae PittHH ............................................  205 2 hits [g-proteobacteria]  hypothetical protein CGSHi22121_02050 [Haemophilus influenz
. . Shewanella oneidensis MR-1 ...............................................  205 2 hits [g-proteobacteria]  ATPase [Shewanella oneidensis MR-1] >gi|24347641|gb|AAN5486
. . Actinobacillus succinogenes 130Z .........................................  205 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Act
. . Chromohalobacter salexigens DSM 3043 .....................................  204 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Chro
. . Haemophilus influenzae 86-028NP ..........................................  204 2 hits [g-proteobacteria]  ATPase [Haemophilus influenzae 86-028NP] >gi|68057972|gb|AA
. . Haemophilus influenzae 7P49H1 ............................................  203 2 hits [g-proteobacteria]  hypothetical protein CGSHi7P49H1_05418 [Haemophilus influen
. . Shewanella sp. MR-7 ......................................................  203 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Shewanella sp. MR-4 ......................................................  203 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Haemophilus influenzae R2846 .............................................  203 1 hit  [g-proteobacteria]  COG3106: Predicted ATPase [Haemophilus influenzae R2846] >g
. . Haemophilus influenzae ...................................................  203 3 hits [g-proteobacteria]  COG3106: Predicted ATPase [Haemophilus influenzae R2846] >g
. . Haemophilus influenzae PittEE ............................................  203 2 hits [g-proteobacteria]  ATPase [Haemophilus influenzae PittEE] >gi|148716326|gb|ABQ
. . Haemophilus influenzae 3655 ..............................................  202 2 hits [g-proteobacteria]  predicted ATPase [Haemophilus influenzae 3655] >gi|14498626
. . Shewanella putrefaciens CN-32 ............................................  202 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Shewanella baltica OS185 .................................................  202 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Shewanella baltica OS195 .................................................  202 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Shewanella baltica OS223 .................................................  202 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [She
. . Shewanella sp. ANA-3 .....................................................  201 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Haemophilus influenzae R3021 .............................................  201 2 hits [g-proteobacteria]  tRNA pseudouridine synthase A [Haemophilus influenzae 22.4-
. . Shewanella baltica OS155 .................................................  201 2 hits [g-proteobacteria]  hypothetical protein Sbal_1620 [Shewanella baltica OS155] >
. . Shewanella frigidimarina NCIMB 400 .......................................  201 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Haemophilus influenzae Rd KW20 ...........................................  201 2 hits [g-proteobacteria]  hypothetical protein HI1637 [Haemophilus influenzae Rd KW20
. . Haemophilus influenzae RdAW ..............................................  201 2 hits [g-proteobacteria]  hypothetical protein HI1637 [Haemophilus influenzae Rd KW20
. . Mannheimia succiniciproducens MBEL55E ....................................  200 2 hits [g-proteobacteria]  hypothetical protein MS0857 [Mannheimia succiniciproducens 
. . Shewanella amazonensis SB2B ..............................................  200 2 hits [g-proteobacteria]  ATPase [Shewanella amazonensis SB2B] >gi|119766877|gb|ABL99
. . Haemophilus somnus 2336 ..................................................  200 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Hae
. . Shewanella putrefaciens 200 ..............................................  199 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Shew
. . Haemophilus influenzae 6P18H1 ............................................  199 2 hits [g-proteobacteria]  hypothetical protein CGSHi6P18H1_01246 [Haemophilus influen
. . Shewanella sp. W3-18-1 ...................................................  199 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Sh
. . Haemophilus somnus 129PT .................................................  199 2 hits [g-proteobacteria]  ATPase [Haemophilus somnus 129PT] >gi|112822783|gb|ABI24872
. . Shewanella piezotolerans WP3 .............................................  195 2 hits [g-proteobacteria]  ATPase, putative [Shewanella piezotolerans WP3] >gi|2125574
. . Actinobacillus pleuropneumoniae L20 ......................................  192 2 hits [g-proteobacteria]  hypothetical protein APL_0866 [Actinobacillus pleuropneumon
. . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  191 1 hit  [g-proteobacteria]  COG3106: Predicted ATPase [Actinobacillus pleuropneumoniae 
. . Aggregatibacter actinomycetemcomitans D11S-1 .............................  191 2 hits [g-proteobacteria]  tRNA pseudouridine synthase A [Aggregatibacter actinomycete
. . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  190 2 hits [g-proteobacteria]  hypothetical protein APP7_0925 [Actinobacillus pleuropneumo
. . Shewanella denitrificans OS217 ...........................................  190 2 hits [g-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Shew
. . Haemophilus parasuis 29755 ...............................................  190 2 hits [g-proteobacteria]  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Hae
. . Haemophilus parasuis SH0165 ..............................................  190 2 hits [g-proteobacteria]  possible ATPase [Haemophilus parasuis SH0165] >gi|219691087
. . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  189 2 hits [g-proteobacteria]  hypothetical protein APJL_0877 [Actinobacillus pleuropneumo
. . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  189 2 hits [g-proteobacteria]  putative ATPase [Mannheimia haemolytica serotype A2 str. BO
. . Mannheimia haemolytica serotype A2 str. OVINE ............................  188 2 hits [g-proteobacteria]  putative ATPase [Mannheimia haemolytica serotype A2 str. OV
. . Mannheimia haemolytica PHL213 ............................................  187 2 hits [g-proteobacteria]  possible ATPase [Mannheimia haemolytica PHL213] >gi|1530925
. . Kangiella koreensis DSM 16069 ............................................  179 2 hits [g-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Kan
. . Pseudoalteromonas tunicata D2 ............................................  175 2 hits [g-proteobacteria]  hypothetical protein PTD2_15962 [Pseudoalteromonas tunicata
. . Actinobacillus minor NM305 ...............................................  174 2 hits [g-proteobacteria]  hypothetical protein AM305_11690 [Actinobacillus minor NM30
. . Haemophilus ducreyi 35000HP ..............................................  174 2 hits [g-proteobacteria]  hypothetical protein HD1136 [Haemophilus ducreyi 35000HP] >
. . Actinobacillus minor 202 .................................................  171 2 hits [g-proteobacteria]  hypothetical protein AM202_02840 [Actinobacillus minor 202]
. . Yersinia pestis D106004 ..................................................  170 1 hit  [enterobacteria]    hypothetical protein YPD4_1496 [Yersinia pestis D106004]
. . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  162 1 hit  [enterobacteria]    putative ATP-binding protein [Salmonella enterica subsp. en
. . Pseudoalteromonas haloplanktis TAC125 ....................................  160 2 hits [g-proteobacteria]  hypothetical protein PSHAa2046 [Pseudoalteromonas haloplank
. . Alteromonadales bacterium TW-7 ...........................................  154 2 hits [g-proteobacteria]  conserved protein with nucleoside triphosphate hydrolase do
. . Beggiatoa sp. PS .........................................................  150 2 hits [g-proteobacteria]  conserved hypothetical protein [Beggiatoa sp. PS] >gi|15206
. . Idiomarina baltica OS145 .................................................  149 2 hits [g-proteobacteria]  Predicted ATPase [Idiomarina baltica OS145] >gi|85694092|gb
. . Idiomarina loihiensis L2TR ...............................................  145 2 hits [g-proteobacteria]  ATPase [Idiomarina loihiensis L2TR] >gi|56178847|gb|AAV8156
. Magnetococcus sp. MC-1 -----------------------------------------------------  166 2 hits [proteobacteria]    protein of unknown function DUF463, YcjX family protein [Ma
. Pseudovibrio sp. JE062 .....................................................  160 2 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Pseudovibrio sp. JE
. Labrenzia aggregata IAM 12614 ..............................................  154 2 hits [a-proteobacteria]  conserved protein with nucleoside triphosphate hydrolase do
. Labrenzia alexandrii DFL-11 ................................................  153 2 hits [a-proteobacteria]  YcjX-like family, DUF463 [Labrenzia alexandrii DFL-11] >gi|
. Sagittula stellata E-37 ....................................................  152 2 hits [a-proteobacteria]  conserved protein with nucleoside triphosphate hydrolase do
. Fulvimarina pelagi HTCC2506 ................................................  152 2 hits [a-proteobacteria]  hypothetical protein FP2506_08891 [Fulvimarina pelagi HTCC2
. Mesorhizobium loti MAFF303099 ..............................................  152 2 hits [a-proteobacteria]  hypothetical protein mlr0775 [Mesorhizobium loti MAFF303099
. Oligotropha carboxidovorans OM5 ............................................  151 2 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Oligotropha carboxi
. Mesorhizobium opportunistum WSM2075 ........................................  150 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Mes
. Rhodopseudomonas palustris BisA53 ..........................................  150 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Rh
. Azorhizobium caulinodans ORS 571 ...........................................  149 2 hits [a-proteobacteria]  YcjX-like family protein [Azorhizobium caulinodans ORS 571]
. Rhodospirillum centenum SW .................................................  149 2 hits [a-proteobacteria]  hypothetical protein RC1_3450 [Rhodospirillum centenum SW] 
. Rhodopseudomonas palustris TIE-1 ...........................................  149 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Rho
. Rhodopseudomonas palustris CGA009 ..........................................  149 2 hits [a-proteobacteria]  hypothetical protein RPA1584 [Rhodopseudomonas palustris CG
. Chelativorans sp. BNC1 .....................................................  147 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Meso
. Jannaschia sp. CCS1 ........................................................  146 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Jann
. Rhodobacterales bacterium Y4I ..............................................  145 2 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Rhodobacterales bac
. Xanthobacter autotrophicus Py2 .............................................  145 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Xan
. Paracoccus denitrificans PD1222 ............................................  144 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX family protein [Pa
. Brucella ceti B1/94 ........................................................  144 2 hits [a-proteobacteria]  conserved hypothetical protein [Brucella ceti B1/94] >gi|26
. Beijerinckia indica subsp. indica ATCC 9039 ................................  144 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Bei
. Brucella pinnipedialis M163/99/10 ..........................................  144 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Brucella pinnipedialis B2/94 ...............................................  144 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Brucella sp. F5/99 .........................................................  144 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Brucella pinnipedialis M292/94/1 ...........................................  144 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Brucella ceti M490/95/1 ....................................................  144 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Aurantimonas manganoxydans SI85-9A1 ........................................  143 2 hits [a-proteobacteria]  conserved hypothetical protein [Aurantimonas manganoxydans 
. Roseobacter sp. GAI101 .....................................................  143 2 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Roseobacter sp. GAI
. Rhodopseudomonas palustris BisB5 ...........................................  143 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Rhod
. Brucella suis 1330 .........................................................  143 2 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella canis ATCC 23365 ..................................................  143 2 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella suis ATCC 23445 ...................................................  143 2 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella suis bv. 5 str. 513 ...............................................  143 3 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella suis bv. 3 str. 686 ...............................................  143 3 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella microti CCM 4915 ..................................................  143 2 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Brucella suis bv. 4 str. 40 ................................................  143 2 hits [a-proteobacteria]  hypothetical protein BR1034 [Brucella suis 1330] >gi|161618
. Rhodopseudomonas palustris BisB18 ..........................................  142 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Rhod
. Brucella sp. 83/13 .........................................................  142 3 hits [a-proteobacteria]  hypothetical protein Bru83_06150 [Brucella sp. 83/13] >gi|2
. Brucella ceti M13/05/1 .....................................................  142 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Brucella ceti M644/93/1 ....................................................  142 2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: conserved hypothetical protein [Brucel
. Sulfitobacter sp. EE-36 ....................................................  142 2 hits [a-proteobacteria]  hypothetical protein EE36_09995 [Sulfitobacter sp. EE-36] >
. Brucella melitensis bv. 3 str. Ether .......................................  142 3 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Brucella melitensis
. Brucella abortus bv. 3 str. Tulya ..........................................  142 3 hits [a-proteobacteria]  hypothetical protein Babob3T_03619 [Brucella abortus bv. 3 
. Hoeflea phototrophica DFL-43 ...............................................  141 2 hits [a-proteobacteria]  hypothetical protein HPDFL43_09682 [Hoeflea phototrophica D
. Brucella melitensis bv. 1 str. 16M .........................................  141 4 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Brucella melitensis
. Brucella melitensis bv. 1 str. Rev.1 .......................................  141 3 hits [a-proteobacteria]  amino acid regulated cytosolic protein [Brucella melitensis
. Nitrobacter hamburgensis X14 ...............................................  141 2 hits [a-proteobacteria]  protein of unknown function DUF463, YcjX-like protein [Nitr
. Rhodopseudomonas palustris HaA2 ............................................  141 2 hits [a-proteobacteria]  hypothetical protein RPB_3941 [Rhodopseudomonas palustris H
. Methylocella silvestris BL2 ................................................  141 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Met
. Nitrobacter winogradskyi Nb-255 ............................................  141 2 hits [a-proteobacteria]  YcjX-like protein [Nitrobacter winogradskyi Nb-255] >gi|744
. Oceanicola batsensis HTCC2597 ..............................................  141 2 hits [a-proteobacteria]  hypothetical protein OB2597_04400 [Oceanicola batsensis HTC
. Nitrobacter sp. Nb-311A ....................................................  140 2 hits [a-proteobacteria]  YcjX-like protein [Nitrobacter sp. Nb-311A] >gi|85699010|gb
. Agrobacterium vitis S4 .....................................................  140 2 hits [a-proteobacteria]  hypothetical protein Avi_2470 [Agrobacterium vitis S4] >gi|
. Hyphomicrobium denitrificans ATCC 51888 ....................................  140 2 hits [a-proteobacteria]  protein of unknown function DUF463 YcjX family protein [Hyp
. Sulfitobacter sp. NAS-14.1 .................................................  140 2 hits [a-proteobacteria]  hypothetical protein NAS141_15008 [Sulfitobacter sp. NAS-14
. Brucella ovis ATCC 25840 ...................................................  140 2 hits [a-proteobacteria]  hypothetical protein BOV_1000 [Brucella ovis ATCC 25840] >g
. Rhizobium sp. NGR234 .......................................................  140 2 hits [a-proteobacteria]  hypothetical protein NGR_c16540 [Rhizobium sp. NGR234] >gi|

