GOS 1111030

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120682281
Annotathon code: GOS_1111030
Sample :
  • GPS :41°29'9n; 71°21'4w
  • North American East Coast: Newport Harbor, RI - USA
  • Coastal (-1m, 9.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : farahetsalah
Annotated on : 2010-01-17 23:07:27
  • ayoub farah
  • chetibi salah

Contents

Synopsis

  • Taxonomy: Bacteria (NCBI info)
    Rank: superkingdom - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 2
    Kingdom: Bacteria - Phylum: - Class: - Order:
    Bacteria;

Genomic Sequence

>JCVI_READ_1091120682281 GOS_1111030 Genomic DNA
TATTGATTTGAATGAAAGAGGATTAGAATATAATTTAGTGTATATTGGATATACGATCGGACACGAATTATCACATTCGTTAGATGATTTAGGAAGTAAA
TTCGATGAGAAAGGTAATTTACATGATTGGTGGACTCCGTCAGATCGAAAGAATTTTAATAAGAAAATAAAGAATGTTATTAAGCAATATGAAACCTTTG
CAAAACGTGATGGAATTATATTTGACGCAACGATGAGTGTTGGTGAAGATTTAGCTGATATTTCTGGAATGGCATTAATTGAGGCTTATTTAATAGATAA
TCAAGTCATTAATAGCGAAACAAATAAACTTAAAAAGATTAATTTAGCACAAATGTATATGAATTTAGCTGTTCAAGCACGGCAACAAATATATAAGAAT
GCAATAAAAGCTCAATTGAAAACAAATCCGCATCCTTTAGAAAAGTATCGAACGAATTGTACATTGGCTCGTTTAGAATTATTTAAGACAATTTATGGAA
TTAAAAAGGGCGATGGAATGTGGTGGAATAATGATACTATTTGGTAATTACCTCGTTTGTTTATACGCTGGTCTTTTTAATTTACTTTAGCATAAATTCT
CTTTTTTATTTATTTATTTACTTATTTATTTATTTACTTATTTACTTTAGCATACATTCTCTTTTACTTTACTTTACTTTACTTTATTTTAGCATAAATT
CTCTTTTACTTTACTTTAGAATATGAATATTTTTAAATTATAAAAAATATAATACCAATTAAAAAATATTTTTTTGTTTGCATTATATATAAAATGCCCA

Translation

[2 - 544/800]   direct strand
>GOS_1111030 Translation [2-544   direct strand]
IDLNERGLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRDGIIFDATMSVGEDLADISGMALIEAYLIDN
QVINSETNKLKKINLAQMYMNLAVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMWWNNDTIW
[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

-Notre séquence de 800pb provient de la côte Est d'Amérique du Nord. Elle comporte 3 ORF potentiels (deux dans le sens direct et un dans le sens indirect) et on a choisit l'ORF de plus grande taille qui est en sens direct, dans le cadre de lecture 2 et de taille de 545bp. Cet ORF code pour une proteine de 181 acides aminés (ne commencant pas par une méthionine mais se terminant par un codon stop). Cette séquence parait codante ce qui a été définitivement confirmé par l'étude des BLAST (blastp vs nr et blastp) avec une multitude de séquences homologues possédant de grandes valeurs de E-value et de forts scores. Cependant, on relève que l'analyse avec swissprot diminue fortement notre nombre d'homologues en raison de sa petite taille et de sa meilleure précision (annotation manuelle). Notre ORF est incomplète en 5' et complète en 3'.


-Notre séquence semble avoir une fonction proteique qu'on retrouve dans plusieurs séquences: c'est un domaine proteique de la famille des peptidases. Ce domaine est retrouvé régulièrement dans nos séquences homologues ce qui nous pousse à donner une crédibilité à cette fonction. On note aussi que le domaine proteique choisit pour notre étude est de trés grande taille recouvrant l'intégralité de la protéine. Si on réalise la comparaison des données d'Interpro et dans le blast chez les homologues, on s'aperçoit que la plupart des peptidases de nos séquences agissent dans un processus de régulation et sont exprimés en C-terminal. Par contre, sur Swissprot nous n'avons pas de séquences homologues donc nous ne pouvons pas statuer sur la fonction biologique ici. Dautre part,Nos résultats se confirment grâce à l'alignemet multiple où on voit que notre séquence requête s'intègre bien au nivau de ces homologues avec de grandes similitudes même si elle débute tardivement(environ 50%)et que nous retrouvons une plétorie de sites conservés.


-Dans l'étude du rapport taxonomique du Blastp vs NR,on obtient dans quelle famille sont regroupées nos séquences. La forte présence des bactéries de tous genres dans les séquences homologues ayant les plus grandes E-value nous a fait choisit cette famille pour notre groupe d'étude et on a opté pour les Archaebacteries dans le groupe extérieur s'assurant tout de même qu'elles soient homologues.


-L'analyse de l'arbre phylogénétique vient conforter toutes nos supputatios précedentes. En effet, on voit deja qu'il y une séparation entre le groupe d'étude et le groupes extérieure. Notre séquence s'intègre tout à fait dans les donc on peut dire que notre séquence GOS_1111030 appartiendrait probablement aux bactériess et plus précisemment en s'intégrant dans une niche de actinobactérie (confirmation blast)


-On a pu retrouver sur notre séquence un processus biologique: processus catabolique protéique et une fonction moléculaire: activité peptidase.Par contre, nous sommes pas arrivé à retrouver le nom du gène car si on regarde à l'aide du NCBI rubrique blast les homologues de notre ORF n'en possèdent pas. On retrouve tout de meme un identifiant NCBI à l'aide du BLASTp vs NR.

ORF finding

PROTOCOLE:

a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'

b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


ANALYSE DES RÉSULTATS:


-Notre séquence comporte 800pb et nous avons retrouvé 3 ORF putatifs.



-Dans le sens direct, nous retrouvons deux ORF représenté par le cadre de lecture1 et 2. Ils s'étalent de la position 535pb à 726pb (191pb)et de la position 2pb à 547pb (545pb).


-Dans le sens indirect, on a qu'un seul ORF sur le cadre de lecture2 ayant une taille de 284pb (de la position 516pb à 800pb).


-Notre analye se portera sur l'ORF retrouvé dans le cadre de lecture 2 en sens direct en raison de sa grande taille, paraissant codant et qui se termine par un codon stop.


-Notre ORF est complète en 3' car elle se termine par un codon stop et par contre incomplet en 5' car si on regarde sur le blast on voit que la séquence query commence à l'acide aminé15 tandis que la séquence subject commence à l'acide aminé496.


RÉSULTATS BRUTS:

-Recherche de ORF en sens direct: 

>ORF number 1 in reading frame 1 on the direct strand extends from base 535 to base 726.
TACTATTTGGTAATTACCTCGTTTGTTTATACGCTGGTCTTTTTAATTTACTTTAGCATA
AATTCTCTTTTTTATTTATTTATTTACTTATTTATTTATTTACTTATTTACTTTAGCATA
CATTCTCTTTTACTTTACTTTACTTTACTTTATTTTAGCATAAATTCTCTTTTACTTTAC
TTTAGAATATGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
YYLVITSFVYTLVFLIYFSINSLFYLFIYLFIYLLIYFSIHSLLLYFTLLYFSINSLLLY
FRI*

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 547.
ATTGATTTGAATGAAAGAGGATTAGAATATAATTTAGTGTATATTGGATATACGATCGGA
CACGAATTATCACATTCGTTAGATGATTTAGGAAGTAAATTCGATGAGAAAGGTAATTTA
CATGATTGGTGGACTCCGTCAGATCGAAAGAATTTTAATAAGAAAATAAAGAATGTTATT
AAGCAATATGAAACCTTTGCAAAACGTGATGGAATTATATTTGACGCAACGATGAGTGTT
GGTGAAGATTTAGCTGATATTTCTGGAATGGCATTAATTGAGGCTTATTTAATAGATAAT
CAAGTCATTAATAGCGAAACAAATAAACTTAAAAAGATTAATTTAGCACAAATGTATATG
AATTTAGCTGTTCAAGCACGGCAACAAATATATAAGAATGCAATAAAAGCTCAATTGAAA
ACAAATCCGCATCCTTTAGAAAAGTATCGAACGAATTGTACATTGGCTCGTTTAGAATTA
TTTAAGACAATTTATGGAATTAAAAAGGGCGATGGAATGTGGTGGAATAATGATACTATT
TGGTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
IDLNERGLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVI
KQYETFAKRDGIIFDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLAQMYM
NLAVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMWWNNDTI
W*

No ORFs were found in reading frame 3.


-Recherche ORF en sens indirect:

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 516 to base 800.
GCCTCAATTAATGCCATTCCAGAAATATCAGCTAAATCTTCACCAACACTCATCGTTGCG
TCAAATATAATTCCATCACGTTTTGCAAAGGTTTCATATTGCTTAATAACATTCTTTATT
TTCTTATTAAAATTCTTTCGATCTGACGGAGTCCACCAATCATGTAAATTACCTTTCTCA
TCGAATTTACTTCCTAAATCATCTAACGAATGTGATAATTCGTGTCCGATCGTATATCCA
ATATACACTAAATTATATTCTAATCCTCTTTCATTCAAATCAATA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
ASINAIPEISAKSSPTLIVASNIIPSRFAKVSYCLITFFIFLLKFFRSDGVHQSCKLPFS
SNLLPKSSNECDNSCPIVYPIYTKLYSNPLSFKSI

Multiple Alignement

PROTOCOLE:

phylogeny.fr/ Muscle/ CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Toutes les séquences utilisées dans le site ont été préalablement mises sous format FASTA manuellement.


ANALYSE DES RÉSULTATS:


-Toutes les séquences utilisées dans le site ont été préalablement mises sous format FASTA manuellement.


-Notre ORF commence très en retard par rapport aux autres séquences(environ 530eme a.aminé). D'autre part, les séquences ont des tailles plus ou moins semblables mais seule notre séquence a vaiment une taille réduite.


-Cet alignement multiple nous permet tout de même bien de confirmer que notre ORF s'intègre tout à fait à ses homologues avec une multitudes de régions conservées (glycine, histidine, tyrosine.....)preuve d'une bonne similarité.

On en déduit donc qu'il y a une bonne concordance entre les informations tirées de la fiche protéique ( domaine peptidase) et celles de l'alignement multiple (bonne conservation de sites) qui nous assure dans nos hypothèses au sujet de notre séquence requête.


-Ainsi ces résultats sont donc de bon augure pour l'obtention d'un arbre phylogénétique.

RÉSULTATS BRUTS:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment



Euryarch3       ---------------------------------------------------MVCG-----
Euryarch5       ------------------------------------------------------------
Euryarch2       ---------------------------------------------------MAGR-----
Verrucom1       ---------------------------------------------------MISRRLLPL
Euryarch1       --------------------------------------------------MKYILLTILL
Euryarch4       --------------------------------------------MKKNGIISLFTFGILL
Bacteroi2       --------------------------------------------------MKFLSLKTCF
Gammapro1       --------------------------------------MRKVLIGGLCASLIMGLTACNQ
Acidobac1       ------------------------------------------------------------
Alphapro1       MPEVRWGGIFFCFRTLRWMGLPRTPAPEERKRRLHLSKLLSRSSLRGALLLSAALVGATA
Alphapro2       ----------------------------------MKQILMSCSALAVLSLAACGPTDAPE
Actinoba2       ------------------------------------------------------------
Actinoba3       ------------------------------------------------------------
Actinoba4       ------------------------------------------------------------
Actinoba1       -----------------------------------------------------MGTVAGA
Fusobact1       --------------------------------------MKKLVIISLFLASINLIYAENT
Fusobact2       ------------------------------------------------------------
Bacteroi1       -------------------------------------MMRKTVKTALLFSSAALIVACG-
Bacteroi3       ----------------------------------------MSLKNTLLASCAVAIAVTS-
Firmicut2       --------------------------------------------------MNRFKIRGGL
Firmicut4       ------------------------------------------------------------
Firmicut5       ------------------------------------------------------------
Firmicut6       ------------------------------------------------------------
Firmicut1       ----------------------------------------MKNYKFTKRLTSFMLLITIL
GOS_111103      ------------------------------------------------------------
Firmicut3       ----------------------------MYRIGFKGMVKEKNKMRHIKCMAAKGMIAGAM
                                                                            

Euryarch3       ----------AKMKKKTYQKSK---------------------------------RYIGF
Euryarch5       -------------------MDK---------------------------------ENIGF
Euryarch2       ----------LDGIPIISEKEKP--------------------------------EKPVF
Verrucom1       IAVLPAAAPLAASVAAAEASRPL--------------------------------VDPGF
Euryarch1       I--VCLACAGCADPAGTAVPGDV--------------------------------SQSPG
Euryarch4       VNTLTIVVLGSSETLRSNMSTSE--------------------------------KEKAF
Bacteroi2       T------VLGIAAISYSAHAQSA--------------------------------T-KFI
Gammapro1       EKAAETKAPEVAKTAAAEAVAKA--------------------------------LGSGI
Acidobac1       ------MWKRVVFVSLLAAVCFA--------------------------------QHSGI
Alphapro1       GVPAPAHAAAPSAPTTQPAPASF--------------------------------GSWGV
Alphapro2       SNTSAQTETAAQTETAQSGAPVY--------------------------------GEFGF
Actinoba2       --------------MTTTEAAPS--------------------------------PAADD
Actinoba3       --------------MTTAHRS-------------------------------------GI
Actinoba4       ------------MPIS------------------------------------------GI
Actinoba1       GVLAACGGTGTPGGPSTTRRPYS--------------------------------SLTGP
Fusobact1       SVPTTVALKKDNRKSGNAATTVTPPATTEKKNPRASERRSDFWDFYERKQSELLKENDKD
Fusobact2       ------------------------------------------------------------
Bacteroi1       ---------ENNKKSENAMTDKN--------------------------------ADKGI
Bacteroi3       --------------CKEPVKDYP-----------------------------------GL
Firmicut2       G-----------------------------------------------------------
Firmicut4       ------------------------------------------------------------
Firmicut5       ------------------------------------------------------------
Firmicut6       ------------------------------------------------------------
Firmicut1       LQSFNLKIFQVNALAAENIIKSD-----------------ISQIR---------------
GOS_111103      ------------------------------------------------------------
Firmicut3       AVAVAATVWGCSAGRTEQDPGTG-----------------MESQAGMDGDGQAVTASRQP
                                                                            

Euryarch3       SVKNMDLKVDPFNDFYLYSCGTWIKRHPLPRDKTRTGSFTALTERNYEILKKIAVSCAAR
Euryarch5       SLEYMNRNINPDENFYEYACGKWLERTVIPAHRSRYNTFMMLYERNMEILKDICE-RSSR
Euryarch2       CINYVDKSYDPMEDFSIYSYGKWVKSHPVPEDKYVYDASTELMEWNNFILGKILE-SCAR
Verrucom1       AIERMDLSVAPGTDFARFAAGKWYETTQIPADKSRWGGFDELREQNWAALREIVEETAAQ
Euryarch1       SGFALNESVHPGDDFYAYVNDAWIAEHPIPADKQYYAVFTGMRDGVDNDLRALLEDAADA
Euryarch4       DPESMNLSIKPGDDFYEYAEGDWIKNHPVPPDKSRYGEFAIVKDRNYDRVKEIMERAASN
Bacteroi2       DPANMDRSVKPGDDFYRYANGTWIKNNPVPAKETRWGSFNALRDFNINAVKGLVEDAAAS
Gammapro1       EFANFDKSVRPQDDFFDYVNGTWYKNTEIPGDRTSTGAFYDLREKSRDDVKAIIDEVAAT
Acidobac1       DRTSLDPTCKPCQDFWRYANGGWLDKNPIPARFPSWGPASVLSENTRANLRGILEAAKGT
Alphapro1       DLEGRDLSVKPGNDFFRYANGTYLDHLQIPADMTSYGPFNALAELSRTRVQGILNDLSAH
Alphapro2       DVAGMNTDVDPGDDFNQYANGGWIDGTELPGDRSRFGMFTVLSEEAEEDVQAIIFEAGEA
Actinoba2       PTAAADPAVRPQDDLYRHVNGTWLRTHEIPADRARDGVVFDLRDQAELDVRAIVEESGAG
Actinoba3       DLTHLDGDTRAQDDLFVHVNGKWLAEYEIPADRAVDGAFRTLYDKAEEDVQTIITEAAE-
Actinoba4       DLSTIDHTVRPQDDLYQHVNGAWLKATEIPDDRPLEGTFTALRDGSELAVRDIIEEAAA-
Actinoba1       DMSGAAPGVRVQDDLFRHVNGAWYDSFQIPPEKPSGGGMETLTDQVEKQLREIIESIRD-
Fusobact1       LFTNTSKDVDAQEDFYTYVNEKWEKNTKIPDTKPAWGSFYELNEKNQD-FLRNLIKELKE
Fusobact2       ------------------------------------------------------------
Bacteroi1       ALAEMDTTVRPQDDFYNYVNGTWAKTAKIPADKPTWGSFHILREKTDENCLLILDNLLKE
Bacteroi3       DMTAMDTSVSPKDDFYRYVNGKWIDSTEIPADQTVWGGFNKLRKDTDADMLAILDRAMND
Firmicut2       DSAVANPDVKLQDNLYLATNSNWLEHAEIPADRPMIGGFTELDIKVKKQLSQDFDNFASN
Firmicut4       ---MTLP--RIQDDLYLAVNGEWQAKTPIPPDKSVVSADSNLTDDIRQKLVADLSTMMQT
Firmicut5       ---MTTY----QDDFYQAVNGKWAETAVIPDDKPRTGGFSDLADEIEALMLDTTDAWLAG
Firmicut6       ---MTTY----QDDFYQAVNGKWAETAVIPDDKPRTGGFSDLADEIEALMLDTTDAWLAG
Firmicut1       ----------LEDDFYTAINREWLENTKLENGYISYGTFEELCGRVNGEIYNIIQEIKEH
GOS_111103      ------------------------------------------------------------
Firmicut3       SASGQGSAPDYVDDFYNAVNHVTLDGWEIPADQPEMSWFRKVSEENYNKVNDMIRKVSSG
                                                                            

Euryarch3       R--------------SSV-GNLRVIGDFYNSFMDTKTVEEAGFGPVEELMSRIKRAKSYR
Euryarch5       N--------------PKN-SVERIVGDFYASAMDIDLIEKNGSRPLKKVFEIID-NISFD
Euryarch2       N--------------SQN-PAERALGDFYISIMDVDGIEKNGFKPVSRFMEIIDRIDSKN
Verrucom1       P--------------AAAGSVPQKVGDFYASAMDTARINALGLKPIEADLAAIADAKDKE
Euryarch1       PE-------------SADRN-ATLLGTFYRSGMDTGTIDREGLDGLSDLLAAIDAIDSRG
Euryarch4       TS-------------APDGSLEQKIGRFYSMGMNNATLEKQHLDSIKSELKMIDNISNAS
Bacteroi2       KS-------------AQPGSVVKRVGDFYTAAMDSLTIEKLGYAPIKAELAKIRQLKNIS
Gammapro1       PN-------------LKEGTDEQKVADQYRAFMDVETLNKLGITPIQPELDAIAAIQTKD
Acidobac1       -----------------------KAGDVYAACMDTAAIDAAGVKPLQPYFDRVAAIGSAK
Alphapro1       PV-------------ENPRSIEEKLGTFYASYMDEAAVESLGTRPLKEDLDAIRAIKTPS
Alphapro2       DA-------------EAG-SNNQLVGDLYASYMNEAAISEAGTAPLEPYLAEINAVESLD
Actinoba2       TLD------------APDADEARKIAALYRSFMDTEAIEAAGVAPLAPDLALIENATDRS
Actinoba3       -SN------------SAAGTDAQRIGDLYSSFMDADAVEAAGLSPIDDELDAVADAPDRS
Actinoba4       -KG------------DAASGIERKIGGLYNSFMDEAVAEAKGIEPIRQRLADVYATGSAT
Actinoba1       ---------------AKAGSDEAKIRDTYRTFMDTAKIDAVGTAPLRSTLSAIDGAADRA
Fusobact1       KPA------------KSLTADEQKVITLYDSYHDIEKRNKEGLEPLKKDLDKINAIQNID
Fusobact2       ------------------------------------------------------------
Bacteroi1       NFA------------QG--TEGQKIKDLYESFIDWKKRDAEGLKPIEGYLNKIEAIKNLT
Bacteroi3       K-E------------LDQSSDQAKAVFVYQSIMDTDARDNAGYEPLKPYLAQIEAVKSVD
Firmicut2       DKS------------LPKIANLDKAVRLYQLALDFKQRNADGAQPIQTDLQKLTSLKNFS
Firmicut4       AKT------------LP----LQYAARLFAKANDQTRRQQLGIEPVRDRISFLMTLTTLD
Firmicut5       -DH------------VPDDAILANFVKFHRLVADYAKRDEVGVSPILPLIEEYQSLKSFS
Firmicut6       -EN------------IPDDAILKNFVKFHRLVADYAKRDEVGVSPILPLIEEYQSLKSFS
Firmicut1       R------------KCYGENSEQLKILNLYSNFLDMKKRNKMGIKP-IENYMKNIDKIKTL
GOS_111103      ------------------------------------------------------------
Firmicut3       TGSREDGGGTPAQSDTGEIRDQENIRALNLTGLDREAREKGGYGQRAGEFLNKIEDAGTV
                                                                            

Euryarch3       DILKIMPDMMLNGADP-LFDVYSTEDSRDSSVYALYVWQGGISLPDRDYYLKGEFKA--I
Euryarch5       KLPEDLARLTMSGIPI-FFDIGSEGDLKNSDVYALYISQGGLSLPDRDYYINDMFSG--V
Euryarch2       NIIETFGEFNTMGISG-LFSFDSMPDEKNSSVYACYLNQDGLSLPNRDYYFDDSFKE--I
Verrucom1       ALFHQVAQMHLRIGSP-FLGLAFFPDQKQSDVYGFYLFQGGLSLPSKEYYFSEKFAR--E
Euryarch1       DLTETTIVLLEQGFPP-VYFYGAGTNPENSSEMIPCLYQGGIGLPDRDYYFRNDAGSPGL
Euryarch4       DLQTVSTQMMEYDLDT-FFSMYAAPDKKNSKIMIATLTQGGLGLPDRDFYFRQDNESIKI
Bacteroi2       GVLDQTAYLRVNGIAAPMFSFGVGQDRKNVNKYLPQLGQGGTTLPDRDYYLKDDSRSVKI
Gammapro1       DLVKFFAHSQIIGGGT-PMAFYIDVDAKDSSRYATHLWQYGLSLPEKDYYFNEEERFVNI
Acidobac1       ELSAGLVAAQSVTGVG-PFTLQQLGDLKNSKDIILYVDSGGLSLPERDYYFKDDARSKQI
Alphapro1       DLAALTGSCPGN-FQFSPFSLGINPDAKDPTRYALNLDQAGLGLPDRDYYLKP--EFASK
Alphapro2       DATALFASVH----HQSPYGFAVWADPADPSVNALRLFQGGLGMGNRDYYLDEGERFQQY
Actinoba2       ALARAMGTLQRTGVG-GALGMWVDTDADDPTAYRAYLYQSGLGLPDESYYRSEEQAT--T
Actinoba3       SLATVIGRHQRVGVG-GAISHYVDTDAKNSERYLIHFSQSGISLPDESYYREDNYAE--I
Actinoba4       DLLALAGRLFRSDVG-GLFYIYPAPDAGNPDRVLLYTGQGGLGLPDESYYRDEKFAP--T
Actinoba1       ALFDVVGAQQRTDGGWGVVGVSVSPDRKNSTRNLVHLTPTMGGLPSKAHYLDAQMQD--V
Fusobact1       DLKKYNIEVTKVGNSE-FYGWGIGTDLNNSKNNAIYLGSAGIGLSRDYFQ-KNTKENKAI
Fusobact2       ------------------------------------------------------------
Bacteroi1       DLQKYLEEVTREGENP-ICAWGVYADMKDSNMNTVYLGNFSIGMGRDYYQ-KDNKENTEA
Bacteroi3       EIPTLLAELSSKGLRG-FYGFGVGPDAQDTDINVAQMRPGSLGMQREYYVDLDDADNVEK
Firmicut2       DFDKHTVDLVKSALAF-PFNLSVDVDMKNTTKNALYFSSPETFLPDAGNYKDSSAD--QL
Firmicut4       QFRAAMPKLVADQYVL-PISPYVDADMHDAEHNILNLGGPDTILPDAAMYQQEDAENAAD
Firmicut5       EFVANIAKYELAGLPN-EFPFSVAPDFMNAQLNVLWAEAPSILLPDTTYYEEDNEKAEEL
Firmicut6       EFVANIAKYELAGLPN-EFPFSVAPDFMNAQLNVLWAEAPSILLPDTTYYEEGNEKAEEL
Firmicut1       DELR--DIFYEEEFTYFQPLINIGVGADYKDSNMNVLYFGSSNLVLGNSLYYKSESYENI
GOS_111103      ------------------------------------------------------------
Firmicut3       GELLSASLRFQKDYGIYSLAGLVYTGDSDDSSVKSLYWLKPDTGLKREVWFSEEESNKKR
                                                                            

Euryarch3       RSKYLDHMTRMFALYGIPAKDART-HARAVLRIETALARASRSAADTRDEVKNYNKYELK
Euryarch5       ISKFNDHVKNMMDILGY-----SI-DYRNLINIEKSLAEHSKSREDLRDLEKLYNKMSIK
Euryarch2       RAQYINHIKNMFILYGFDDKTSEN-MGNTVLKIETSLALKSRSPVELRDPDKNYNRFQFN
Verrucom1       RWEFVGHVAKMLELAGEPRAAAFQ-QAETVFALEKALAENAKLPVELRDRLANYNKMTID
Euryarch1       RDAYREHIARVLVLAGRSPEEAAA-DAKTVYAMEAALAAAHLGREENRDPQKTANIHTLA
Euryarch4       REQYLTHVTRMFVFLGDSPEIAEN-NARTVMRIETRLANASFTNVEDNDEVKTYNKMSLE
Bacteroi2       REAYNTYLTTLFKLTGSTAAEATK-KAAVVMAIEKQFAEAQMSRLEMRDPYKTYNKFTLT
Gammapro1       REAFKAHIEKMYELAGLS--GGKE-AAETVLKLETAIANAHWNVVDVRDSTKTYNKFQVS
Acidobac1       REEFVKHVARMLELAGTQPEAAAA-QAQTILAFETKLADATKTAVQRRDIPAMYHKVDFA
Alphapro1       KKAYQAYVEKALTLADWP--EPAK-AATAIVTFETRLAKAHWARETLRDPQKTYNPMTVA
Alphapro2       RDAYVAYIARIFELSGIE--GGQE-KAEAILAFETRIADAHWTREDSRDVTLTYNVMSVA
Actinoba2       REAYVAHVARMLRLAGVAADAEADAVAGRIMDLETRLAAAHWDRVRDRDAVATHNPTAWA
Actinoba3       REKYVAHIDKMFTLAGVGYDAQ------RVFELEKKIAAGHWDVVKRRDADLSYNLVGFE
Actinoba4       VAAYRTHVATMLALAGR-EDAES--AADRVVDLETKLASHHWDNVTLRDPQKTYNLKTAE
Actinoba1       RDKYREFMRKTAELAGFADPAGT---ADRVIAVETNLARATWEREKYRDDNATYNLYQWT
Fusobact1       LDEYTKYVSDMLKYLG--ETNTLE-KAKKIVAFEKEIAETLLTNEERHDVTKYNNPIAVS
Fusobact2       ------------------------------------------------------------
Bacteroi1       LQKYQDYVKAIFKVLK--DDKAAE-KAKQMVDFERSVAKLMLTNEEDRNPNLSYNPQTMA
Bacteroi3       LAAYEKHVARMLTLTGTDATQAAQ-DAKTVIAIETQMAQPRLDKVARRNPQLSYNPMSYD
Firmicut2       LTIFEKQSVQLLKLAGFNENESKK-YAANAIKFDKLLAKYKKSQEELNDIAGIYNPYSIS
Firmicut4       LAAWSQMAAAMLAAAGFSQTDQTA-YVEAAKRFDRRLADYVPANVDLAVDSTYDNPLSWQ
Firmicut5       RGIWRQSQEKLLPQFGFSTEEIKD-LLDKVIELDKQLAKYVLSREEGSEYAKLYHPYVWA
Firmicut6       RGIWRQSQEKLLPQFGFSTEEIKD-LLDKVIELDKQLAKYVLSREEGSEYAKLYHPYVWA
Firmicut1       RKEYIKYIEKLHRLYGEDKKKSRE-NAERFYNIERKIAEGIPTYQEEAKDNNRFNNTYNI
GOS_111103      ------------------------------------------------------------
Firmicut3       VEEYKRYLTRLHESNGMDTREAGE-TVERVTAMMKDLASSSLKIEETYDAKKTNN----V
                                                                            

Euryarch3       TVRNRYLNLEIDRLVRKLGAG----NAAYVIVGQPEFLEAAN-KLVKSSSIYDLIAYFEW
Euryarch5       DLDERYNNLGISRYLNSLGV-----NADYAIVATPDYLSFLN-GFIKDVDINDIKEYFKW
Euryarch2       DIEKEFPGLRHREYFSKIGLT----GLDYIIIGQPEFFRDLD-SIIQQYTLDDWKIYMKW
Verrucom1       AAASAYAGLPLKQLVQELGVPA---TVRDVIVGQPKFFEGLS-KELQARSLDELKVYTRW
Euryarch1       ELEERYPAVGWGTLAAIPGSG----SVGRVHVYQPGYVEELD-SLLATAPLDDWKVYLRY
Euryarch4       ELQAFAPGINWSCLFVSLGHP----DVAEVNVRNPSYFKELS-SALQDENIDDWKTFLRW
Bacteroi2       DFNKTTPRISWPQLFSKLLVN----GQDTVLVSSPKFFVSLN-DMLESVPLNEWKTYLEW
Gammapro1       ELATLAPDINWQLYLTTLGAD----KQGDIIINQPSFIEGLN-ALVKTEDLATWKTYLQW
Acidobac1       GLTAMAPDFDWKLLFNELHLS----TSAPINVTEPEFLKRFN-QQLTSESLADWKTWLRW
Alphapro1       DLAKNAPGFEWSIWLSAAGLPEQGLDKRVLIVGEPSAITEEA-RVVADTDMDTLRAWLAA
Alphapro2       ELDELAPALNF-----PEGMANLGLNVDELIVVQPTAIAQTS-AILEDTDLETIKDWMAF
Actinoba2       ELADVARGFDADAWAEGLRVPAD--AFDVVVLREPSFFAALG-EAWTDVPLEQWREWLTW
Actinoba3       ELTEQNPGLDWAAWLSGLGADSE--KFAEIVVRQPDFLHTFT-ALWASESLDDWKAWAAW
Actinoba4       QAGELFP--LLATWFEAADIAGE--KRQEIVVSTPDFFSGAA-ALLDTEPLDAWRDWLAM
Actinoba1       QLADLAPGFDWLRWRDLQGLTSE--TSKEVVVMQPDFLPAAA-TIWAKTDIEALKDCARM
Fusobact1       ELGTLSKNVDLADYLKQLNVK-----TDKVIISELNYYKNLD-KFVNNGNIDTIKEYMKY
Fusobact2       ------------------------------------------------------------
Bacteroi1       ELSKLVKNLNLPQFLKNVGVN-----TDKVVVSEIRLYKQYD-KFINEKNLPLIKDYLKY
Bacteroi3       EFKTLVPSIDWDEYFDQLEVKD----FDRIVVSQPEYMTALN-SMWDDSNLEAMKTYMRW
Firmicut2       DFKAAFTNMNIDQLLNGLLPN----SPEKVIITEPKFLQHIN-ELLSPDKFEELKSWLVV
Firmicut4       AFEDAAGYLGIPQAFATYMLQ----TPAKVNAVVPAYLPHLS-KLLTADNYSEWHAWMVI
Firmicut5       DFKKLAPELPLDSIFEKILGQ----VPDKVIVPEERFWTEFAATYYSEANWDLLKANLIV
Firmicut6       DFKKLAPELPLDSIFEKILGQ----VPDKVIVPEERFWTEFAATYYSEANWDLLKANLIV
Firmicut1       MTVKELEDISPNIKIGEMLKKFN-IINPKKIIVENPSNIRFVDSLVNEDNLEDMKIFFKT
GOS_111103      ------------------------------------------------------------
Firmicut3       YTARDASAIYPEALSMELLSGIYGIREDEKTVVVEPDVCRKLGTYLTEDNLPLLKEYVKT
                                                                            

Euryarch3       NLLYSSAGLLHSAAVKENFDFFGRQLLGQKAMQPRWKRAIGMINSMVGESIGELYVKENF
Euryarch5       HAINAYAPYLSNDFVMENFNFFGKILTGKEKIEERWERAIRVIDSSIGEALGELYVNERF
Euryarch2       NVLNSAAPFLFGDVEMEHFDFFQRKLLGQQLPAKRWKKAVSIIDSFMGEALGKIYVEKQF
Verrucom1       QLLRAAAPLLSEPLEAESFRFYGTVLNGTPQQEPRWQRATKAVDGAIGEALGQLYVEKRF
Euryarch1       RLIDQASPYLGASFEEEHFAFYETTLYGVPEMKPRWQRVVAAESEFLGDLVGRAYVTGYV
Euryarch4       KLILGTSPYLSSDVEEEHFDFYGRKLNGQQEMKPRWKRVIDAENEAMGEAVGRVYVDRYF
Bacteroi2       NVLKSAAANLSSPFVNATFAFNQAQT-GQKVQTPRWQRMSQLTDGTIGDLVGQLYVARYF
Gammapro1       QTLTHAAGQLTEALDQENFEFFSKTLNGQAEQQPRWKRAVASVNGMLGEVVGKVYVKHHF
Acidobac1       RLLTGSAGRLAKPIFDENFHFRSTVLTGVTEQQPRWRTCVGMADGSVGEELGKLYVDKYF
Alphapro1       HLVENATSYLPDRFEQARFALT-KSLTGQPSLPARWKRGVQATSSAMGMALGKVYVQRYF
Alphapro2       NFISDRAGWLPTEFEDANFDFFGRTLRGQTEQRPRDRRAVNLVGGALGHAVGQIYVERHF
Actinoba2       RVVRSRAPYLTDEIVTANFDFYGRTLTGAQELRERWKRGVALVEGALGEAVGRIYVQRHF
Actinoba3       KVLHARSPYLHSALVDETFAFYGTTLSGTEENRERWKRGVSLVQDLLGEAVGKLYVDRHF
Actinoba4       RVISAAAPYLSQAVVDANFAFYGTTISGTPRNKDRWKRGVAVVEAALGEAVGQIYVARHF
Actinoba1       GIISTYADVLPQAFGDARFEFYERTLDGAQKQEERWKMGVTMVNTTLGEALGRLYVQKHF
Fusobact1       NLIKSAASVLTDDLGKRSYEFYGKYLSGQKERETLEKRALDFTDGALGEIIGKIYVQRNF
Fusobact2       ------------------------------------------------------------
Bacteroi1       QLVADNASNLTKELDELSFNFYNKELQGQQEQRPMNKRALSVINGILGEAFGKLYVEKYF
Bacteroi3       TMVDAAATMLSTELEDANWDFYSKTMRGAKEQRPRDERALGTVNGTLGEALGQLYVSEKF
Firmicut2       TFINHYATYLSQEFR-EAAFAYDHAVYGAKELQSQAQHAYGIANNILGEVIGLYYGQTYF
Firmicut4       NELLTCATYLSDDLR-QLAGQYDRFLAGQPEASSWTKHAFGIANEYFDDVIGQYYGQTYF
Firmicut5       DAANAYNAYLTDDIR-VESGAYSRALSGTPQAMDKQKAAFYLAQGPFSQALGLWYAGQKF
Firmicut6       DAANAYNAYLTDDIR-VESGAYSRALSGTPQAMDKQKAAFYLAQGPFSQALGLWYAGQKF
Firmicut1       IVLLNTDNLLTNDFR-KASSDLKKELYGVEVVDLTESGAVKFTTCNLCEITSKLYVDKYF
GOS_111103      ------------------------------------------------------------
Firmicut3       CLYADLSAMTDMESL-NAAQEYQMAVSGTEEKKPFERTVSESVQQELGFQCGRLFCLKYF
                                                                            

Euryarch3       SPAAEARAKALVKDIRNAFGARLERLEWMQPSTKKKALEKFDAMNTKLGHPKRFR-DYSR
Euryarch5       GPAARQKAETLVNDVLSAFKSRLENIEWMSNETKKKALEKLSMFKTKIGYPDHFR-DYSS
Euryarch2       GEDSKRRMDDMIEDLKEVFIERINNLSWMGRETKEKALEKFSKFRAKVGYPSKYI-DYSS
Verrucom1       PPAARARMMELIENVKAVMRDRLAQLEWMTEPTRQKALEKFSRFRAMIGYPAKWR-DYSS
Euryarch1       DPRTRGMVSGMVVAIRETFDARMADLTWMSEPTKAAAREKLAAMGEKIAYPDRWT-DYSG
Euryarch4       DPGSRARMQEMVLNLKTAFRERIQDLTWMEPETKKEALKKLEVLEVQVGYPDEWL-NYSE
Bacteroi2       KPDAKVRMDELIANLRKAFEIRIKNLDWMSEVTKQKALEKLHAFVPKIGYPSKWR-TYQG
Gammapro1       TPEAKARMQDLVENLRGAYGKSIDELSWMSPDTKVAAKDKLAKFNPKIGYPNKWE-DYSK
Acidobac1       PPQSRQRAKDLVENLRVTLGEQIQGSEWLAADTKRNALLKLKAFNSKVGYPDRWR-DYSG
Alphapro1       PPENRTTMQKLTTDLKDAFRVRLRNNTWMSPATKQAALRKLENFEIQVGYPNKWR-DYAS
Alphapro2       PPSSKTQMEDLVARLTTAFESRLENLEWMDDETRAEALTKLAGFEARIGYPEIWD-SYEG
Actinoba2       PPTHKARMDTLVANLVEAYRRSITSLDWMGPDTRERALAKLAAFTPKIGYPVRWR-DYSS
Actinoba3       PAEAKTRMLELVANLQEAYRRNISDLEWMSPQTREAALAKLEKFTPKIGYPDKWR-DYAG
Actinoba4       PESHKARMQTLVGNLIEAYRSSINEVGWMGADTKAEALRKLDGFRAKIGFPDEWI-DYSA
Actinoba1       SAESKRQVEKLVENLKSAYRSAFERSQWMSPPTRTAAIAKLDKMTTKLGYPDKWE-DYST
Fusobact1       SPEAKKNTQKMVEYIKKAMKNRIEKLDWMTNATKKKALEKLAKVNVKIGYPDKWR-DYSK
Fusobact2       ------------------------------------------------------------
Bacteroi1       PPKAKEEMVTLVDYLKKSFAQHIKDVTWMSEATKEKALAKLNKFTVKVGYPDKWE-DYSK
Bacteroi3       PAEAKAKAKEMIEYVKKAYEVRINGLDWMSPETKVKAIEKLNGMTIKIGYPDQWK-DYSE
Firmicut2       GPEAKADVEQMIRKILATYKARLQTNDWLTSSTQKQALKKLDAITLKIGYPDKLS-DLYD
Firmicut4       GADAKADVTAMVKQILAQYRVQLENNTWLSPATKQKAMRKLATMQVKMGYPERLF-SLYD
Firmicut5       SPEAKADVESKVARMIEVYKSRLETADWLAPATREKAITKLNVITPHIGYPEKLP-ETYA
Firmicut6       SPEAKADVESKVARMIEVYKSRLETADWLAPATREKAITKLNVITPHIGYPEKLP-ETYA
Firmicut1       DKECKDEVSTLCDEIIDNYRYRLNNVEWMTEETKEKALEKLDNMNVKIGYPDSWG-EYND
GOS_111103      ----------------------------------------------------------ID
Firmicut3       DDDAKQDVTDIVRKVIDVYDRRLADMEWMTETTRSEARKKLAAIMVKVGYPEQWPQDRYS
                                                                            

Euryarch3       VKTAP----NNLFGNFLSAYRFELHRRMS---RIGKKVDKNEW--HMNAHTVNAYYDQSK
Euryarch5       IEIRR----DDYPGNVLRSMVFELKRQLN---RIGRQVDKGEW--EMTPPTVNAYYNPVN
Euryarch2       IKISQ----DRLFENIINCNKFELERETK---RIGKPVDKELW--EMTPPTVNAYFSPTD
Verrucom1       VEIKR----DDYFGNAARAAYFNSRRVID---RLGRKVDKDEW--GMTPPTVNAYFSSVT
Euryarch1       LNLS-----DSYVENVRAAKAHAFIHGPEGLERVGGPVDPGTW--FITPQTVNAYYDPTR
Euryarch4       LEVKN----DSYAMNVLRASKFKFHHGPSGLDRIGQPVNRKLW--EMNPQETNAYADYNK
Bacteroi2       LVISP----NAYLQNLRNAGTWAYKEMVS---QLGKPVDRTRF--GMTPPTVNAYYSPTM
Gammapro1       LTIKA----DDLVGNAKRAAALQHEKDLA---KLGAPIDRDEW--HMTPQTVNAYYNPTM
Acidobac1       LKVDA----KSYFENAVASYRFERAYQMS---KIGKPIDRNEW--EMTPPTLNAYYNPLM
Alphapro1       LDVHK----GDVYGNARNGVAYEWRYWLA---RLDQPVDRDEW--DMTPQTVNAYNNPLF
Alphapro2       LEISA----DDYFGNRTRMAEFNWAEQIE---DLNSPVDTREW--GWPPQIVNASYSPLA
Actinoba2       LELVP----GDVVANVRAASTYELDRDLA---KIGRPVDRDEW--FMPPQTVNAYYNPGM
Actinoba3       LDISA----TDLVGNYRRGYAAEYDRDLA---KLGGPVDRDEW--FMTPQTVNAYYNPGM
Actinoba4       VEIDP----NDLLGNVERAHNADVDRHLD---EVGKPVDRNKW--LMTPQTVNAYYHPMM
Actinoba1       LEVGT----SSAVENTRAVIAYTEQMTLD---QLTKPVDRSKW--NMLPQSVNASYVPTS
Fusobact1       MVIS--SND-TLYDQMKNISVWAYNEEFK---KIGKPVDKTEW--HMYPHTINAYYSPTE
Fusobact2       ---------------------------MK---KVGKPVDKTEW--HMSPHTINAYYSPTS
Bacteroi1       LTIEPAAKT-VYFANLQRVSEWAYQKSLE---KVGKPVDKTKW--GMSPQTVNAYYNPLY
Bacteroi3       MEIKSPANEGTLFDNMLAVQSWNYRDNLN---KLGEKVDKTEW--FMSPQTVNAYYNPYY
Firmicut2       QIQVS--SEKSLYENIIAANQTQLVHNFS---QLNKPVDRTLWGADLPANEINAGYNPTN
Firmicut4       HLSVD--ADDDLLTAILKLSAQTQAFWFK---QVGQPVDRNQW--NMPGHLVNASYDPLK
Firmicut5       KKVID--ESLSLVENAQNLAKITIAHTWS---KWNKPVDRSEW--HMPAHLVNAYYDPQQ
Firmicut6       KKVID--ESLSLVENAQNLAKITIAHTWS---KWNKPVDRSEW--HMPAHLVNAYYDLQQ
Firmicut1       LKVRSFSEGGSLVENIINIYEFQTRKQFE---KIDMPVNKKEW--SMGACTVNAYYNPLN
GOS_111103      LNER--------------------------------------------------------
Firmicut3       LKLAAPEDGGLYVDNILAIRKVDQDYMFR---TKDDPVDRMEW--EMTPQTVNAYYNPGN
                                                                            

Euryarch3       NEIVLPAGIFQPPFFDP-EKDDAINYAAIGGVIGHELTHGYDDQGSLFDKNGNLHEWWTA
Euryarch5       NEIVFPAGILQPPFFDP-GAYDAVNYGAIGTVIAHEITHGYDDQGSNFDGHGNMVQWWND
Euryarch2       NEIVFPAGILQPPFFDP-EMDDAVNYGATGATIAHEISHGFDDEGRKYDLNGNLNDWWTP
Verrucom1       NQIVFPAGILQPPFFDV-RMDDAVNYGAIAAVIGHEITHGFDDQGRRSDADGNLVDWWTP
Euryarch1       NEMVFPAAVLQPPIFDP-DRDPAFNYAILGWLIGHEMTHGFDDQGRQYDKDGNLKDWWTE
Euryarch4       IIIVFPAGILQPPFFNK-DADDAVNYGAIGAIIGHEMTHHFDSQGRKFDASGNLTDWWTQ
Bacteroi2       NEIVFPAGILQFPFFDP-NADDAVNYGGIGAVIGHEMSHGFDDSGSQYDKDGNLRNWWTA
Gammapro1       NEIVFPAAILQPPFFNM-EADDAVNYGGIGAVIGHEMGHGFDDQGAKFDGEGNLRDWWTE
Acidobac1       NEIVFPAGILQPPFFDG-QGDDATNYGAIGAVIGHEMGHGFDDQGSQFDAEGNMKNWWTP
Alphapro1       DQVVFPAAILQPPFFNP-KADMAVNYGAIGGVIGHEMTHSFDDEGRQFDEHGRLHDWWTK
Alphapro2       NQITFPAGILQAPFFDP-NADMAVNFGGIGGVIGHEIGHGFDDNGRRYDAEGRLRDWWTE
Actinoba2       NEVVFPAAILQPPFFDP-DAADAANYGSIGAVIGHEIGHGFDDQGSRYDGDGRLADWWTP
Actinoba3       NEIVFPAAILQPPFFDA-AADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNMVDWWTD
Actinoba4       NEIVFPAAILQPPFFTA-DADDAVNYGGIGAVIGHEIGHGFDDQGSQFDGGGALRNWWTD
Actinoba1       NEICFPAAILQAPFFSV-DNQAAVNYGAIGAVIGHEIGHAFDDSGSKYDGDGNLKDWWAP
Fusobact1       NEIVFPAGILQFPFYDFNKSEVASNFGAIGTIIGHELTHAFDVSGASYDGDGNVKNWWTD
Fusobact2       NEIVFPAGILQYPFYDYGKSEMASNFGGIGTVIGHELTHAFDVSGASYDGDGNVRNWWTE
Bacteroi1       NEIVFPAAILQPPFFNF-EADPAVNFGGIGAVIGHEMTHGFDDSGAEFDGDGNLKNWWTP
Bacteroi3       NEIVFPAAILQPPFYNY-EADAAFNFGGMGAVIGHEISHGFDDSGAKFDANGNMTDWWTA
Firmicut2       NDITFPAGILQKPFYSL-DNTLSENLGGIGAVIGHEITHAFDPNGSKFDEVGNIRNWWSD
Firmicut4       NDITFPAGILQPPYYSL-KWTRAENLGGTGATIGHEISHSFDNNGALYDEHGNLHNWWTP
Firmicut5       NQIVFPAAILQEPFYSL-DQSSSANYGGIGAVIAHEISHAFDTNGASFDEHGSLNDWWTQ
Firmicut6       NQIVFPAAILQEPFYSL-DQSSSANYGGIGAVIAHEISHAFDTNGASFDEHGSLNDWWTQ
Firmicut1       NEIVFPAAILQYPFYDK-NASKEKNLGGIGAVIGHELTHAFDNVGSQFDEDGQLNDWWTE
GOS_111103      --------------------GLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTP
Firmicut3       NEIVFPAGILQPPFYDP-EGVPVTNLGRIGSVIGHEITHAFDTSGSQYDEKGNLRDWWTA
                                        *    .  *.**: *  *  *   *  * : :**  

Euryarch3       KDRANFRKRAEKVVKLYGALEIM---PGTKINGRLTLGENIADLGGISIAYDAMQASAKR
Euryarch5       NDRQKFRELSEKIKKLYNGLEII---PGVKLNGGLTLGENIADIGGVLIAYDALKMRVN-
Euryarch2       EDDKAFTEKAKSVVELYNSIEAL---PGIHVNGPLTLGENIADIGGVSIAFEALEHRLKK
Verrucom1       EDEARFKERAQMLVAQYNSYEAL---PGLHVNGQLTLGENIADLGGVSIAFEALQRSLRG
Euryarch1       EDAANFNDRTALLVAEYNAFEAL---PGLYVNGNLTLGENIADFGGLTMAYHAWKKAENG
Euryarch4       EDADNFNKSTEVLVDEYNRFEVL---PGLYVNGNLTLPENVADFGGLTVAYHAYKLSLKE
Bacteroi2       EDREKFNAKTKQLGEQFDGYKVL---DTIPVNGKFTMGENIGDLGGLNAAYEAFKMTRQG
Gammapro1       QDLKEFSARGKALIEQYNGYQVF---DDLHVNGELTLGENIGDLSGVTIAYKAYKMSLHG
Acidobac1       ADLKSFTTRAGCVVEQYDTLDLG---DGAHHKGKLVVGEAMGDLNGLKLAYRAYHRALKG
Alphapro1       EDAARFQKLADRLGAQFDAFEVL---PGVHVNGKLTMGENIADLGGLTLALDAYHAALK-
Alphapro2       ETNVRFEERAGELGAQYEAFCPV---EGQCVSGRLTMGENIGDLGGLQMAYTAWRQYVDE
Actinoba2       EDRAEFETRTAALVAQYDAFSPAQLDGSRHVSGGLTVGENIGDLGGLAIAVDAYEIALG-
Actinoba3       EDRSEFGKRTKALIEQYNEFEPKELPG-HHVNGEFTIGENIGDLGGLSIAIAAYKIATEG
Actinoba4       EDRQAFEKLTARLVAQYDALSPAAAPG-HHVNGRLTLGENIGDLAGLAIAHKAYRISLEG
Actinoba1       ADRAEFDKRTKALIAQYNTLVPIGAAPGSTVNGAMTVGENLADLGGLGIAVEAFRLAVKN
Fusobact1       EDKKSFDEVTKKLENQYSKYTVD---GGIHLNGKYTLTENIADLGGVNIAYDALQLYLKD
Fusobact2       EDKMKFDAATKKLEEQFSRYSVG---GGVYVNGKYTLTENIADLGGLNIAYDALQMYMKD
Bacteroi1       EDKKNFENATKALAKQYDQYEPV---KGVFVNGTFTSGENIADLGGVNIAFDALQMYLKD
Bacteroi3       NDKTQFEDLGKDLANQYSAIEVL---PGVNINGEFTLGENIGDLGGVNAAYDAHQLWMQD
Firmicut2       EDYVKFNELSKSEITLFDGIVCG----GIKTNGNLTVGENVADLGGLTAAVETAKKEN--
Firmicut4       ADKQAFDQLVKAMAAQFDGRDYE----GVKVNGTLTVSENMADNAGMDVALALLGDQPDV
Firmicut5       EDYAAFKERTDKIVAQFDGLESH----GAKVNGKLTVSENVADLGGVACALEAAQSEED-
Firmicut6       EDYAAFKERTDKIVAQFDGLESH----GAKVNGKLTVSENVADLGGVACALEAAQSEED-
Firmicut1       SDYKEFTERSKKVIDYYSNIEVEN---GKFVNGALTVGENISDLGGIACVID--------
GOS_111103      SDRKNFNKKIKNVIKQYETFAKRD---GIIFDATMSVGEDLADISGMALIEAYLIDNQVI
Firmicut3       EDKQRFEELAAKVVDYYDTMEVN----GTKINGSLTATENIADLGGVSCVTE--------
                     *          :              ..     * :.*  *:             

Euryarch3       R--KPRG-------------RIDGFTQEQRFFISWAQLWKGRTSKGAAKMLAAADPHSPA
Euryarch5       ----LNE-------------KLNGLTNEQIFFISYAQIWREKVRDDEVKRLATIDPHSPG
Euryarch2       N-PELRK-------------VIDGYTPEQRFFMGWAQSWRTTVKDEALKWQILNDVHSPE
Verrucom1       Q--PTPP-------------KIDGFTAEQRFFISWAQQWRTQFRDDALRLQVARDPHAPG
Euryarch1       ---SAD--------------PAA----DRKFFLAAPCLWRVNDRGDSLRNLVLADPHSPE
Euryarch4       ---EPD--------------IIDGFTGDQRFFLGFTQVWRESDTNELLRTLVLTDTHSPA
Bacteroi2       ---QSDE-------------KIDGFTPDQRFFLSWAQVWRGNILPEIAAQMIKTDPHSPG
Gammapro1       ---KEAP-------------VIDGLTGDERFFIGFAQIWRAKMKEEALRNRVATDPHSPA
Acidobac1       ---KEAP-------------VIDGFTGDQRFFLAFARVWGSQTRPEAVQLQTNTDPHPIA
Alphapro1       --GKPAP-------------ELDGLTGDQRVFLGWAQVWREKLREETIRRLVVTDPHSPP
Alphapro2       VYGGEAP-------------VIDGMTGDQRFFLGWAQVWRNLITEDALRAQLLGDPHSPA
Actinoba2       RRP--------------------DRAELRELFASWAVSWREKGHDAEVIRLLTIDPHSPP
Actinoba3       TEPP----------------VIDGLTGLQRVFFGWAQVWRTKAREAEALRRLAVDPHSPP
Actinoba4       REPE----------------VLDGLTGHQRFFASWAAGWRQVIRQEEAIRRLATDPHSPN
Actinoba1       RDAGTEFADQSGSATPSASGPQAENAALVPLFLSYARSWQNKTRPEAVRESLATAMHAPP
Fusobact1       NPNAT---------------KVYPNISSKIFFMNYARMWRQKSTPEFLRNLAKSDSHSPN
Fusobact2       HPNST---------------KAYSDTINKLFFLSFARMWRQKSTPEYLKNLAKTDSHSPN
Bacteroi1       KGNVG---------------KISNFTQEQRFFISWGTVWRTLSTDKYLTNQVKTDPHSPG
Bacteroi3       KGRPE---------------AIDGFTPEQRFFLSWGTVWRTKMREEALKQRIKGDTHSPG
Firmicut2       -------------------------GNLQEVFQSWAKIWRGKMTPQVRKTLIAYDPHAPR
Firmicut4       -------------------------KDLQAFFITYARSWATKMRPERAKTVLRQDVHAPA
Firmicut5       -------------------------FSARDFFINFATIWRMKAREEYMQMLASIDVHAPG
Firmicut6       -------------------------FSARDFFINFATIWRMKAREEYMQMLASIDVHAPG
Firmicut1       --IAKKID----------------GYNLKDLFENYAAIWREVSTTEIKDYLLNNDPHAPK
GOS_111103      NSETNKLK----------------KINLAQMYMNLAVQARQQIYKNAIKAQLKTNPHPLE
Firmicut3       ---IAKDE----------------GYDLRELYKAYAALWAGKYRDEYLAYVMTNDVHSPG
                                              .:                        *.  

Euryarch3       RFRGLIPTTTHPNFERSFA----EKSKLA----KMKKQYEYANLW
Euryarch5       KFRGQIPVYNHPAFERAFN----SKRKRD----KIIIW-------
Euryarch2       KIRAEIPAYVNPNFQHTFTGLSNNNLKYR----EIIIW-------
Verrucom1       NIRAFGPLVNFQPFYDAFAVKEGDRMWRSP-AQRAKIW-------
Euryarch1       KFRVNGVLFNIPEF-------------------------------
Euryarch4       RFRVNGVVFNVPEFYRAFPNVNPSDKLYRPESERPVIW-------
Bacteroi2       PYRTIGAPVNMDAWYSAFD-VQPGDKLYKKPEERIRLW-------
Gammapro1       KFRALGALSNMPEFYSTYGVKEGDAMYLAP-EKRVKIW-------
Acidobac1       KYRAIGTLQNMPEFRKAFECQGTDKMVRVD-EKQCSLW-------
Alphapro1       QARVNMPMHNIDAWYDAWKVQPTDKLYLAP-DQRVKIW-------
Alphapro2       QYRINGVVRNLDAWYDAFGVTEEDDLYLPP-EQRVRIW-------
Actinoba2       EFRCNGVVANLDAFAEAFDVQPGDGLWIDP-QDRVRIW-------
Actinoba3       EFRCNGVVRNLDTFHEEFDVKPGDALYLEP-EKRVKIW-------
Actinoba4       EFRTNAIARNLDAFHEAFEVTEQDEMWMPS-GERVSIW-------
Actinoba1       EFRTNQVVKNVDTFADTFGVRPGDGEWLEP-KDRVRLW-------
Fusobact1       YFRVNGVLQNVDAFHKIFETIPGDGMYKAP-EDRIKIW-------
Fusobact2       IFRVNGTLVNVDAFHKVFETKPGDKMYKAP-EDRIKIW-------
Bacteroi1       YFRSFGPLVNVDAWYKAFDVKEGDKLYKKP-EDRIKIW-------
Bacteroi3       MYRGYVPLQNIDAFYDAFEITETDGMYISP-ENRIKIW-------
Firmicut2       ELRTNVTAQSIDDFYTAFDITPGDGMWLDP-EKRVHIW-------
Firmicut4       TLRVNVPVQNFPAWYQAFNVQPQDGMYRQP-QKRLTIWHR-----
Firmicut5       ELRTNVTLTNFDAFHETFDIKEGDAMWRAP-KDRVIIW-------
Firmicut6       ELRTNVTLTNFDAFHETFDIKEGDAMWRAP-KDRVIIW-------
Firmicut1       KVRVNGVLSQFEEFYKTYGIKPGDKMYVKP-EDRVGIW-------
GOS_111103      KYRTNCTLARLELFKTIYGIKKGDGMWWNN-DT---IW-------
Firmicut3       IIRVNAVLSATSDFYTAFHVKEGDGMYQKV-ENRPGIW-------
                  *          :                               
  

Protein Domains

PROTOCOLE:

EBI / programme Interproscan / banque de domaine Interpro



ANALYSE DES RÉSULTATS:


-On releve un domaine proteique remarquable: Peptidase. Ce domaine est retrouvé à deux reprises mais nous étudierons plus particulièrement le second car c'est le domaine le plus grand.


-Les domaines trouvés ont des E-values très faible variant de 2,2e-12 à 1,2e-34 ce qui est un signe d'homologie, de bonnes similarités et que ces domaines sont probants.


-De tous ces résultats, on retient que le domaine proteique parent est IPR018497 relatif à une peptidase car c'est celui qui a la plus grande taille (181pb).


-Le domaine retenu a une activité metalloendopeptidase.

Cette aminotransférase fait partie de la famille des Phosphate Regulating Neutral Endopeptidase .



RÉSULTATS BRUTS:
Sequence_1	FD44FE05C54757E8	181	HMMPanther	PTHR11733:SF18	ZINC METALLOPROTEASE (BACTERIA)	15	181	1e-29	T	26-Nov-2009	NULL	NULL	
Sequence_1	FD44FE05C54757E8	181	HMMPanther	PTHR11733	ZINC METALLOPROTEASE FAMILY M13 NEPRILYSIN-RELATED	15	181	1e-29	T	26-Nov-2009	IPR000718	Peptidase M13, neprilysin	Molecular Function: metalloendopeptidase activity (GO:0004222), Biological Process: proteolysis (GO:0006508)
Sequence_1	FD44FE05C54757E8	181	Gene3D	G3DSA:3.40.390.10	no description	10	181	2.3e-27	T	26-Nov-2009	NULL	NULL	
Sequence_1	FD44FE05C54757E8	181	superfamily	SSF55486	Metalloproteases ("zincins"), catalytic domain	10	181	1.2e-34	T	26-Nov-2009	NULL	NULL	
Sequence_1	FD44FE05C54757E8	181	HMMPfam	PF01431	Peptidase_M13	2	181	2.2e-12	T	26-Nov-2009	IPR018497	Peptidase M13, neprilysin, C-terminal	Molecular Function: metalloendopeptidase activity (GO:0004222), Biological Process: proteolysis (GO:0006508)

Phylogeny

PROTOCOLE:


Phylogény.fr / A la carte / Alignement Muscle / Phylogeny Bio NJ ou Phy ML


ANALYSE DES RÉSULTATS:


-La structure générale des arbres nous confirment pas trés nettement les résultats des BLAST avec une médiocre distinction entre le groupe d'études (bactéries dans leur ensemble) et le groupe extérieur ( les archaébactéries). Le groupe extérieur ici ne permet d'enraciner l'arbre correctement et les séquences du groupe d'études sont regroupées en différents taxons.

Si on se réfere à l'arbre de la vie on voit de bonnes et de moins bonnes choses. les arbres Phy ML et Bio NJ donnent des résultats assez semblables mais nous utiliseront le second pour nos interprétations en raison d'une meilleure lisibilité à nos yeux.

Les séquences du groupe extérieur (archaes) sont bien rejeté vers l'extérieur.

Nous retrouvons aussi une bonne cohérence au sein de notre groupe d'étude (bactéries) avec un regroupement entre les firmicutes d'un côté, les protéobactéries d'autre part, et un petit mélanges de bactéries d'un autre côté.

Notre séquence s'apparente assez bien avec son groupe d'étude à en croire l'arbre phylogénétique.


-Cependant, on remarque dans les deux arbres un transfert d'une Verucomicrobactérie dans le groupe extérieure (Verrucom1_Opitutus_terrae_PB90-1/Verrucomicrobia/ref_YP_00181869) qui est sans doute le fruit d'un transfert horizontal.



-En somme, notre séquence requete s'intègre avec une Acidobactérie (Acidobac1_Solibacter_usitatus_Ellin6076/Acidobacteria/ref_YP_825) qui serait peut etre une beta car c'est l'organisme le plus proche. Ce résultat est en accord avec notre hypothèse initiale statuée grâce au blast où on voit une forte homologie pour les bactéries.