BLAST

PROTOCOL

1) BLASTp vs SWISSPROT/ NCBI default parameters

2) BLASTp versus NR / NCBI default parameters apart from "Max target sequences_500"



RESULTS ANALYSIS:


I do BLASTp using swissprot and NR of my translated sequence to find that if there exists true homologs of my sequence or not. so with BLASTp and with NR i got very good homolgy with 92% identity. i got approx 500 hits of which the first hit is best homolog of my sequence with very good e-value that is 1e-118. Best homolog information is


ref|YP_856412.1| amino acid regulated cytosolic protein [Aero... 429 1e-118 Gene info


so as we get best homology so this is also a strong evidence that sequence is coding.

RAW RESULTS

1) BLASTp vs SWISSPROT :

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P76046.1|YCJX_ECOLI  RecName: Full=Uncharacterized protein ...   241    3e-63
sp|P44280.1|Y1637_HAEIN  RecName: Full=Uncharacterized protein...   201    4e-51
sp|Q967S7.1|GAGHB_DROME  RecName: Full=Retrovirus-related Gag ...  35.0    0.38 
sp|Q9THV5.1|RPOC2_SINAL  RecName: Full=DNA-directed RNA polyme...  32.3    2.3  
sp|C6E7C1.1|GCP_GEOSM  RecName: Full=Probable O-sialoglycoprot...  32.3    2.6  
sp|B3WEN7.1|PRMA_LACCB  RecName: Full=Ribosomal protein L11 me...  32.3    2.8   Gene info
sp|Q038Q5.1|PRMA_LACC3  RecName: Full=Ribosomal protein L11 me...  32.0    3.0   Gene info
sp|Q9M0S5.2|ISOA3_ARATH  RecName: Full=Isoamylase 3, chloropla...  31.6    4.0  
sp|Q6BJ48.2|MUS81_DEBHA  RecName: Full=Crossover junction endo...  31.2    5.9  
sp|C6DKU9.1|Y2519_PECCP  RecName: Full=UPF0176 protein PC1_2519    30.8    7.8  
sp|A9W4X1.1|CYSN_METEP  RecName: Full=Sulfate adenylyltransfer...  30.4    9.0  
sp|B7L0X9.1|CYSN_METC4  RecName: Full=Sulfate adenylyltransfer...  30.4    9.3  
sp|B1Z7C0.1|CYSN_METPB  RecName: Full=Sulfate adenylyltransfer...  30.4    10.0 



>sp|P76046.1|YCJX_ECOLI  RecName: Full=Uncharacterized protein ycjX
Length=465

 Score =  241 bits (615),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/213 (54%), Positives = 153/213 (71%), Gaps = 1/213 (0%)

Query  23   STATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIME  82
            +   L++RF  Y   +V+GFY+ HF  FDRQIVLVDCLQPLN+G  +F DM+ A+ ++M+
Sbjct  252  NAGMLRERFNYYCEKVVKGFYKNHFLRFDRQIVLVDCLQPLNSGPQAFNDMRLALTQLMQ  311

Query  83   SFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIA  142
            SF YG+   +RRLFSP IDKLLF A+KADHVT +QH  MVSLLQ L++     A FEGI+
Sbjct  312  SFHYGQRTLFRRLFSPVIDKLLFAATKADHVTIDQHANMVSLLQQLIQDAWQNAAFEGIS  371

Query  143  TECLALAAIKATEVGKGVADGREFPAIRGTSLS-GEPLLLFPGEVPSHIPPAQWWNNQGF  201
             +CL LA+++AT  G    +G + PA+RG  LS G PL ++PGEVP+ +P   +W+ QGF
Sbjct  372  MDCLGLASVQATTSGIIDVNGEKIPALRGNRLSDGAPLTVYPGEVPARLPGQAFWDKQGF  431

Query  202  DFQAFRPLPMSAHQALPHIRLDAALEFLLGDHL  234
             F+AFRP  M   + LPHIRLDAALEFL+GD L
Sbjct  432  QFEAFRPQVMDVDKPLPHIRLDAALEFLIGDKL  464


>sp|P44280.1|Y1637_HAEIN  RecName: Full=Uncharacterized protein HI1637
Length=470

 Score =  201 bits (510),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 148/240 (61%), Gaps = 6/240 (2%)

Query  2    LQFVPL----GVGRCLFGEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            LQF PL    G       +  +     A L +R+  Y+  +V+GFYE +F+ FDRQ++L 
Sbjct  231  LQFFPLIHLSGEHWQTLKKTAKSNSYFAVLTKRYNYYRNKIVKGFYENYFSTFDRQVILA  290

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCL PLN    +F DMQ  + ++  +F YG  N+  RLFSP+ID+L+FVA+KADH+T +Q
Sbjct  291  DCLTPLNHSQQAFLDMQMGLNQLFNNFHYGSRNFLHRLFSPQIDRLMFVATKADHITRDQ  350

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGT-SLSG  176
               +VSL++ +V+ G     FEGI TE  A+AA++ T+       G+E  AI+G  S+  
Sbjct  351  IPNLVSLMRQIVQEGGRHVEFEGIDTEYTAIAAVRTTKQVIVNQQGKEIKAIQGVRSIDK  410

Query  177  EPLLLFPGEVPSHIPPAQWWNNQ-GFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            + + L+PG VPS +P  ++W  Q  FDF +F P P+   +++PH+R+DA L+FLL D  E
Sbjct  411  QLITLYPGTVPSKLPKTEFWQKQPHFDFDSFEPQPLEQGESIPHLRMDAVLQFLLSDRFE  470


>sp|Q967S7.1|GAGHB_DROME  RecName: Full=Retrovirus-related Gag polyprotein from transposon 
HMS-Beagle
Length=467

 Score = 35.0 bits (79),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 0/55 (0%)

Query  31   FEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIMESFA  85
            F      +V+  Y  + A FDR   +V  ++  +   A FG  ++++ RIME++ 
Sbjct  66   FTDVSDQVVEPEYRNNLADFDRVPDIVKSIREFSGNPAEFGSWKKSVDRIMETYT  120


>sp|Q9THV5.1|RPOC2_SINAL  RecName: Full=DNA-directed RNA polymerase subunit beta''; AltName: 
Full=PEP; AltName: Full=Plastid-encoded RNA polymerase 
subunit beta''; Short=RNA polymerase subunit beta''
Length=1384

 Score = 32.3 bits (72),  Expect = 2.3, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 0/33 (0%)

Query  15    GEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHF  47
             G  R GA STAT +  F + K +L++G YE++F
Sbjct  1330  GSQRIGALSTATYQHSFGKNKNYLIRGRYERYF  1362


>sp|C6E7C1.1|GCP_GEOSM  RecName: Full=Probable O-sialoglycoprotein endopeptidase; Short=Glycoprotease
Length=342

 Score = 32.3 bits (72),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 10/108 (9%)

Query  93   RRLFSPRIDKLLFVASKADHVTPE----QHGPMVSLL--QHLVRSGRGQARFEGIATE--  144
            R + S  +   + V ++   V PE    +H   VS +  Q L  +G G  R +GIA    
Sbjct  22   RTVLSSIVASQISVHAEYGGVVPEIASRKHLESVSFVVEQALAEAGVGLDRIDGIAVTQG  81