RÉSULTATS BRUTS: 


-Arbre phylogénétique Phy ML:


                                                                                                -----0.2----
 
                             +Firmicut5_Streptococcus_pyogenes_str._Manfredo/Firmicutes/ref_YP
                 +-----------+
                 |           +Firmicut6_Streptococcus_pyogenes_M1_GAS/Firmicutes/ref_NP_270025
         +-------+
         |       +------------------------------Firmicut4_Lactobacillus/Firmicutes/ref_ZP_04440603.1_gi_22955187
 +-------+
 |       |     +----------------------Firmicut2_Lactobacillus_gasseri_ATCC_33323/Firmicutes/ref_YP_819
 |       |     |
 |       +-----+
 |             |            +---------------------------Firmicut3_Clostridiales/Firmicutes/ref_ZP_04671025.1_gi_23962799
 |             +------------+
 |                          +-------------------Firmicut1_Clostridium_butyricum_5521/Firmicutes/ref_ZP_02949882.
 |
 |           +-----------------Actinoba1_Tsukamurella/Actinobacteria/ref_ZP_04028615.1_gi_22798
 |           |
 |   +-------+   +-----------------Actinoba4_Arthrobacter_chlorophenolicus_A6/Actinobacteria/ref_YP
 |   |       +---+
 |   |           |  +-----------Actinoba2_Beutenbergia/Actinobacteria/ref_YP_002882628.1_gi_2298
 |   |           +--+
 |   |              +----------Actinoba3_Rhodococcus_erythropolis_PR4/Actinobacteria/ref_YP_002
 |   |
 |   |                             +-----------gi_219852068_ref_YP_002466500.1_Endothelin-converting_enzyme_1_C
 |   |           +-----------------+
 |   |           |                 +--------gi_126180048_ref_YP_001048013.1_endothelin-converting_protein_1
 +---+       +---+
     |       |   |       +--------------------Alphapro2_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/r
     |       |   |       |
     |  +----+   +-------+
     |  |    |           +---------------Alphapro1_Acetobacter/Alphaproteobacteria/ref_YP_003187092.1_gi
     |  |    |
     |  |    +-----------------Verrucom1_Opitutus_terrae_PB90-1/Verrucomicrobia/ref_YP_00181869
     |  |
     |  | +----------------------------------------------------------GOS_1111030_Traduction_2-544_sens_direct
     |  | |
     +--+ |   +----------------------Bacteroi3_Flavobacteria_bacterium_BBFL7/Bacteroidetes/ref_ZP_012
        | |   |
        | |---+   +--------------------Bacteroi2_Pedobacter/Bacteroidetes/ref_YP_003091517.1_gi_2555311
        | |   |   |
        | |   +---+     +-----------Bacteroi1_Capnocytophaga/Bacteroidetes/ref_YP_003142101.1_gi_256
        | |       |     |
        | |       +-----+                 +-------Fusobact1_Leptotrichia/Fusobacteria/ref_YP_003164052.1_gi_257125
        +-+             +-----------------+
          |                               |
          |                               +--Fusobact2_Leptotrichia/Fusobacteria/ref_ZP_05900983.1_gi_2608897
          |
          |           +--------Gammapro1_Shewanella_amazonensis_SB2B/Gammaproteobacteria/ref_YP
          |   +-------+
          |   |       +---------------------------Acidobac1_Solibacter_usitatus_Ellin6076/Acidobacteria/ref_YP_825
          +---+
              |       +-----------------------------gi_255513866_gb_EET90131.1_Endothelin-converting_enzyme_1_Candid
              +-------+
                      +-------------------------gi_257075537_ref_ZP_05569898.1_zinc_metalloprotease_Ferroplasma


-Arbre phylogénétique BIO NJ:



                                                                                                      ------0.2----
 
          +-----------------------------------------------------GOS_1111030_Traduction_2-544_sens_direct
    +-----+
    |     +--------------------------------Acidobac1_Solibacter_usitatus_Ellin6076/Acidobacteria/ref_YP_825
 +--+
 |  +---------------Gammapro1_Shewanella_amazonensis_SB2B/Gammaproteobacteria/ref_YP
 |
 |                      +-------------gi_219852068_ref_YP_002466500.1_Endothelin-converting_enzyme_1_C
 | +--------------------+
 | |                    |
 | |                    +---------gi_126180048_ref_YP_001048013.1_endothelin-converting_protein_1
 | |
 | |         +------------------------Bacteroi3_Flavobacteria_bacterium_BBFL7/Bacteroidetes/ref_ZP_012
 | |         |
 | |     +---+   +--------------------Bacteroi2_Pedobacter/Bacteroidetes/ref_YP_003091517.1_gi_2555311
 | |     |   |   |
 | |     |   +---+    +------------------Bacteroi1_Capnocytophaga/Bacteroidetes/ref_YP_003142101.1_gi_256
 | |     |       +----+
 | |     |            |               +--------Fusobact1_Leptotrichia/Fusobacteria/ref_YP_003164052.1_gi_257125
 | |     |            +---------------+
 | |    ++                            +------Fusobact2_Leptotrichia/Fusobacteria/ref_ZP_05900983.1_gi_2608897
 | |    ||
 | |    ||              +------------------------------Firmicut3_Clostridiales/Firmicutes/ref_ZP_04671025.1_gi_23962799
 | |    ||       +------+
 +-+    ||       |      +---------------------------Firmicut1_Clostridium_butyricum_5521/Firmicutes/ref_ZP_02949882.
   |    ||       |
   |    |+-------+ +---------------------------------Firmicut2_Lactobacillus_gasseri_ATCC_33323/Firmicutes/ref_YP_819
   |    |        | |
   |    |        +-+
   |+---+          |  +---------------------------------Firmicut4_Lactobacillus/Firmicutes/ref_ZP_04440603.1_gi_22955187
   ||   |          +--+
   ||   |             |                    +Firmicut5_Streptococcus_pyogenes_str._Manfredo/Firmicutes/ref_YP
   ||   |             +--------------------+
   ||   |                                  +Firmicut6_Streptococcus_pyogenes_M1_GAS/Firmicutes/ref_NP_270025
   ||   |
   ||   |         +-----------------------Alphapro2_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/r
   ||   | +-------+
   ||   | |       +--------------------Alphapro1_Acetobacter/Alphaproteobacteria/ref_YP_003187092.1_gi
   ||   | |
   ||   +-+      +---------------------Actinoba1_Tsukamurella/Actinobacteria/ref_ZP_04028615.1_gi_22798
   ++     |      |
    |     +------+   +-----------------Actinoba4_Arthrobacter_chlorophenolicus_A6/Actinobacteria/ref_YP
    |            |   |
    |            +---+
    |                |  +--------------Actinoba2_Beutenbergia/Actinobacteria/ref_YP_002882628.1_gi_2298
    |                +--+
    |                   +-------------Actinoba3_Rhodococcus_erythropolis_PR4/Actinobacteria/ref_YP_002
    |
    |      +-------------------------------gi_255513866_gb_EET90131.1_Endothelin-converting_enzyme_1_Candid
    |   +--+
    +---+  +--------------------------------gi_257075537_ref_ZP_05569898.1_zinc_metalloprotease_Ferroplasma
        |
        +--------------------Verrucom1_Opitutus_terrae_PB90-1/Verrucomicrobia/ref_YP_00181869

Taxonomy report

PROTOCOLE:

Dans le blast P contre NR, on clique sur le rapport taxonomique


ANALYSE DES RÉSULTATS:


-Groupe d'étude: Les bactéries


Clostridium butyricum E4 str. BoNT E BL5262 ................... 109 6 hits [firmicutes]

Tsukamurella paurometabola DSM 20162 .......................... 107 6 hits [high GC Gram+]

Beutenbergia cavernae DSM 12333 ............................... 104 2 hits [high GC Gram+]

Shewanella amazonensis SB2B ................................... 103 4 hits [g-proteobacteria]

Candidatus Solibacter usitatus Ellin6076 ...................... 98 10 hits [bacteria]

Capnocytophaga ochracea DSM 7271 .............................. 96 2 hits [CFB group bacteria]

Opitutus terrae PB90-1 ........................................ 96 4 hits [verrucomicrobia]

Lactobacillus gasseri 202-4 ................................... 93 6 hits [firmicutes]

Pedobacter heparinus DSM 2366 ................................. 93 4 hits [CFB group bacteria]

Leptotrichia buccalis C-1013-b .............................. 91 2 hits [fusobacteria]

Arthrobacter chlorophenolicus A6 .............................. 90 2 hits [high GC Gram+]

Rhodococcus erythropolis SK121 ................................ 90 2 hits [high GC Gram+]

Clostridiales bacterium 1_7_47FAA ............................. 86 2 hits [firmicutes]

Lactobacillus rhamnosus LMS2-1 ................................ 86 4 hits [firmicutes]

Acetobacter pasteurianus IFO 3283-12 .......................... 86 1 hit [a-proteobacteria]

Oceanicaulis alexandrii HTCC2633 .............................. 86 4 hits [a-proteobacteria]

Leptotrichia hofstadii F0254 ................................ 85 2 hits [fusobacteria]

Streptococcus pyogenes str. Manfredo .......................... 84 2 hits [firmicutes]

Streptococcus pyogenes MGAS10394 .............................. 84 2 hits [firmicutes]

Flavobacteria bacterium BBFL7 ................................. 84 2 hits [CFB group bacteria]



Groupe extérieur: Archaebacteries



Methanoculleus marisnigri JR1 ................................... 88 2 hits [euryarchaeotes]

Ferroplasma acidarmanus fer1 .................................... 86 2 hits [euryarchaeotes]

Candidatus Micrarchaeum acidiphilum ARMAN-2 ..................... 84 1 hit [euryarchaeotes]

Methanosarcina barkeri str. Fusaro .............................. 76 2 hits [euryarchaeotes]

Picrophilus torridus DSM 9790 ................................... 71 2 hits [euryarchaeotes]




-Dans notre groupe d'étude, on doit pas y mettre un seul type de bactéries (cyanobactérie ou firmicutes etc...) mais plutot les bactéries en générales car aucune famille de séquences avec de tres bons scores se dégagent. Ainsi, on a choisit des firmicutes, protéobactéries, fusobactéries... toutes étant potentiellement homolohgues.


-Le groupe extérieur est constitué de séquences hors groupe d'étude et ayant une taxonomique différente (Archeabactéries). Les séquences choisies ont un bon score ce qui laisse présager une homologie de séquences.




RÉSULTATS BRUTS: 