Query  145  -CLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLLLFPGEVPSHIP  191
              LA A +    V KG+A GR  P +    + G  L +F  E P   P
Sbjct  82   PGLAGALLVGISVAKGLAFGRSLPLVGVNHIEGHLLAVFL-EAPVQFP  128


>sp|B3WEN7.1|PRMA_LACCB Gene info RecName: Full=Ribosomal protein L11 methyltransferase; Short=L11 
Mtase
Length=315

 GENE ID: 6406281 prmA | Ribosomal protein L11 methyltransferase (L11 Mtase)
[Lactobacillus casei BL23]

 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 60/154 (38%), Gaps = 34/154 (22%)

Query  37   HLVQGFYEQHFAGFDRQIVLV---DCLQPLNAGAASFG-DMQQAIARIMESFAYGKSNWW  92
            HL  G   Q    FD    LV   D +     G A FG D   A   + +      +N W
Sbjct  58   HLASG--AQVIGYFDPATSLVEQRDHIATRVRGLAQFGLDPGAATVTLADVRQADWANVW  115

Query  93   RRLFSP-RIDKLLFVASKADHVTPEQHGP---------------------MVSLLQHLVR  130
            ++ + P R+ + L +  K +H TP+Q G                      M+SLL+ ++R
Sbjct  116  KQYYHPLRVSRFLTIVPKWEHYTPQQAGELQLTLDPGMAFGTGTHPTTQLMLSLLESVIR  175

Query  131  SGRGQ------ARFEGIATECLALAAIKATEVGK  158
             G         +    IA E L +  I AT+V +
Sbjct  176  GGETMIDVGTGSGILAIAAERLGVGDILATDVDE  209


>sp|Q038Q5.1|PRMA_LACC3 Gene info RecName: Full=Ribosomal protein L11 methyltransferase; Short=L11 
Mtase
Length=315

 GENE ID: 4419935 LSEI_1542 | ribosomal protein L11 methylase
[Lactobacillus casei ATCC 334] (10 or fewer PubMed links)

 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 60/154 (38%), Gaps = 34/154 (22%)

Query  37   HLVQGFYEQHFAGFDRQIVLV---DCLQPLNAGAASFG-DMQQAIARIMESFAYGKSNWW  92
            HL  G   Q    FD    LV   D +     G A FG D   A   + +      +N W
Sbjct  58   HLASG--AQVIGYFDPATSLVEQRDHIATRVRGLAQFGLDPGAATVTLADVRQADWANVW  115

Query  93   RRLFSP-RIDKLLFVASKADHVTPEQHGP---------------------MVSLLQHLVR  130
            ++ + P R+ + L +  K +H TP+Q G                      M+SLL+ ++R
Sbjct  116  KQYYHPLRVSRFLTIVPKWEHYTPQQAGELQLTLDPGMAFGTGTHPTTQLMLSLLESVIR  175

Query  131  SGRGQ------ARFEGIATECLALAAIKATEVGK  158
             G         +    IA E L +  I AT+V +
Sbjct  176  GGETMIDVGTGSGILAIAAERLGVGDILATDVDE  209


>sp|Q9M0S5.2|ISOA3_ARATH  RecName: Full=Isoamylase 3, chloroplastic; Short=AtISA3; Flags: 
Precursor
Length=764

 Score = 31.6 bits (70),  Expect = 4.0, Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 0/40 (0%)

Query  50   FDRQIVLVDCLQPLNAGAASFGDMQQAIARIMESFAYGKS  89
            FDR I+L+D    L  G +SFGD  Q  A+   ++ +  S
Sbjct  179  FDRSILLLDPYAKLVKGHSSFGDSSQKFAQFYGTYDFESS  218


>sp|Q6BJ48.2|MUS81_DEBHA  RecName: Full=Crossover junction endonuclease MUS81
Length=651

 Score = 31.2 bits (69),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 53/131 (40%), Gaps = 20/131 (15%)

Query  63   LNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMV  122
            + +    FGDM  AI   M S     SN++ + F    D + F+AS    +  +      
Sbjct  458  VTSDMNKFGDMSDAIQTAM-SMTMTISNFYLKRFKSIEDTIAFLASLTQVIKDQFAKNKT  516

Query  123  SLLQHLVRSGRGQA-----------RFEGIAT--ECLALAAIKATEVGK-GVADGRE---  165
            +LL    RS + QA           +FE  +T  EC  L +     +GK G+   +E   
Sbjct  517  NLLVLKARSIKNQAEYSSLIAKFKEKFENRSTSYECAHLFSTFQDSMGKTGMMTVKETFI  576

Query  166  --FPAIRGTSL  174
                 IRG SL
Sbjct  577  LMLMGIRGVSL  587


>sp|C6DKU9.1|Y2519_PECCP  RecName: Full=UPF0176 protein PC1_2519
Length=355

 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query  197  NNQGFDFQAFRPLPMSAHQALPHIRLDAALE  227
            NNQ   F AF+ +  SAH AL  IRL+ ALE
Sbjct  73   NNQ---FDAFKAVLFSAHPALDQIRLNIALE  100

------------------------------------------------------------------------------------------------------------------------------------------------------

2) BLASTp versus NR: 

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_856412.1|  amino acid regulated cytosolic protein [Aero...   429    1e-118 Gene info
ref|YP_001142214.1|  hypothetical protein ASA_2422 [Aeromonas ...   427    5e-118 Gene info
ref|ZP_06155087.1|  putative ATPase [Photobacterium damselae s...   259    2e-67 
ref|ZP_01221055.1|  putative ATPase [Photobacterium profundum ...   257    9e-67 
ref|ZP_05884954.1|  putative ATP-binding protein [Vibrio coral...   255    2e-66 
ref|ZP_02194610.1|  asparaginyl-tRNA synthetase [Vibrio sp. AN...   254    4e-66 
ref|YP_130621.1|  putative ATPase [Photobacterium profundum SS...   254    5e-66  Gene info
gb|ABA55853.1|  hypothetical protein [Vibrio sp. DAT722]            253    1e-65 
ref|YP_002151103.1|  ATP-binding protein [Proteus mirabilis HI...   252    2e-65  Gene info
ref|ZP_01984646.1|  amino acid regulated cytosolic protein [Vi...   251    3e-65 
ref|ZP_01235265.1|  putative ATPase [Vibrio angustum S14] >gb|...   251    3e-65 
ref|YP_001445109.1|  hypothetical protein VIBHAR_01917 [Vibrio...   250    7e-65  Gene info
ref|ZP_01991890.1|  amino acid regulated cytosolic protein [Vi...   250    1e-64 
ref|ZP_01259543.1|  hypothetical protein V12G01_16627 [Vibrio ...   249    1e-64 
ref|ZP_04921576.1|  amino acid regulated cytosolic protein [Vi...   249    2e-64  Gene info
ref|ZP_06177252.1|  conserved hypothetical protein [Vibrio har...   249    2e-64 
ref|NP_798250.1|  hypothetical protein VP1871 [Vibrio parahaem...   248    2e-64  Gene info
ref|ZP_06052258.1|  putative ATPase [Grimontia hollisae CIP 10...   248    3e-64 
ref|ZP_01162731.1|  putative ATPase [Photobacterium sp. SKA34]...   248    4e-64 
ref|YP_001176880.1|  protein of unknown function DUF463, YcjX ...   248    5e-64  Gene info
ref|ZP_06126857.1|  hypothetical protein PretD1_17529 [Provide...   247    7e-64 
ref|ZP_05971596.1|  hypothetical protein PROVRUST_05148 [Provi...   246    9e-64 
ref|ZP_05967841.1|  hypothetical protein EcanA3_05940 [Enterob...   244    4e-63 
ref|ZP_05945767.1|  putative ATP-binding protein [Vibrio orien...   244    7e-63 
ref|YP_002157907.1|  amino acid regulated cytosolic protein [V...   243    8e-63  Gene info
ref|ZP_03805810.1|  hypothetical protein PROPEN_04205 [Proteus...   243    9e-63 
ref|YP_216665.1|  putative ATPase [Salmonella enterica subsp. ...   243    1e-62  Gene info
ref|ZP_02666181.1|  YcjX [Salmonella enterica subsp. enterica ...   243    1e-62 
ref|NP_460643.1|  putative ATPase [Salmonella typhimurium LT2]...   243    1e-62  Gene info
ref|YP_206272.1|  hypothetical protein VF_A0314 [Vibrio fische...   243    1e-62  Gene info
ref|ZP_02574818.1|  YcjX [Salmonella enterica subsp. enterica ...   243    1e-62 
ref|YP_150468.1|  putative ATP-binding protein [Salmonella ent...   243    1e-62  Gene info
ref|ZP_04562158.1|  conserved hypothetical protein [Citrobacte...   243    1e-62 
ref|NP_455818.1|  putative ATP-binding protein [Salmonella ent...   243    2e-62  Gene info
ref|YP_002637623.1|  putative ATP-binding protein [Salmonella ...   242    2e-62  Gene info
ref|NP_929817.1|  hypothetical protein plu2582 [Photorhabdus l...   242    2e-62  Gene info
ref|YP_002264815.1|  hypothetical protein VSAL_II0484 [Aliivib...   242    2e-62  Gene info
emb|CBG88439.1|  putative ATP-binding protein [Citrobacter rod...   242    3e-62 
ref|ZP_03364470.1|  hypothetical protein SentesTyph_16143 [Sal...   241    3e-62 
ref|YP_002040937.1|  YcjX [Salmonella enterica subsp. enterica...   241    3e-62  Gene info
dbj|BAI54842.1|  conserved hypothetical protein [Escherichia c...   241    3e-62 
ref|YP_403034.1|  putative YcjX [Shigella dysenteriae Sd197] >...   241    3e-62  Gene info
ref|YP_001334964.1|  putative enzyme [Klebsiella pneumoniae su...   241    4e-62  Gene info
ref|YP_669286.1|  hypothetical protein ECP_1374 [Escherichia c...   241    4e-62  Gene info
ref|ZP_03066110.1|  conserved hypothetical protein [Shigella d...   241    4e-62 
ref|YP_310732.1|  putative enzyme [Shigella sonnei Ss046] >gb|...   241    4e-62  Gene info
ref|YP_408178.1|  YcjX [Shigella boydii Sb227] >ref|YP_0018801...   241    4e-62  Gene info
ref|YP_001462629.1|  hypothetical protein EcE24377A_1532 [Esch...   241    4e-62  Gene info
ref|ZP_02903159.1|  conserved hypothetical protein [Escherichi...   241    4e-62 
gb|AAF28131.1|AF153317_28  YcjX [Shigella dysenteriae]              241    4e-62 
ref|ZP_03043760.1|  conserved hypothetical protein [Escherichi...   241    4e-62 
gb|ACX39969.1|  protein of unknown function DUF463 YcjX family...   241    4e-62 
ref|ZP_03069254.1|  conserved hypothetical protein [Escherichi...   241    4e-62 
ref|NP_415837.1|  conserved protein with nucleoside triphospha...   241    4e-62  Gene info
ref|NP_287867.1|  hypothetical protein Z2458 [Escherichia coli...   241    4e-62  Gene info
ref|YP_002407673.1|  conserved hypothetical protein; putative ...   241    4e-62  Gene info
ref|YP_001743855.1|  hypothetical protein EcSMS35_1801 [Escher...   241    4e-62  Gene info
ref|YP_002329049.1|  conserved protein with nucleoside triphos...   241    4e-62  Gene info
ref|YP_002226438.1|  putative ATP-binding protein [Salmonella ...   241    4e-62  Gene info
ref|YP_002382796.1|  conserved hypothetical protein; putative ...   241    4e-62  Gene info
ref|ZP_03032590.1|  conserved hypothetical protein [Escherichi...   241    5e-62 
ref|YP_002397523.1|  conserved hypothetical protein; putative ...   241    5e-62  Gene info
ref|ZP_02655170.1|  YcjX [Salmonella enterica subsp. enterica ...   241    5e-62 
ref|YP_001570340.1|  hypothetical protein SARI_01296 [Salmonel...   241    5e-62  Gene info
ref|YP_001452963.1|  hypothetical protein CKO_01391 [Citrobact...   241    5e-62  Gene info
ref|YP_002238937.1|  hypothetical protein KPK_3111 [Klebsiella...   241    5e-62  Gene info
ref|YP_002391221.1|  conserved hypothetical protein; putative ...   241    6e-62  Gene info
ref|ZP_05119238.1|  amino acid regulated cytosolic protein [Vi...   241    6e-62 
ref|ZP_05432293.1|  hypothetical protein ShiD9_05907 [Shigella...   240    7e-62 
ref|ZP_04004048.1|  ATPase [Escherichia coli 83972] >gb|EEJ469...   240    7e-62 
ref|YP_852487.1|  hypothetical protein APECO1_474 [Escherichia...   240    8e-62  Gene info
ref|NP_934870.1|  ATPase [Vibrio vulnificus YJ016] >dbj|BAC948...   240    9e-62  Gene info
ref|NP_753697.1|  hypothetical protein c1793 [Escherichia coli...   239    1e-61  Gene info
ref|YP_688840.1|  hypothetical protein SFV_1337 [Shigella flex...   238    3e-61  Gene info
ref|YP_002892082.1|  protein of unknown function DUF463 YcjX f...   238    3e-61  Gene info
ref|YP_540601.1|  hypothetical protein UTI89_C1592 [Escherichi...   238    3e-61  Gene info
ref|NP_761119.1|  putative ATP-binding protein [Vibrio vulnifi...   238    3e-61  Gene info
ref|YP_001478848.1|  protein of unknown function DUF463 YcjX f...   237    9e-61  Gene info
ref|ZP_06190345.1|  hypothetical protein SOD_b02800 [Serratia ...   236    1e-60 
ref|YP_003295911.1|  predicted ATPase [Edwardsiella tarda EIB2...   236    2e-60  Gene info
ref|ZP_01869056.1|  hypothetical protein VSAK1_07149 [Vibrio s...   235    4e-60 
ref|ZP_00991793.1|  hypothetical protein V12B01_03938 [Vibrio ...   234    4e-60 
ref|ZP_04610894.1|  hypothetical protein yrohd0001_27040 [Yers...   234    6e-60 
ref|ZP_01064588.1|  hypothetical protein MED222_16166 [Vibrio ...   234    6e-60 
ref|YP_001437742.1|  hypothetical protein ESA_01652 [Enterobac...   234    7e-60  Gene info
ref|YP_003210668.1|  Uncharacterized protein ycjX [Cronobacter...   234    7e-60  Gene info
ref|ZP_04639908.1|  hypothetical protein ymoll0001_22300 [Yers...   234    7e-60 
ref|ZP_04614954.1|  hypothetical protein yruck0001_13200 [Yers...   234    7e-60 
ref|YP_002417404.1|  hypothetical protein VS_1795 [Vibrio sple...   234    8e-60  Gene info
ref|YP_002648718.1|  hypothetical protein EpC_17100 [Erwinia p...   233    9e-60  Gene info
ref|NP_707226.1|  putative enzyme [Shigella flexneri 2a str. 3...   233    9e-60  Gene info
gb|ADA73728.1|  hypothetical protein SFxv_1503 [Shigella flexn...   233    1e-59 
ref|ZP_01815342.1|  hypothetical protein VSWAT3_05666 [Vibrion...   233    1e-59 
ref|YP_003040789.1|  hypothetical protein PAU_01953 [Photorhab...   233    2e-59  Gene info
ref|YP_001907582.1|  Putative ATP-binding protein [Erwinia tas...   233    2e-59  Gene info
ref|ZP_02960389.1|  hypothetical protein PROSTU_02332 [Provide...   232    2e-59 
ref|ZP_04630978.1|  hypothetical protein yfred0001_6670 [Yersi...   232    2e-59 
ref|YP_001400765.1|  hypothetical protein YpsIP31758_1790 [Yer...   232    2e-59  Gene info
ref|YP_002933247.1|  hypothetical protein NT01EI_1836 [Edwards...   232    3e-59  Gene info
ref|ZP_04626647.1|  hypothetical protein yberc0001_22690 [Yers...   231    4e-59 
ref|ZP_04635892.1|  hypothetical protein yinte0001_17540 [Yers...   231    4e-59 
ref|YP_001006358.1|  hypothetical protein YE2118 [Yersinia ent...   231    4e-59  Gene info
gb|ACY62135.1|  hypothetical protein YPD8_1450 [Yersinia pesti...   231    4e-59 
ref|YP_003004088.1|  protein of unknown function DUF463 YcjX f...   231    4e-59  Gene info
ref|NP_669299.1|  hypothetical protein y1984 [Yersinia pestis ...   231    5e-59  Gene info
ref|ZP_04619855.1|  hypothetical protein yaldo0001_14900 [Yers...   231    6e-59 
ref|YP_002987344.1|  protein of unknown function DUF463 YcjX f...   230    9e-59  Gene info
ref|YP_001162174.1|  hypothetical protein YPDSF_0795 [Yersinia...   230    9e-59  Gene info
ref|ZP_05716629.1|  conserved hypothetical protein [Vibrio mim...   230    1e-58 
ref|ZP_05925257.1|  predicted ATPase [Vibrio sp. RC341] >gb|EE...   230    1e-58 
ref|ZP_04623504.1|  hypothetical protein ykris0001_41970 [Yers...   229    2e-58 
ref|YP_003259970.1|  protein of unknown function DUF463 YcjX f...   229    2e-58  Gene info
ref|ZP_03320173.1|  hypothetical protein PROVALCAL_03121 [Prov...   228    3e-58 