root
. cellular organisms
. . Bacteria           [bacteria]
. . . Fusobacteriaceae   [fusobacteria]
. . . . Sebaldella termitidis ATCC 33386 ----------------------------  111   2 hits [fusobacteria]         Endothelin-converting enzyme 1 [Sebaldella termitidis ATCC 
. . . . Leptotrichia buccalis C-1013-b ..............................   91   2 hits [fusobacteria]         Endothelin-converting enzyme 1 [Leptotrichia buccalis DSM 1
. . . . Leptotrichia goodfellowii F0264 .............................   90   4 hits [fusobacteria]         neprilysin [Leptotrichia goodfellowii F0264] >gi|261748578|
. . . . Leptotrichia hofstadii F0254 ................................   85   2 hits [fusobacteria]         metalloendopeptidase PepO [Leptotrichia hofstadii F0254] >g
. . . Clostridium butyricum 5521 ------------------------------------  109   6 hits [firmicutes]           neutral endopeptidase [Clostridium butyricum 5521] >gi|2376
. . . Clostridium butyricum E4 str. BoNT E BL5262 ...................  109   6 hits [firmicutes]           neutral endopeptidase [Clostridium butyricum 5521] >gi|2376
. . . Tsukamurella paurometabola DSM 20162 ..........................  107   6 hits [high GC Gram+]        predicted metalloendopeptidase [Tsukamurella paurometabola 
. . . gamma proteobacterium NOR5-3 ..................................  105   2 hits [g-proteobacteria]     peptidase, M13 (neprilysin) family [gamma proteobacterium N
. . . Nocardioides sp. JS614 ........................................  105   2 hits [high GC Gram+]        endothelin-converting protein 1 [Nocardioides sp. JS614] >g
. . . Beutenbergia cavernae DSM 12333 ...............................  104   2 hits [high GC Gram+]        Neprilysin [Beutenbergia cavernae DSM 12333] >gi|229567015|
. . . Brachybacterium faecium DSM 4810 ..............................  104   2 hits [high GC Gram+]        endothelin-converting enzyme [Brachybacterium faecium DSM 4
. . . Frankia sp. EAN1pec ...........................................  104   2 hits [high GC Gram+]        endothelin-converting protein 1 [Frankia sp. EAN1pec] >gi|1
. . . Clavibacter michiganensis subsp. sepedonicus ..................  103   2 hits [high GC Gram+]        putative metallopeptidase [Clavibacter michiganensis subsp.
. . . Shewanella amazonensis SB2B ...................................  103   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella amazonensis SB2
. . . Myxococcus xanthus DK 1622 ....................................  102   4 hits [d-proteobacteria]     M13 family peptidase [Myxococcus xanthus DK 1622] >gi|10846
. . . Clavibacter michiganensis subsp. michiganensis NCPPB 382 ......  102   2 hits [high GC Gram+]        metallopeptidase family M13 [Clavibacter michiganensis subs
. . . Frankia alni ACN14a ...........................................  102   2 hits [high GC Gram+]        zinc metalloendopeptidase [Frankia alni ACN14a] >gi|1111510
. . . Spirosoma linguale DSM 74 .....................................  102   6 hits [CFB group bacteria]   predicted metalloendopeptidase [Spirosoma linguale DSM 74] 
. . . Xylanimonas cellulosilytica DSM 15894 .........................  101   1 hit  [high GC Gram+]        Neprilysin [Xylanimonas cellulosilytica DSM 15894]
. . . Flavobacteriales bacterium ALC-1 ..............................  100   2 hits [CFB group bacteria]   metalloendopeptidase PepO [Flavobacteriales bacterium ALC-1
. . . Chryseobacterium gleum ATCC 35910 .............................   99   6 hits [CFB group bacteria]   possible endothelin-converting enzyme 1 [Chryseobacterium g
. . . Shewanella piezotolerans WP3 ..................................   99   6 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Shewanella piezotolerans WP
. . . Mobiluncus mulieris ATCC 35243 ................................   98   2 hits [high GC Gram+]        possible Endothelin-converting enzyme 1 [Mobiluncus mulieri
. . . Methylibium petroleiphilum PM1 ................................   98   4 hits [b-proteobacteria]     endothelin-converting protein 1 [Methylibium petroleiphilum
. . . Shewanella putrefaciens 200 ...................................   98   4 hits [g-proteobacteria]     peptidase M13 [Shewanella putrefaciens 200] >gi|146291896|r
. . . Shewanella putrefaciens CN-32 .................................   98   4 hits [g-proteobacteria]     peptidase M13 [Shewanella putrefaciens 200] >gi|146291896|r
. . . Shewanella sp. W3-18-1 ........................................   98   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella sp. W3-18-1] >g
. . . Idiomarina baltica OS145 ......................................   98   2 hits [g-proteobacteria]     Secreted zinc metalloproteinase [Idiomarina baltica OS145] 
. . . Candidatus Solibacter usitatus Ellin6076 ......................   98  10 hits [bacteria]             endothelin-converting protein 1 [Solibacter usitatus Ellin6
. . . Clostridium botulinum B str. Eklund 17B .......................   97   4 hits [firmicutes]           neutral endopeptidase [Clostridium botulinum B str. Eklund 
. . . Clostridium beijerinckii NCIMB 8052 ...........................   97   4 hits [firmicutes]           endothelin-converting protein 1 [Clostridium beijerinckii N
. . . Shewanella loihica PV-4 .......................................   97   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella loihica PV-4] >
. . . gamma proteobacterium HTCC2207 ................................   97   2 hits [g-proteobacteria]     metalloendopeptidase PepO [marine gamma proteobacterium HTC
. . . Flavobacteriaceae bacterium 3519-10 ...........................   97   2 hits [CFB group bacteria]   metallopeptidase [Flavobacteriaceae bacterium 3519-10] >gi|
. . . Shewanella oneidensis MR-1 ....................................   97   6 hits [g-proteobacteria]     M13 family peptidase [Shewanella oneidensis MR-1] >gi|24350
. . . Sanguibacter keddieii DSM 10542 ...............................   97   3 hits [high GC Gram+]        endothelin-converting enzyme [Sanguibacter keddieii DSM 105
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ...........   97   2 hits [g-proteobacteria]     metallopeptidase [Actinobacillus pleuropneumoniae serovar 3
. . . Lactobacillus crispatus JV-V01 ................................   97   4 hits [firmicutes]           M13 family peptidase [Lactobacillus crispatus JV-V01] >gi|2
. . . Lactobacillus crispatus 125-2-CHN .............................   97   4 hits [firmicutes]           M13 family peptidase [Lactobacillus crispatus JV-V01] >gi|2
. . . Lactobacillus crispatus MV-1A-US ..............................   97   4 hits [firmicutes]           M13 family peptidase [Lactobacillus crispatus JV-V01] >gi|2
. . . Lactobacillus crispatus MV-3A-US ..............................   97   4 hits [firmicutes]           M13 family peptidase [Lactobacillus crispatus JV-V01] >gi|2
. . . Shewanella sp. MR-4 ...........................................   97   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella sp. MR-4] >gi|1
. . . Shewanella sp. MR-7 ...........................................   97   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella sp. MR-7] >gi|1
. . . Shewanella sp. ANA-3 ..........................................   97   6 hits [g-proteobacteria]     peptidase M13 [Shewanella sp. ANA-3] >gi|117611543|gb|ABK46
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ...........   96   2 hits [g-proteobacteria]     neutral endopeptidase [Actinobacillus pleuropneumoniae sero
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ...........   96   1 hit  [g-proteobacteria]     COG3590: Predicted metalloendopeptidase [Actinobacillus ple
. . . Actinobacillus pleuropneumoniae L20 ...........................   96   2 hits [g-proteobacteria]     COG3590: Predicted metalloendopeptidase [Actinobacillus ple
. . . Capnocytophaga ochracea DSM 7271 ..............................   96   2 hits [CFB group bacteria]   Endothelin-converting enzyme 1 [Capnocytophaga ochracea DSM
. . . Arthrobacter aurescens TC1 ....................................   96   2 hits [high GC Gram+]        putative zinc metalloproteinase [Arthrobacter aurescens TC1
. . . Capnocytophaga sputigena ATCC 33612 ...........................   96   2 hits [CFB group bacteria]   metallopeptidase [Capnocytophaga sputigena Capno] >gi|21395
. . . Clostridium sp. M62/1 .........................................   96   2 hits [firmicutes]           hypothetical protein CLOM621_00361 [Clostridium sp. M62/1] 
. . . Clostridium bolteae ATCC BAA-613 ..............................   96   2 hits [firmicutes]           hypothetical protein CLOBOL_00028 [Clostridium bolteae ATCC
. . . Opitutus terrae PB90-1 ........................................   96   4 hits [verrucomicrobia]      neprilysin [Opitutus terrae PB90-1] >gi|177840842|gb|ACB750
. . . Shewanella denitrificans OS217 ................................   96   2 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella denitrificans O
. . . Shewanella benthica KT99 ......................................   96   4 hits [g-proteobacteria]     peptidase, M13 family protein [Shewanella benthica KT99] >g
. . . Actinomyces sp. oral taxon 848 str. F0332 .....................   96   4 hits [high GC Gram+]        metalloendopeptidase PepO [Actinomyces sp. oral taxon 848 s
. . . Idiomarina loihiensis L2TR ....................................   96   2 hits [g-proteobacteria]     secreted zinc metalloproteinase [Idiomarina loihiensis L2TR
. . . Haemophilus parasuis SH0165 ...................................   96   2 hits [g-proteobacteria]     neutral endopeptidase [Haemophilus parasuis SH0165] >gi|219
. . . Shewanella baltica OS185 ......................................   96   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella baltica OS185] 
. . . Shewanella woodyi ATCC 51908 ..................................   96   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella woodyi ATCC 519
. . . Shewanella baltica OS155 ......................................   95   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella baltica OS155] 
. . . Shewanella baltica OS223 ......................................   95   6 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Shewanella baltica OS223] >
. . . Shewanella baltica OS195 ......................................   95   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella baltica OS195] 
. . . Kineococcus radiotolerans SRS30216 ............................   95   2 hits [high GC Gram+]        Endothelin-converting enzyme 1 [Kineococcus radiotolerans S
. . . Xanthomonas axonopodis pv. citri str. 306 .....................   95   8 hits [g-proteobacteria]     metallopeptidase [Xanthomonas axonopodis pv. citri str. 306
. . . Pseudoalteromonas atlantica T6c ...............................   95   2 hits [g-proteobacteria]     endothelin-converting protein 1 [Pseudoalteromonas atlantic
. . . Xanthomonas oryzae pv. oryzae KACC10331 .......................   95   4 hits [g-proteobacteria]     metallopeptidase [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 .............   95   8 hits [g-proteobacteria]     metallopeptidase precursor [Xanthomonas campestris pv. vesi
. . . Chitinophaga pinensis DSM 2588 ................................   95   4 hits [CFB group bacteria]   Neprilysin [Chitinophaga pinensis DSM 2588] >gi|256040546|g
. . . Legionella drancourtii LLAP12 .................................   95   2 hits [g-proteobacteria]     metallopeptidase PepO [Legionella drancourtii LLAP12] >gi|2
. . . Lactobacillus acidophilus NCFM ................................   95   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus acidophilus NCFM] >gi|
. . . Lactobacillus acidophilus ATCC 4796 ...........................   95   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus acidophilus NCFM] >gi|
. . . Psychroflexus torquis ATCC 700755 .............................   95   4 hits [CFB group bacteria]   metalloendopeptidase PepO [Psychroflexus torquis ATCC 70075
. . . Capnocytophaga gingivalis ATCC 33624 ..........................   95   8 hits [CFB group bacteria]   neprilysin-2 [Capnocytophaga gingivalis ATCC 33624] >gi|228
. . . Flavobacterium johnsoniae UW101 ...............................   95   2 hits [CFB group bacteria]   endothelin-converting protein 1 [Flavobacterium johnsoniae 
. . . Lactobacillus helveticus DPC 4571 .............................   95   6 hits [firmicutes]           endopeptidase o [Lactobacillus helveticus DPC 4571] >gi|160
. . . Lactobacillus helveticus ......................................   95   5 hits [firmicutes]           endopeptidase O [Lactobacillus helveticus]
. . . Propionibacterium acnes KPA171202 .............................   95   2 hits [high GC Gram+]        M13 family metallopeptidase [Propionibacterium acnes KPA171
. . . Mesoplasma florum L1 ..........................................   95   2 hits [mycoplasmas]          putative membrane metallo endopeptidase [Mesoplasma florum 
. . . Propionibacterium acnes SK137 .................................   95   2 hits [high GC Gram+]        peptidase family M13 [Propionibacterium acnes SK137] >gi|21
. . . Rhodospirillum centenum SW ....................................   95   2 hits [a-proteobacteria]     metallopeptidase PepO, peptidase, M13 family, putative [Rho
. . . Lactobacillus helveticus DSM 20075 ............................   95   6 hits [firmicutes]           endopeptidase O [Lactobacillus helveticus DSM 20075] >gi|26
. . . Lactobacillus helveticus CNRZ32 ...............................   95   3 hits [firmicutes]           RecName: Full=Neutral endopeptidase; AltName: Full=Endopept
. . . Rhodopirellula baltica SH 1 ...................................   95   2 hits [planctomycetes]       zinc metalloproteinase [Rhodopirellula baltica SH 1] >gi|32
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 .........   95  10 hits [g-proteobacteria]     metallopeptidase [Xanthomonas campestris pv. campestris str
. . . Xanthomonas campestris pv. campestris str. 8004 ...............   95  10 hits [g-proteobacteria]     metallopeptidase [Xanthomonas campestris pv. campestris str
. . . Xanthomonas campestris pv. campestris str. B100 ...............   95   5 hits [g-proteobacteria]     Metallopeptidase [Xanthomonas campestris pv. campestris str
. . . Xanthomonas campestris pv. campestris .........................   95   5 hits [g-proteobacteria]     Metallopeptidase [Xanthomonas campestris pv. campestris str
. . . Shewanella halifaxensis HAW-EB4 ...............................   95   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella halifaxensis HA
. . . Sphingobacterium spiritivorum ATCC 33861 ......................   95   4 hits [CFB group bacteria]   possible Endothelin-converting enzyme 1 [Sphingobacterium s
. . . Xanthomonas oryzae pv. oryzae PXO99A ..........................   94   4 hits [g-proteobacteria]     metallopeptidase [Xanthomonas oryzae pv. oryzae PXO99A] >gi
. . . Colwellia psychrerythraea 34H .................................   94   4 hits [g-proteobacteria]     metalloendopeptidase PepO [Colwellia psychrerythraea 34H] >
. . . Haemophilus parasuis 29755 ....................................   94   2 hits [g-proteobacteria]     DNA polymerase III subunit alpha [Haemophilus parasuis 2975
. . . Teredinibacter turnerae T7901 .................................   94   2 hits [g-proteobacteria]     peptidase, M13 family [Teredinibacter turnerae T7901] >gi|2
. . . Shewanella frigidimarina NCIMB 400 ............................   94   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella frigidimarina N
. . . Actinobacillus minor NM305 ....................................   94   2 hits [g-proteobacteria]     neutral endopeptidase [Actinobacillus minor NM305] >gi|2402
. . . Cellulomonas flavigena DSM 20109 ..............................   93   2 hits [high GC Gram+]        endothelin-converting enzyme [Cellulomonas flavigena DSM 20
. . . Actinobacillus minor 202 ......................................   93   2 hits [g-proteobacteria]     neutral endopeptidase [Actinobacillus minor 202] >gi|223017
. . . Acinetobacter baumannii ATCC 17978 ............................   93   2 hits [g-proteobacteria]     putative metallopeptidase [Acinetobacter baumannii ATCC 179
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 .   93   2 hits [g-proteobacteria]     metallopeptidase PepO [Legionella pneumophila subsp. pneumo
. . . Shewanella sediminis HAW-EB3 ..................................   93   6 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella sediminis HAW-E
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 .....................   93   4 hits [g-proteobacteria]     metallopeptidase [Xanthomonas oryzae pv. oryzae MAFF 311018
. . . Legionella pneumophila str. Paris .............................   93   2 hits [g-proteobacteria]     hypothetical protein lpp2660 [Legionella pneumophila str. P
. . . Legionella pneumophila str. Lens ..............................   93   2 hits [g-proteobacteria]     hypothetical protein lpl2530 [Legionella pneumophila str. L
. . . Croceibacter atlanticus HTCC2559 ..............................   93   2 hits [CFB group bacteria]   Peptidase, M13 family (lipoprotein) [Croceibacter atlanticu
. . . Sphingobacterium spiritivorum ATCC 33300 ......................   93   4 hits [CFB group bacteria]   possible Endothelin-converting enzyme 1 [Sphingobacterium s
. . . Lactobacillus gasseri ATCC 33323 ..............................   93   6 hits [firmicutes]           neutral endopeptidase [Lactobacillus gasseri ATCC 33323] >g
. . . Lactobacillus gasseri MV-22 ...................................   93   3 hits [firmicutes]           neutral endopeptidase [Lactobacillus gasseri ATCC 33323] >g
. . . Lactobacillus gasseri 202-4 ...................................   93   6 hits [firmicutes]           neutral endopeptidase [Lactobacillus gasseri ATCC 33323] >g
. . . Pedobacter heparinus DSM 2366 .................................   93   4 hits [CFB group bacteria]   Endothelin-converting enzyme 1 [Pedobacter heparinus DSM 23
. . . Haemophilus ducreyi 35000HP ...................................   93   2 hits [g-proteobacteria]     metallopeptidase [Haemophilus ducreyi 35000HP] >gi|33147661
. . . Legionella pneumophila str. Corby .............................   93   2 hits [g-proteobacteria]     metallopeptidase PepO [Legionella pneumophila str. Corby] >
. . . Zymomonas mobilis subsp. mobilis ZM4 ..........................   93   2 hits [a-proteobacteria]     metallopeptidase [Zymomonas mobilis subsp. mobilis ZM4] >gi
. . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ..................   93   2 hits [a-proteobacteria]     metallopeptidase [Zymomonas mobilis subsp. mobilis ZM4] >gi
. . . Acidobacterium capsulatum ATCC 51196 ..........................   93   6 hits [bacteria]             peptidase, M13 family [Acidobacterium capsulatum ATCC 51196
. . . Zymomonas mobilis subsp. mobilis ATCC 10988 ...................   93   2 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Zymomonas mobilis subsp. mo
. . . Shewanella pealeana ATCC 700345 ...............................   92   4 hits [g-proteobacteria]     endothelin-converting protein 1 [Shewanella pealeana ATCC 7
. . . Stigmatella aurantiaca DW4/3-1 ................................   92   2 hits [d-proteobacteria]     hypothetical protein STIAU_8588 [Stigmatella aurantiaca DW4
. . . Streptococcus suis SC84 .......................................   92   4 hits [firmicutes]           putative endopeptidase [Streptococcus suis SC84] >gi|253752
. . . Streptococcus suis P1/7 .......................................   92   4 hits [firmicutes]           putative endopeptidase [Streptococcus suis SC84] >gi|253752
. . . Caulobacter sp. K31 ...........................................   92   6 hits [a-proteobacteria]     endothelin-converting protein 1 [Caulobacter sp. K31] >gi|1
. . . Streptococcus suis 98HAH33 ....................................   92   4 hits [firmicutes]           metalloendopeptidase [Streptococcus suis 98HAH33] >gi|14569
. . . Stenotrophomonas maltophilia R551-3 ...........................   92   8 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Stenotrophomonas maltophili
. . . Streptococcus suis BM407 ......................................   92   4 hits [firmicutes]           endopeptidase [Streptococcus suis BM407] >gi|251817251|emb|
. . . Streptococcus suis 89/1591 ....................................   92   4 hits [firmicutes]           Endothelin-converting enzyme 1 [Streptococcus suis 89/1591]
. . . Dyadobacter fermentans DSM 18053 ..............................   92   2 hits [CFB group bacteria]   Endothelin-converting enzyme 1 [Dyadobacter fermentans DSM 
. . . Clostridium botulinum E1 str. 'BoNT E Beluga' .................   92   6 hits [firmicutes]           neprilysin [Clostridium botulinum E1 str. 'BoNT E Beluga'] 
. . . unidentified eubacterium SCB49 ................................   92   4 hits [CFB group bacteria]   Peptidase, M13 family (lipoprotein) [unidentified eubacteri
. . . Leifsonia xyli subsp. xyli str. CTCB07 ........................   92   2 hits [high GC Gram+]        metallopeptidase [Leifsonia xyli subsp. xyli str. CTCB07] >
. . . Candidatus Koribacter versatilis Ellin345 .....................   92  10 hits [bacteria]             PgPepO oligopeptidase [Candidatus Koribacter versatilis Ell
. . . Acinetobacter baumannii AB900 .................................   92   1 hit  [g-proteobacteria]     putative metallopeptidase [Acinetobacter baumannii AB900]
. . . Parabacteroides johnsonii DSM 18315 ...........................   92   2 hits [CFB group bacteria]   hypothetical protein PRABACTJOHN_01301 [Parabacteroides joh
. . . Pseudoalteromonas tunicata D2 .................................   92   6 hits [g-proteobacteria]     metalloendopeptidase PepO [Pseudoalteromonas tunicata D2] >
. . . Stenotrophomonas maltophilia K279a ............................   92   8 hits [g-proteobacteria]     peptidase, m13 family [Stenotrophomonas maltophilia K279a] 
. . . Parabacteroides sp. D13 .......................................   92   2 hits [CFB group bacteria]   conserved hypothetical protein [Parabacteroides sp. D13] >g
. . . Clostridium botulinum E3 str. Alaska E43 ......................   92   6 hits [firmicutes]           neutral endopeptidase [Clostridium botulinum E3 str. Alaska
. . . Arthrobacter sp. FB24 .........................................   92   2 hits [high GC Gram+]        endothelin-converting protein 1 [Arthrobacter sp. FB24] >gi
. . . Stenotrophomonas sp. SKA14 ....................................   92   8 hits [g-proteobacteria]     putative endothelin-converting enzyme 1 [Stenotrophomonas s
. . . Bacteroides sp. 2_1_7 .........................................   91   1 hit  [CFB group bacteria]   putative endopeptidase [Bacteroides sp. 2_1_7]
. . . Parabacteroides distasonis ATCC 8503 ..........................   91   2 hits [CFB group bacteria]   putative endopeptidase [Parabacteroides distasonis ATCC 850
. . . Bacteroides sp. 2_1_33B .......................................   91   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 2_1_33B] >g
. . . Bacteroides sp. 3_1_33FAA .....................................   91   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 3_1_33FAA] 
. . . Xylella fastidiosa M12 ........................................   91   2 hits [g-proteobacteria]     endothelin-converting protein 1 [Xylella fastidiosa M12] >g
. . . Xylella fastidiosa Temecula1 ..................................   91   2 hits [g-proteobacteria]     metallopeptidase [Xylella fastidiosa Temecula1] >gi|1826821
. . . Xylella fastidiosa M23 ........................................   91   2 hits [g-proteobacteria]     metallopeptidase [Xylella fastidiosa Temecula1] >gi|1826821
. . . Kordia algicida OT-1 ..........................................   91   2 hits [CFB group bacteria]   Endothelin-converting enzyme 1 [Kordia algicida OT-1] >gi|1
. . . Streptococcus uberis 0140J ....................................   91   2 hits [firmicutes]           endopeptidase O [Streptococcus uberis 0140J] >gi|222114664|
. . . Brevibacterium linens BL2 .....................................   90   1 hit  [high GC Gram+]        zinc metalloprotease [Brevibacterium linens BL2]
. . . Xylella fastidiosa Dixon ......................................   90   2 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Xylella fastidiosa Dixon] >
. . . Xylella fastidiosa subsp. sandyi Ann-1 ........................   90   4 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Xylella fastidiosa Dixon] >
. . . Bacteroides vulgatus ATCC 8482 ................................   90   2 hits [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides vulgatus
. . . Bacteroides sp. 4_3_47FAA .....................................   90   2 hits [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides vulgatus
. . . Rhodococcus jostii RHA1 .......................................   90   2 hits [high GC Gram+]        neprilysin [Rhodococcus jostii RHA1] >gi|110821615|gb|ABG96
. . . Bacteroides sp. 9_1_42FAA .....................................   90   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] 
. . . Bacteroides sp. D4 ............................................   90   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] 
. . . Bacteroides dorei DSM 17855 ...................................   90   2 hits [CFB group bacteria]   hypothetical protein BACDOR_03388 [Bacteroides dorei DSM 17
. . . Mobiluncus curtisii ATCC 43063 ................................   90   2 hits [high GC Gram+]        endothelin-converting protein 1 [Mobiluncus curtisii ATCC 4
. . . Micrococcus luteus NCTC 2665 ..................................   90   2 hits [high GC Gram+]        endothelin-converting enzyme [Micrococcus luteus NCTC 2665]
. . . Arthrobacter chlorophenolicus A6 ..............................   90   2 hits [high GC Gram+]        Endothelin-converting enzyme 1 [Arthrobacter chlorophenolic
. . . Rhodococcus erythropolis SK121 ................................   90   2 hits [high GC Gram+]        neprilysin [Rhodococcus erythropolis SK121] >gi|229324485|g
. . . Rhodococcus erythropolis PR4 ..................................   90   2 hits [high GC Gram+]        metalloendopeptidase [Rhodococcus erythropolis PR4] >gi|226
. . . Lactobacillus gasseri JV-V03 ..................................   90   4 hits [firmicutes]           M13 family peptidase [Lactobacillus gasseri JV-V03] >gi|227
. . . marine actinobacterium PHSC20C1 ...............................   90   2 hits [high GC Gram+]        metallopeptidase [marine actinobacterium PHSC20C1] >gi|8881
. . . Gluconacetobacter diazotrophicus PAl 5 ........................   90   4 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Gluconacetobacter diazotrop
. . . Mycobacterium abscessus .......................................   90   4 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium abscessus] >gi|16924302
. . . Rhodococcus opacus B4 .........................................   90   2 hits [high GC Gram+]        metalloendopeptidase [Rhodococcus opacus B4] >gi|226243077|
. . . Flavobacterium psychrophilum JIP02/86 .........................   90   2 hits [CFB group bacteria]   M13 family metallopeptidase PepO precursor [Flavobacterium 
. . . Francisella tularensis subsp. tularensis FSC033 ...............   90   2 hits [g-proteobacteria]     hypothetical protein [Francisella tularensis subsp. tularen
. . . Francisella tularensis subsp. tularensis MA00-2987 ............   90   3 hits [g-proteobacteria]     hypothetical protein [Francisella tularensis subsp. tularen
. . . Dokdonia donghaensis MED134 ...................................   90   4 hits [CFB group bacteria]   metalloendopeptidase PepO [Dokdonia donghaensis MED134] >gi
. . . Porphyromonas uenonis 60-3 ....................................   90   4 hits [CFB group bacteria]   endopeptidase PepO [Porphyromonas uenonis 60-3] >gi|2283089
. . . Streptococcus mutans UA159 ....................................   90   2 hits [firmicutes]           putative peptidase [Streptococcus mutans UA159] >gi|2121754
. . . Streptococcus mutans ..........................................   90   1 hit  [firmicutes]           putative peptidase [Streptococcus mutans UA159] >gi|2121754
. . . Francisella novicida U112 .....................................   90   2 hits [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Francisella novicida FTE ......................................   90   2 hits [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Francisella novicida FTG ......................................   90   2 hits [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Francisella novicida GA99-3548 ................................   90   2 hits [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Francisella novicida ..........................................   90   1 hit  [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Streptococcus mutans NN2025 ...................................   89   1 hit  [firmicutes]           putative peptidase [Streptococcus mutans NN2025]
. . . Parabacteroides merdae ATCC 43184 .............................   89   2 hits [CFB group bacteria]   hypothetical protein PARMER_02915 [Parabacteroides merdae A
. . . Nocardia farcinica IFM 10152 ..................................   89   4 hits [high GC Gram+]        putative peptidase [Nocardia farcinica IFM 10152] >gi|54019
. . . Corynebacterium urealyticum DSM 7109 ..........................   89   2 hits [high GC Gram+]        putative endopeptidase [Corynebacterium urealyticum DSM 710
. . . Maricaulis maris MCS10 ........................................   89   4 hits [a-proteobacteria]     endothelin-converting protein 1 [Maricaulis maris MCS10] >g
. . . Janibacter sp. HTCC2649 .......................................   89   2 hits [high GC Gram+]        putative peptidase [Janibacter sp. HTCC2649] >gi|84381831|g
. . . Jonesia denitrificans DSM 20603 ...............................   88   2 hits [high GC Gram+]        Endothelin-converting enzyme 1 [Jonesia denitrificans DSM 2
. . . Roseovarius sp. HTCC2601 ......................................   88   2 hits [a-proteobacteria]     probable zinc metalloproteinase [Roseovarius sp. HTCC2601] 
. . . Actinomyces coleocanis DSM 15436 ..............................   88   2 hits [high GC Gram+]        endothelin-converting protein 1 [Actinomyces coleocanis DSM
. . . Gordonia bronchialis DSM 43247 ................................   88   4 hits [high GC Gram+]        Endothelin-converting enzyme 1 [Gordonia bronchialis DSM 43
. . . bacterium Ellin514 ............................................   88   2 hits [verrucomicrobia]      Endothelin-converting enzyme 1 [bacterium Ellin514] >gi|223
. . . Chromobacterium violaceum ATCC 12472 ..........................   88   4 hits [b-proteobacteria]     metallopeptidase [Chromobacterium violaceum ATCC 12472] >gi
. . . Polaribacter sp. MED152 .......................................   88   2 hits [CFB group bacteria]   peptidase family M13 [Polaribacter sp. MED152] >gi|85821587
. . . Pseudoalteromonas haloplanktis TAC125 .........................   88   4 hits [g-proteobacteria]     peptidase, M13 (lipoprotein) [Pseudoalteromonas haloplankti
. . . Polaribacter irgensii 23-P ....................................   88   2 hits [CFB group bacteria]   Peptidase, M13 family lipoprotein [Polaribacter irgensii 23
. . . Prevotella bergensis DSM 17361 ................................   87   1 hit  [CFB group bacteria]   putative endothelin-converting enzyme [Prevotella bergensis
. . . Lysinibacillus sphaericus C3-41 ...............................   87   2 hits [firmicutes]           neutral endopeptidase [Lysinibacillus sphaericus C3-41] >gi
. . . Kangiella koreensis DSM 16069 .................................   87   2 hits [g-proteobacteria]     Endothelin-converting enzyme 1 [Kangiella koreensis DSM 160
. . . Sorangium cellulosum 'So ce 56' ...............................   87   2 hits [d-proteobacteria]     metallopeptidase [Sorangium cellulosum 'So ce 56'] >gi|1611
. . . Rhodopseudomonas palustris BisB5 ..............................   87   2 hits [a-proteobacteria]     endothelin-converting protein 1 [Rhodopseudomonas palustris
. . . Porphyromonas endodontalis ATCC 35406 .........................   87   2 hits [CFB group bacteria]   endopeptidase PepO [Porphyromonas endodontalis ATCC 35406] 
. . . Propionibacterium sp. oral taxon 191 str. F0233 ...............   87   2 hits [high GC Gram+]        endopeptidase PepO [Porphyromonas endodontalis ATCC 35406] 
. . . Acidimicrobium ferrooxidans DSM 10331 .........................   87   2 hits [high GC Gram+]        Endothelin-converting enzyme 1 [Acidimicrobium ferrooxidans
. . . Actinomyces urogenitalis DSM 15434 ............................   87   2 hits [high GC Gram+]        endothelin-converting protein [Actinomyces urogenitalis DSM
. . . Bacillus sp. B14905 ...........................................   87   2 hits [firmicutes]           putative membrane metallo endopeptidase [Bacillus sp. B1490
. . . Corynebacterium amycolatum SK46 ...............................   87   2 hits [high GC Gram+]        neprilysin [Corynebacterium amycolatum SK46] >gi|213951647|
. . . Aeromonas salmonicida subsp. salmonicida A449 .................   87   2 hits [g-proteobacteria]     M13 family peptidase [Aeromonas salmonicida subsp. salmonic
. . . Pedobacter sp. BAL39 ..........................................   87   4 hits [CFB group bacteria]   probable metallopeptidase [Pedobacter sp. BAL39] >gi|149228
. . . Tropheryma whipplei str. Twist ................................   86   2 hits [high GC Gram+]        metalloendopeptidase [Tropheryma whipplei str. Twist] >gi|2
. . . Bifidobacterium angulatum DSM 20098 ...........................   86   2 hits [high GC Gram+]        hypothetical protein BIFANG_02422 [Bifidobacterium angulatu
. . . Tropheryma whipplei TW08/27 ...................................   86   2 hits [high GC Gram+]        peptidase [Tropheryma whipplei TW08/27] >gi|28411055|emb|CA
. . . Erythrobacter sp. SD-21 .......................................   86   2 hits [a-proteobacteria]     probable zinc metalloproteinase [Erythrobacter sp. SD-21] >
. . . Lactobacillus jensenii SJ-7A-US ...............................   86   4 hits [firmicutes]           endopeptidase O [Lactobacillus jensenii SJ-7A-US] >gi|26056
. . . Lactobacillus jensenii 269-3 ..................................   86   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus jensenii 269-3] >gi|23
. . . Lactobacillus jensenii 1153 ...................................   86   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus jensenii 269-3] >gi|23
. . . Lactobacillus johnsonii ATCC 33200 ............................   86   6 hits [firmicutes]           M13 family peptidase [Lactobacillus johnsonii ATCC 33200] >
. . . Lactobacillus johnsonii NCC 533 ...............................   86   6 hits [firmicutes]           neutral endopeptidase [Lactobacillus johnsonii NCC 533] >gi
. . . Streptococcus salivarius SK126 ................................   86   2 hits [firmicutes]           endopeptidase O [Streptococcus salivarius SK126] >gi|228250
. . . Lactobacillus johnsonii FI9785 ................................   86   4 hits [firmicutes]           endopeptidase O [Lactobacillus johnsonii FI9785] >gi|262397
. . . Clostridiales bacterium 1_7_47FAA .............................   86   2 hits [firmicutes]           endothelin-converting enzyme 1 [Clostridiales bacterium 1_7
. . . Lactobacillus rhamnosus LMS2-1 ................................   86   4 hits [firmicutes]           M13 family peptidase [Lactobacillus rhamnosus LMS2-1] >gi|2
. . . Lactobacillus rhamnosus Lc 705 ................................   86   4 hits [firmicutes]           M13 family peptidase [Lactobacillus rhamnosus LMS2-1] >gi|2
. . . Acetobacter pasteurianus IFO 3283-01 ..........................   86   2 hits [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-03 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-07 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-22 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-26 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-32 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-01-42C ......................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Acetobacter pasteurianus IFO 3283-12 ..........................   86   1 hit  [a-proteobacteria]     metallopeptidase [Acetobacter pasteurianus IFO 3283-01] >gi
. . . Oceanicaulis alexandrii HTCC2633 ..............................   86   4 hits [a-proteobacteria]     Secreted zinc metalloproteinase [Oceanicaulis alexandrii HT
. . . Gardnerella vaginalis ATCC 14019 ..............................   85   2 hits [high GC Gram+]        possible Endothelin-converting enzyme 1 [Gardnerella vagina
. . . Hirschia baltica ATCC 49814 ...................................   85   2 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Hirschia baltica ATCC 49814
. . . Lactobacillus rhamnosus HN001 .................................   85   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus rhamnosus HN001] >gi|1
. . . Bacteroides coprophilus DSM 18228 .............................   85   2 hits [CFB group bacteria]   hypothetical protein BACCOPRO_03512 [Bacteroides coprophilu
. . . Streptococcus ratti ...........................................   85   1 hit  [firmicutes]           putative PepO [Streptococcus ratti]
. . . marine gamma proteobacterium HTCC2080 .........................   85   2 hits [g-proteobacteria]     peptidase, M13 family protein [marine gamma proteobacterium
. . . Kribbella flavida DSM 17836 ...................................   85   2 hits [high GC Gram+]        endothelin-converting enzyme [Kribbella flavida DSM 17836] 
. . . Lactobacillus rhamnosus GG ....................................   85   6 hits [firmicutes]           neutral endopeptidase (endopeptidase O) [Lactobacillus rham
. . . Caulobacter segnis ATCC 21756 .................................   85   2 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Caulobacter segnis ATCC 217
. . . Nakamurella multipartita DSM 44233 ............................   85   2 hits [high GC Gram+]        Neprilysin [Nakamurella multipartita DSM 44233] >gi|2585536
. . . Bifidobacterium adolescentis L2-32 ............................   85   2 hits [high GC Gram+]        hypothetical protein BIFADO_00738 [Bifidobacterium adolesce
. . . Gramella forsetii KT0803 ......................................   85   2 hits [CFB group bacteria]   neutral endopeptidase [Gramella forsetii KT0803] >gi|117579
. . . Bifidobacterium adolescentis ATCC 15703 .......................   85   2 hits [high GC Gram+]        M13 family peptidase [Bifidobacterium adolescentis ATCC 157
. . . Corynebacterium jeikeium K411 .................................   85   2 hits [high GC Gram+]        putative endopeptidase [Corynebacterium jeikeium K411] >gi|
. . . Corynebacterium jeikeium ATCC 43734 ...........................   85   2 hits [high GC Gram+]        M13 family peptidase [Corynebacterium jeikeium ATCC 43734] 
. . . Streptococcus pneumoniae SP11-BS70 ............................   84   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae SP11-BS70] >gi|14
. . . Alteromonadales bacterium TW-7 ................................   84   4 hits [g-proteobacteria]     Peptidase, M13 family (lipoprotein) [Alteromonadales bacter
. . . Streptococcus sp. 2_1_36FAA ...................................   84   2 hits [firmicutes]           endopeptidase O [Streptococcus sp. 2_1_36FAA] >gi|262260929
. . . Prevotella sp. oral taxon 472 str. F0295 ......................   84   2 hits [CFB group bacteria]   metalloendopeptidase PepO [Prevotella sp. oral taxon 472 st
. . . Lactobacillus ultunensis DSM 16047 ............................   84   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus ultunensis DSM 16047] 
. . . Streptococcus pyogenes str. Manfredo ..........................   84   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pyogenes str. Manfr
. . . Streptococcus pyogenes M1 GAS .................................   84   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pyogenes M1 GAS] >g
. . . Streptococcus pyogenes M49 591 ................................   84   1 hit  [firmicutes]           COG3590: Predicted metalloendopeptidase [Streptococcus pyog
. . . Streptococcus pyogenes NZ131 ..................................   84   2 hits [firmicutes]           COG3590: Predicted metalloendopeptidase [Streptococcus pyog
. . . Streptococcus pyogenes MGAS6180 ...............................   84   2 hits [firmicutes]           neutral endopeptidase [Streptococcus pyogenes MGAS6180] >gi
. . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 .........   84   2 hits [firmicutes]           oligoendopeptidase O [Streptococcus dysgalactiae subsp. equ
. . . Streptococcus pyogenes MGAS10750 ..............................   84   2 hits [firmicutes]           Oligoendopeptidase O [Streptococcus pyogenes MGAS10750] >gi
. . . Streptococcus pyogenes MGAS8232 ...............................   84   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pyogenes MGAS8232] 
. . . Streptococcus pyogenes MGAS315 ................................   84   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pyogenes MGAS8232] 
. . . Streptococcus pyogenes SSI-1 ..................................   84   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pyogenes MGAS8232] 
. . . Flavobacteria bacterium BBFL7 .................................   84   2 hits [CFB group bacteria]   endopeptidase M13 family [Flavobacteria bacterium BBFL7] >g
. . . Streptococcus pyogenes MGAS5005 ...............................   84   2 hits [firmicutes]           neutral endopeptidase [Streptococcus pyogenes MGAS5005] >gi
. . . Streptococcus pyogenes MGAS10394 ..............................   84   2 hits [firmicutes]           neutral endopeptidase [Streptococcus pyogenes MGAS10394] >g
. . . Streptococcus pyogenes MGAS10270 ..............................   84   2 hits [firmicutes]           neutral endopeptidase [Streptococcus pyogenes MGAS10394] >g
. . . Streptococcus thermophilus ....................................   84   1 hit  [firmicutes]           oligopeptidase [Streptococcus thermophilus]
. . . Streptococcus thermophilus LMD-9 ..............................   84   2 hits [firmicutes]           endopeptidase O [Streptococcus thermophilus LMD-9] >gi|1161
. . . Xanthomonas oryzae pv. oryzicola BLS256 .......................   83   2 hits [g-proteobacteria]     metallopeptidase [Xanthomonas oryzae pv. oryzicola BLS256]
. . . Streptococcus thermophilus LMG 18311 ..........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus thermophilus LMG 18311] >gi|
. . . Streptococcus thermophilus CNRZ1066 ...........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus thermophilus LMG 18311] >gi|
. . . Algoriphagus sp. PR1 ..........................................   83   2 hits [CFB group bacteria]   metalloendopeptidase PepO [Algoriphagus sp. PR1] >gi|126578
. . . Streptococcus pyogenes MGAS9429 ...............................   83   2 hits [firmicutes]           oligoendopeptidase O [Streptococcus pyogenes MGAS9429] >gi|
. . . Streptococcus pyogenes MGAS2096 ...............................   83   2 hits [firmicutes]           oligoendopeptidase O [Streptococcus pyogenes MGAS9429] >gi|
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 ..............   83   2 hits [g-proteobacteria]     M13 family peptidase [Aeromonas hydrophila subsp. hydrophil
. . . Kytococcus sedentarius DSM 20547 ..............................   83   2 hits [high GC Gram+]        endothelin-converting enzyme [Kytococcus sedentarius DSM 20
. . . Mycoplasma hominis ............................................   83   2 hits [mycoplasmas]          Endopeptidase O [Mycoplasma hominis] >gi|268322854|emb|CAX3
. . . Mycobacterium kansasii ATCC 12478 .............................   83   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium kansasii ATCC 12478]
. . . Enterococcus gallinarum EG2 ...................................   83   2 hits [firmicutes]           M13 family peptidase [Enterococcus gallinarum EG2] >gi|2578
. . . Bifidobacterium pseudocatenulatum DSM 20438 ...................   83   2 hits [high GC Gram+]        hypothetical protein BIFPSEUDO_02445 [Bifidobacterium pseud
. . . Anaeromyxobacter sp. Fw109-5 ..................................   83   2 hits [d-proteobacteria]     endothelin-converting protein 1 [Anaeromyxobacter sp. Fw109
. . . Brevundimonas subvibrioides ATCC 15264 ........................   83   2 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Brevundimonas subvibrioides
. . . Streptococcus vestibularis ....................................   83   1 hit  [firmicutes]           endopeptidase O [Streptococcus vestibularis]
. . . Streptococcus pneumoniae SP9-BS68 .............................   83   2 hits [firmicutes]           thiol peroxidase [Streptococcus pneumoniae SP9-BS68] >gi|16
. . . Streptococcus pneumoniae SP195 ................................   83   2 hits [firmicutes]           thiol peroxidase [Streptococcus pneumoniae SP9-BS68] >gi|16
. . . Streptococcus pneumoniae TIGR4 ................................   83   3 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae SP14-BS69 ............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae SP19-BS75 ............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae SP23-BS72 ............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae CDC0288-04 ...........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae MLV-016 ..............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae Hungary19A-6 .........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae P1031 ................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae CCRI 1974 ............................   83   1 hit  [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae CCRI 1974M2 ..........................   83   1 hit  [firmicutes]           endopeptidase O [Streptococcus pneumoniae TIGR4] >gi|111657
. . . Streptococcus pneumoniae ATCC 700669 ..........................   83   2 hits [firmicutes]           putative endopeptidase O [Streptococcus pneumoniae ATCC 700
. . . Streptococcus pneumoniae 70585 ................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae 70585] >gi|225721
. . . Streptococcus pneumoniae G54 ..................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae G54] >gi|19435806
. . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 .....   83   2 hits [firmicutes]           hypothetical protein STRINF_00492 [Streptococcus infantariu
. . . Streptococcus pneumoniae SP18-BS74 ............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae SP18-BS74] >gi|14
. . . Streptococcus pneumoniae JJA ..................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae JJA] >gi|22572414
. . . Streptococcus pneumoniae SP3-BS71 .............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae SP3-BS71] >gi|168
. . . Streptococcus pneumoniae CDC1087-00 ...........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae SP3-BS71] >gi|168
. . . Streptococcus pneumoniae Taiwan19F-14 .........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae SP3-BS71] >gi|168
. . . Streptococcus suis 05ZYH33 ....................................   83   4 hits [firmicutes]           metalloendopeptidase [Streptococcus suis 05ZYH33] >gi|14632
. . . Streptococcus pneumoniae R6 ...................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae R6] >gi|116517102
. . . Streptococcus pneumoniae D39 ..................................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae R6] >gi|116517102
. . . Streptococcus pneumoniae SP6-BS73 .............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae R6] >gi|116517102
. . . Streptococcus pneumoniae CDC3059-06 ...........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae R6] >gi|116517102
. . . Streptococcus pneumoniae CDC1873-00 ...........................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae CDC1873-00] >gi|1
. . . Alteromonas macleodii ATCC 27126 ..............................   83   2 hits [g-proteobacteria]     metalloendopeptidase PepO [Alteromonas macleodii ATCC 27126]
. . . Streptococcus pneumoniae CGSP14 ...............................   83   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae CGSP14] >gi|18262
. . . Anaeromyxobacter sp. K ........................................   83   2 hits [d-proteobacteria]     Endothelin-converting enzyme 1 [Anaeromyxobacter sp. K] >gi
. . . Mycobacterium leprae TN .......................................   82   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium leprae TN] >gi|22123088
. . . Mycobacterium leprae Br4923 ...................................   82   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium leprae TN] >gi|22123088
. . . Mycobacterium leprae ..........................................   82   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium leprae TN] >gi|22123088
. . . Prevotella tannerae ATCC 51259 ................................   82   2 hits [CFB group bacteria]   metalloendopeptidase PepO [Prevotella tannerae ATCC 51259] 
. . . Streptococcus salivarius ......................................   82   1 hit  [firmicutes]           endopeptidase O [Streptococcus salivarius]
. . . Caulobacter crescentus CB15 ...................................   82   2 hits [a-proteobacteria]     peptidase M13 family protein [Caulobacter crescentus CB15] 