ref|ZP_03825516.1|  hypothetical protein PcarbP_02787 [Pectoba...   228    4e-58 
ref|YP_003333284.1|  protein of unknown function DUF463 YcjX f...   228    4e-58  Gene info
ref|YP_003017895.1|  hypothetical protein PC1_2327 [Pectobacte...   228    4e-58  Gene info
ref|ZP_03830386.1|  hypothetical protein PcarcW_03224 [Pectoba...   227    9e-58 
ref|ZP_06078904.1|  putative ATP-binding protein [Vibrio sp. R...   226    1e-57 
ref|ZP_06033296.1|  putative ATP-binding protein [Vibrio mimic...   226    2e-57 
ref|ZP_06049152.1|  predicted ATPase [Vibrio cholerae CT 5369-...   226    2e-57 
ref|ZP_05722384.1|  conserved hypothetical protein [Vibrio mim...   226    2e-57 
ref|ZP_01950740.1|  conserved hypothetical protein [Vibrio cho...   226    2e-57 
ref|ZP_04405141.1|  hypothetical protein VCB_003340 [Vibrio ch...   225    2e-57 
ref|ZP_04961553.1|  conserved hypothetical protein [Vibrio cho...   225    2e-57 
ref|ZP_04917988.1|  conserved hypothetical protein [Vibrio cho...   225    2e-57 
ref|ZP_01979897.1|  conserved hypothetical protein [Vibrio cho...   225    2e-57 
ref|ZP_04415302.1|  hypothetical protein VCA_003544 [Vibrio ch...   225    3e-57 
ref|ZP_05877260.1|  putative ATP-binding protein [Vibrio furni...   225    3e-57 
ref|ZP_04920444.1|  conserved hypothetical protein [Vibrio cho...   225    3e-57 
ref|YP_050080.1|  hypothetical protein ECA1986 [Pectobacterium...   225    3e-57  Gene info
ref|ZP_01982697.1|  conserved hypothetical protein [Vibrio cho...   225    3e-57 
ref|ZP_04419002.1|  hypothetical protein VCG_002707 [Vibrio ch...   225    3e-57 
ref|ZP_01957251.1|  conserved hypothetical protein [Vibrio cho...   225    3e-57 
ref|NP_230951.1|  hypothetical protein VC1306 [Vibrio cholerae...   224    4e-57  Gene info
ref|ZP_06039339.1|  putative ATP-binding protein [Vibrio mimic...   224    8e-57 
ref|YP_001761463.1|  protein of unknown function DUF463 YcjX f...   223    2e-56  Gene info
ref|ZP_05881811.1|  putative ATP-binding protein [Vibrio metsc...   222    2e-56 
ref|YP_001674965.1|  protein of unknown function DUF463 YcjX f...   221    5e-56  Gene info
ref|ZP_05729583.1|  protein of unknown function DUF463 YcjX fa...   218    5e-55 
ref|YP_001094618.1|  protein of unknown function DUF463, YcjX ...   217    8e-55  Gene info
ref|ZP_02159102.1|  hypothetical ATPase [Shewanella benthica K...   216    1e-54 
ref|YP_270436.1|  hypothetical protein CPS_3769 [Colwellia psy...   214    7e-54  Gene info
ref|YP_662563.1|  protein of unknown function DUF463, YcjX-lik...   211    3e-53  Gene info
ref|YP_001502521.1|  protein of unknown function DUF463 YcjX f...   210    9e-53  Gene info
ref|YP_001473296.1|  protein of unknown function DUF463, YcjX ...   210    1e-52  Gene info
ref|ZP_05920302.1|  conserved hypothetical protein [Pasteurell...   207    5e-52 
ref|ZP_01790783.1|  tRNA pseudouridine synthase A [Haemophilus...   207    5e-52 
ref|ZP_01796741.1|  predicted ATPase [Haemophilus influenzae R...   206    1e-51 
ref|ZP_05849951.1|  ATPase [Haemophilus influenzae NT127] >gb|...   206    1e-51 
ref|ZP_00156615.2|  COG3106: Predicted ATPase [Haemophilus inf...   206    1e-51 
ref|NP_245847.1|  hypothetical protein PM0910 [Pasteurella mul...   206    2e-51  Gene info
ref|YP_003007093.1|  tRNA pseudouridine synthase A [Aggregatib...   205    3e-51  Gene info
ref|YP_001293127.1|  tRNA pseudouridine synthase A [Haemophilu...   205    3e-51  Gene info
ref|ZP_01783582.1|  hypothetical protein CGSHi22121_02050 [Hae...   205    3e-51 
ref|NP_717418.1|  ATPase [Shewanella oneidensis MR-1] >gb|AAN5...   205    3e-51  Gene info
ref|YP_001345046.1|  protein of unknown function DUF463 YcjX f...   205    3e-51  Gene info
ref|YP_573285.1|  protein of unknown function DUF463, YcjX-lik...   204    5e-51  Gene info
ref|YP_248885.1|  ATPase [Haemophilus influenzae 86-028NP] >gb...   204    7e-51  Gene info
ref|ZP_04466370.1|  hypothetical protein CGSHi7P49H1_05418 [Ha...   203    9e-51 
ref|YP_738589.1|  protein of unknown function DUF463, YcjX fam...   203    1e-50  Gene info
ref|YP_734607.1|  protein of unknown function DUF463, YcjX fam...   203    1e-50  Gene info
ref|ZP_00155209.2|  COG3106: Predicted ATPase [Haemophilus inf...   203    1e-50 
ref|YP_001290919.1|  ATPase [Haemophilus influenzae PittEE] >g...   203    1e-50  Gene info
ref|ZP_01788771.1|  predicted ATPase [Haemophilus influenzae 3...   202    2e-50 
ref|YP_001183029.1|  protein of unknown function DUF463, YcjX ...   202    2e-50  Gene info
ref|YP_001365819.1|  protein of unknown function DUF463 YcjX f...   202    2e-50  Gene info
ref|YP_001554076.1|  protein of unknown function DUF463 YcjX f...   202    3e-50  Gene info
ref|YP_002358645.1|  protein of unknown function DUF463 YcjX f...   202    3e-50  Gene info
ref|YP_870278.1|  protein of unknown function DUF463, YcjX fam...   201    4e-50  Gene info
ref|ZP_01786718.1|  tRNA pseudouridine synthase A [Haemophilus...   201    4e-50 
ref|YP_001050003.1|  hypothetical protein Sbal_1620 [Shewanell...   201    4e-50  Gene info
ref|YP_751254.1|  protein of unknown function DUF463, YcjX fam...   201    6e-50  Gene info
ref|NP_439779.1|  hypothetical protein HI1637 [Haemophilus inf...   201    7e-50  GeoGene info
ref|YP_088049.1|  hypothetical protein MS0857 [Mannheimia succ...   200    1e-49  Gene info
ref|YP_927117.1|  ATPase [Shewanella amazonensis SB2B] >gb|ABL...   200    1e-49  Gene info
ref|YP_001784276.1|  protein of unknown function DUF463 YcjX f...   200    1e-49  Gene info
ref|ZP_01707607.1|  protein of unknown function DUF463, YcjX-l...   199    1e-49 
ref|ZP_04464955.1|  hypothetical protein CGSHi6P18H1_01246 [Ha...   199    2e-49 
ref|YP_963973.1|  protein of unknown function DUF463, YcjX fam...   199    2e-49  Gene info
ref|YP_718807.1|  ATPase [Haemophilus somnus 129PT] >gb|ABI248...   199    2e-49  Gene info
ref|YP_002312537.1|  ATPase, putative [Shewanella piezotoleran...   195    4e-48  Gene info
ref|YP_001053567.1|  hypothetical protein APL_0866 [Actinobaci...   192    3e-47  Gene info
ref|ZP_00133835.1|  COG3106: Predicted ATPase [Actinobacillus ...   191    4e-47 
ref|YP_003255561.1|  tRNA pseudouridine synthase A [Aggregatib...   191    8e-47  Gene info
ref|YP_001968719.1|  hypothetical protein APP7_0925 [Actinobac...   190    9e-47  Gene info
ref|YP_563480.1|  protein of unknown function DUF463, YcjX-lik...   190    9e-47  Gene info
ref|ZP_02478276.1|  S-adenosylmethionine:tRNA ribosyltransfera...   190    1e-46 
ref|YP_002475258.1|  possible ATPase [Haemophilus parasuis SH0...   190    1e-46  Gene info
ref|YP_001651879.1|  hypothetical protein APJL_0877 [Actinobac...   189    2e-46  Gene info
ref|ZP_05990096.1|  putative ATPase [Mannheimia haemolytica se...   189    3e-46 
ref|ZP_05991862.1|  putative ATPase [Mannheimia haemolytica se...   188    3e-46 
ref|ZP_04977243.1|  possible ATPase [Mannheimia haemolytica PH...   187    7e-46 
ref|YP_003147115.1|  protein of unknown function DUF463 YcjX f...   179    2e-43  Gene info
ref|ZP_01135173.1|  hypothetical protein PTD2_15962 [Pseudoalt...   175    3e-42 
ref|ZP_04753945.1|  hypothetical protein AM305_11690 [Actinoba...   174    4e-42 
ref|NP_873608.1|  hypothetical protein HD1136 [Haemophilus duc...   174    9e-42  Gene info
ref|ZP_05629792.1|  hypothetical protein AM202_02840 [Actinoba...   171    6e-41 
gb|ACY58404.1|  hypothetical protein YPD4_1496 [Yersinia pesti...   170    8e-41 
ref|YP_865337.1|  protein of unknown function DUF463, YcjX fam...   166    1e-39  Gene info
ref|ZP_03360738.1|  putative ATP-binding protein [Salmonella e...   162    3e-38 
ref|ZP_05083609.1|  amino acid regulated cytosolic protein [Ps...   160    9e-38 
ref|YP_340545.1|  hypothetical protein PSHAa2046 [Pseudoaltero...   160    1e-37  Gene info
ref|ZP_01546147.1|  conserved protein with nucleoside triphosp...   154    5e-36 
ref|ZP_01613708.1|  conserved protein with nucleoside triphosp...   154    7e-36 
ref|ZP_05113407.1|  YcjX-like family, DUF463 [Labrenzia alexan...   153    1e-35 
gb|AAQ12664.1|  hypothetical protein [Haemophilus influenzae]       153    2e-35 
ref|ZP_01747341.1|  conserved protein with nucleoside triphosp...   152    2e-35 
ref|ZP_01437949.1|  hypothetical protein FP2506_08891 [Fulvima...   152    2e-35 
ref|NP_102508.1|  hypothetical protein mlr0775 [Mesorhizobium ...   152    4e-35  Gene info
ref|YP_002288062.1|  amino acid regulated cytosolic protein [O...   151    5e-35  Gene info
ref|ZP_05807370.1|  protein of unknown function DUF463 YcjX fa...   150    8e-35 
ref|ZP_02002197.1|  conserved hypothetical protein [Beggiatoa ...   150    9e-35 
ref|YP_783217.1|  protein of unknown function DUF463, YcjX fam...   150    1e-34  Gene info
ref|ZP_01043155.1|  Predicted ATPase [Idiomarina baltica OS145...   149    2e-34 
ref|YP_001524576.1|  YcjX-like family protein [Azorhizobium ca...   149    2e-34  Gene info
ref|YP_002299620.1|  hypothetical protein RC1_3450 [Rhodospiri...   149    3e-34  Gene info
ref|YP_001990775.1|  protein of unknown function DUF463 YcjX f...   149    3e-34  Gene info
ref|NP_946930.1|  hypothetical protein RPA1584 [Rhodopseudomon...   149    3e-34  Gene info
ref|YP_673978.1|  protein of unknown function DUF463, YcjX-lik...   147    6e-34  Gene info
ref|YP_511405.1|  protein of unknown function DUF463, YcjX-lik...   146    2e-33  Gene info
ref|ZP_05077877.1|  amino acid regulated cytosolic protein [Rh...   145    3e-33 
ref|YP_001418996.1|  protein of unknown function DUF463 YcjX f...   145    4e-33  Gene info
ref|YP_155118.1|  ATPase [Idiomarina loihiensis L2TR] >gb|AAV8...   145    5e-33  Gene info
ref|YP_914447.1|  protein of unknown function DUF463, YcjX fam...   144    6e-33  Gene info
ref|ZP_05936484.1|  conserved hypothetical protein [Brucella c...   144    7e-33 
ref|YP_001833510.1|  protein of unknown function DUF463 YcjX f...   144    9e-33  Gene info
ref|ZP_05953436.1|  LOW QUALITY PROTEIN: conserved hypothetica...   144    1e-32 
ref|ZP_01228825.1|  conserved hypothetical protein [Aurantimon...   143    1e-32 
ref|ZP_05099014.1|  amino acid regulated cytosolic protein [Ro...   143    1e-32 
ref|YP_570824.1|  protein of unknown function DUF463, YcjX-lik...   143    1e-32  Gene info
ref|NP_698040.1|  hypothetical protein BR1034 [Brucella suis 1...   143    2e-32  Gene info
ref|YP_534113.1|  protein of unknown function DUF463, YcjX-lik...   142    2e-32  Gene info
ref|ZP_05180920.1|  hypothetical protein Bru83_06150 [Brucella...   142    2e-32 
ref|ZP_05932907.1|  LOW QUALITY PROTEIN: conserved hypothetica...   142    2e-32 
ref|ZP_00956425.1|  hypothetical protein EE36_09995 [Sulfitoba...   142    3e-32 
ref|ZP_05454406.1|  amino acid regulated cytosolic protein [Br...   142    4e-32 
ref|ZP_05155576.1|  hypothetical protein Babob3T_03619 [Brucel...   142    4e-32 
ref|ZP_02166699.1|  hypothetical protein HPDFL43_09682 [Hoefle...   141    4e-32 
ref|NP_539868.1|  amino acid regulated cytosolic protein [Bruc...   141    4e-32  Gene info
ref|YP_578579.1|  protein of unknown function DUF463, YcjX-lik...   141    4e-32  Gene info
ref|YP_487545.1|  hypothetical protein RPB_3941 [Rhodopseudomo...   141    4e-32  Gene info
ref|YP_002363770.1|  protein of unknown function DUF463 YcjX f...   141    6e-32  Gene info
ref|YP_319621.1|  YcjX-like protein [Nitrobacter winogradskyi ...   141    7e-32  Gene info
ref|ZP_01001422.1|  hypothetical protein OB2597_04400 [Oceanic...   141    7e-32 
ref|ZP_01044873.1|  YcjX-like protein [Nitrobacter sp. Nb-311A...   140    8e-32 
ref|YP_002549771.1|  hypothetical protein Avi_2470 [Agrobacter...   140    9e-32  Gene info
ref|ZP_05375725.1|  protein of unknown function DUF463 YcjX fa...   140    1e-31 
ref|ZP_00963252.1|  hypothetical protein NAS141_15008 [Sulfito...   140    1e-31 
ref|YP_001258974.1|  hypothetical protein BOV_1000 [Brucella o...   140    1e-31  Gene info
ref|YP_002826172.1|  hypothetical protein NGR_c16540 [Rhizobiu...   140    1e-31  Gene info
ref|ZP_02140936.1|  hypothetical protein RLO149_17618 [Roseoba...   140    2e-31 
ref|YP_221749.1|  hypothetical protein BruAb1_1039 [Brucella a...   139    2e-31  Gene info
ref|ZP_05152518.1|  ATP/GTP-binding site motif A (P-loop) [Bru...   139    2e-31 
ref|ZP_05451279.1|  hypothetical protein Bneo5_12267 [Brucella...   139    2e-31 
ref|YP_001370665.1|  protein of unknown function DUF463 YcjX f...   139    2e-31  Gene info
ref|ZP_05342686.1|  amino acid regulated cytosolic protein [Th...   139    2e-31 
ref|YP_001203563.1|  hypothetical protein BRADO1433 [Bradyrhiz...   139    2e-31  Gene info
ref|ZP_00959865.1|  hypothetical protein ISM_08520 [Roseovariu...   138    4e-31 
ref|ZP_01011384.1|  hypothetical protein RB2654_18948 [Rhodoba...   138    4e-31 
ref|ZP_01879761.1|  hypothetical protein RTM1035_09229 [Roseov...   138    4e-31 
ref|ZP_04680286.1|  protein of unknown function DUF463 YcjX fa...   138    5e-31 
ref|YP_682359.1|  hypothetical protein RD1_2071 [Roseobacter d...   137    6e-31  Gene info
ref|ZP_01157603.1|  hypothetical protein OG2516_14698 [Oceanic...   137    7e-31 
ref|ZP_05074422.1|  amino acid regulated cytosolic protein [Rh...   137    8e-31 
ref|NP_773893.1|  hypothetical protein blr7253 [Bradyrhizobium...   136    1e-30  Gene info
ref|ZP_05064260.1|  amino acid regulated cytosolic protein [Oc...   135    3e-30 
ref|ZP_02154616.1|  hypothetical protein OIHEL45_00872 [Oceani...   135    3e-30 
ref|ZP_05780530.1|  amino acid regulated cytosolic protein [Ci...   135    4e-30 
ref|ZP_03371934.1|  putative ATP-binding protein [Salmonella e...   135    4e-30 
ref|YP_001327206.1|  protein of unknown function DUF463 YcjX f...   135    4e-30  Gene info
ref|ZP_01901122.1|  hypothetical protein RAZWK3B_01330 [Roseob...   135    5e-30 
ref|ZP_01443237.1|  hypothetical protein R2601_19120 [Roseovar...   135    5e-30 
ref|ZP_05054222.1|  YcjX-like family, DUF463 [Octadecabacter a...   134    5e-30 
ref|ZP_01034044.1|  hypothetical protein ROS217_19402 [Roseova...   134    6e-30 
ref|ZP_02145736.1|  hypothetical protein RGBS107_09871 [Phaeob...   134    7e-30 
ref|ZP_02149650.1|  conserved protein with nucleoside triphosp...   134    8e-30 
ref|ZP_01899537.1|  putative ATPase [Moritella sp. PE36] >gb|E...   134    8e-30 
ref|NP_385912.1|  hypothetical protein SMc00467 [Sinorhizobium...   134    9e-30  Gene info
ref|YP_001533279.1|  protein of unknown function DUF463 YcjX f...   134    1e-29  Gene info
ref|ZP_05122053.1|  amino acid regulated cytosolic protein [Rh...   133    1e-29 
ref|YP_001242478.1|  hypothetical protein BBta_6674 [Bradyrhiz...   133    1e-29  Gene info
ref|YP_168345.1|  hypothetical protein SPO3142 [Ruegeria pomer...   133    2e-29  Gene info
ref|ZP_05785104.1|  amino acid regulated cytosolic protein [Si...   132    2e-29 
ref|YP_001166712.1|  protein of unknown function DUF463, YcjX ...   132    3e-29  Gene info
ref|YP_353645.1|  hypothetical protein RSP_0570 [Rhodobacter s...   132    4e-29  Gene info
ref|ZP_01741388.1|  conserved protein with nucleoside triphosp...   132    4e-29 
ref|YP_002526270.1|  hypothetical protein RSKD131_1909 [Rhodob...   131    5e-29  Gene info
ref|ZP_01752753.1|  conserved protein with nucleoside triphosp...   131    6e-29 
ref|ZP_01057752.1|  hypothetical protein MED193_09335 [Roseoba...   130    8e-29 
ref|ZP_01752315.1|  hypothetical protein RCCS2_11152 [Roseobac...   130    1e-28 
ref|YP_002281477.1|  protein of unknown function DUF463 YcjX f...   129    3e-28  Gene info
ref|YP_469838.1|  hypothetical protein RHE_CH02331 [Rhizobium ...   129    3e-28  Gene info
ref|YP_002732771.1|  protein of unknown function DUF463 YcjX f...   129    3e-28  Gene info
ref|NP_354364.2|  hypothetical protein Atu1357 [Agrobacterium ...   129    3e-28  Gene info
ref|YP_768229.1|  hypothetical protein RL2645 [Rhizobium legum...   127    7e-28  Gene info
ref|YP_002975994.1|  protein of unknown function DUF463 YcjX f...   127    7e-28  Gene info
ref|ZP_03513117.1|  hypothetical protein Retl8_22734 [Rhizobiu...   126    1e-27 
ref|YP_001978560.1|  hypothetical protein RHECIAT_CH0002429 [R...   126    2e-27  Gene info
ref|YP_002544704.1|  hypothetical protein Arad_2631 [Agrobacte...   125    2e-27  Gene info
ref|ZP_05844661.1|  protein of unknown function DUF463 YcjX fa...   125    4e-27 
ref|ZP_05091089.1|  amino acid regulated cytosolic protein [Ru...   125    4e-27 
ref|YP_614379.1|  protein of unknown function DUF463, YcjX-lik...   123    2e-26  Gene info
ref|ZP_01002493.1|  hypothetical protein SKA53_12938 [Loktanel...   122    2e-26 
ref|ZP_05128532.1|  amino acid regulated cytosolic protein [ga...   122    4e-26 
ref|ZP_05741218.1|  amino acid regulated cytosolic protein [Si...   121    7e-26 
ref|ZP_06222892.1|  conserved hypothetical protein [Haemophilu...   121    7e-26 
ref|ZP_03369105.1|  hypothetical protein SentesTyp_01553 [Salm...   121    7e-26 
ref|ZP_03401706.1|  hypothetical protein Salmonellaentericaent...   115    4e-24 
ref|YP_001754815.1|  protein of unknown function DUF463 YcjX f...   111    5e-23  Gene info
ref|ZP_01952908.1|  YcjX [Vibrio cholerae MAK 757] >gb|EAY3793...   108    4e-22 
ref|YP_003068003.1|  hypothetical protein METDI2464 [Methyloba...   101    5e-20  Gene info
ref|YP_001639253.1|  protein of unknown function DUF463 YcjX f...   101    5e-20  Gene info
ref|YP_002420894.1|  protein of unknown function DUF463 YcjX f...   101    6e-20  Gene info
ref|YP_002962835.1|  hypothetical protein MexAM1_META1p1714 [M...   100    1e-19  Gene info
ref|ZP_03342011.1|  putative ATP-binding protein [Salmonella e...   100    1e-19 
ref|YP_001924423.1|  protein of unknown function DUF463 YcjX f...   100    1e-19  Gene info
ref|YP_002502131.1|  protein of unknown function DUF463 YcjX f...  95.5    4e-18  Gene info
ref|YP_001772917.1|  protein of unknown function DUF463 YcjX f...  93.6    2e-17  Gene info
ref|ZP_03386608.1|  hypothetical protein SentesT_31815 [Salmon...  93.6    2e-17 
ref|YP_003263058.1|  protein of unknown function DUF463 YcjX f...  84.3    1e-14  Gene info
gb|ABD79012.1|  HI1637-like protein [Haemophilus influenzae]       84.0    1e-14 
ref|YP_744768.1|  amino acid regulated cytosolic protein [Gran...  82.0    5e-14  Gene info
ref|ZP_00049703.2|  COG3106: Predicted ATPase [Magnetospirillu...  80.5    1e-13 
ref|ZP_03339741.1|  putative ATP-binding protein [Salmonella e...  79.7    2e-13 
ref|ZP_03360737.1|  hypothetical protein SentesTyphi_21855 [Sa...  79.3    3e-13 
ref|ZP_06223114.1|  conserved hypothetical protein [Haemophilu...  70.5    1e-10 
ref|YP_002124450.1|  hypothetical protein MADE_00138 [Alteromo...  67.8    9e-10  Gene info
ref|ZP_04714387.1|  hypothetical protein AmacA2_05196 [Alterom...  62.4    3e-08 
ref|ZP_03525931.1|  hypothetical protein RetlC8_03862 [Rhizobi...  61.2    9e-08 
ref|XP_414522.2|  PREDICTED: similar to phosphoinositide-bindi...  42.0    0.046  Gene info
ref|XP_002392790.1|  hypothetical protein MPER_07587 [Moniliop...  38.1    0.76   Gene info
ref|XP_503221.1|  YALI0D24189p [Yarrowia lipolytica] >emb|CAG8...  37.7    0.85   Gene info
ref|XP_002084478.1|  GD12812 [Drosophila simulans] >gb|EDX1006...  37.4    1.1    Gene info
ref|YP_002497092.1|  sulfate adenylyltransferase, large subuni...  36.6    2.1    Gene info
ref|YP_001861245.1|  FAD linked oxidase domain-containing prot...  35.8    3.8    Gene info
ref|XP_001560882.1|  hypothetical protein BC1G_00910 [Botryoti...  35.8    4.1    Gene info
ref|YP_002376594.1|  Carboxymethylenebutenolidase [Cyanothece ...  35.4    4.9    Gene info
sp|Q967S7.1|GAGHB_DROME  RecName: Full=Retrovirus-related Gag ...  35.0    6.2   
ref|XP_001691649.1|  predicted protein [Chlamydomonas reinhard...  34.7    8.0    Gene info
gb|EEE26785.1|  calcium/calmodulin-dependent 3',5'-cyclic nucl...  34.7    9.0   
ref|XP_002368163.1|  calcium/calmodulin-dependent 3',5'-cyclic...  34.3    9.4    Gene info
ref|ZP_02437023.1|  hypothetical protein BACSTE_03294 [Bactero...  34.3    9.9   