. . . Caulobacter crescentus NA1000 .................................   82   2 hits [a-proteobacteria]     peptidase M13 family protein [Caulobacter crescentus CB15] 
. . . Mycoplasma agalactiae PG2 .....................................   82   2 hits [mycoplasmas]          endopeptidase O [Mycoplasma agalactiae PG2] >gi|148291680|e
. . . Streptococcus pneumoniae TCH8431/19A ..........................   82   2 hits [firmicutes]           endopeptidase O [Streptococcus pneumoniae TCH8431/19A] >gi|
. . . Bifidobacterium longum NCC2705 ................................   82   2 hits [high GC Gram+]        M13 family peptidase [Bifidobacterium longum NCC2705] >gi|2
. . . Alistipes putredinis DSM 17216 ................................   82   2 hits [CFB group bacteria]   hypothetical protein ALIPUT_02104 [Alistipes putredinis DSM
. . . Brevundimonas sp. BAL3 ........................................   82   4 hits [a-proteobacteria]     peptidase family M13 [Brevundimonas sp. BAL3] >gi|196185586
. . . Clostridium hylemonae DSM 15053 ...............................   82   2 hits [firmicutes]           hypothetical protein CLOHYLEM_07366 [Clostridium hylemonae 
. . . Bifidobacterium longum subsp. infantis ATCC 55813 .............   82   2 hits [high GC Gram+]        possible Endothelin-converting enzyme 1 [Bifidobacterium lo
. . . Bifidobacterium longum subsp. infantis ATCC 15697 .............   82   2 hits [high GC Gram+]        Neprilysin [Bifidobacterium longum subsp. infantis ATCC 156
. . . Streptococcus sanguinis SK36 ..................................   82   4 hits [firmicutes]           Zinc metalloproteinase in scaA 5'region, putative [Streptoc
. . . Sphingomonas sp. SKA58 ........................................   82   2 hits [a-proteobacteria]     metallopeptidase [Sphingomonas sp. SKA58] >gi|94422695|gb|E
. . . Streptococcus parasanguinis ...................................   82   1 hit  [firmicutes]           endopeptidase O [Streptococcus parasanguinis]
. . . Streptococcus gordonii str. Challis substr. CH1 ...............   82   2 hits [firmicutes]           endopeptidase O [Streptococcus gordonii str. Challis substr
. . . Bifidobacterium catenulatum DSM 16992 .........................   82   2 hits [high GC Gram+]        hypothetical protein BIFCAT_01377 [Bifidobacterium catenula
. . . Flavobacteria bacterium BAL38 .................................   82   2 hits [CFB group bacteria]   Peptidase, M13 family (lipoprotein) [Flavobacteria bacteriu
. . . Bifidobacterium longum subsp. infantis CCUG 52486 .............   82   2 hits [high GC Gram+]        peptidase family M13 protein [Bifidobacterium longum subsp.
. . . Xylella fastidiosa 9a5c .......................................   82   2 hits [g-proteobacteria]     metallopeptidase [Xylella fastidiosa 9a5c] >gi|9105440|gb|A
. . . Bifidobacterium longum DJO10A .................................   82   3 hits [high GC Gram+]        COG3590: Predicted metalloendopeptidase [Bifidobacterium lo
. . . Streptococcus agalactiae COH1 .................................   82   4 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae COH1] >gi|7717295
. . . Enterococcus casseliflavus EC20 ...............................   82   2 hits [firmicutes]           M13 family peptidase [Enterococcus casseliflavus EC20] >gi|
. . . Enterococcus casseliflavus EC30 ...............................   81   2 hits [firmicutes]           M13 family peptidase [Enterococcus casseliflavus EC30] >gi|
. . . Enterococcus casseliflavus EC10 ...............................   81   2 hits [firmicutes]           M13 family peptidase [Enterococcus casseliflavus EC30] >gi|
. . . Kocuria rhizophila DC2201 .....................................   81   2 hits [high GC Gram+]        metalloendopeptidase [Kocuria rhizophila DC2201] >gi|183580
. . . Bacteroides plebeius DSM 17135 ................................   81   2 hits [CFB group bacteria]   hypothetical protein BACPLE_02323 [Bacteroides plebeius DSM
. . . Mycobacterium ulcerans Agy99 ..................................   81   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium ulcerans Agy99] >gi|118
. . . Streptococcus equi subsp. zooepidemicus .......................   81   2 hits [firmicutes]           endopeptidase O [Streptococcus equi subsp. zooepidemicus] >
. . . Streptococcus equi subsp. equi 4047 ...........................   81   2 hits [firmicutes]           endopeptidase O [Streptococcus equi subsp. equi 4047] >gi|2
. . . Streptococcus equi subsp. zooepidemicus MGCS10565 .............   81   2 hits [firmicutes]           metallopeptidase PepO [Streptococcus equi subsp. zooepidemi
. . . Lactobacillus plantarum WCFS1 .................................   81   2 hits [firmicutes]           endopeptidase PepO [Lactobacillus plantarum WCFS1] >gi|2827
. . . Lactobacillus plantarum JDM1 ..................................   81   2 hits [firmicutes]           endopeptidase PepO [Lactobacillus plantarum JDM1] >gi|25404
. . . Lactobacillus plantarum subsp. plantarum ATCC 14917 ...........   81   2 hits [firmicutes]           endopeptidase PepO [Lactobacillus plantarum subsp. plantaru
. . . Mycobacterium marinum M .......................................   81   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium marinum M] >gi|18317379
. . . Sphingopyxis alaskensis RB2256 ................................   81   2 hits [a-proteobacteria]     endothelin-converting protein 1 [Sphingopyxis alaskensis RB
. . . Anaeromyxobacter dehalogenans 2CP-C ...........................   80   2 hits [d-proteobacteria]     PgPepO oligopeptidase [Anaeromyxobacter dehalogenans 2CP-C]
. . . Alteromonas macleodii 'Deep ecotype' ..........................   80   4 hits [g-proteobacteria]     metalloendopeptidase PepO [Alteromonas macleodii 'Deep ecot
. . . Anaeromyxobacter dehalogenans 2CP-1 ...........................   80   2 hits [d-proteobacteria]     Endothelin-converting enzyme 1 [Anaeromyxobacter dehalogena
. . . Erythrobacter litoralis HTCC2594 ..............................   80   2 hits [a-proteobacteria]     zinc metalloproteinase [Erythrobacter litoralis HTCC2594] >
. . . Aeromicrobium marinum DSM 15272 ...............................   80   1 hit  [high GC Gram+]        metallopeptidase [Aeromicrobium marinum DSM 15272]
. . . Sphingomonas wittichii RW1 ....................................   80   2 hits [a-proteobacteria]     endothelin-converting protein 1 [Sphingomonas wittichii RW1
. . . Mycobacterium sp. JLS .........................................   80   2 hits [high GC Gram+]        PgPepO oligopeptidase [Mycobacterium sp. JLS] >gi|126232560
. . . Actinomyces odontolyticus ATCC 17982 ..........................   80   2 hits [high GC Gram+]        hypothetical protein ACTODO_01501 [Actinomyces odontolyticu
. . . Mycobacterium sp. KMS .........................................   80   2 hits [high GC Gram+]        PgPepO oligopeptidase [Mycobacterium sp. KMS] >gi|119692311
. . . Mycobacterium sp. MCS .........................................   80   2 hits [high GC Gram+]        PgPepO oligopeptidase [Mycobacterium sp. MCS] >gi|108767556
. . . Streptococcus agalactiae A909 .................................   80   2 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae A909] >gi|7740566
. . . Streptococcus agalactiae H36B .................................   80   6 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae A909] >gi|7740566
. . . Streptococcus agalactiae CJB111 ...............................   80   4 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae A909] >gi|7740566
. . . Providencia alcalifaciens DSM 30120 ...........................   80   2 hits [enterobacteria]       hypothetical protein PROVALCAL_02823 [Providencia alcalifac
. . . Lactobacillus jensenii JV-V16 .................................   80   4 hits [firmicutes]           M13 family peptidase [Lactobacillus jensenii JV-V16] >gi|25
. . . Lactobacillus jensenii 27-2-CHN ...............................   80   4 hits [firmicutes]           M13 family peptidase [Lactobacillus jensenii JV-V16] >gi|25
. . . Lactobacillus jensenii 115-3-CHN ..............................   80   4 hits [firmicutes]           M13 family peptidase [Lactobacillus jensenii JV-V16] >gi|25
. . . Streptococcus agalactiae 2603V/R ..............................   80   2 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae 2603V/R] >gi|2501
. . . Streptococcus agalactiae NEM316 ...............................   80   2 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae 2603V/R] >gi|2501
. . . Streptococcus agalactiae 18RS21 ...............................   80   4 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae 2603V/R] >gi|2501
. . . Streptococcus agalactiae 515 ..................................   80   2 hits [firmicutes]           endopeptidase O [Streptococcus agalactiae 2603V/R] >gi|2501
. . . Bifidobacterium animalis subsp. lactis AD011 ..................   80   2 hits [high GC Gram+]        metalloendopeptidase [Bifidobacterium animalis subsp. lacti
. . . Bifidobacterium animalis ......................................   80   1 hit  [high GC Gram+]        metalloendopeptidase [Bifidobacterium animalis subsp. lacti
. . . Prevotella veroralis F0319 ....................................   80   4 hits [CFB group bacteria]   metalloendopeptidase PepO [Prevotella veroralis F0319] >gi|
. . . Prevotella melaninogenica ATCC 25845 ..........................   79   4 hits [CFB group bacteria]   endopeptidase PepO [Prevotella melaninogenica ATCC 25845] >
. . . Mycobacterium intracellulare ATCC 13950 .......................   79   1 hit  [high GC Gram+]        peptidase family protein M13 [Mycobacterium intracellulare 
. . . Streptococcus suis ............................................   79   1 hit  [firmicutes]           neprilysin [Streptococcus suis]
. . . Bacteroides fragilis YCH46 ....................................   79   2 hits [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides fragilis
. . . Bacteroides sp. 2_1_16 ........................................   79   2 hits [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides fragilis
. . . Bacteroides sp. 3_2_5 .........................................   79   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 3_2_5] >gi|
. . . Bacteroides fragilis NCTC 9343 ................................   79   2 hits [CFB group bacteria]   putative endopeptidase [Bacteroides fragilis NCTC 9343] >gi
. . . Providencia rustigianii DSM 4541 ..............................   79   1 hit  [enterobacteria]       endothelin-converting protein 1 [Providencia rustigianii DS
. . . Lactobacillus buchneri ATCC 11577 .............................   79   2 hits [firmicutes]           M13 family peptidase [Lactobacillus buchneri ATCC 11577] >g
. . . Mycobacterium gilvum PYR-GCK ..................................   79   2 hits [high GC Gram+]        neprilysin [Mycobacterium gilvum PYR-GCK] >gi|145213562|gb|
. . . Bacteroides intestinalis DSM 17393 ............................   79   2 hits [CFB group bacteria]   hypothetical protein BACINT_04820 [Bacteroides intestinalis
. . . Oenococcus oeni ATCC BAA-1163 .................................   79   2 hits [firmicutes]           endopeptidase O, peptidase M13 family [Oenococcus oeni ATCC
. . . Bacteroides cellulosilyticus DSM 14838 ........................   78   2 hits [CFB group bacteria]   hypothetical protein BACCELL_00239 [Bacteroides cellulosily
. . . Oenococcus oeni PSU-1 .........................................   78   2 hits [firmicutes]           oligopeptidase O1 [Oenococcus oeni PSU-1] >gi|116092327|gb|
. . . Mycobacterium smegmatis str. MC2 155 ..........................   78   2 hits [high GC Gram+]        metallopeptidase [Mycobacterium smegmatis str. MC2 155] >gi
. . . Bacteroides stercoris ATCC 43183 ..............................   78   2 hits [CFB group bacteria]   hypothetical protein BACSTE_00096 [Bacteroides stercoris AT
. . . Lactobacillus iners DSM 13335 .................................   78   2 hits [firmicutes]           endopeptidase O [Lactobacillus iners DSM 13335] >gi|2591675
. . . Bifidobacterium dentium ATCC 27678 ............................   78   2 hits [high GC Gram+]        hypothetical protein BIFDEN_00124 [Bifidobacterium dentium 
. . . Bifidobacterium animalis subsp. lactis HN019 ..................   78   2 hits [high GC Gram+]        belongs to peptidase family M13 [Bifidobacterium animalis s
. . . Bifidobacterium animalis subsp. lactis Bl-04 ..................   78   2 hits [high GC Gram+]        belongs to peptidase family M13 [Bifidobacterium animalis s
. . . Bifidobacterium animalis subsp. lactis DSM 10140 ..............   78   2 hits [high GC Gram+]        belongs to peptidase family M13 [Bifidobacterium animalis s
. . . Providencia stuartii ATCC 25827 ...............................   78   2 hits [enterobacteria]       hypothetical protein PROSTU_02718 [Providencia stuartii ATC
. . . Bifidobacterium bifidum NCIMB 41171 ...........................   78   1 hit  [high GC Gram+]        M13 family peptidase [Bifidobacterium bifidum NCIMB 41171]
. . . Bacteroides fragilis 3_1_12 ...................................   78   1 hit  [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides fragilis
. . . Providencia rettgeri DSM 1131 .................................   78   1 hit  [enterobacteria]       endothelin-converting protein 1 [Providencia rettgeri DSM 1
. . . Phenylobacterium zucineum HLK1 ................................   78   4 hits [a-proteobacteria]     metallopeptidase [Phenylobacterium zucineum HLK1] >gi|19647
. . . Bifidobacterium gallicum DSM 20093 ............................   78   1 hit  [high GC Gram+]        metalloendopeptidase [Bifidobacterium gallicum DSM 20093]
. . . Bacteroides uniformis ATCC 8492 ...............................   78   2 hits [CFB group bacteria]   hypothetical protein BACUNI_02410 [Bacteroides uniformis AT
. . . Mycobacterium avium 104 .......................................   77   2 hits [high GC Gram+]        peptidase family protein M13 [Mycobacterium avium 104] >gi|
. . . Mycobacterium avium subsp. avium ATCC 25291 ...................   77   1 hit  [high GC Gram+]        peptidase family protein M13 [Mycobacterium avium subsp. av
. . . Catonella morbi ATCC 51271 ....................................   77   2 hits [firmicutes]           hypothetical protein GCWU000282_00943 [Catonella morbi ATCC
. . . Mycobacterium tuberculosis str. Haarlem .......................   77   2 hits [high GC Gram+]        hypothetical zinc metalloprotease [Mycobacterium tuberculos
. . . Lactobacillus hilgardii ATCC 8290 .............................   77   2 hits [firmicutes]           M13 family peptidase [Lactobacillus hilgardii ATCC 8290] >g
. . . Lactobacillus brevis subsp. gravesensis ATCC 27305 ............   77   2 hits [firmicutes]           M13 family peptidase [Lactobacillus brevis subsp. gravesens
. . . Mycobacterium tuberculosis T92 ................................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis T92] >gi|2
. . . Mycobacterium tuberculosis T46 ................................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis T92] >gi|2
. . . Enterococcus faecium 1,231,501 ................................   77   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium 1,231,501] >gi|2
. . . Enterococcus faecium TC 6 .....................................   77   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium 1,231,501] >gi|2
. . . Mycobacterium tuberculosis H37Rv ..............................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis CDC1551 ............................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium bovis AF2122/97 .................................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium bovis BCG str. Pasteur 1173P2 ...................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis H37Ra ..............................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis F11 ................................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis 02_1987 ............................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis 94_M4241A ..........................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis EAS054 .............................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium bovis BCG str. Tokyo 172 ........................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis KZN 1435 ...........................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis C ..................................   77   2 hits [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis '98-R604 INH-RIF-EM' ...............   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis KZN 4207 ...........................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis KZN 605 ............................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis CPHL_A .............................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Mycobacterium tuberculosis K85 ................................   77   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis H37Rv] >gi
. . . Enterococcus faecium DO .......................................   77   3 hits [firmicutes]           Endothelin-converting enzyme 1 [Enterococcus faecium DO] >g
. . . Enterococcus faecium 1,230,933 ................................   77   2 hits [firmicutes]           Endothelin-converting enzyme 1 [Enterococcus faecium DO] >g
. . . Enterococcus faecium 1,231,502 ................................   77   2 hits [firmicutes]           Endothelin-converting enzyme 1 [Enterococcus faecium DO] >g
. . . Enterococcus faecium 1,231,410 ................................   77   2 hits [firmicutes]           Endothelin-converting enzyme 1 [Enterococcus faecium DO] >g
. . . Enterococcus faecium C68 ......................................   77   2 hits [firmicutes]           Endothelin-converting enzyme 1 [Enterococcus faecium DO] >g
. . . Corynebacterium kroppenstedtii DSM 44385 ......................   77   2 hits [high GC Gram+]        putative endopeptidase [Corynebacterium kroppenstedtii DSM 
. . . Bacteroides eggerthii DSM 20697 ...............................   77   2 hits [CFB group bacteria]   hypothetical protein BACEGG_00676 [Bacteroides eggerthii DS
. . . Mycoplasma penetrans HF-2 .....................................   77   2 hits [mycoplasmas]          end peptidase [Mycoplasma penetrans HF-2] >gi|26454333|dbj|
. . . Mycobacterium tuberculosis T85 ................................   76   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis T85]
. . . Enterococcus faecium TX1330 ...................................   76   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium TX1330] >gi|2578
. . . Enterococcus faecium 1,141,733 ................................   76   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium TX1330] >gi|2578
. . . Enterococcus faecium Com12 ....................................   76   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium TX1330] >gi|2578
. . . Enterococcus faecium Com15 ....................................   76   2 hits [firmicutes]           M13 family peptidase [Enterococcus faecium Com15] >gi|25783
. . . Lactobacillus reuteri .........................................   76   1 hit  [firmicutes]           predicted metalloendopeptidase [Lactobacillus reuteri]
. . . Lactobacillus reuteri CF48-3A .................................   76   2 hits [firmicutes]           M13 family peptidase [Lactobacillus reuteri CF48-3A] >gi|22
. . . Lactobacillus reuteri SD2112 ..................................   76   2 hits [firmicutes]           M13 family peptidase [Lactobacillus reuteri CF48-3A] >gi|22
. . . Enterococcus faecium 1,231,408 ................................   76   2 hits [firmicutes]           peptidase M13 [Enterococcus faecium 1,231,408] >gi|25782911
. . . Lactobacillus brevis ATCC 367 .................................   75   2 hits [firmicutes]           neutral endopeptidase [Lactobacillus brevis ATCC 367] >gi|1
. . . Plesiocystis pacifica SIR-1 ...................................   75   4 hits [d-proteobacteria]     Endothelin-converting enzyme 1 [Plesiocystis pacifica SIR-1
. . . Mycobacterium vanbaalenii PYR-1 ...............................   75   2 hits [high GC Gram+]        neprilysin [Mycobacterium vanbaalenii PYR-1] >gi|119954029|
. . . Porphyromonas gingivalis W83 ..................................   75   2 hits [CFB group bacteria]   endopeptidase PepO [Porphyromonas gingivalis W83] >gi|34396
. . . Bacteroides thetaiotaomicron VPI-5482 .........................   75   2 hits [CFB group bacteria]   putative endothelin-converting enzyme [Bacteroides thetaiot
. . . Porphyromonas gingivalis ATCC 33277 ...........................   75   2 hits [CFB group bacteria]   endopeptidase PepO [Porphyromonas gingivalis ATCC 33277] >g
. . . Corynebacterium efficiens YS-314 ..............................   75   4 hits [high GC Gram+]        putative endopeptidase [Corynebacterium efficiens YS-314] >
. . . Parvularcula bermudensis HTCC2503 .............................   75   2 hits [a-proteobacteria]     peptidase M13 family protein [Parvularcula bermudensis HTCC
. . . Bacteroides sp. 1_1_6 .........................................   75   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 1_1_6] >gi|
. . . Porphyromonas gingivalis ......................................   75   1 hit  [CFB group bacteria]   PepO [Porphyromonas gingivalis]
. . . Lactobacillus reuteri DSM 20016 ...............................   75   2 hits [firmicutes]           endothelin-converting protein 1 [Lactobacillus reuteri DSM 
. . . Lactobacillus reuteri JCM 1112 ................................   75   2 hits [firmicutes]           endothelin-converting protein 1 [Lactobacillus reuteri DSM 
. . . Lactobacillus reuteri MM2-3 ...................................   75   2 hits [firmicutes]           endothelin-converting protein 1 [Lactobacillus reuteri DSM 
. . . Lactobacillus reuteri MM4-1A ..................................   75   2 hits [firmicutes]           endothelin-converting protein 1 [Lactobacillus reuteri DSM 
. . . Mycoplasma synoviae 53 ........................................   75   2 hits [mycoplasmas]          endopeptidase O [Mycoplasma synoviae 53] >gi|71851300|gb|AA
. . . Lactobacillus reuteri 100-23 ..................................   75   2 hits [firmicutes]           Endothelin-converting enzyme 1 [Lactobacillus reuteri 100-2
. . . Lactobacillus paracasei subsp. paracasei 8700:2 ...............   75   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus paracasei subsp. parac
. . . Lactobacillus casei ATCC 334 ..................................   74   4 hits [firmicutes]           neutral endopeptidase [Lactobacillus casei ATCC 334] >gi|11
. . . Corynebacterium lipophiloflavum DSM 44291 .....................   74   2 hits [high GC Gram+]        endothelin-converting protein 1 [Corynebacterium lipophilof
. . . Lactobacillus casei BL23 ......................................   74   4 hits [firmicutes]           Neutral endopeptidase (Endopeptidase O) [Lactobacillus case
. . . Bacteroides coprocola DSM 17136 ...............................   74   2 hits [CFB group bacteria]   hypothetical protein BACCOP_03317 [Bacteroides coprocola DS
. . . Corynebacterium diphtheriae NCTC 13129 ........................   74   1 hit  [high GC Gram+]        putative endopeptidase [Corynebacterium diphtheriae NCTC 13
. . . Corynebacterium diphtheriae ...................................   74   1 hit  [high GC Gram+]        putative endopeptidase [Corynebacterium diphtheriae NCTC 13
. . . Bacteroides caccae ATCC 43185 .................................   74   2 hits [CFB group bacteria]   hypothetical protein BACCAC_03343 [Bacteroides caccae ATCC 
. . . Mycobacterium tuberculosis T17 ................................   74   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis T17]
. . . Rothia mucilaginosa ATCC 25296 ................................   73   2 hits [high GC Gram+]        neprilysin [Rothia mucilaginosa ATCC 25296] >gi|255296386|g
. . . Mycoplasma mycoides subsp. capri str. GM12 ....................   73   2 hits [mycoplasmas]          endopeptidase O [Mycoplasma mycoides subsp. capri str. GM12
. . . Clostridium asparagiforme DSM 15981 ...........................   73   2 hits [firmicutes]           hypothetical protein CLOSTASPAR_03797 [Clostridium asparagi
. . . Mycobacterium tuberculosis GM 1503 ............................   73   1 hit  [high GC Gram+]        zinc metalloprotease [Mycobacterium tuberculosis GM 1503]
. . . Corynebacterium tuberculostearicum SK141 ......................   73   2 hits [high GC Gram+]        endOpeptidase o [Corynebacterium tuberculostearicum SK141] 
. . . Bacteroides sp. 2_2_4 .........................................   73   2 hits [CFB group bacteria]   conserved hypothetical protein [Bacteroides sp. 2_2_4] >gi|
. . . Corynebacterium pseudogenitalium ATCC 33035 ...................   73   2 hits [high GC Gram+]        endothelin-converting protein 1 [Corynebacterium pseudogeni
. . . Lactobacillus paracasei subsp. paracasei ATCC 25302 ...........   73   4 hits [firmicutes]           Neutral endopeptidase (endopeptidase O) [Lactobacillus para
. . . Bacteroides sp. D2 ............................................   73   1 hit  [CFB group bacteria]   putative endopeptidase [Bacteroides sp. D2]
. . . Pediococcus pentosaceus ATCC 25745 ............................   73   2 hits [firmicutes]           neutral endopeptidase [Pediococcus pentosaceus ATCC 25745] 
. . . Bacteroides ovatus ATCC 8483 ..................................   73   2 hits [CFB group bacteria]   hypothetical protein BACOVA_03656 [Bacteroides ovatus ATCC 
. . . Bacteroides sp. D1 ............................................   73   2 hits [CFB group bacteria]   hypothetical protein BACOVA_03656 [Bacteroides ovatus ATCC 
. . . Bacteroides sp. 2_1_22 ........................................   73   2 hits [CFB group bacteria]   hypothetical protein BACOVA_03656 [Bacteroides ovatus ATCC 
. . . Lactobacillus sakei subsp. sakei 23K ..........................   73   2 hits [firmicutes]           endopeptidase O [Lactobacillus sakei subsp. sakei 23K] >gi|
. . . Hyphomonas neptunium ATCC 15444 ...............................   73   2 hits [a-proteobacteria]     M13 family peptidase [Hyphomonas neptunium ATCC 15444] >gi|
. . . Bacteroides finegoldii DSM 17565 ..............................   72   2 hits [CFB group bacteria]   metalloendopeptidase PepO [Bacteroides finegoldii DSM 17565
. . . Lactobacillus ruminis ATCC 25644 ..............................   72   2 hits [firmicutes]           oligoendopeptidase O [Lactobacillus ruminis ATCC 25644] >gi
. . . Glaciecola sp. HTCC2999 .......................................   72   1 hit  [g-proteobacteria]     endothelin-converting protein 1 [Glaciecola sp. HTCC2999]
. . . Corynebacterium aurimucosum ATCC 700975 .......................   72   3 hits [high GC Gram+]        putative endopeptidase [Corynebacterium aurimucosum ATCC 70
. . . Lactobacillus antri DSM 16041 .................................   72   2 hits [firmicutes]           endopeptidase O [Lactobacillus antri DSM 16041] >gi|2591698
. . . Mycoplasma capricolum subsp. capricolum ATCC 27343 ............   72   2 hits [mycoplasmas]          endopeptidase O [Mycoplasma capricolum subsp. capricolum AT
. . . Asticcacaulis excentricus CB 48 ...............................   72   2 hits [a-proteobacteria]     Endothelin-converting enzyme 1 [Asticcacaulis excentricus C
. . . Clostridium hathewayi DSM 13479 ...............................   72   1 hit  [firmicutes]           neutral endopeptidase [Clostridium hathewayi DSM 13479]
. . . Lactobacillus fermentum 28-3-CHN ..............................   71   2 hits [firmicutes]           endopeptidase [Lactobacillus fermentum 28-3-CHN] >gi|260553
. . . Lactobacillus fermentum IFO 3956 ..............................   70   2 hits [firmicutes]           endopeptidase [Lactobacillus fermentum IFO 3956] >gi|183227
. . . Lactobacillus fermentum ATCC 14931 ............................   70   2 hits [firmicutes]           M13 family peptidase [Lactobacillus fermentum ATCC 14931] >
. . . Lactobacillus salivarius ATCC 11741 ...........................   70   2 hits [firmicutes]           oligoendopeptidase O [Lactobacillus salivarius ATCC 11741] 
. . . Lactobacillus vaginalis ATCC 49540 ............................   70   2 hits [firmicutes]           M13 family peptidase [Lactobacillus vaginalis ATCC 49540] >
. . . Corynebacterium glucuronolyticum ATCC 51866 ...................   70   2 hits [high GC Gram+]        M13 family peptidase [Corynebacterium glucuronolyticum ATCC
. . . Mycoplasma arthritidis 158L3-1 ................................   70   2 hits [mycoplasmas]          endopeptidase O [Mycoplasma arthritidis 158L3-1] >gi|193002
. . . Corynebacterium glucuronolyticum ATCC 51867 ...................   70   2 hits [high GC Gram+]        endothelin-converting protein 1 [Corynebacterium glucuronol
. . . Lactobacillus salivarius UCC118 ...............................   70   2 hits [firmicutes]           oligoendopeptidase O [Lactobacillus salivarius UCC118] >gi|
. . . Mycoplasma mycoides subsp. mycoides SC str. PG1 ...............   69   4 hits [mycoplasmas]          peptidase [Mycoplasma mycoides subsp. mycoides SC str. PG1]
. . . Gluconobacter oxydans 621H ....................................   69   2 hits [a-proteobacteria]     metalloprotease [Gluconobacter oxydans 621H] >gi|58002876|g
. . . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ......   69   2 hits [firmicutes]           oligopeptidase O3 [Leuconostoc mesenteroides subsp. mesente
. . . Mycoplasma fermentans PG18 ....................................   69   1 hit  [mycoplasmas]          hypothetical protein [Mycoplasma fermentans PG18]
. . . Leuconostoc mesenteroides subsp. cremoris ATCC 19254 ..........   68   2 hits [firmicutes]           M13 family peptidase [Leuconostoc mesenteroides subsp. crem
. . . Weissella paramesenteroides ATCC 33313 ........................   68   2 hits [firmicutes]           M13 family peptidase [Weissella paramesenteroides ATCC 3331
. . . Corynebacterium accolens ATCC 49725 ...........................   68   2 hits [high GC Gram+]        endothelin-converting protein 1 [Corynebacterium accolens A
. . . Corynebacterium genitalium ATCC 33030 .........................   68   2 hits [high GC Gram+]        endopeptidase O [Corynebacterium genitalium ATCC 33030] >gi
. . . Corynebacterium striatum ATCC 6940 ............................   68   2 hits [high GC Gram+]        possible Endothelin-converting enzyme 1 [Corynebacterium st
. . . Corynebacterium matruchotii ATCC 33806 ........................   68   2 hits [high GC Gram+]        hypothetical protein CORMATOL_00101 [Corynebacterium matruc
. . . Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 ........   68   2 hits [firmicutes]           endopeptidase [Lactobacillus delbrueckii subsp. bulgaricus 
. . . Corynebacterium glutamicum ATCC 13032 .........................   68   4 hits [high GC Gram+]        Predicted metalloendopeptidase [Corynebacterium glutamicum 
. . . Corynebacterium matruchotii ATCC 14266 ........................   68   2 hits [high GC Gram+]        endOpeptidase o [Corynebacterium matruchotii ATCC 14266] >g
. . . Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ......   68   2 hits [firmicutes]           neutral endopeptidase [Lactobacillus delbrueckii subsp. bul
. . . Corynebacterium glutamicum R ..................................   67   2 hits [high GC Gram+]        hypothetical protein cgR_0233 [Corynebacterium glutamicum R
. . . Bdellovibrio bacteriovorus HD100 ..............................   67   2 hits [d-proteobacteria]     metallopeptidase [Bdellovibrio bacteriovorus HD100] >gi|395
. . . Lactobacillus coleohominis 101-4-CHN ..........................   67   2 hits [firmicutes]           endothelin-converting protein 1 [Lactobacillus coleohominis
. . . Dehalococcoides sp. VS ........................................   66   2 hits [GNS bacteria]         Endothelin-converting enzyme 1 [Dehalococcoides sp. VS] >gi
. . . Lactococcus lactis subsp. lactis Il1403 .......................   65   2 hits [firmicutes]           neutral endopeptidase [Lactococcus lactis subsp. lactis Il1
. . . Lactococcus lactis subsp. lactis ..............................   65   1 hit  [firmicutes]           neutral endopeptidase [Lactococcus lactis subsp. lactis Il1
. . . Lactococcus lactis ............................................   65   5 hits [firmicutes]           endopeptidase [Lactococcus lactis] >gi|145968732|gb|ABQ0001
. . . Lactococcus lactis subsp. cremoris MG1363 .....................   65   5 hits [firmicutes]           endopeptidase O [Lactococcus lactis subsp. cremoris MG1363]
. . . Lactococcus lactis subsp. cremoris SK11 .......................   64   5 hits [firmicutes]           oligopeptidase O1 [Lactococcus lactis subsp. cremoris SK11]
. . . Lactococcus lactis subsp. cremoris ............................   64   1 hit  [firmicutes]           oligopeptidase O1 [Lactococcus lactis subsp. cremoris SK11]
. . . Erythrobacter sp. NAP1 ........................................   64   2 hits [a-proteobacteria]     metalloendopeptidase PepO [Erythrobacter sp. NAP1] >gi|8568
. . . Streptococcus gordonii str. Challis ...........................   62   1 hit  [firmicutes]           RecName: Full=Putative zinc metalloproteinase in scaA 5'reg
. . . Streptococcus gordonii ........................................   62   1 hit  [firmicutes]           RecName: Full=Putative zinc metalloproteinase in scaA 5'reg
. . . Renibacterium salmoninarum ATCC 33209 .........................   62   2 hits [high GC Gram+]        M13 family metallopeptidase [Renibacterium salmoninarum ATC
. . . Francisella tularensis subsp. holarctica FSC022 ...............   62   2 hits [g-proteobacteria]     hypothetical protein FTAG_00059 [Francisella tularensis sub
. . . Francisella tularensis subsp. holarctica 257 ..................   61   2 hits [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Francisella tularensis subsp. holarctica FSC200 ...............   61   1 hit  [g-proteobacteria]     M13 family metallopeptidase [Francisella tularensis subsp. 
. . . Leuconostoc citreum KM20 ......................................   60   2 hits [firmicutes]           metalloendopeptidase [Leuconostoc citreum KM20] >gi|1698033
. . Micromonas sp. RCC299 -------------------------------------------   93   2 hits [green algae]          predicted protein [Micromonas sp. RCC299] >gi|226517174|gb|
. . Methanosphaerula palustris E1-9c ................................   88   2 hits [euryarchaeotes]       Endothelin-converting enzyme 1 [Candidatus Methanosphaerula
. . Methanoculleus marisnigri JR1 ...................................   88   2 hits [euryarchaeotes]       endothelin-converting protein 1 [Methanoculleus marisnigri 
. . Ferroplasma acidarmanus fer1 ....................................   86   2 hits [euryarchaeotes]       zinc metalloprotease [Ferroplasma acidarmanus fer1]
. . Candidatus Micrarchaeum acidiphilum ARMAN-2 .....................   84   1 hit  [euryarchaeotes]       Endothelin-converting enzyme 1 [Candidatus Micrarchaeum aci
. . Thalassiosira pseudonana CCMP1335 ...............................   84   2 hits [diatoms]              metalloprotease [Thalassiosira pseudonana CCMP1335] >gi|220
. . Drosophila mojavensis ...........................................   83  14 hits [flies]                GI23832 [Drosophila mojavensis] >gi|193914783|gb|EDW13650.1
. . Drosophila willistoni ...........................................   83  10 hits [flies]                GK14429 [Drosophila willistoni] >gi|194170128|gb|EDW85029.1
. . Drosophila pseudoobscura pseudoobscura ..........................   82  10 hits [flies]                GA22015 [Drosophila pseudoobscura pseudoobscura] >gi|198132
. . Drosophila persimilis ...........................................   82  10 hits [flies]                GL21487 [Drosophila persimilis] >gi|194112562|gb|EDW34605.1
. . Drosophila ananassae ............................................   82  18 hits [flies]                GF16094 [Drosophila ananassae] >gi|190628771|gb|EDV44295.1|
. . Culex quinquefasciatus ..........................................   82  14 hits [flies]                endothelin-converting enzyme [Culex quinquefasciatus] >gi|1
. . Venturia canescens ..............................................   82   1 hit  [wasps &c.]            neprilysin-like protein [Venturia canescens]
. . Drosophila sechellia ............................................   82  14 hits [flies]                GM10687 [Drosophila sechellia] >gi|194133349|gb|EDW54865.1|
. . Drosophila melanogaster .........................................   82  25 hits [flies]                neprilysin 2 [Drosophila melanogaster] >gi|4972692|gb|AAD34
. . Drosophila erecta ...............................................   82  14 hits [flies]                GG11422 [Drosophila erecta] >gi|190650558|gb|EDV47813.1| GG
. . Drosophila virilis ..............................................   81  18 hits [flies]                GJ23291 [Drosophila virilis] >gi|194151634|gb|EDW67068.1| G
. . Cryptococcus neoformans var. neoformans B-3501A .................   81   2 hits [basidiomycetes]       hypothetical protein CNBB1520 [Cryptococcus neoformans var.
. . Phaeodactylum tricornutum CCAP 1055/1 ...........................   81   2 hits [diatoms]              predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. . Cryptococcus neoformans var. neoformans JEC21 ...................   81   2 hits [basidiomycetes]       Endothelin-converting enzyme 1 [Cryptococcus neoformans var
. . Acyrthosiphon pisum .............................................   81   5 hits [aphids]               PREDICTED: similar to endothelin-converting enzyme [Acyrtho
. . Methanosarcina acetivorans C2A ..................................   80   2 hits [euryarchaeotes]       endothelin converting enzyme homolog PepO [Methanosarcina a
. . Drosophila simulans .............................................   79  12 hits [flies]                GD19662 [Drosophila simulans] >gi|194198063|gb|EDX11639.1| 
. . Micromonas pusilla CCMP1545 .....................................   79   1 hit  [green algae]          predicted protein [Micromonas pusilla CCMP1545]
. . Locusta migratoria ..............................................   79   1 hit  [grasshoppers]         endothelin-converting enzyme [Locusta migratoria]
. . Pediculus humanus corporis (human body lice) ....................   79  12 hits [lice]                 endothelin-converting enzyme, putative [Pediculus humanus c
. . Drosophila grimshawi ............................................   79  18 hits [flies]                GH18118 [Drosophila grimshawi] >gi|193894887|gb|EDV93753.1|
. . Drosophila yakuba ...............................................   79  14 hits [flies]                GE25338 [Drosophila yakuba] >gi|194182077|gb|EDW95688.1| GE
. . Toxoplasma gondii ME49 ..........................................   78   4 hits [apicomplexans]        peptidase family M13 domain-containing protein [Toxoplasma 
. . Schistosoma japonicum ...........................................   78   1 hit  [flatworms]            endothelin converting enzyme 2 [Schistosoma japonicum]
. . Strongylocentrotus purpuratus (purple urchin) ...................   78   8 hits [sea urchins]          PREDICTED: hypothetical protein [Strongylocentrotus purpura
. . Aedes aegypti ...................................................   77   8 hits [flies]                endothelin-converting enzyme [Aedes aegypti] >gi|108872328|
. . Manduca sexta (tomato hornworm) .................................   77   1 hit  [moths]                zinc metalloprotease [Manduca sexta]
. . Branchiostoma floridae ..........................................   76  12 hits [lancelets]            hypothetical protein BRAFLDRAFT_286684 [Branchiostoma flori
. . Nasonia vitripennis .............................................   76  13 hits [wasps &c.]            PREDICTED: similar to zinc metalloprotease [Nasonia vitripe
. . Methanosarcina barkeri str. Fusaro ..............................   76   2 hits [euryarchaeotes]       PgPepO oligopeptidase [Methanosarcina barkeri str. Fusaro] 
. . Bombyx mori (silk moth) .........................................   75   2 hits [moths]                neutral endopeptidase 24.11 [Bombyx mori] >gi|13359138|dbj|
. . Tribolium castaneum (rust-red flour beetle) .....................   75   9 hits [beetles]              PREDICTED: similar to neutral endopeptidase 24.11 isoform 2
. . Apis mellifera (bee) ............................................   75   5 hits [bees]                 PREDICTED: similar to Neprilysin 3 CG9565-PA isoform 1 [Api
. . Hydra magnipapillata ............................................   75   8 hits [hydrozoans]           PREDICTED: similar to Ece1 protein, partial [Hydra magnipap
. . Caenorhabditis briggsae .........................................   75  16 hits [nematodes]            Hypothetical protein CBG20611 [Caenorhabditis briggsae] >gi
. . Caenorhabditis elegans (nematode) ...............................   75  14 hits [nematodes]            hypothetical protein F26G1.6 [Caenorhabditis elegans] >gi|5
. . Homo sapiens (man) ..............................................   74 103 hits [primates]             phosphate regulating endopeptidase homolog, X-linked (hypop
. . Anopheles gambiae str. PEST .....................................   74  10 hits [flies]                AGAP007796-PA [Anopheles gambiae str. PEST] >gi|21300767|gb
. . Pan troglodytes .................................................   73  26 hits [primates]             PREDICTED: X-linked phosphate regulating endopeptidase homo
. . Sus scrofa (wild boar) ..........................................   73   1 hit  [even-toed ungulates]  PREDICTED: similar to Phosphate-regulating neutral endopept
. . Mus musculus (mouse) ............................................   73  54 hits [rodents]              Pex protein [Mus musculus]
. . Ixodes scapularis (shoulder tick) ...............................   73  14 hits [mites & ticks]        neprilysin, putative [Ixodes scapularis] >gi|215506337|gb|E
. . Macaca mulatta (rhesus macaque) .................................   72  14 hits [primates]             PREDICTED: X-linked phosphate regulating endopeptidase homo
. . Rattus norvegicus (brown rat) ...................................   72  30 hits [rodents]              phosphate regulating gene with homologies to endopeptidases
. . Monodelphis domestica ...........................................   72   3 hits [marsupials]           PREDICTED: similar to PHEX protein [Monodelphis domestica]
. . Bos taurus (cow) ................................................   72  21 hits [even-toed ungulates]  PREDICTED: similar to Phosphate-regulating neutral endopept
. . Picrophilus torridus DSM 9790 ...................................   71   2 hits [euryarchaeotes]       zinc metalloprotease [Picrophilus torridus DSM 9790] >gi|48
. . Equus caballus (equine) .........................................   71   7 hits [odd-toed ungulates]   PREDICTED: similar to Phosphate-regulating neutral endopept
. . Canis lupus familiaris (dogs) ...................................   71   7 hits [carnivores]           PREDICTED: similar to Phosphate regulating neutral endopept
. . Gallus gallus (bantam) ..........................................   71   7 hits [birds]                PREDICTED: hypothetical protein [Gallus gallus]
. . Nematostella vectensis ..........................................   71  24 hits [sea anemones]         predicted protein [Nematostella vectensis] >gi|156224383|gb
. . Tetraodon nigroviridis ..........................................   70   5 hits [bony fishes]          unnamed protein product [Tetraodon nigroviridis]
. . Ciona intestinalis ..............................................   70   3 hits [tunicates]            PREDICTED: similar to endothelin-converting enzyme 2 [Ciona
. . Danio rerio (zebra fish) ........................................   70   7 hits [bony fishes]          PREDICTED: similar to endothelin converting enzyme 2, parti
. . Ornithorhynchus anatinus (duck-billed platypus) .................   70   2 hits [monotremes]           PREDICTED: similar to X-linked hypophosphatemia protein [Or
. . Malassezia globosa CBS 7966 .....................................   70   2 hits [basidiomycetes]       hypothetical protein MGL_0366 [Malassezia globosa CBS 7966]
. . Laccaria bicolor S238N-H82 ......................................   69   2 hits [basidiomycetes]       predicted protein [Laccaria bicolor S238N-H82] >gi|16464707
. . Hydra vulgaris ..................................................   69   1 hit  [hydrozoans]           endothelin converting enzyme [Hydra vulgaris]
. . Xenopus laevis (common platanna) ................................   69   6 hits [frogs & toads]        hypothetical protein LOC495020 [Xenopus laevis] >gi|5403512
. . Coprinopsis cinerea okayama7#130 ................................   68   2 hits [basidiomycetes]       hypothetical protein CC1G_05104 [Coprinopsis cinerea okayam
. . Perca flavescens ................................................   68   1 hit  [bony fishes]          neprilysin [Perca flavescens]
. . Taeniopygia guttata (zebra finch) ...............................   67   4 hits [birds]                PREDICTED: hypothetical protein [Taeniopygia guttata]
. . Phytophthora infestans T30-4 ....................................   67   3 hits [oomycetes]            endothelin-converting enzyme 1, metalloprotease family M13,
. . Ustilago maydis 521 .............................................   67   2 hits [basidiomycetes]       hypothetical protein UM02693.1 [Ustilago maydis 521] >gi|46
. . Xenopus (Silurana) tropicalis ...................................   67   2 hits [frogs & toads]        hypothetical protein LOC100145721 [Xenopus (Silurana) tropi
. . Macaca fascicularis (cynomolgus monkey) .........................   65   1 hit  [primates]             unnamed protein product [Macaca fascicularis]
. . Fundulus heteroclitus (killifish) ...............................   65   1 hit  [bony fishes]          endothelin converting enzyme-1 [Fundulus heteroclitus]
. . Brugia malayi (agent of lymphatic fil...) .......................   65   4 hits [nematodes]            Peptidase family M13 containing protein [Brugia malayi] >gi
. . Botryotinia fuckeliana B05.10 ...................................   63   2 hits [ascomycetes]          hypothetical protein BC1G_09378 [Botryotinia fuckeliana B05
. . Trichoplax adhaerens ............................................   62   4 hits [placozoans]           hypothetical protein TRIADDRAFT_63323 [Trichoplax adhaerens
. . Sclerotinia sclerotiorum 1980 UF-70 .............................   61   2 hits [ascomycetes]          hypothetical protein SS1G_05697 [Sclerotinia sclerotiorum 1
. . Cavia porcellus (guinea pig) ....................................   61   1 hit  [rodents]              RecName: Full=Endothelin-converting enzyme 1; Short=ECE-1 >
. . Cavia (guinea-pigs) .............................................   61   1 hit  [rodents]              RecName: Full=Endothelin-converting enzyme 1; Short=ECE-1 >
. . Verticillium albo-atrum VaMs.102 ................................   60   1 hit  [ascomycetes]          endothelin-converting enzyme [Verticillium albo-atrum VaMs.
. . Pongo abelii (Orang-utan) .......................................   60   5 hits [primates]             hypothetical protein [Pongo abelii]
. . Maconellicoccus hirsutus (pink hibiscus mealybug) ...............   60   1 hit  [scale insects]        putative neprilysin [Maconellicoccus hirsutus]
. . Podospora anserina DSM 980 ......................................   60   1 hit  [ascomycetes]          unnamed protein product [Podospora anserina] >gi|170936913|
. . Podospora anserina ..............................................   60   1 hit  [ascomycetes]          unnamed protein product [Podospora anserina] >gi|170936913|
. . Toxoplasma gondii RH ............................................   59   1 hit  [apicomplexans]        endothelin-converting enzyme, putative [Toxoplasma gondii M
. . Toxoplasma gondii GT1 ...........................................   59   1 hit  [apicomplexans]        endothelin-converting enzyme, putative [Toxoplasma gondii M
. . Toxoplasma gondii VEG ...........................................   59   1 hit  [apicomplexans]        endothelin-converting enzyme, putative [Toxoplasma gondii M
. . Aspergillus nidulans FGSC A4 ....................................   59   3 hits [ascomycetes]          TPA: endothelin-converting enzyme (AFU_orthologue; AFUA_3G1
. . Aplysia californica .............................................   58   1 hit  [gastropods]           neutral endopeptidase [Aplysia californica]
. . Pyrenophora tritici-repentis Pt-1C-BFP ..........................   58   2 hits [ascomycetes]          endothelin-converting enzyme 1 [Pyrenophora tritici-repenti
. . Oryctolagus cuniculus (domestic rabbit) .........................   58   3 hits [rabbits & hares]      membrane metallo-endopeptidase [Oryctolagus cuniculus] >gi|
. . Necator americanus ..............................................   57   1 hit  [nematodes]            metalloproteinase [Necator americanus]
. synthetic construct -----------------------------------------------   82   4 hits [other sequences]      neprilysin 2 [Drosophila melanogaster] >gi|4972692|gb|AAD34