>ref|YP_856412.1| Gene info amino acid regulated cytosolic protein [Aeromonas hydrophila 
subsp. hydrophila ATCC 7966]
 gb|ABK38573.1| Gene info amino acid regulated cytosolic protein [Aeromonas hydrophila 
subsp. hydrophila ATCC 7966]
Length=476

 GENE ID: 4488981 AHA_1881 | amino acid regulated cytosolic protein
[Aeromonas hydrophila subsp. hydrophila ATCC 7966] (10 or fewer PubMed links)

 Score =  429 bits (1103),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 218/235 (92%), Positives = 218/235 (92%), Gaps = 2/235 (0%)

Query  1    MLQFVPLGVGRCLFGEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCL  60
            MLQFVP  V      EP  G    ATLKQRFEQYK HLVQGFYEQHFAGFDRQIVLVDCL
Sbjct  244  MLQFVPW-VWDKPAQEPAEGT-LYATLKQRFEQYKQHLVQGFYEQHFAGFDRQIVLVDCL  301

Query  61   QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP  120
            QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP
Sbjct  302  QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP  361

Query  121  MVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLL  180
            MVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE LL
Sbjct  362  MVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGESLL  421

Query  181  LFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            LFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMS HQALPHIRLDAALEFLLGDHLE
Sbjct  422  LFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSPHQALPHIRLDAALEFLLGDHLE  476


>ref|YP_001142214.1| Gene info hypothetical protein ASA_2422 [Aeromonas salmonicida subsp. salmonicida 
A449]
 gb|ABO90466.1| Gene info conserved hypothetical protein [Aeromonas salmonicida subsp. 
salmonicida A449]
Length=468

 GENE ID: 4996714 ASA_2422 | hypothetical protein
[Aeromonas salmonicida subsp. salmonicida A449]

 Score =  427 bits (1097),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 219/235 (93%), Gaps = 2/235 (0%)

Query  1    MLQFVPLGVGRCLFGEPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCL  60
            MLQFVP    +   GEP  G+  T TLKQRFEQYK HLVQGFYEQHFAGFDRQIVLVDCL
Sbjct  236  MLQFVPWMWDKPA-GEPADGSLYT-TLKQRFEQYKQHLVQGFYEQHFAGFDRQIVLVDCL  293

Query  61   QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP  120
            QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP
Sbjct  294  QPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGP  353

Query  121  MVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLL  180
            +VSL QHLVRSGRGQARFEGI TECLALAAIKATEVGKGVA+GREFPAIRGTSLSGEPLL
Sbjct  354  LVSLFQHLVRSGRGQARFEGITTECLALAAIKATEVGKGVANGREFPAIRGTSLSGEPLL  413

Query  181  LFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            LFPGEVP+HIPPAQWWNNQGFDFQAFRPL MSAHQALPHIRLDAALEFLLGDHLE
Sbjct  414  LFPGEVPAHIPPAQWWNNQGFDFQAFRPLAMSAHQALPHIRLDAALEFLLGDHLE  468


>ref|ZP_06155087.1|  putative ATPase [Photobacterium damselae subsp. damselae CIP 
102761]
 gb|EEZ40784.1|  putative ATPase [Photobacterium damselae subsp. damselae CIP 
102761]
Length=464

 Score =  259 bits (662),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/210 (57%), Positives = 158/210 (75%), Gaps = 0/210 (0%)

Query  25   ATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIMESF  84
            A LKQR++ Y+ H+V+GFY++HF+ FDRQI+LVDCLQPLNAG  SF DM+QAI ++M+SF
Sbjct  255  AMLKQRYKYYQQHIVKGFYKEHFSKFDRQIILVDCLQPLNAGPESFNDMRQAIDQLMQSF  314

Query  85   AYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIATE  144
             YG+S+  RR+F+PRIDK+LF A+KADHVTPEQH  +V+LLQ LV      A FEGI  +
Sbjct  315  KYGRSSLLRRMFAPRIDKVLFAATKADHVTPEQHPNLVNLLQQLVNEAWHTASFEGIEMD  374

Query  145  CLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLLLFPGEVPSHIPPAQWWNNQGFDFQ  204
            C++LA+I+ATE G     G++ PA+RG S+  +P  LFPGEVP  +P   +W N GF+F 
Sbjct  375  CVSLASIQATEPGFVNHHGQQVPALRGVSMDEQPQTLFPGEVPKRLPNESFWQNNGFEFM  434

Query  205  AFRPLPMSAHQALPHIRLDAALEFLLGDHL  234
             FRPL   + + LPHIR+D ALEFLLGD L
Sbjct  435  NFRPLEQQSDEPLPHIRMDKALEFLLGDKL  464


>ref|ZP_01221055.1|  putative ATPase [Photobacterium profundum 3TCK]
 gb|EAS42347.1|  putative ATPase [Photobacterium profundum 3TCK]
Length=465

 Score =  257 bits (656),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 155/213 (72%), Gaps = 0/213 (0%)

Query  23   STATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIME  82
            +   LK R++ Y+ H+V+ FY  HF+ FDRQI+LVDCLQPLNAG  SF DM+QA+ ++M+
Sbjct  253  NIGMLKSRYKYYQQHVVKAFYRDHFSKFDRQIILVDCLQPLNAGTESFNDMRQALDQLMQ  312

Query  83   SFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIA  142
            SF YG+S+  RRLFSPRIDK+LF A+K+DHVTPEQH  +VSLLQ LV      A FEGI 
Sbjct  313  SFKYGRSSLLRRLFSPRIDKVLFAATKSDHVTPEQHPNLVSLLQQLVNEAWQTASFEGIK  372

Query  143  TECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLLLFPGEVPSHIPPAQWWNNQGFD  202
             +C++LA+I+ATE G     G + PA+RG +L GEP  +FPGEVP  +P   +W N GFD
Sbjct  373  MDCVSLASIQATEPGFVAHQGSQVPALRGCNLEGEPQTIFPGEVPRRLPNESFWQNNGFD  432

Query  203  FQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            F  FRPL   + + LPHIR+D AL++LLGD L+
Sbjct  433  FVNFRPLAQQSDEPLPHIRMDKALQYLLGDKLK  465


>ref|ZP_05884954.1|  putative ATP-binding protein [Vibrio coralliilyticus ATCC BAA-450]
 gb|EEX33547.1|  putative ATP-binding protein [Vibrio coralliilyticus ATCC BAA-450]
Length=458

 Score =  255 bits (652),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 163/237 (68%), Gaps = 7/237 (2%)

Query  1    MLQFVPLGVGRCLFGEPRRGAPST--ATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVD  58
            +LQF P     C F E  + +  +  A LK R+++Y+  +V+ FY+ HF+ FDRQIVLVD
Sbjct  227  VLQFFP-----CRFDEESKASKDSNLAMLKARYQEYQQKVVKAFYKHHFSTFDRQIVLVD  281

Query  59   CLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQH  118
            CLQPLNAG  SF DM+ AI +IM SF YG+SN  +RLF+PRIDK+LF A+KADHVTPEQH
Sbjct  282  CLQPLNAGYESFHDMRHAIEQIMHSFRYGRSNMLKRLFAPRIDKILFAATKADHVTPEQH  341

Query  119  GPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGEP  178
              +VSLLQ +V      A +E I   C+++A+I+AT+ G         PAI+G +L  +P
Sbjct  342  PNLVSLLQQMVHPAWQTASYENIEMSCISMASIQATKTGFINRGTESVPAIQGITLDEQP  401

Query  179  LLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            + +FPGEVP  +P   +W N+GF+F AFRPLP S    LPHIR+D ALE+L+GD L+
Sbjct  402  MTIFPGEVPKKLPQKSFWQNEGFEFTAFRPLPSSIDDPLPHIRIDKALEYLIGDKLK  458


>ref|ZP_02194610.1|  asparaginyl-tRNA synthetase [Vibrio sp. AND4]
 gb|EDP59856.1|  asparaginyl-tRNA synthetase [Vibrio sp. AND4]
Length=458

 Score =  254 bits (650),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/238 (50%), Positives = 168/238 (70%), Gaps = 9/238 (3%)

Query  1    MLQFVPLGVGRCLFG---EPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF P     C F    +P +G+ + A L+ R+ +Y+  +V+ FY+ HFA FDRQIVLV
Sbjct  227  VLQFFP-----CRFDAETKPVKGS-NLAMLEARYHEYQQKVVKAFYKHHFATFDRQIVLV  280

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  +F DM+QA+ +IM SF YG+S++ RRLFSP+ID++LF A+KADHVTP+Q
Sbjct  281  DCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLFSPKIDRVLFAATKADHVTPDQ  340

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  +VSLLQ +V      A +E I   C+++A+I+AT  G   +  +  PA++GT+L GE
Sbjct  341  HPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTTGFITSGDKSVPALQGTTLDGE  400

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            P+ +FPGEVP  +P A +W N GFDF +FRP+P    + + HIRLD ALE+LLGD L+
Sbjct  401  PMTMFPGEVPKKLPNAAYWQNSGFDFTSFRPMPSETDEPMKHIRLDKALEYLLGDKLK  458


>ref|YP_130621.1| Gene info putative ATPase [Photobacterium profundum SS9]
 emb|CAG20819.1| Gene info putative ATPase [Photobacterium profundum SS9]
Length=478

 GENE ID: 3123961 PBPRA2436 | putative ATPase [Photobacterium profundum SS9]
(10 or fewer PubMed links)

 Score =  254 bits (649),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 154/213 (72%), Gaps = 0/213 (0%)

Query  23   STATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIME  82
            +   LK R++ Y+ H+V+ FY  HF+ FDRQI+LVDCLQPLNAG  SF DM+QA+ ++M+
Sbjct  266  NIGMLKSRYKYYQQHVVKAFYRDHFSKFDRQIILVDCLQPLNAGTESFNDMRQALDQLMQ  325

Query  83   SFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIA  142
            SF YG+S+  RRLFSPRIDK+LF A+K+DHVTPEQH  +VSLLQ LV      A FEGI 
Sbjct  326  SFKYGRSSLLRRLFSPRIDKVLFAATKSDHVTPEQHPNLVSLLQQLVNEAWQTASFEGIK  385

Query  143  TECLALAAIKATEVGKGVADGREFPAIRGTSLSGEPLLLFPGEVPSHIPPAQWWNNQGFD  202
             +C++LA+I+ATE G     G + PA+RG +L GE   +FPGEVP  +P   +W N GFD
Sbjct  386  MDCVSLASIQATEPGFVAHQGSQVPALRGCNLEGESQTIFPGEVPRRLPNESFWQNNGFD  445

Query  203  FQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            F  FRPL   + + LPHIR+D AL++LLGD L+
Sbjct  446  FVNFRPLAQQSDEPLPHIRMDKALQYLLGDKLK  478


>gb|ABA55853.1|  hypothetical protein [Vibrio sp. DAT722]
Length=458

 Score =  253 bits (646),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/238 (50%), Positives = 168/238 (70%), Gaps = 9/238 (3%)

Query  1    MLQFVPLGVGRCLFG---EPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF P     C F    +P +G+ + A L+ R+ +Y+  +V+ FY+ HFA FDRQIVLV
Sbjct  227  VLQFFP-----CRFDADMKPAKGS-NLAMLEARYHEYQQKVVKAFYKHHFATFDRQIVLV  280

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  +F DM+QA+ +IM SF YG+S++ RRLFSP+ID++LF A+KADHVTP+Q
Sbjct  281  DCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLFSPKIDRVLFAATKADHVTPDQ  340

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  +VSLLQ +V      A +E I   C+++A+I+AT  G   +  +  PA++GT+L GE
Sbjct  341  HPHLVSLLQQMVHPSWQTASYENIEMSCMSIASIQATTSGFIASGDKTVPALQGTTLDGE  400

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
            P+ +FPGEVP  +P A +W N GFDF +FRP+P    + + HIRLD ALE+LLGD L+
Sbjct  401  PMTMFPGEVPKKLPNAAFWQNSGFDFTSFRPMPSETDEPMKHIRLDKALEYLLGDKLK  458


>ref|YP_002151103.1| Gene info ATP-binding protein [Proteus mirabilis HI4320]
 ref|ZP_03840051.1|  ATPase [Proteus mirabilis ATCC 29906]
 emb|CAR42903.1| Gene info putative ATP-binding protein [Proteus mirabilis HI4320]
 gb|EEI49157.1|  ATPase [Proteus mirabilis ATCC 29906]
Length=464

 GENE ID: 6803473 PMI1372 | ATP-binding protein [Proteus mirabilis HI4320]
(10 or fewer PubMed links)

 Score =  252 bits (644),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/214 (55%), Positives = 154/214 (71%), Gaps = 1/214 (0%)

Query  23   STATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLVDCLQPLNAGAASFGDMQQAIARIME  82
            +   LK+R+E Y  H+V+GFY  HF GFDRQIVLVDCLQPLN GA  F DM+QA+ ++M 
Sbjct  251  NIGMLKKRYEYYGQHIVKGFYRDHFQGFDRQIVLVDCLQPLNQGADVFNDMRQALTQLMR  310

Query  83   SFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQHGPMVSLLQHLVRSGRGQARFEGIA  142
            SF YGK    RRLFSP IDKLLF A+KADH+TP+QH  +VSLLQ L++  +  A FEGI+
Sbjct  311  SFHYGKRTLLRRLFSPCIDKLLFAATKADHITPDQHENLVSLLQQLIQDAKQNAIFEGIS  370

Query  143  TECLALAAIKATEVGKGVADGREFPAIRGTSLS-GEPLLLFPGEVPSHIPPAQWWNNQGF  201
             +C+ LA+I ATE G     G + PA++G  L+  +PL+ FPGEVP  +P   +W  QGF
Sbjct  371  IDCMGLASIAATESGIVDHHGEKIPAVKGYRLTDNQPLVYFPGEVPKRLPEKAFWQKQGF  430

Query  202  DFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
             F++FRP  +S   A+PHIR+D+ALEFLLGD L+
Sbjct  431  SFESFRPQQISRDSAVPHIRMDSALEFLLGDKLK  464


>ref|ZP_01984646.1|  amino acid regulated cytosolic protein [Vibrio harveyi HY01]
 gb|EDL70800.1|  amino acid regulated cytosolic protein [Vibrio harveyi HY01]
Length=458

 Score =  251 bits (642),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 168/238 (70%), Gaps = 9/238 (3%)

Query  1    MLQFVPLGVGRCLFG---EPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF P     C F    +P +G+ + A L+ R+ +Y+  +V+ FY+ HFA FDRQIVLV
Sbjct  227  VLQFFP-----CRFDADVKPVKGS-NLAMLEARYHEYQQKVVKAFYKHHFATFDRQIVLV  280

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  +F DM+QA+ +IM SF YG+S++ RRLFSP+ID++LF A+KADHVTP+Q
Sbjct  281  DCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLFSPKIDRVLFAATKADHVTPDQ  340

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  +VSLLQ +V      A +E I   C+++A+I+AT  G   +  +  PA++GT+L GE
Sbjct  341  HPHLVSLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALKGTTLDGE  400

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
             + +FPGEVP  +P A +W N GFDF +FRP+P +  + + HIRLD ALE+LLGD L+
Sbjct  401  SMTMFPGEVPKKLPNAAYWQNSGFDFTSFRPMPSATDEPMKHIRLDKALEYLLGDKLK  458


>ref|ZP_01235265.1|  putative ATPase [Vibrio angustum S14]
 gb|EAS64212.1|  putative ATPase [Vibrio angustum S14]
Length=465

 Score =  251 bits (642),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 161/238 (67%), Gaps = 3/238 (1%)

Query  1    MLQFVPLGVGRCLFGEPRRGAPSTAT---LKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF PL   +    +    A  +     L+ R++ Y+ H+V+ FY  HF+ FDRQI+LV
Sbjct  228  VLQFFPLLWNKKYTEKQLIDADESTNVGMLRNRYKYYQQHVVKAFYNDHFSKFDRQIILV  287

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  SF DM+QA+ ++M+SF YG+S+  RRLFSPRIDK+LF A+KADH+TPEQ
Sbjct  288  DCLQPLNAGPESFNDMRQALDQLMQSFKYGRSSLLRRLFSPRIDKVLFAATKADHITPEQ  347

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  +V LLQ LV      A FEGI  +C++LA+I+ATE G     G++ PA+RG  LSG 
Sbjct  348  HPNLVGLLQQLVNEAWQTASFEGIKMDCVSLASIQATEPGFVNHKGQQVPALRGVDLSGN  407

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
               LFPGEVP  +P   +W  Q FDF  FRPL   + + LPHIR+D ALE+LLGD L+
Sbjct  408  AQTLFPGEVPKRLPNVDFWQQQSFDFINFRPLQQQSDEPLPHIRMDKALEYLLGDKLQ  465


>ref|YP_001445109.1| Gene info hypothetical protein VIBHAR_01917 [Vibrio harveyi ATCC BAA-1116]
 gb|ABU70882.1| Gene info hypothetical protein VIBHAR_01917 [Vibrio harveyi ATCC BAA-1116]
Length=458

 GENE ID: 5555426 VIBHAR_01917 | hypothetical protein
[Vibrio harveyi ATCC BAA-1116]

 Score =  250 bits (639),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 167/238 (70%), Gaps = 9/238 (3%)

Query  1    MLQFVPLGVGRCLFG---EPRRGAPSTATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF P     C F    +P +G+ + A L+ R+ +Y+  +V+ FY+ HFA FDRQIVLV
Sbjct  227  VLQFFP-----CRFDADTKPVKGS-NLAMLEARYHKYQQKVVKAFYKHHFATFDRQIVLV  280

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  +F DM+QA+ +IM SF YG+S++ RRLFSP+ID++LF A+KADHVTP+Q
Sbjct  281  DCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLFSPKIDRVLFAATKADHVTPDQ  340

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  ++SLLQ +V      A +E I   C+++A+I+AT  G   +  +  PA++GT+L GE
Sbjct  341  HPHLISLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFIASGDKSVPALKGTTLDGE  400

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
             + +FPGEVP  +P A +W N GFDF +FRP+P    + + HIRLD ALE+LLGD L+
Sbjct  401  SMTMFPGEVPKKLPNAAYWQNSGFDFTSFRPMPSETDEPMKHIRLDKALEYLLGDKLK  458


>ref|ZP_01991890.1|  amino acid regulated cytosolic protein [Vibrio parahaemolyticus 
AQ3810]
 ref|ZP_05911356.1|  hypothetical protein VparAQ_19790 [Vibrio parahaemolyticus AQ4037]
 gb|EDM58239.1|  amino acid regulated cytosolic protein [Vibrio parahaemolyticus 
AQ3810]
Length=458

 Score =  250 bits (638),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/238 (50%), Positives = 167/238 (70%), Gaps = 9/238 (3%)

Query  1    MLQFVPLGVGRCLFGEPRRGAP---STATLKQRFEQYKLHLVQGFYEQHFAGFDRQIVLV  57
            +LQF P     C F EP   AP   + A L+ RF +Y+  +V+ FY+ HFA FDRQIVLV
Sbjct  227  VLQFFP-----CRF-EPESKAPKGSNLAMLEARFHEYQQKVVKAFYKHHFATFDRQIVLV  280

Query  58   DCLQPLNAGAASFGDMQQAIARIMESFAYGKSNWWRRLFSPRIDKLLFVASKADHVTPEQ  117
            DCLQPLNAG  +F DM+QA+ +IM SF YG+S++ RRLFSP+IDK+LF A+KADHVTP+Q
Sbjct  281  DCLQPLNAGDEAFYDMRQALEQIMHSFRYGRSSFLRRLFSPKIDKVLFAATKADHVTPDQ  340

Query  118  HGPMVSLLQHLVRSGRGQARFEGIATECLALAAIKATEVGKGVADGREFPAIRGTSLSGE  177
            H  + SLLQ +V      A +E I   C+++A+I+AT  G   +  +   A++GT+L+GE
Sbjct  341  HPHLASLLQQMVHPAWQTAAYENIEMSCMSIASIQATTSGFITSGDKTISALQGTTLNGE  400

Query  178  PLLLFPGEVPSHIPPAQWWNNQGFDFQAFRPLPMSAHQALPHIRLDAALEFLLGDHLE  235
             + +FPGEVP  +P A +W N GFDF +FRP+P ++ + + HIRLD AL++LLGD L+
Sbjct  401  AMTMFPGEVPKKLPNAAYWQNSGFDFTSFRPMPSASDEPMKHIRLDKALDYLLGDKLK  458