BLAST

PROTOCOLE:


-a) BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions_5000"


-b) BLASTp contre SWISSPROT, paramètres par défaut au NCBI



ANALYSE DES RÉSULTATS:


Notre ORF présente une multitudes d'homologues à travers NR et très peu chez SWISSPROT.


-Dans le BLASTp vs NR, on retrouve un beaucoup d'homologues avec de faible E-value et de bon scores allant jusque 111. On note une E-value max_2e-23 et une E-value min_ 9,8.

On a du modifier le parametre du nombre de séquence (de 100 à 5000 séquences) car les E-value étaient trop élévées pour pouvoir définir une limite d'homologie. Ainsi, on releve un saut de E-value de 9e-04 à 0.001 ce qui n'est pas pertinent pour statuer sur sur un seuil, mais on fixera quand même comme limite de E-value 9e-4 grâce à l'étude du blast et on dira que toutes les séquences ayant une E-value inférieure à la limite seront considérées comme homologues. En effet, Ceci sera verifier par l'alignement 2à2 où on note une faible homologie à partir de cette limite (gap, identité.....).

On peut pas affirmer que les séquences homologues ont une fonction strictement conservée en accord avec notre étude.

Si on regarde les informations relatives aux fonctions proteiques de nos séquences dans le blast, on remarque une similarité entre elles. En effet elles ont toutes quasiment en commun la même fonction relative à une endopeptidase qui est un signe de plus dans notre hypothèse d'homologie



-Par contre les résultats du BLASTp vs SWISSPROT sont differents.

En effet, nous avons seulement 40 séquences dont 38 paraissent homologues avec des scores moyens(score max 95.7) et des E-value sensiblement faible (E-value max 2e-19)On fixera comme limite de E-value 6e-07 pour définir l'homologie grâce à l'alignement 2à2 (score, identité, gap...) et on note aussi un sut de E-value en passant de 6e-07 à 0.002. Ceci sexplique par le fait que SWISSPROT soit une banque proteique qui contient moins de séquences annothées que NR car on y réalise des annotations manuelles qui sont donc plus précises.


RÉSULTATS BRUTS: 

-Blastp vs NR:

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_003309260.1|  Endothelin-converting enzyme 1 [Sebaldell...   111    2e-23 Gene info
ref|ZP_02949882.1|  neutral endopeptidase [Clostridium butyric...   109    1e-22
ref|ZP_04028615.1|  predicted metalloendopeptidase [Tsukamurel...   107    7e-22
ref|ZP_05126103.1|  peptidase, M13 (neprilysin) family [gamma ...   105    3e-21
ref|YP_921363.1|  endothelin-converting protein 1 [Nocardioide...   105    3e-21 Gene info
ref|YP_002882628.1|  Neprilysin [Beutenbergia cavernae DSM 123...   104    4e-21 Gene info
ref|YP_003154614.1|  endothelin-converting enzyme [Brachybacte...   104    4e-21 Gene info
ref|YP_001507672.1|  endothelin-converting protein 1 [Frankia ...   104    5e-21 Gene info
ref|YP_001711650.1|  putative metallopeptidase [Clavibacter mi...   103    7e-21 Gene info
ref|YP_928487.1|  endothelin-converting protein 1 [Shewanella ...   103    9e-21 Gene info
ref|YP_631363.1|  M13 family peptidase [Myxococcus xanthus DK ...   102    1e-20 Gene info
ref|YP_001223564.1|  metallopeptidase family M13 [Clavibacter ...   102    2e-20 Gene info
ref|YP_714303.1|  zinc metalloendopeptidase [Frankia alni ACN1...   102    2e-20 Gene info
ref|ZP_04493416.1|  predicted metalloendopeptidase [Spirosoma ...   102    2e-20
gb|ACZ30135.1|  Neprilysin [Xylanimonas cellulosilytica DSM 15...   101    4e-20
ref|ZP_02181494.1|  metalloendopeptidase PepO [Flavobacteriale...   100    7e-20
ref|ZP_03849621.1|  possible endothelin-converting enzyme 1 [C...  99.8    1e-19
ref|YP_002313130.1|  Endothelin-converting enzyme 1 [Shewanell...  99.4    2e-19 Gene info
ref|ZP_03994102.1|  possible Endothelin-converting enzyme 1 [M...  99.0    2e-19
ref|YP_001019360.1|  endothelin-converting protein 1 [Methylib...  99.0    2e-19 Gene info
ref|ZP_03849622.1|  possible endothelin-converting enzyme 1 [C...  99.0    2e-19
gb|EEZ91506.1|  neprilysin [Mobiluncus mulieris 28-1]              99.0    2e-19
ref|ZP_01707862.1|  peptidase M13 [Shewanella putrefaciens 200...  98.6    2e-19
ref|YP_964750.1|  endothelin-converting protein 1 [Shewanella ...  98.6    2e-19 Gene info
ref|ZP_01043555.1|  Secreted zinc metalloproteinase [Idiomarin...  98.6    2e-19
ref|YP_825967.1|  endothelin-converting protein 1 [Solibacter ...  98.2    3e-19 Gene info
ref|YP_001887421.1|  neutral endopeptidase [Clostridium botuli...  97.8    4e-19 Gene info
ref|YP_001307511.1|  endothelin-converting protein 1 [Clostrid...  97.8    4e-19 Gene info
ref|YP_001095098.1|  endothelin-converting protein 1 [Shewanel...  97.8    4e-19 Gene info
ref|ZP_01224772.1|  metalloendopeptidase PepO [marine gamma pr...  97.8    5e-19
ref|YP_003094962.1|  metallopeptidase [Flavobacteriaceae bacte...  97.4    5e-19 Gene info
ref|NP_719376.1|  M13 family peptidase [Shewanella oneidensis ...  97.4    5e-19 Gene info
ref|ZP_05818296.1|  endothelin-converting enzyme [Sanguibacter...  97.4    6e-19 Gene info
ref|YP_001652952.1|  metallopeptidase [Actinobacillus pleuropn...  97.4    6e-19 Gene info
ref|ZP_03996740.1|  M13 family peptidase [Lactobacillus crispa...  97.4    6e-19
ref|YP_735306.1|  endothelin-converting protein 1 [Shewanella ...  97.1    6e-19 Gene infof|YP_003309260.1| Gene info
ref|YP_736844.1|  endothelin-converting protein 1 [Shewanella ...  97.1    6e-19 Gene info
ref|YP_868403.1|  peptidase M13 [Shewanella sp. ANA-3] >gb|ABK...  97.1    7e-19 Gene info
ref|ZP_04493978.1|  predicted metalloendopeptidase [Spirosoma ...  97.1    8e-19
ref|YP_001969796.1|  neutral endopeptidase [Actinobacillus ple...  96.7    8e-19 Gene info
ref|ZP_00134915.2|  COG3590: Predicted metalloendopeptidase [A...  96.7    8e-19
ref|YP_003142101.1|  Endothelin-converting enzyme 1 [Capnocyto...  96.7    9e-19 Gene info
ref|YP_947967.1|  putative zinc metalloproteinase [Arthrobacte...  96.7    9e-19 Gene info
ref|ZP_03389928.1|  metallopeptidase [Capnocytophaga sputigena...  96.7    1e-18
ref|ZP_03730373.1|  hypothetical protein CLOM621_00361 [Clostr...  96.3    1e-18
ref|ZP_02082516.1|  hypothetical protein CLOBOL_00028 [Clostri...  96.3    1e-18
ref|YP_001818694.1|  neprilysin [Opitutus terrae PB90-1] >gb|A...  96.3    1e-18 Gene info
ref|YP_562100.1|  endothelin-converting protein 1 [Shewanella ...  96.3    1e-18 Gene info
ref|ZP_02157393.1|  peptidase, M13 family protein [Shewanella ...  96.3    1e-18
ref|ZP_06163563.1|  metalloendopeptidase PepO [Actinomyces sp....  96.3    1e-18
ref|YP_154853.1|  secreted zinc metalloproteinase [Idiomarina ...  96.3    1e-18 Gene info
ref|YP_002475941.1|  neutral endopeptidase [Haemophilus parasu...  96.3    1e-18 Gene info
ref|YP_001367813.1|  endothelin-converting protein 1 [Shewanel...  96.3    1e-18 Gene info
ref|YP_001759300.1|  endothelin-converting protein 1 [Shewanel...  96.3    1e-18 Gene info
ref|YP_001049082.1|  endothelin-converting protein 1 [Shewanel...  95.9    1e-18 Gene info
ref|YP_002359462.1|  Endothelin-converting enzyme 1 [Shewanell...  95.9    1e-18 Gene info
ref|YP_001556168.1|  endothelin-converting protein 1 [Shewanel...  95.9    1e-18 Gene info
ref|YP_001364152.1|  Endothelin-converting enzyme 1 [Kineococc...  95.9    1e-18 Gene info
ref|NP_643181.1|  metallopeptidase [Xanthomonas axonopodis pv....  95.9    2e-18 Gene info
ref|YP_662913.1|  endothelin-converting protein 1 [Pseudoalter...  95.9    2e-18 Gene info
ref|YP_200101.1|  metallopeptidase [Xanthomonas oryzae pv. ory...  95.9    2e-18 Gene info
ref|YP_364758.1|  metallopeptidase precursor [Xanthomonas camp...  95.9    2e-18 Gene info
ref|YP_003126291.1|  Neprilysin [Chitinophaga pinensis DSM 258...  95.5    2e-18 Gene info
ref|ZP_05108783.1|  metallopeptidase PepO [Legionella drancour...  95.5    2e-18
ref|YP_194136.1|  neutral endopeptidase [Lactobacillus acidoph...  95.5    2e-18 Gene info
ref|ZP_01254577.1|  metalloendopeptidase PepO [Psychroflexus t...  95.5    2e-18
ref|ZP_04057414.1|  neprilysin-2 [Capnocytophaga gingivalis AT...  95.1    2e-18
ref|YP_001193312.1|  endothelin-converting protein 1 [Flavobac...  95.1    2e-18 Gene info
ref|YP_001577651.1|  endopeptidase o [Lactobacillus helveticus...  95.1    2e-18 Gene info
gb|ABB30008.1|  endopeptidase O [Lactobacillus helveticus]         95.1    2e-18
ref|YP_056588.1|  M13 family metallopeptidase [Propionibacteri...  95.1    2e-18 Gene info
ref|YP_053482.1|  putative membrane metallo endopeptidase [Mes...  95.1    2e-18 Gene info
ref|ZP_03389856.1|  peptidase family M13 [Propionibacterium ac...  95.1    3e-18
ref|YP_002298063.1|  metallopeptidase PepO, peptidase, M13 fam...  95.1    3e-18 Gene info
ref|ZP_05751616.1|  endopeptidase O [Lactobacillus helveticus ...  95.1    3e-18
sp|O52071.1|PEPO_LACHE  RecName: Full=Neutral endopeptidase; A...  95.1    3e-18
ref|NP_868672.1|  zinc metalloproteinase [Rhodopirellula balti...  95.1    3e-18 Gene info
ref|NP_638058.1|  metallopeptidase [Xanthomonas campestris pv....  95.1    3e-18 Gene info
ref|YP_001902860.1|  Metallopeptidase [Xanthomonas campestris ...  95.1    3e-18 Gene info
ref|YP_001675464.1|  endothelin-converting protein 1 [Shewanel...  95.1    3e-18 Gene info
ref|ZP_04780557.1|  possible Endothelin-converting enzyme 1 [S...  95.1    3e-18
ref|YP_001312007.1|  endothelin-converting protein 1 [Clostrid...  95.1    3e-18 Gene info
ref|YP_001912533.1|  metallopeptidase [Xanthomonas oryzae pv. ...  94.7    3e-18 Gene info
ref|YP_267913.1|  metalloendopeptidase PepO [Colwellia psychre...  94.7    3e-18 Gene info
ref|ZP_06163562.1|  endopeptidase o [Actinomyces sp. oral taxo...  94.7    3e-18
ref|ZP_02478933.1|  DNA polymerase III subunit alpha [Haemophi...  94.7    3e-18
ref|YP_003072790.1|  peptidase, M13 family [Teredinibacter tur...  94.7    3e-18 Gene info
ref|YP_749533.1|  endothelin-converting protein 1 [Shewanella ...  94.7    4e-18 Gene info
ref|ZP_04754513.1|  neutral endopeptidase [Actinobacillus mino...  94.4    5e-18
ref|ZP_04366368.1|  endothelin-converting enzyme [Cellulomonas...  94.0    5e-18
ref|ZP_03611861.1|  neutral endopeptidase [Actinobacillus mino...  94.0    5e-18
ref|ZP_04779678.1|  possible Endothelin-converting enzyme 1 [S...  94.0    6e-18
gb|ABO13201.2|  putative metallopeptidase [Acinetobacter bauma...  94.0    6e-18 Gene info
ref|YP_001085803.1|  putative metallopeptidase [Acinetobacter ...  94.0    6e-18 Gene info
ref|YP_096612.1|  metallopeptidase PepO [Legionella pneumophil...  94.0    6e-18 Gene info
ref|YP_001475241.1|  endothelin-converting protein 1 [Shewanel...  94.0    6e-18 Gene info
ref|XP_002501910.1|  predicted protein [Micromonas sp. RCC299]...  93.6    7e-18 Gene info
ref|YP_450393.1|  metallopeptidase [Xanthomonas oryzae pv. ory...  93.6    7e-18 Gene info
ref|YP_124965.1|  hypothetical protein lpp2660 [Legionella pne...  93.6    8e-18 Gene info
ref|YP_127859.1|  hypothetical protein lpl2530 [Legionella pne...  93.6    8e-18 Gene info
ref|ZP_00949736.1|  Peptidase, M13 family (lipoprotein) [Croce...  93.6    8e-18
ref|ZP_03970331.1|  possible Endothelin-converting enzyme 1 [S...  93.6    8e-18
ref|YP_819571.1|  neutral endopeptidase [Lactobacillus gasseri...  93.6    8e-18 Gene info
ref|YP_003091517.1|  Endothelin-converting enzyme 1 [Pedobacte...  93.2    9e-18 Gene info
ref|NP_872794.1|  metallopeptidase [Haemophilus ducreyi 35000H...  93.2    9e-18 Gene info
ref|YP_001249865.1|  metallopeptidase PepO [Legionella pneumop...  93.2    9e-18 Gene info
ref|ZP_04057427.1|  neprilysin [Capnocytophaga gingivalis ATCC...  93.2    9e-18
ref|YP_001821485.1|  endothelin-converting protein 1 [Opitutus...  93.2    1e-17 Gene info
ref|YP_162457.1|  metallopeptidase [Zymomonas mobilis subsp. m...  93.2    1e-17 Gene info
ref|YP_002755963.1|  peptidase, M13 family [Acidobacterium cap...  93.2    1e-17 Gene info
ref|ZP_04759345.1|  Endothelin-converting enzyme 1 [Zymomonas ...  93.2    1e-17
ref|YP_001503028.1|  endothelin-converting protein 1 [Shewanel...  92.8    1e-17 Gene info
ref|ZP_01467606.1|  hypothetical protein STIAU_8588 [Stigmatel...  92.8    1e-17
ref|YP_003024204.1|  putative endopeptidase [Streptococcus sui...  92.8    1e-17 Gene info
ref|YP_001685066.1|  endothelin-converting protein 1 [Caulobac...  92.8    1e-17 Gene info
ref|YP_001199717.1|  metalloendopeptidase [Streptococcus suis ...  92.8    1e-17 Gene info
ref|YP_002029257.1|  Endothelin-converting enzyme 1 [Stenotrop...  92.8    1e-17 Gene info
ref|YP_003027927.1|  endopeptidase [Streptococcus suis BM407] ...  92.8    1e-17 Gene info
ref|ZP_03625773.1|  Endothelin-converting enzyme 1 [Streptococ...  92.8    1e-17
ref|YP_003088698.1|  Endothelin-converting enzyme 1 [Dyadobact...  92.8    1e-17 Gene info
ref|ZP_04821760.1|  neprilysin [Clostridium botulinum E1 str. ...  92.8    1e-17
ref|ZP_01889244.1|  Peptidase, M13 family (lipoprotein) [unide...  92.8    1e-17
ref|YP_061291.1|  metallopeptidase [Leifsonia xyli subsp. xyli...  92.4    2e-17 Gene info
ref|YP_593590.1|  PgPepO oligopeptidase [Candidatus Koribacter...  92.4    2e-17 Gene info
ref|ZP_04661682.1|  putative metallopeptidase [Acinetobacter b...  92.4    2e-17
ref|ZP_03475639.1|  hypothetical protein PRABACTJOHN_01301 [Pa...  92.4    2e-17
ref|ZP_01135178.1|  metalloendopeptidase PepO [Pseudoalteromon...  92.0    2e-17
ref|YP_001971278.1|  peptidase, m13 family [Stenotrophomonas m...  92.0    2e-17 Gene info
ref|YP_823093.1|  endothelin-converting protein 1 [Solibacter ...  92.0    2e-17 Gene info
ref|ZP_05546121.1|  conserved hypothetical protein [Parabacter...  92.0    2e-17
ref|YP_001922357.1|  neutral endopeptidase [Clostridium botuli...  92.0    2e-17 Gene info
ref|YP_831707.1|  endothelin-converting protein 1 [Arthrobacte...  92.0    2e-17 Gene info
ref|ZP_05136676.1|  putative endothelin-converting enzyme 1 [S...  92.0    2e-17
ref|YP_589088.1|  endothelin-converting protein 1 [Candidatus ...  91.7    3e-17 Gene info
ref|YP_822810.1|  endothelin-converting protein 1 [Solibacter ...  91.7    3e-17 Gene info
ref|ZP_05287276.1|  putative endopeptidase [Bacteroides sp. 2_...  91.7    3e-17
ref|YP_001302940.1|  putative endopeptidase [Parabacteroides d...  91.7    3e-17 Gene info
ref|YP_003164052.1|  Endothelin-converting enzyme 1 [Leptotric...  91.7    3e-17 Gene info
ref|ZP_06074366.1|  conserved hypothetical protein [Bacteroide...  91.7    3e-17
ref|YP_593589.1|  PgPepO oligopeptidase [Candidatus Koribacter...  91.7    3e-17 Gene info
ref|ZP_06087412.1|  conserved hypothetical protein [Bacteroide...  91.7    3e-17
ref|YP_003119869.1|  Endothelin-converting enzyme 1 [Chitinoph...  91.7    3e-17 Gene info
ref|YP_001776258.1|  endothelin-converting protein 1 [Xylella ...  91.3    3e-17 Gene info
ref|ZP_05135960.1|  metallopeptidase [Stenotrophomonas sp. SKA...  91.3    3e-17
ref|NP_779763.1|  metallopeptidase [Xylella fastidiosa Temecul...  91.3    4e-17 Gene info
ref|ZP_04026781.1|  predicted metalloendopeptidase [Tsukamurel...  91.3    4e-17
ref|ZP_02161428.1|  Endothelin-converting enzyme 1 [Kordia alg...  91.3    4e-17
ref|YP_002563028.1|  endopeptidase O [Streptococcus uberis 014...  91.3    4e-17 Gene info
ref|ZP_05915086.1|  zinc metalloprotease [Brevibacterium linen...  90.9    4e-17
ref|ZP_00650856.1|  Endothelin-converting enzyme 1 [Xylella fa...  90.9    4e-17
ref|YP_001299320.1|  putative endothelin-converting enzyme [Ba...  90.9    5e-17 Gene info
ref|YP_001556469.1|  endothelin-converting protein 1 [Shewanel...  90.9    5e-17 Gene info
ref|YP_001368114.1|  endothelin-converting protein 1 [Shewanel...  90.9    5e-17 Gene info
ref|YP_001052247.1|  endothelin-converting protein 1 [Shewanel...  90.9    5e-17 Gene info
ref|YP_002359751.1|  Endothelin-converting enzyme 1 [Shewanell...  90.9    5e-17 Gene info
ref|YP_705057.1|  neprilysin [Rhodococcus jostii RHA1] >gb|ABG...  90.9    5e-17 Gene info
ref|ZP_04538971.1|  conserved hypothetical protein [Bacteroide...  90.9    5e-17
ref|ZP_03301994.1|  hypothetical protein BACDOR_03388 [Bactero...  90.9    5e-17
ref|ZP_03922605.1|  endothelin-converting protein 1 [Mobiluncu...  90.9    6e-17
ref|YP_002956266.1|  endothelin-converting enzyme [Micrococcus...  90.5    6e-17 Gene info
ref|YP_002488027.1|  Endothelin-converting enzyme 1 [Arthrobac...  90.5    6e-17 Gene info
ref|ZP_04382847.1|  neprilysin [Rhodococcus erythropolis SK121...  90.5    6e-17
ref|YP_002768410.1|  metalloendopeptidase [Rhodococcus erythro...  90.5    7e-17 Gene info
ref|ZP_03951073.1|  M13 family peptidase [Lactobacillus gasser...  90.5    7e-17
ref|ZP_04056579.1|  neprilysin [Capnocytophaga gingivalis ATCC...  90.5    7e-17
ref|ZP_01129206.1|  metallopeptidase [marine actinobacterium P...  90.5    7e-17
ref|YP_002277742.1|  Endothelin-converting enzyme 1 [Gluconace...  90.5    7e-17 Gene info
ref|YP_002027587.1|  Endothelin-converting enzyme 1 [Stenotrop...  90.5    7e-17 Gene info
ref|YP_001704709.1|  zinc metalloprotease [Mycobacterium absce...  90.1    8e-17 Gene info
ref|YP_002782370.1|  metalloendopeptidase [Rhodococcus opacus ...  90.1    8e-17 Gene info
ref|YP_001603181.1|  putative metallopeptidase [Gluconacetobac...  90.1    8e-17 Gene info
ref|YP_001295025.1|  M13 family metallopeptidase PepO precurso...  90.1    8e-17 Gene info
ref|ZP_04986760.1|  hypothetical protein [Francisella tularens...  90.1    9e-17
ref|ZP_01049816.1|  metalloendopeptidase PepO [Dokdonia dongha...  90.1    9e-17
ref|ZP_04054506.1|  endopeptidase PepO [Porphyromonas uenonis ...  90.1    9e-17
ref|ZP_03665865.1|  M13 family metallopeptidase [Francisella t...  90.1    9e-17
ref|ZP_06010880.1|  neprilysin [Leptotrichia goodfellowii F026...  90.1    9e-17
ref|NP_722332.1|  putative peptidase [Streptococcus mutans UA1...  90.1    9e-17 Gene info
ref|YP_898826.1|  M13 family metallopeptidase [Francisella tul...  90.1    1e-16 Gene info
ref|YP_002755341.1|  peptidase, M13 (neprilysin) family [Acido...  90.1    1e-16 Gene info
ref|YP_001922162.1|  endopeptidase O [Clostridium botulinum E3...  89.7    1e-16 Gene info
dbj|BAH88809.1|  putative peptidase [Streptococcus mutans NN2025]  89.7    1e-16
ref|ZP_02032895.1|  hypothetical protein PARMER_02915 [Parabac...  89.7    1e-16
ref|YP_121856.1|  putative peptidase [Nocardia farcinica IFM 1...  89.7    1e-16 Gene info
ref|YP_739631.1|  endothelin-converting protein 1 [Shewanella ...  89.7    1e-16 Gene info
ref|YP_732570.1|  endothelin-converting protein 1 [Shewanella ...  89.7    1e-16 Gene info
ref|YP_001799494.1|  putative endopeptidase [Corynebacterium u...  89.7    1e-16 Gene info
ref|YP_755704.1|  endothelin-converting protein 1 [Maricaulis ...  89.7    1e-16 Gene info
ref|YP_001973161.1|  putative endopeptidase O [Stenotrophomona...  89.4    1e-16 Gene info
ref|ZP_00997128.1|  putative peptidase [Janibacter sp. HTCC264...  89.4    1e-16
ref|ZP_01704221.1|  peptidase M13 [Shewanella putrefaciens 200...  89.4    2e-16
ref|YP_003160905.1|  Endothelin-converting enzyme 1 [Jonesia d...  89.0    2e-16 Gene info
ref|YP_961936.1|  endothelin-converting protein 1 [Shewanella ...  89.0    2e-16 Gene info
ref|ZP_01442401.1|  probable zinc metalloproteinase [Roseovari...  89.0    2e-16
ref|ZP_03925678.1|  endothelin-converting protein 1 [Actinomyc...  89.0    2e-16
ref|YP_003274784.1|  Endothelin-converting enzyme 1 [Gordonia ...  89.0    2e-16 Gene info
ref|ZP_03631787.1|  Endothelin-converting enzyme 1 [bacterium ...  89.0    2e-16
ref|NP_903975.1|  metallopeptidase [Chromobacterium violaceum ...  88.6    2e-16 Gene info
ref|ZP_04643747.1|  endopeptidase O [Lactobacillus gasseri 202...  88.6    2e-16
ref|YP_814890.1|  neutral endopeptidase [Lactobacillus gasseri...  88.6    2e-16 Gene info
ref|ZP_06010883.1|  neprilysin [Leptotrichia goodfellowii F026...  88.6    2e-16
ref|ZP_01053306.1|  peptidase family M13 [Polaribacter sp. MED...  88.6    3e-16 Gene info
ref|YP_002466500.1|  Endothelin-converting enzyme 1 [Candidatu...  88.6    3e-16 Gene info
ref|ZP_00682733.1|  Endothelin-converting enzyme 1 [Xylella fa...  88.6    3e-16
ref|ZP_04489066.1|  predicted metalloendopeptidase [Spirosoma ...  88.6    3e-16
ref|YP_341235.1|  peptidase, M13 (lipoprotein) [Pseudoalteromo...  88.6    3e-16 Gene info
ref|ZP_03850515.1|  endothelin-converting protein 1 [Chryseoba...  88.2    3e-16
ref|ZP_04057368.1|  peptidase family M13 family protein [Capno...  88.2    3e-16
ref|ZP_01117265.1|  Peptidase, M13 family lipoprotein [Polarib...  88.2    3e-16
ref|YP_001048013.1|  endothelin-converting protein 1 [Methanoc...  88.2    3e-16 Gene info
ref|NP_716066.1|  M13 family peptidase [Shewanella oneidensis ...  88.2    4e-16 Gene info
ref|ZP_06006869.1|  putative endothelin-converting enzyme [Pre...  87.8    4e-16
ref|YP_001698734.1|  neutral endopeptidase [Lysinibacillus sph...  87.8    4e-16 Gene info
ref|YP_003145906.1|  Endothelin-converting enzyme 1 [Kangiella...  87.8    4e-16 Gene info
ref|YP_001611887.1|  metallopeptidase [Sorangium cellulosum 'S...  87.8    4e-16 Gene info
ref|YP_569142.1|  endothelin-converting protein 1 [Rhodopseudo...  87.8    4e-16 Gene info
ref|YP_001887221.1|  endopeptidase O [Clostridium botulinum B ...  87.8    4e-16 Gene info
ref|ZP_04389042.1|  endopeptidase PepO [Porphyromonas endodont...  87.8    5e-16
ref|YP_003109430.1|  Endothelin-converting enzyme 1 [Acidimicr...  87.8    5e-16 Gene info
ref|ZP_04025998.1|  endothelin-converting enzyme [Tsukamurella...  87.8    5e-16
ref|ZP_03927664.1|  endothelin-converting protein [Actinomyces...  87.4    5e-16
ref|ZP_01723878.1|  putative membrane metallo endopeptidase [B...  87.4    5e-16
ref|ZP_03393889.1|  neprilysin [Corynebacterium amycolatum SK4...  87.4    6e-16
ref|ZP_01133455.1|  Peptidase, M13 family (lipoprotein) [Pseud...  87.4    6e-16
ref|YP_001142874.1|  M13 family peptidase [Aeromonas salmonici...  87.0    7e-16 Gene info
ref|ZP_01886462.1|  probable metallopeptidase [Pedobacter sp. ...  87.0    7e-16
ref|ZP_01049007.1|  peptidase, M13 family protein [Dokdonia do...  87.0    8e-16
ref|YP_002754984.1|  peptidase, M13 family [Acidobacterium cap...  86.7    9e-16 Gene info
ref|ZP_05569898.1|  zinc metalloprotease [Ferroplasma acidarma...  86.7    9e-16
ref|NP_787897.1|  metalloendopeptidase [Tropheryma whipplei st...  86.7    9e-16 Gene info
ref|YP_001902992.1|  Metallopeptidase [Xanthomonas campestris ...  86.7    9e-16 Gene info
ref|ZP_04447445.1|  hypothetical protein BIFANG_02422 [Bifidob...  86.7    9e-16
ref|NP_789702.1|  peptidase [Tropheryma whipplei TW08/27] >emb...  86.7    9e-16 Gene info
ref|ZP_01863278.1|  probable zinc metalloproteinase [Erythroba...  86.7    1e-15
ref|ZP_05866347.1|  endopeptidase O [Lactobacillus jensenii SJ...  86.7    1e-15
ref|ZP_04646010.1|  neutral endopeptidase [Lactobacillus jense...  86.7    1e-15
ref|ZP_04007870.1|  M13 family peptidase [Lactobacillus johnso...  86.7    1e-15
ref|NP_965124.1|  neutral endopeptidase [Lactobacillus johnson...  86.7    1e-15 Gene info
ref|YP_868080.1|  peptidase M13 [Shewanella sp. ANA-3] >gb|ABK...  86.3    1e-15 Gene info
ref|ZP_04062569.1|  endopeptidase O [Streptococcus salivarius ...  86.3    1e-15
ref|YP_003293065.1|  endopeptidase O [Lactobacillus johnsonii ...  86.3    1e-15 Gene info
ref|ZP_04671025.1|  endothelin-converting enzyme 1 [Clostridia...  86.3    1e-15
ref|ZP_04440603.1|  M13 family peptidase [Lactobacillus rhamno...  86.3    1e-15
ref|YP_003187092.1|  metallopeptidase [Acetobacter pasteurianu...  86.3    1e-15 Gene info
ref|ZP_00952860.1|  Secreted zinc metalloproteinase [Oceanicau...  86.3    1e-15
ref|NP_637923.1|  metallopeptidase [Xanthomonas campestris pv....  86.3    1e-15 Gene info
ref|NP_716127.1|  M13 family peptidase [Shewanella oneidensis ...  86.3    1e-15 Gene info
ref|ZP_03937254.1|  possible Endothelin-converting enzyme 1 [G...  85.9    1e-15
ref|YP_868146.1|  peptidase M13 [Shewanella sp. ANA-3] >gb|ABK...  85.9    1e-15 Gene info
ref|ZP_01890050.1|  putative endopeptidase [unidentified eubac...  85.9    1e-15
ref|YP_003058733.1|  Endothelin-converting enzyme 1 [Hirschia ...  85.9    1e-15 Gene info
ref|ZP_03211716.1|  neutral endopeptidase [Lactobacillus rhamn...  85.9    1e-15
ref|YP_365565.1|  metallopeptidase precursor [Xanthomonas camp...  85.9    2e-15 Gene info
ref|ZP_05900983.1|  metalloendopeptidase PepO [Leptotrichia ho...  85.9    2e-15
ref|ZP_03645121.1|  hypothetical protein BACCOPRO_03512 [Bacte...  85.9    2e-15
gb|AAZ76611.1|  putative PepO [Streptococcus ratti]                85.9    2e-15
ref|ZP_01625825.1|  peptidase, M13 family protein [marine gamm...  85.9    2e-15
ref|YP_002359709.1|  Endothelin-converting enzyme 1 [Shewanell...  85.9    2e-15 Gene info
ref|NP_901657.1|  metallopeptidase [Chromobacterium violaceum ...  85.5    2e-15 Gene info
ref|ZP_03861188.1|  endothelin-converting enzyme [Kribbella fl...  85.5    2e-15
ref|YP_003170779.1|  neutral endopeptidase (endopeptidase O) [...  85.5    2e-15 Gene info
ref|YP_001023032.1|  endothelin-converting protein 1 [Methylib...  85.5    2e-15 Gene info
ref|ZP_04821467.1|  endopeptidase O [Clostridium botulinum E1 ...  85.5    2e-15
ref|ZP_06119897.1|  Endothelin-converting enzyme 1 [Caulobacte...  85.5    2e-15
ref|YP_003199539.1|  Neprilysin [Nakamurella multipartita DSM ...  85.5    2e-15
ref|YP_732636.1|  endothelin-converting protein 1 [Shewanella ...  85.5    2e-15 Gene info
ref|ZP_02028312.1|  hypothetical protein BIFADO_00738 [Bifidob...  85.5    2e-15
ref|YP_863108.1|  neutral endopeptidase [Gramella forsetii KT0...  85.5    2e-15 Gene info
ref|YP_909321.1|  M13 family peptidase [Bifidobacterium adoles...  85.1    3e-15 Gene info
ref|YP_590567.1|  PgPepO oligopeptidase [Candidatus Koribacter...  85.1    3e-15 Gene info
ref|YP_249849.1|  putative endopeptidase [Corynebacterium jeik...  85.1    3e-15 Gene info
ref|ZP_05847508.1|  M13 family peptidase [Corynebacterium jeik...  85.1    3e-15
ref|YP_001705259.1|  zinc metalloprotease [Mycobacterium absce...  85.1    3e-15 Gene info
ref|ZP_01825260.1|  endopeptidase O [Streptococcus pneumoniae ...  84.7    3e-15
ref|ZP_01613128.1|  Peptidase, M13 family (lipoprotein) [Alter...  84.7    3e-15
ref|YP_739568.1|  endothelin-converting protein 1 [Shewanella ...  84.7    3e-15 Gene info
ref|ZP_06061204.1|  endopeptidase O [Streptococcus sp. 2_1_36F...  84.7    4e-15
gb|EET90131.1|  Endothelin-converting enzyme 1 [Candidatus Mic...  84.7    4e-15
ref|ZP_02949972.1|  endopeptidase O [Clostridium butyricum 552...  84.7    4e-15
ref|ZP_05918269.1|  metalloendopeptidase PepO [Prevotella sp. ...  84.7    4e-15
ref|ZP_04010420.1|  neutral endopeptidase [Lactobacillus ultun...  84.7    4e-15
ref|XP_002296777.1|  metalloprotease [Thalassiosira pseudonana...  84.3    4e-15 Gene info
ref|YP_001129256.1|  putative endopeptidase O [Streptococcus p...  84.3    4e-15 Gene info
ref|NP_644019.1|  metallopeptidase [Xanthomonas axonopodis pv....  84.3    4e-15 Gene info
ref|NP_270025.1|  putative endopeptidase O [Streptococcus pyog...  84.3    4e-15 Gene info
ref|ZP_00366169.1|  COG3590: Predicted metalloendopeptidase [S...  84.3    4e-15
ref|YP_001683352.1|  endothelin-converting protein 1 [Caulobac...  84.3    5e-15 Gene info
ref|YP_281231.1|  neutral endopeptidase [Streptococcus pyogene...  84.3    5e-15 Gene info
ref|YP_002997761.1|  oligoendopeptidase O [Streptococcus dysga...  84.3    5e-15 Gene info
ref|YP_603368.1|  Oligoendopeptidase O [Streptococcus pyogenes...  84.3    5e-15 Gene info
ref|NP_608102.1|  putative endopeptidase O [Streptococcus pyog...  84.3    5e-15 Gene info
ref|ZP_01201403.1|  endopeptidase M13 family [Flavobacteria ba...  84.3    5e-15
ref|YP_283145.1|  neutral endopeptidase [Streptococcus pyogene...  84.3    5e-15 Gene info
ref|YP_061099.1|  neutral endopeptidase [Streptococcus pyogene...  84.3    5e-15 Gene info
emb|CAC14579.1|  oligopeptidase [Streptococcus thermophilus]       84.3    5e-15
ref|YP_821179.1|  endopeptidase O [Streptococcus thermophilus ...  84.3    5e-15 Gene info
ref|ZP_02242680.1|  metallopeptidase [Xanthomonas oryzae pv. o...  84.0    5e-15
ref|YP_824999.1|  endothelin-converting protein 1 [Solibacter ...  84.0    5e-15 Gene info
ref|YP_140299.1|  endopeptidase O [Streptococcus thermophilus ...  84.0    6e-15 Gene info
ref|ZP_01717934.1|  metalloendopeptidase PepO [Algoriphagus sp...  84.0    6e-15
ref|YP_001556411.1|  endothelin-converting protein 1 [Shewanel...  84.0    6e-15 Gene info
ref|YP_597524.1|  oligoendopeptidase O [Streptococcus pyogenes...  84.0    6e-15 Gene info
ref|YP_001048851.1|  endothelin-converting protein 1 [Shewanel...  84.0    6e-15 Gene info
ref|YP_855747.1|  M13 family peptidase [Aeromonas hydrophila s...  84.0    6e-15 Gene info
ref|YP_001095551.1|  endothelin-converting protein 1 [Shewanel...  84.0    6e-15 Gene info
ref|YP_003149907.1|  endothelin-converting enzyme [Kytococcus ...  84.0    6e-15 Gene info
ref|YP_003302992.1|  Endopeptidase O [Mycoplasma hominis] >emb...  84.0    6e-15 Gene info
ref|ZP_04750743.1|  zinc metalloprotease [Mycobacterium kansas...  84.0    6e-15
ref|ZP_02244800.1|  metallopeptidase [Xanthomonas oryzae pv. o...  84.0    7e-15
ref|YP_001368053.1|  endothelin-converting protein 1 [Shewanel...  84.0    7e-15 Gene info
ref|ZP_05650546.1|  M13 family peptidase [Enterococcus gallina...  83.6    8e-15
ref|XP_001998189.1|  GI23832 [Drosophila mojavensis] >gb|EDW13...  83.6    9e-15 Gene info
ref|ZP_03741894.1|  hypothetical protein BIFPSEUDO_02445 [Bifi...  83.2    9e-15
ref|YP_001380335.1|  endothelin-converting protein 1 [Anaeromy...  83.2    9e-15 Gene info
ref|ZP_06172261.1|  Endothelin-converting enzyme 1 [Brevundimo...  83.2    1e-14
ref|ZP_02158202.1|  peptidase, M13 family protein [Shewanella ...  83.2    1e-14
gb|ABF13327.1|  endopeptidase O [Streptococcus vestibularis]       83.2    1e-14
ref|ZP_01823210.1|  thiol peroxidase [Streptococcus pneumoniae...  83.2    1e-14
ref|NP_346087.1|  endopeptidase O [Streptococcus pneumoniae TI...  83.2    1e-14 Gene info
ref|YP_002511539.1|  putative endopeptidase O [Streptococcus p...  83.2    1e-14 Gene info
ref|YP_002740913.1|  endopeptidase O [Streptococcus pneumoniae...  83.2    1e-14 Gene info
ref|YP_002038262.1|  endopeptidase O [Streptococcus pneumoniae...  83.2    1e-14 Gene info
ref|ZP_02919640.1|  hypothetical protein STRINF_00492 [Strepto...  83.2    1e-14
ref|ZP_01830400.1|  endopeptidase O [Streptococcus pneumoniae ...  83.2    1e-14
ref|YP_002736589.1|  endopeptidase O [Streptococcus pneumoniae...  83.2    1e-14 Gene info
ref|ZP_01817375.1|  endopeptidase O [Streptococcus pneumoniae ...  83.2    1e-14
ref|YP_001199448.1|  metalloendopeptidase [Streptococcus suis ...  83.2    1e-14 Gene info
ref|NP_359084.1|  endopeptidase O [Streptococcus pneumoniae R6...  83.2    1e-14 Gene info
ref|ZP_03625799.1|  Neprilysin [Streptococcus suis 89/1591] >g...  83.2    1e-14
ref|YP_003093940.1|  Neprilysin [Pedobacter heparinus DSM 2366...  83.2    1e-14 Gene info
ref|ZP_02708435.1|  endopeptidase O [Streptococcus pneumoniae ...  83.2    1e-14
ref|XP_002074043.1|  GK14429 [Drosophila willistoni] >gb|EDW85...  83.2    1e-14 Gene info
ref|ZP_04713967.1|  metalloendopeptidase PepO [Alteromonas mac...  83.2    1e-14
ref|YP_001836337.1|  endopeptidase O [Streptococcus pneumoniae...  83.2    1e-14 Gene info
ref|YP_002133563.1|  Endothelin-converting enzyme 1 [Anaeromyx...  83.2    1e-14 Gene info
ref|NP_302672.1|  zinc metalloprotease [Mycobacterium leprae T...  82.8    1e-14 Gene info
ref|ZP_05734715.2|  metalloendopeptidase PepO [Prevotella tann...  82.8    1e-14
gb|ABF13325.1|  endopeptidase O [Streptococcus salivarius]         82.8    1e-14
ref|NP_422298.1|  peptidase M13 family protein [Caulobacter cr...  82.8    1e-14 Gene info
ref|YP_001256510.1|  endopeptidase O [Mycoplasma agalactiae PG...  82.8    1e-14 Gene info
ref|ZP_04799305.1|  endopeptidase O [Streptococcus pneumoniae ...  82.8    1e-14
ref|NP_696878.1|  M13 family peptidase [Bifidobacterium longum...  82.8    2e-14 Gene info
ref|ZP_02425946.1|  hypothetical protein ALIPUT_02104 [Alistip...  82.8    2e-14
ref|ZP_05033133.1|  peptidase family M13 [Brevundimonas sp. BA...  82.4    2e-14
ref|ZP_03780265.1|  hypothetical protein CLOHYLEM_07366 [Clost...  82.4    2e-14
ref|YP_001905262.1|  Metallopeptidase [Xanthomonas campestris ...  82.4    2e-14 Gene info
ref|XP_001359579.2|  GA22015 [Drosophila pseudoobscura pseudoo...  82.4    2e-14 Gene info
ref|XP_002017505.1|  GL21487 [Drosophila persimilis] >gb|EDW34...  82.4    2e-14 Gene info
ref|XP_001955734.1|  GF16094 [Drosophila ananassae] >gb|EDV442...  82.4    2e-14 Gene info
ref|ZP_03976678.1|  possible Endothelin-converting enzyme 1 [B...  82.4    2e-14
ref|XP_001867103.1|  endothelin-converting enzyme [Culex quinq...  82.4    2e-14 UniGene infoGene info
ref|YP_002322079.1|  Neprilysin [Bifidobacterium longum subsp....  82.4    2e-14 Gene info
ref|YP_001034272.1|  Zinc metalloproteinase in scaA 5'region, ...  82.4    2e-14 Gene info
ref|ZP_01304372.1|  metallopeptidase [Sphingomonas sp. SKA58] ...  82.4    2e-14
gb|AAD40473.1|AF116532_1  endopeptidase O [Streptococcus paras...  82.4    2e-14
ref|YP_002026816.1|  Endothelin-converting enzyme 1 [Stenotrop...  82.4    2e-14 Gene info
ref|YP_001451068.1|  endopeptidase O [Streptococcus gordonii s...  82.4    2e-14 Gene info
gb|AAL91975.1|AF483275_1  neprilysin-like protein [Venturia ca...  82.0    2e-14
ref|ZP_03324581.1|  hypothetical protein BIFCAT_01377 [Bifidob...  82.0    2e-14
ref|YP_001686296.1|  endothelin-converting protein 1 [Caulobac...  82.0    2e-14 Gene info
ref|ZP_01733856.1|  Peptidase, M13 family (lipoprotein) [Flavo...  82.0    2e-14
ref|ZP_04664692.1|  peptidase family M13 protein [Bifidobacter...  82.0    2e-14
ref|NP_639017.1|  metallopeptidase [Xanthomonas campestris pv....  82.0    2e-14 Gene info
ref|NP_297866.1|  metallopeptidase [Xylella fastidiosa 9a5c] >...  82.0    2e-14 Gene info
ref|ZP_00120790.2|  COG3590: Predicted metalloendopeptidase [B...  82.0    2e-14 Gene info
ref|YP_590155.1|  PgPepO oligopeptidase [Candidatus Koribacter...  82.0    2e-14 Gene info
ref|XP_002038328.1|  GM10687 [Drosophila sechellia] >gb|EDW548...  82.0    2e-14 Gene info
ref|NP_524227.1|  neprilysin 2 [Drosophila melanogaster] >gb|A...  82.0    2e-14 UniGene infoGene info
ref|ZP_00785170.1|  endopeptidase O [Streptococcus agalactiae ...  82.0    3e-14
ref|ZP_05656733.1|  M13 family peptidase [Enterococcus casseli...  82.0    3e-14
ref|XP_001978855.1|  GG11422 [Drosophila erecta] >gb|EDV47813....  82.0    3e-14 Gene info
ref|ZP_05646656.1|  M13 family peptidase [Enterococcus casseli...  81.6    3e-14
ref|XP_002053548.1|  GJ23291 [Drosophila virilis] >gb|EDW67068...  81.6    3e-14 Gene info
ref|YP_002313963.1|  Peptidase, M13 family [Shewanella piezoto...  81.6    3e-14 Gene info
ref|XP_777350.1|  hypothetical protein CNBB1520 [Cryptococcus ...  81.6    3e-14 UniGene infoGene info
ref|YP_001854060.1|  metalloendopeptidase [Kocuria rhizophila ...  81.6    3e-14 Gene info
ref|ZP_03208665.1|  hypothetical protein BACPLE_02323 [Bactero...  81.6    3e-14
ref|YP_001472177.1|  endothelin-converting protein 1 [Shewanel...  81.6    3e-14 Gene info
ref|XP_002184552.1|  predicted protein [Phaeodactylum tricornu...  81.6    3e-14 UniGene infoGene info
ref|XP_569246.1|  Endothelin-converting enzyme 1 [Cryptococcus...  81.6    3e-14 UniGene infoGene info
ref|YP_905149.1|  zinc metalloprotease [Mycobacterium ulcerans...  81.3    3e-14 Gene info
ref|YP_002743676.1|  endopeptidase O [Streptococcus equi subsp...  81.3    3e-14 Gene info
ref|YP_364630.1|  metallopeptidase [Xanthomonas campestris pv....  81.3    3e-14 Gene info
ref|XP_001944610.1|  PREDICTED: similar to endothelin-converti...  81.3    4e-14 UniGene infoGene info
ref|YP_002745547.1|  endopeptidase O [Streptococcus equi subsp...  81.3    4e-14 Gene info
ref|YP_002122525.1|  metallopeptidase PepO [Streptococcus equi...  81.3    4e-14 Gene info
ref|NP_786662.1|  endopeptidase PepO [Lactobacillus plantarum ...  81.3    4e-14 Gene info
ref|YP_003064328.1|  endopeptidase PepO [Lactobacillus plantar...  81.3    4e-14 Gene info
ref|ZP_04015003.1|  endopeptidase PepO [Lactobacillus plantaru...  81.3    4e-14
ref|YP_001848760.1|  zinc metalloprotease [Mycobacterium marin...  81.3    4e-14 Gene info
ref|YP_926261.1|  endothelin-converting protein 1 [Shewanella ...  81.3    4e-14 Gene info
ref|YP_616774.1|  endothelin-converting protein 1 [Sphingopyxi...  81.3    4e-14 Gene info
ref|YP_001035533.1|  metalloendopeptidase, putative [Streptoco...  81.3    4e-14 Gene info
ref|YP_464352.1|  PgPepO oligopeptidase [Anaeromyxobacter deha...  80.9    5e-14 Gene info
ref|ZP_00952859.1|  Secreted zinc metalloproteinase [Oceanicau...  80.9    5e-14
ref|NP_616924.1|  endothelin converting enzyme homolog PepO [M...  80.9    5e-14 Gene info
ref|YP_002124997.1|  metalloendopeptidase PepO [Alteromonas ma...  80.9    5e-14 Gene info
ref|YP_001970453.1|  putative ZINC METALLOpeptidase [Stenotrop...  80.9    5e-14 Gene info
ref|YP_002491680.1|  Endothelin-converting enzyme 1 [Anaeromyx...  80.9    5e-14 Gene info
ref|YP_001197524.1|  metalloendopeptidase [Streptococcus suis ...  80.9    5e-14 Gene info
ref|YP_459303.1|  zinc metalloproteinase [Erythrobacter litora...  80.9    5e-14 Gene info
ref|ZP_06047718.1|  metallopeptidase [Aeromicrobium marinum DS...  80.9    5e-14
ref|YP_001261020.1|  endothelin-converting protein 1 [Sphingom...  80.9    5e-14 Gene info
ref|YP_001068451.1|  PgPepO oligopeptidase [Mycobacterium sp. ...  80.9    6e-14 Gene info
ref|YP_199301.1|  metallopeptidase [Xanthomonas oryzae pv. ory...  80.9    6e-14 Gene info
ref|NP_643055.1|  metallopeptidase [Xanthomonas axonopodis pv....  80.9    6e-14 Gene info
ref|YP_449631.1|  metallopeptidase [Xanthomonas oryzae pv. ory...  80.5    6e-14 Gene info
ref|ZP_02044627.1|  hypothetical protein ACTODO_01501 [Actinom...  80.5    6e-14
ref|YP_936174.1|  PgPepO oligopeptidase [Mycobacterium sp. KMS...  80.5    6e-14 Gene info
ref|YP_637334.1|  PgPepO oligopeptidase [Mycobacterium sp. MCS...  80.5    6e-14 Gene info
ref|YP_330455.1|  endopeptidase O [Streptococcus agalactiae A9...  80.5    6e-14 Gene info
ref|ZP_03319876.1|  hypothetical protein PROVALCAL_02823 [Prov...  80.5    6e-14
ref|ZP_03956591.1|  M13 family peptidase [Lactobacillus jensen...  80.5    7e-14
ref|NP_688879.1|  endopeptidase O [Streptococcus agalactiae 26...  80.5    7e-14 Gene info
ref|ZP_05133961.1|  metallopeptidase [Stenotrophomonas sp. SKA...  80.5    7e-14
ref|YP_118491.1|  putative peptidase [Nocardia farcinica IFM 1...  80.1    9e-14 Gene info
ref|YP_002469932.1|  metalloendopeptidase [Bifidobacterium ani...  80.1    9e-14 Gene info
ref|YP_001915710.1|  metallopeptidase [Xanthomonas oryzae pv. ...  80.1    9e-14 Gene info
ref|ZP_05857719.1|  metalloendopeptidase PepO [Prevotella vero...  80.1    9e-14
ref|YP_001758720.1|  endothelin-converting protein 1 [Shewanel...  80.1    1e-13 Gene info
ref|XP_002102136.1|  GD19662 [Drosophila simulans] >gb|EDX1163...  79.7    1e-13 Gene info
gb|EEH57579.1|  predicted protein [Micromonas pusilla CCMP1545]    79.7    1e-13
gb|AAN73018.1|  endothelin-converting enzyme [Locusta migratoria]  79.7    1e-13
ref|ZP_04833263.1|  endopeptidase PepO [Prevotella melaninogen...  79.7    1e-13
ref|ZP_05224019.1|  peptidase family protein M13 [Mycobacteriu...  79.7    1e-13
gb|ABY64907.1|  neprilysin [Streptococcus suis]                    79.7    1e-13
ref|YP_101378.1|  putative endothelin-converting enzyme [Bacte...  79.7    1e-13 Gene info
ref|ZP_04844856.1|  conserved hypothetical protein [Bacteroide...  79.7    1e-13
ref|XP_002424541.1|  endothelin-converting enzyme, putative [P...  79.7    1e-13 Gene info
ref|YP_213499.1|  putative endopeptidase [Bacteroides fragilis...  79.3    1e-13 Gene info
ref|ZP_01885156.1|  Endothelin-converting enzyme 1 [Pedobacter...  79.3    1e-13
ref|YP_755705.1|  endothelin-converting protein 1 [Maricaulis ...  79.3    1e-13 Gene info
ref|ZP_05971299.1|  endothelin-converting protein 1 [Providenc...  79.3    1e-13
ref|ZP_03942626.1|  M13 family peptidase [Lactobacillus buchne...  79.3    1e-13
ref|XP_001990691.1|  GH18118 [Drosophila grimshawi] >gb|EDV937...  79.3    2e-13 Gene info
ref|YP_001131754.1|  neprilysin [Mycobacterium gilvum PYR-GCK]...  79.3    2e-13 Gene info
ref|ZP_03017208.1|  hypothetical protein BACINT_04820 [Bactero...  79.3    2e-13
ref|XP_002095976.1|  GE25338 [Drosophila yakuba] >gb|EDW95688....  79.3    2e-13 Gene info
ref|ZP_01543833.1|  endopeptidase O, peptidase M13 family [Oen...  79.3    2e-13
ref|ZP_03675916.1|  hypothetical protein BACCELL_00239 [Bacter...  79.0    2e-13
ref|ZP_01255163.1|  metalloendopeptidase PepO [Psychroflexus t...  79.0    2e-13
ref|YP_811146.1|  oligopeptidase O1 [Oenococcus oeni PSU-1] >g...  79.0    2e-13 Gene info
ref|YP_884649.1|  metallopeptidase [Mycobacterium smegmatis st...  79.0    2e-13 Gene info
ref|XP_002372110.1|  peptidase family M13 domain-containing pr...  79.0    2e-13 UniGene infoGene info
emb|CAX82880.1|  endothelin converting enzyme 2 [Schistosoma j...  79.0    2e-13
ref|XP_001191766.1|  PREDICTED: hypothetical protein [Strongyl...  79.0    2e-13 UniGene infoGene info
ref|ZP_02433885.1|  hypothetical protein BACSTE_00096 [Bactero...  78.6    2e-13
ref|YP_003275516.1|  Neprilysin [Gordonia bronchialis DSM 4324...  78.6    2e-13 Gene info
ref|ZP_05743768.1|  endopeptidase O [Lactobacillus iners DSM 1...  78.6    2e-13
ref|ZP_02916865.1|  hypothetical protein BIFDEN_00124 [Bifidob...  78.6    2e-13
ref|ZP_02963869.1|  belongs to peptidase family M13 [Bifidobac...  78.6    3e-13
ref|ZP_02960751.1|  hypothetical protein PROSTU_02718 [Provide...  78.6    3e-13
ref|ZP_03647204.1|  M13 family peptidase [Bifidobacterium bifi...  78.2    3e-13
ref|ZP_05284209.1|  putative endothelin-converting enzyme [Bac...  78.2    3e-13
ref|ZP_00780574.1|  endopeptidase PepO [Streptococcus agalacti...  78.2    3e-13
ref|ZP_06123721.1|  endothelin-converting protein 1 [Providenc...  78.2    3e-13
ref|YP_002130004.1|  metallopeptidase [Phenylobacterium zucine...  78.2    4e-13 Gene info
ref|ZP_05966006.1|  metalloendopeptidase [Bifidobacterium gall...  78.2    4e-13
ref|ZP_02070979.1|  hypothetical protein BACUNI_02410 [Bactero...  78.2    4e-13
ref|YP_884098.1|  peptidase family protein M13 [Mycobacterium ...  77.8    4e-13 Gene info
ref|ZP_03967273.1|  possible Endothelin-converting enzyme 1 [S...  77.8    4e-13
ref|ZP_05218932.1|  peptidase family protein M13 [Mycobacteriu...  77.8    4e-13
ref|ZP_04449711.1|  hypothetical protein GCWU000282_00943 [Cat...  77.8    5e-13
ref|XP_001992205.1|  GH24626 [Drosophila grimshawi] >gb|EDV919...  77.8    5e-13 Gene info
ref|XP_001661626.1|  endothelin-converting enzyme [Aedes aegyp...  77.4    5e-13 UniGene infoGene info
ref|YP_003292368.1|  endopeptidase O2 [Lactobacillus johnsonii...  77.4    5e-13 Gene info
ref|ZP_04982693.1|  hypothetical zinc metalloprotease [Mycobac...  77.4    5e-13
ref|XP_002039490.1|  GM23001 [Drosophila sechellia] >gb|EDW562...  77.4    6e-13 Gene info
ref|ZP_03952850.1|  M13 family peptidase [Lactobacillus hilgar...  77.4    6e-13
gb|AAO21504.1|AF413063_1  zinc metalloprotease [Manduca sexta]     77.4    6e-13
ref|ZP_04012016.1|  neutral endopeptidase [Lactobacillus ultun...  77.4    6e-13
ref|ZP_03939679.1|  M13 family peptidase [Lactobacillus brevis...  77.4    6e-13
ref|ZP_03423324.1|  zinc metalloprotease [Mycobacterium tuberc...  77.4    6e-13
ref|XP_002067283.1|  GK16267 [Drosophila willistoni] >gb|EDW78...  77.4    6e-13 Gene info
ref|ZP_05663421.1|  M13 family peptidase [Enterococcus faecium...  77.4    6e-13
ref|NP_214712.1|  zinc metalloprotease [Mycobacterium tubercul...  77.4    6e-13 Gene info
ref|ZP_03951815.1|  M13 family peptidase [Lactobacillus gasser...  77.0    7e-13
ref|ZP_00603028.1|  Endothelin-converting enzyme 1 [Enterococc...  77.0    7e-13
ref|YP_002905417.1|  putative endopeptidase [Corynebacterium k...  77.0    7e-13 Gene info
ref|ZP_03457906.1|  hypothetical protein BACEGG_00676 [Bactero...  77.0    7e-13
ref|XP_002427833.1|  endothelin-converting enzyme, putative [P...  77.0    7e-13 Gene info
ref|NP_758258.1|  end peptidase [Mycoplasma penetrans HF-2] >d...  77.0    7e-13 Gene info
ref|ZP_02949426.1|  peptidase family M13 [Clostridium butyricu...  77.0    8e-13
ref|ZP_04006818.1|  M13 family peptidase [Lactobacillus johnso...  76.6    9e-13
ref|ZP_03435229.1|  zinc metalloprotease [Mycobacterium tuberc...  76.6    9e-13
ref|ZP_03982356.1|  M13 family peptidase [Enterococcus faecium...  76.6    9e-13
ref|XP_002605513.1|  hypothetical protein BRAFLDRAFT_286684 [B...  76.6    9e-13 Gene info
ref|ZP_05677379.1|  M13 family peptidase [Enterococcus faecium...  76.6    9e-13
gb|ABI26327.1|  predicted metalloendopeptidase [Lactobacillus ...  76.6    9e-13
ref|NP_964163.1|  endopeptidase O [Lactobacillus johnsonii NCC...  76.6    9e-13 Gene info
ref|ZP_03975352.1|  M13 family peptidase [Lactobacillus reuter...  76.6    9e-13
ref|ZP_05672385.1|  peptidase M13 [Enterococcus faecium 1,231,...  76.6    9e-13
ref|XP_001599502.1|  PREDICTED: similar to zinc metalloproteas...  76.6    1e-12 UniGene infoGene info
ref|XP_002589137.1|  hypothetical protein BRAFLDRAFT_278852 [B...  76.3    1e-12 UniGene infoGene info
ref|ZP_04644402.1|  neutral endopeptidase [Lactobacillus gasse...  76.3    1e-12
ref|YP_814000.1|  neutral endopeptidase [Lactobacillus gasseri...  76.3    1e-12 Gene info
ref|YP_306314.1|  PgPepO oligopeptidase [Methanosarcina barker...  76.3    1e-12 Gene info
ref|XP_001977841.1|  GG19262 [Drosophila erecta] >gb|EDV46768....  75.9    1e-12 Gene info
ref|YP_795983.1|  neutral endopeptidase [Lactobacillus brevis ...  75.9    2e-12 Gene info
ref|XP_002430353.1|  hypothetical protein Phum_PHUM474680 [Ped...  75.9    2e-12 Gene info
ref|ZP_01908565.1|  Endothelin-converting enzyme 1 [Plesiocyst...  75.9    2e-12
ref|YP_951040.1|  neprilysin [Mycobacterium vanbaalenii PYR-1]...  75.9    2e-12 Gene info
ref|NP_904500.1|  endopeptidase PepO [Porphyromonas gingivalis...  75.9    2e-12 Gene info
ref|XP_001654841.1|  endothelin-converting enzyme [Aedes aegyp...  75.9    2e-12 UniGene infoGene info
ref|NP_812722.1|  putative endothelin-converting enzyme [Bacte...  75.9    2e-12 Gene info
ref|YP_001928387.1|  endopeptidase PepO [Porphyromonas gingiva...  75.9    2e-12 Gene info
ref|YP_631637.1|  M13 family peptidase [Myxococcus xanthus DK ...  75.5    2e-12 Gene info
ref|ZP_01907397.1|  Endothelin-converting enzyme 1 [Plesiocyst...  75.5    2e-12
ref|NP_736762.1|  putative endopeptidase [Corynebacterium effi...  75.5    2e-12 Gene info
ref|XP_001608120.1|  PREDICTED: similar to endothelin-converti...  75.5    2e-12 UniGene infoGene info
ref|NP_001036959.1|  neutral endopeptidase 24.11 [Bombyx mori]...  75.5    2e-12 UniGene infoGene info
ref|ZP_01016273.1|  peptidase M13 family protein [Parvularcula...  75.5    2e-12
ref|ZP_04848786.1|  conserved hypothetical protein [Bacteroide...  75.5    2e-12
ref|XP_002100959.1|  GE15881 [Drosophila yakuba] >gb|EDX02067....  75.5    2e-12 Gene info
ref|XP_975991.1|  PREDICTED: similar to neutral endopeptidase ...  75.5    2e-12 UniGene infoGene info
gb|ABB30009.1|  endopeptidase O3 [Lactobacillus helveticus]        75.5    2e-12
ref|XP_392043.2|  PREDICTED: similar to Neprilysin 3 CG9565-PA...  75.5    2e-12 UniGene infoGene info
dbj|BAA24495.1|  PepO [Porphyromonas gingivalis]                   75.5    2e-12
ref|YP_001272373.1|  endothelin-converting protein 1 [Lactobac...  75.5    2e-12 Gene info
ref|YP_278620.1|  endopeptidase O [Mycoplasma synoviae 53] >gb...  75.5    2e-12 Gene info
gb|AAM12295.1|  RE48040p [Drosophila melanogaster]                 75.1    3e-12
ref|NP_523417.2|  neprilysin 3 [Drosophila melanogaster] >gb|A...  75.1    3e-12 UniGene infoGene info
ref|ZP_03073228.1|  Endothelin-converting enzyme 1 [Lactobacil...  75.1    3e-12
ref|XP_002167298.1|  PREDICTED: similar to Ece1 protein, parti...  75.1    3e-12 UniGene infoGene info
ref|XP_002631459.1|  Hypothetical protein CBG20611 [Caenorhabd...  75.1    3e-12 Gene info
ref|YP_001576720.1|  endopeptidase [Lactobacillus helveticus D...  75.1    3e-12 Gene info
ref|NP_494857.2|  hypothetical protein F26G1.6 [Caenorhabditis...  75.1    3e-12 UniGene infoGene info
ref|XP_393860.3|  PREDICTED: similar to Neprilysin 2 CG9761-PA...  75.1    3e-12 UniGene infoGene info
ref|ZP_04674863.1|  neutral endopeptidase [Lactobacillus parac...  75.1    3e-12
ref|YP_806301.1|  neutral endopeptidase [Lactobacillus casei A...  74.7    3e-12 Gene info
ref|ZP_03979612.1|  endothelin-converting protein 1 [Corynebac...  74.7    3e-12
ref|YP_001987173.1|  Neutral endopeptidase (Endopeptidase O) [...  74.7    3e-12 Gene info
gb|EAW98987.1|  phosphate regulating endopeptidase homolog, X-...  74.7    3e-12 Gene info
dbj|BAG65346.1|  unnamed protein product [Homo sapiens]            74.7    4e-12 Gene info
ref|XP_317711.1|  AGAP007796-PA [Anopheles gambiae str. PEST] ...  74.7    4e-12 UniGene infoGene info
ref|ZP_03011410.1|  hypothetical protein BACCOP_03317 [Bactero...  74.7    4e-12
ref|NP_938546.1|  putative endopeptidase [Corynebacterium diph...  74.7    4e-12 Gene info
ref|ZP_01961707.1|  hypothetical protein BACCAC_03343 [Bactero...  74.7    4e-12
ref|ZP_03535071.1|  zinc metalloprotease [Mycobacterium tuberc...  74.7    4e-12
ref|YP_001919841.1|  endothelin-converting enzyme 1 [Clostridi...  74.3    4e-12 Gene info
ref|XP_002001084.1|  GI22167 [Drosophila mojavensis] >gb|EDW16...  74.3    5e-12 Gene info
dbj|BAG63030.1|  unnamed protein product [Homo sapiens]            73.9    6e-12 Gene info
ref|NP_000435.3|  phosphate-regulating neutral endopeptidase [...  73.9    6e-12 UniGene infoGene info
ref|NP_637922.1|  metallopeptidase [Xanthomonas campestris pv....  73.9    6e-12 Gene info
ref|ZP_05367591.1|  neprilysin [Rothia mucilaginosa ATCC 25296...  73.9    6e-12
gb|ACU79017.1|  endopeptidase O [Mycoplasma mycoides subsp. ca...  73.9    6e-12
ref|XP_002166068.1|  PREDICTED: similar to membrane metallo-en...  73.9    6e-12 Gene info
ref|XP_002105264.1|  GD21386 [Drosophila simulans] >gb|EDX1476...  73.9    6e-12 Gene info
ref|XP_520972.2|  PREDICTED: X-linked phosphate regulating end...  73.9    6e-12 UniGene infoGene info
ref|XP_002037125.1|  GM12743 [Drosophila sechellia] >gb|EDW532...  73.9    7e-12 Gene info
ref|YP_364629.1|  metallopeptidase [Xanthomonas campestris pv....  73.9    7e-12 Gene info
ref|XP_001602211.1|  PREDICTED: similar to endothelin-converti...  73.9    7e-12 UniGene infoGene info
ref|ZP_05751057.1|  endopeptidase O [Corynebacterium efficiens...  73.9    7e-12
ref|XP_002012368.1|  GI10875 [Drosophila mojavensis] >gb|EDW08...  73.9    7e-12 Gene info
ref|ZP_03759771.1|  hypothetical protein CLOSTASPAR_03797 [Clo...  73.6    7e-12
ref|XP_001926802.1|  PREDICTED: similar to Phosphate-regulatin...  73.6    7e-12 UniGene infoGene info
ref|XP_002631837.1|  Hypothetical protein CBG17774 [Caenorhabd...  73.6    8e-12 Gene info
ref|ZP_03534731.1|  zinc metalloprotease [Mycobacterium tuberc...  73.6    8e-12
gb|AAB47750.1|  Pex protein [Mus musculus]                         73.6    8e-12 Gene info
gb|ABM69259.1|  PHEX [Mus musculus]                                73.6    8e-12 Gene info
ref|NP_035207.1|  X-linked phosphate regulating endopeptidase ...  73.6    8e-12 UniGene infoGene info
ref|ZP_05366865.1|  endOpeptidase o [Corynebacterium tuberculo...  73.6    8e-12
ref|YP_001902993.1|  Metallopeptidase [Xanthomonas campestris ...  73.6    8e-12 Gene info
ref|ZP_04550063.1|  conserved hypothetical protein [Bacteroide...  73.6    9e-12
ref|ZP_03920569.1|  endothelin-converting protein 1 [Corynebac...  73.6    9e-12
ref|YP_193097.1|  neutral endopeptidase [Lactobacillus acidoph...  73.6    9e-12 Gene info
ref|ZP_03965504.1|  Neutral endopeptidase (endopeptidase O) [L...  73.6    9e-12
ref|XP_002098664.1|  GE23808 [Drosophila yakuba] >gb|EDW98376....  73.6    9e-12 Gene info
ref|ZP_05758442.1|  putative endopeptidase [Bacteroides sp. D2]    73.2    9e-12
ref|YP_803841.1|  neutral endopeptidase [Pediococcus pentosace...  73.2    1e-11 Gene info
ref|ZP_02066656.1|  hypothetical protein BACOVA_03656 [Bactero...  73.2    1e-11
ref|YP_394665.1|  endopeptidase O [Lactobacillus sakei subsp. ...  73.2    1e-11 Gene info
ref|YP_761738.1|  M13 family peptidase [Hyphomonas neptunium A...  73.2    1e-11 Gene info
ref|ZP_06170550.1|  Endothelin-converting enzyme 1 [Brevundimo...  73.2    1e-11
ref|XP_002400640.1|  neprilysin, putative [Ixodes scapularis] ...  73.2    1e-11 Gene info
ref|ZP_05416389.1|  metalloendopeptidase PepO [Bacteroides fin...  72.8    1e-11
ref|XP_001087261.1|  PREDICTED: X-linked phosphate regulating ...  72.8    1e-11 UniGene infoGene info
ref|ZP_03957602.1|  oligoendopeptidase O [Lactobacillus rumini...  72.8    1e-11
ref|NP_643054.1|  metallopeptidase [Xanthomonas axonopodis pv....  72.8    1e-11 Gene info
ref|NP_651645.1|  CG14527 [Drosophila melanogaster] >gb|AAF568...  72.8    1e-11 UniGene infoGene info
gb|AAC24487.1|  metalloendopeptidase homolog [Homo sapiens]        72.8    1e-11 Gene info
ref|XP_002023949.1|  GL27139 [Drosophila persimilis] >gb|EDW28...  72.8    1e-11 Gene info
ref|XP_002137135.1|  GA26744 [Drosophila pseudoobscura pseudoo...  72.8    2e-11 Gene info
ref|XP_002096450.1|  GE25050 [Drosophila yakuba] >gb|EDW96162....  72.8    2e-11 Gene info
ref|NP_650904.3|  neprilysin 4, isoform A [Drosophila melanoga...  72.8    2e-11 UniGene infoGene info
ref|YP_002131630.1|  peptidase M13 family protein [Phenylobact...  72.8    2e-11 Gene info
ref|ZP_03559589.1|  endothelin-converting protein 1 [Glaciecol...  72.4    2e-11
ref|XP_001979401.1|  GG15258 [Drosophila erecta] >gb|EDV48359....  72.4    2e-11 Gene info
ref|XP_002102696.1|  GD20045 [Drosophila simulans] >gb|EDX1219...  72.4    2e-11 Gene info
ref|XP_002043452.1|  GM23172 [Drosophila sechellia] >gb|EDW496...  72.4    2e-11 Gene info
ref|NP_732540.2|  neprilysin 4, isoform B [Drosophila melanoga...  72.4    2e-11 Gene info
ref|XP_002022508.1|  GL13072 [Drosophila persimilis] >gb|EDW26...  72.4    2e-11 Gene info
ref|YP_002833635.1|  putative endopeptidase [Corynebacterium a...  72.4    2e-11 Gene info
ref|ZP_05745139.1|  endopeptidase O [Lactobacillus antri DSM 1...  72.4    2e-11
ref|YP_424440.1|  endopeptidase O [Mycoplasma capricolum subsp...  72.4    2e-11 Gene info
gb|EDL96111.1|  phosphate regulating gene with homologies to e...  72.0    2e-11 Gene info
gb|EDL96112.1|  phosphate regulating gene with homologies to e...  72.0    2e-11 Gene info
ref|XP_001362795.1|  PREDICTED: similar to PHEX protein [Monod...  72.0    2e-11 UniGene infoGene info
ref|NP_037136.1|  phosphate regulating endopeptidase homolog, ...  72.0    2e-11 UniGene infoGene info
ref|XP_001354952.1|  GA21880 [Drosophila pseudoobscura pseudoo...  72.0    2e-11 Gene info
ref|ZP_04771373.1|  Endothelin-converting enzyme 1 [Asticcacau...  72.0    2e-11
ref|YP_339889.1|  peptidase M13 protein [Pseudoalteromonas hal...  72.0    2e-11 Gene info
ref|YP_001903741.1|  Metallopeptidase [Xanthomonas campestris ...  72.0    2e-11 Gene info
ref|NP_637400.1|  metallopeptidase [Xanthomonas campestris pv....  72.0    2e-11 Gene info
ref|XP_616148.4|  PREDICTED: similar to Phosphate-regulating n...  72.0    3e-11 UniGene infoGene info
ref|ZP_06113977.1|  neutral endopeptidase [Clostridium hathewa...  72.0    3e-11
ref|XP_969454.2|  PREDICTED: similar to endothelin-converting ...  72.0    3e-11 UniGene infoGene info
ref|XP_002072178.1|  GK22708 [Drosophila willistoni] >gb|EDW83...  72.0    3e-11 Gene info
ref|XP_001848831.1|  endothelin-converting enzyme 1 [Culex qui...  72.0    3e-11 UniGene infoGene info
ref|XP_001954549.1|  GF18324 [Drosophila ananassae] >gb|EDV431...  72.0    3e-11 Gene info
ref|YP_023832.1|  zinc metalloprotease [Picrophilus torridus D...  71.6    3e-11 Gene info
ref|XP_001493520.1|  PREDICTED: similar to Phosphate-regulatin...  71.6    3e-11 UniGene infoGene info
ref|XP_001981421.1|  GG11623 [Drosophila erecta] >gb|EDV53291....  71.6    3e-11 Gene info
ref|XP_002055656.1|  GJ18666 [Drosophila virilis] >gb|EDW65857...  71.6    3e-11 Gene info
ref|XP_537979.2|  PREDICTED: similar to Phosphate regulating n...  71.6    3e-11 UniGene infoGene info
ref|XP_002054164.1|  GJ24287 [Drosophila virilis] >gb|EDW67684...  71.6    3e-11 Gene info
gb|EDL40188.1|  endothelin converting enzyme-like 1, isoform C...  71.6    3e-11 Gene info
ref|XP_001233077.1|  PREDICTED: hypothetical protein [Gallus g...  71.6    3e-11 UniGene infoGene info
ref|NP_494538.1|  hypothetical protein F18A12.8 [Caenorhabditi...  71.6    3e-11 UniGene infoGene info
ref|NP_067281.2|  endothelin converting enzyme-like 1 [Mus mus...  71.6    3e-11 UniGene infoGene info
ref|XP_002434480.1|  neprilysin, putative [Ixodes scapularis] ...  71.6    3e-11 Gene info
dbj|BAE35023.1|  unnamed protein product [Mus musculus]            71.2    4e-11 Gene info
ref|XP_001950596.1|  PREDICTED: similar to zinc metalloproteas...  71.2    4e-11 UniGene infoGene info
ref|XP_001637272.1|  predicted protein [Nematostella vectensis...  71.2    4e-11 Gene info
ref|XP_001963556.1|  GF20227 [Drosophila ananassae] >gb|EDV446...  71.2    4e-11 Gene info
ref|ZP_05863394.1|  endopeptidase [Lactobacillus fermentum 28-...  71.2    5e-11
emb|CAF97373.1|  unnamed protein product [Tetraodon nigroviridis]  70.9    5e-11
ref|XP_001654072.1|  neprilysin [Aedes aegypti] >gb|EAT38188.1...  70.9    5e-11 UniGene infoGene info
ref|YP_001844621.1|  endopeptidase [Lactobacillus fermentum IF...  70.9    5e-11 Gene info
ref|XP_422744.2|  PREDICTED: similar to Endothelin converting ...  70.9    5e-11 Gene info
ref|XP_002590567.1|  hypothetical protein BRAFLDRAFT_83798 [Br...  70.9    5e-11 Gene info
ref|XP_002130786.1|  PREDICTED: similar to endothelin-converti...  70.9    5e-11 UniGene infoGene info
ref|XP_321277.4|  AGAP001791-PA [Anopheles gambiae str. PEST] ...  70.9    6e-11 UniGene infoGene info
ref|ZP_03944127.1|  M13 family peptidase [Lactobacillus fermen...  70.9    6e-11
ref|ZP_04716908.1|  putative peptidase M13 family protein [Alt...  70.9    6e-11
ref|XP_001333228.2|  PREDICTED: similar to endothelin converti...  70.5    7e-11 UniGene infoGene info
ref|ZP_05571643.1|  zinc metalloprotease [Ferroplasma acidarma...  70.5    7e-11
ref|XP_001994465.1|  GH16092 [Drosophila grimshawi] >gb|EDV910...  70.5    7e-11 Gene info
ref|XP_001849327.1|  neprilysin [Culex quinquefasciatus] >gb|E...  70.5    7e-11 UniGene infoGene info
ref|ZP_04006935.1|  conserved hypothetical protein [Lactobacil...  70.5    7e-11
ref|ZP_05857180.1|  metalloendopeptidase PepO [Prevotella vero...  70.5    7e-11
ref|XP_001513691.1|  PREDICTED: similar to X-linked hypophosph...  70.5    8e-11 UniGene infoGene info
ref|XP_001732591.1|  hypothetical protein MGL_0366 [Malassezia...  70.5    8e-11 Gene info
ref|ZP_04009122.1|  oligoendopeptidase O [Lactobacillus saliva...  70.1    8e-11
ref|ZP_01614655.1|  putative peptidase M13 family protein [Alt...  70.1    8e-11
gb|EDL75616.1|  endothelin converting enzyme-like 1 [Rattus no...  70.1    8e-11 Gene info
ref|NP_068544.1|  endothelin converting enzyme-like 1 [Rattus ...  70.1    9e-11 UniGene infoGene info
ref|ZP_03960014.1|  M13 family peptidase [Lactobacillus vagina...  70.1    9e-11
ref|ZP_03971180.1|  M13 family peptidase [Corynebacterium gluc...  70.1    9e-11
ref|XP_543287.2|  PREDICTED: similar to Endothelin-converting ...  70.1    9e-11 UniGene infoGene info
ref|XP_002591627.1|  hypothetical protein BRAFLDRAFT_223369 [B...  70.1    9e-11 UniGene infoGene info
ref|YP_002000269.1|  endopeptidase O [Mycoplasma arthritidis 1...  70.1    9e-11 Gene info
ref|XP_001629550.1|  predicted protein [Nematostella vectensis...  70.1    1e-10 Gene info
ref|ZP_03917703.1|  endothelin-converting protein 1 [Corynebac...  70.1    1e-10
ref|YP_536554.1|  oligoendopeptidase O [Lactobacillus salivari...  70.1    1e-10 Gene info
ref|ZP_01134060.1|  putative peptidase M13 family protein [Pse...  70.1    1e-10
ref|XP_002630395.1|  Hypothetical protein CBG04334 [Caenorhabd...  70.1    1e-10 Gene info
ref|XP_394870.3|  PREDICTED: similar to Neprilysin 4 CG4058-PA...  69.7    1e-10 UniGene infoGene info
ref|XP_001878622.1|  predicted protein [Laccaria bicolor S238N...  69.7    1e-10 Gene info
ref|NP_975490.1|  peptidase [Mycoplasma mycoides subsp. mycoid...  69.7    1e-10 Gene info
sp|Q9JMI0.1|ECEL1_MOUSE  RecName: Full=Endothelin-converting e...  69.7    1e-10 Gene info
ref|YP_192426.1|  metalloprotease [Gluconobacter oxydans 621H]...  69.7    1e-10 Gene info
ref|YP_819371.1|  oligopeptidase O3 [Leuconostoc mesenteroides...  69.3    1e-10 Gene info
dbj|BAH69711.1|  hypothetical protein [Mycoplasma fermentans P...  69.3    1e-10
ref|YP_002127139.1|  putative peptidase M13 family protein [Al...  69.3    2e-10 Gene info
gb|AAD46624.1|AF162671_1  endothelin converting enzyme [Hydra ...  69.3    2e-10
ref|XP_002125559.1|  PREDICTED: similar to membrane metallo-en...  69.3    2e-10 UniGene infoGene info
gb|AAZ22338.1|  endothelin converting enzyme-like 1 [Homo sapi...  69.3    2e-10 Gene info
ref|NP_004817.2|  endothelin converting enzyme-like 1 [Homo sa...  69.3    2e-10 UniGene infoGene info
ref|XP_002163103.1|  PREDICTED: similar to endothelin converti...  69.3    2e-10 UniGene infoGene info
ref|NP_001088195.1|  hypothetical protein LOC495020 [Xenopus l...  69.3    2e-10 UniGene infoGene info
ref|XP_689191.2|  PREDICTED: similar to Membrane metallo-endop...  69.3    2e-10 UniGene infoGene info
ref|ZP_03913485.1|  M13 family peptidase [Leuconostoc mesenter...  68.9    2e-10
emb|CAB86601.1|  xce [Homo sapiens] >gb|AAH50453.2| Endothelin...  68.9    2e-10 Gene info
ref|XP_001919390.1|  PREDICTED: similar to endothelin converti...  68.9    2e-10 UniGene infoGene info
ref|NP_651646.1|  CG14526 [Drosophila melanogaster] >gb|AAD386...  68.9    2e-10 UniGene infoGene info
gb|EAW71000.1|  endothelin converting enzyme-like 1, isoform C...  68.9    2e-10 Gene info
ref|ZP_04782551.1|  M13 family peptidase [Weissella paramesent...  68.9    2e-10
ref|YP_824060.1|  endothelin-converting protein 1 [Solibacter ...  68.9    2e-10 Gene info
emb|CAA76113.1|  metallopeptidase [Homo sapiens]                   68.9    2e-10 Gene info
ref|YP_001675516.1|  endothelin-converting protein 1 [Shewanel...  68.9    2e-10 Gene info
ref|NP_496490.2|  NEPrilysin metallopeptidase family member (n...  68.9    2e-10 UniGene infoGene info
ref|XP_312790.3|  AGAP003106-PA [Anopheles gambiae str. PEST] ...  68.9    2e-10 UniGene infoGene info
ref|XP_002037126.1|  GM12744 [Drosophila sechellia] >gb|EDW532...  68.6    2e-10 Gene info
ref|ZP_04834892.1|  endopeptidase PepO [Prevotella melaninogen...  68.6    2e-10
ref|ZP_03932401.1|  endothelin-converting protein 1 [Corynebac...  68.6    2e-10
ref|XP_002416318.1|  neprilysin, putative [Ixodes scapularis] ...  68.6    2e-10 Gene info
ref|ZP_05708288.1|  endopeptidase O [Corynebacterium genitaliu...  68.6    2e-10
ref|XP_001833404.1|  hypothetical protein CC1G_05104 [Coprinop...  68.6    2e-10 Gene info
ref|XP_002105265.1|  GD21387 [Drosophila simulans] >gb|EDX1476...  68.6    3e-10 Gene info
ref|ZP_03936121.1|  possible Endothelin-converting enzyme 1 [C...  68.6    3e-10
ref|XP_974559.2|  PREDICTED: similar to neutral endopeptidase ...  68.6    3e-10 UniGene infoGene info
ref|ZP_05751795.1|  endopeptidase O [Lactobacillus helveticus ...  68.6    3e-10
ref|XP_001600059.1|  PREDICTED: similar to zinc metalloproteas...  68.6    3e-10 UniGene infoGene info
ref|ZP_03709297.1|  hypothetical protein CORMATOL_00101 [Coryn...  68.6    3e-10
ref|YP_618394.1|  endopeptidase [Lactobacillus delbrueckii sub...  68.6    3e-10 Gene info
ref|YP_268183.1|  neutral zinc metallopeptidase M13 family pro...  68.6    3e-10 Gene info
dbj|BAB97547.1|  Predicted metalloendopeptidase [Corynebacteri...  68.2    3e-10 Gene info
ref|ZP_04835732.1|  endOpeptidase o [Corynebacterium matruchot...  68.2    3e-10
ref|YP_812306.1|  neutral endopeptidase [Lactobacillus delbrue...  68.2    3e-10 Gene info
ref|XP_781407.2|  PREDICTED: similar to neprilysin [Strongyloc...  68.2    3e-10 UniGene infoGene info
gb|AAC28366.1|  neprilysin [Perca flavescens]                      68.2    3e-10
ref|XP_001953872.1|  GF17017 [Drosophila ananassae] >gb|EDV424...  68.2    4e-10 Gene info
ref|YP_002310483.1|  Neutral zinc metallopeptidase, M13 family...  68.2    4e-10 Gene info
ref|YP_001137098.1|  hypothetical protein cgR_0233 [Corynebact...  67.8    5e-10 Gene info
ref|YP_001577502.1|  endopeptidase O2 [Lactobacillus helveticu...  67.8    5e-10 Gene info
ref|NP_599406.1|  metalloendopeptidase [Corynebacterium glutam...  67.8    5e-10 Gene info
gb|ABB30006.1|  endopeptidase O2 [Lactobacillus helveticus]        67.8    5e-10
ref|ZP_05133056.1|  metallopeptidase [Stenotrophomonas sp. SKA...  67.8    5e-10
ref|ZP_05549784.1|  endopeptidase O3 [Lactobacillus crispatus ...  67.8    5e-10
ref|XP_002193378.1|  PREDICTED: hypothetical protein [Taeniopy...  67.8    5e-10 UniGene infoGene info
ref|XP_002432226.1|  endothelin-converting enzyme, putative [P...  67.8    5e-10 Gene info
ref|YP_002029258.1|  Neprilysin [Stenotrophomonas maltophilia ...  67.4    5e-10 Gene info
ref|NP_506520.1|  hypothetical protein T16A9.4 [Caenorhabditis...  67.4    5e-10 UniGene infoGene info
ref|XP_859178.1|  PREDICTED: similar to Phosphate regulating n...  67.4    5e-10 UniGene infoGene info
ref|ZP_03995917.1|  M13 family peptidase [Lactobacillus crispa...  67.4    5e-10
ref|ZP_05554735.1|  endopeptidase O3 [Lactobacillus crispatus ...  67.4    5e-10
gb|EEY54863.1|  endothelin-converting enzyme 1, metalloproteas...  67.4    6e-10
ref|XP_970993.1|  PREDICTED: similar to Endothelin-converting ...  67.4    6e-10 UniGene infoGene info
ref|YP_001503090.1|  endothelin-converting protein 1 [Shewanel...  67.4    6e-10 Gene info
ref|XP_002637927.1|  Hypothetical protein CBG04739 [Caenorhabd...  67.4    6e-10 Gene info
ref|YP_001475365.1|  endothelin-converting protein 1 [Shewanel...  67.4    6e-10 Gene info
ref|XP_002404392.1|  neprilysin, putative [Ixodes scapularis] ...  67.4    6e-10 Gene info
ref|XP_758840.1|  hypothetical protein UM02693.1 [Ustilago may...  67.4    6e-10 Gene info
ref|NP_970279.1|  metallopeptidase [Bdellovibrio bacteriovorus...  67.0    7e-10 Gene info
gb|AAF13152.1|AF157105_1  soluble secreted endopeptidase [Mus ...  67.0    7e-10 Gene info
ref|XP_001944441.1|  PREDICTED: similar to neutral endopeptida...  67.0    7e-10 Gene info
ref|NP_001120567.1|  hypothetical protein LOC100145721 [Xenopu...  67.0    7e-10 UniGene infoGene info
gb|AAF13153.1|AF157106_1  soluble secreted endopeptidase delta...  67.0    8e-10 Gene info
ref|XP_001599960.1|  PREDICTED: similar to neutral endopeptida...  67.0    8e-10 UniGene infoGene info
ref|ZP_05553877.1|  endothelin-converting protein 1 [Lactobaci...  67.0    8e-10
ref|XP_973465.1|  PREDICTED: similar to AGAP007796-PA [Triboli...  67.0    8e-10 UniGene infoGene info
ref|NP_001101467.1|  membrane metallo-endopeptidase-like 1 [Ra...  67.0    8e-10 UniGene infoGene info
pir||JC7265  neprilysin (EC 3.4.24.11) II - rat                    67.0    9e-10
gb|EDL81277.1|  mel transforming oncogene-like 1 (predicted), ...  66.6    9e-10 Gene info
ref|XP_974578.2|  PREDICTED: similar to neutral endopeptidase ...  66.6    1e-09 UniGene infoGene info
ref|NP_871928.1|  hypothetical protein F18A12.8 [Caenorhabditi...  66.6    1e-09 Gene info
ref|ZP_02204950.1|  Endothelin-converting enzyme 1 [Dehalococc...  66.6    1e-09
gb|AAG18448.1|AF302077_1  neprilysin-like peptidase gamma [Mus...  66.6    1e-09 Gene info
pdb|3DWB|A  Chain A, Structure Of Human Ece-1 Complexed With P...  66.2    1e-09 Related structures
ref|YP_001762262.1|  endothelin-converting protein 1 [Shewanel...  66.2    1e-09 Gene info
ref|XP_001981422.1|  GG11622 [Drosophila erecta] >gb|EDV53292....  66.2    1e-09 Gene info
ref|YP_001973163.1|  putative exported endopeptidase [Stenotro...  66.2    1e-09 Gene info
ref|XP_795266.2|  PREDICTED: similar to neprilysin [Strongyloc...  66.2    1e-09 UniGene infoGene info
ref|NP_038811.2|  membrane metallo-endopeptidase-like 1 [Mus m...  65.9    2e-09 UniGene infoGene info
sp|Q9JLI3.1|MMEL1_MOUSE  RecName: Full=Membrane metallo-endope...  65.9    2e-09 Gene info
gb|AAG18446.1|AF302075_1  neprilysin-like peptidase alpha [Mus...  65.9    2e-09 Gene info
ref|ZP_04646064.1|  neutral endopeptidase [Lactobacillus jense...  65.9    2e-09
dbj|BAG52644.1|  unnamed protein product [Homo sapiens]            65.9    2e-09 Gene info
emb|CAG07031.1|  unnamed protein product [Tetraodon nigroviridis]  65.9    2e-09
dbj|BAE32538.1|  unnamed protein product [Mus musculus]            65.9    2e-09 Gene info
ref|XP_974609.1|  PREDICTED: similar to neutral endopeptidase ...  65.9    2e-09 UniGene infoGene info
ref|XP_001607040.1|  PREDICTED: similar to GA22015-PA [Nasonia...  65.5    2e-09 UniGene infoGene info
ref|XP_002631068.1|  C. briggsae CBR-NEP-1 protein [Caenorhabd...  65.5    2e-09 Gene info
gb|AAQ89282.1|  ECEL1 [Homo sapiens]                               65.5    2e-09 Gene info
ref|XP_002638126.1|  Hypothetical protein CBG04988 [Caenorhabd...  65.5    2e-09 Gene info
ref|XP_001600035.1|  PREDICTED: similar to neutral endopeptida...  65.5    2e-09 UniGene infoGene info
ref|XP_001354840.2|  GA19217 [Drosophila pseudoobscura pseudoo...  65.5    2e-09 Gene info
dbj|BAE89526.1|  unnamed protein product [Macaca fascicularis]     65.5    2e-09
gb|EEY56805.1|  endothelin-converting enzyme, metalloprotease ...  65.5    2e-09
ref|XP_553645.3|  AGAP009791-PA [Anopheles gambiae str. PEST] ...  65.5    2e-09 UniGene infoGene info
ref|YP_750642.1|  endothelin-converting protein 1 [Shewanella ...  65.5    2e-09 Gene info
ref|XP_002125740.1|  PREDICTED: similar to LOC495020 protein [...  65.5    2e-09 Gene info
ref|XP_001098573.1|  PREDICTED: endothelin converting enzyme 1...  65.5    2e-09 UniGene infoGene info
ref|XP_002435145.1|  neprilysin, putative [Ixodes scapularis] ...  65.5    2e-09 Gene info
ref|XP_516151.2|  PREDICTED: endothelin converting enzyme-like...  65.5    2e-09 UniGene infoGene info
gb|ABS42950.1|  endothelin converting enzyme-1 [Fundulus heter...  65.5    2e-09
gb|EDL80853.1|  endothelin converting enzyme 1, isoform CRA_b ...  65.5    2e-09 Gene info
ref|XP_395313.3|  PREDICTED: similar to F18A12.8a [Apis mellif...  65.5    2e-09 UniGene infoGene info
ref|XP_001900211.1|  Peptidase family M13 containing protein [...  65.5    3e-09 Gene info
ref|XP_001599405.1|  PREDICTED: similar to zinc metalloproteas...  65.5    3e-09 UniGene infoGene info
ref|ZP_03955811.1|  M13 family peptidase [Lactobacillus jensen...  65.1    3e-09
ref|XP_002024268.1|  GL14909 [Drosophila persimilis] >gb|EDW29...  65.1    3e-09 Gene info
ref|NP_267960.1|  neutral endopeptidase [Lactococcus lactis su...  65.1    3e-09 Gene info
ref|YP_001174730.1|  endopeptidase [Lactococcus lactis] >gb|AB...  65.1    3e-09 Gene info
ref|YP_001032041.1|  endopeptidase O [Lactococcus lactis subsp...  65.1    3e-09 Gene info
ref|XP_001978412.1|  GG19572 [Drosophila erecta] >gb|EDV47339....  64.7    4e-09 Gene info
ref|XP_001378153.1|  PREDICTED: similar to vacuolar protein so...  64.7    4e-09 UniGene infoGene info
ref|XP_001865244.1|  zinc metalloprotease [Culex quinquefascia...  64.7    4e-09 Gene info
ref|XP_001901622.1|  Hypothetical zinc metalloproteinase T16A9...  64.7    4e-09 Gene info
ref|XP_002099869.1|  GE16732 [Drosophila yakuba] >gb|EDX00977....  64.7    4e-09 Gene info
ref|NP_511056.2|  neprilysin 1, isoform A [Drosophila melanoga...  64.7    4e-09 UniGene infoGene info
ref|XP_001194810.1|  PREDICTED: similar to ENSANGP00000003181 ...  64.7    4e-09 UniGene infoGene info
ref|XP_002075320.1|  GK15832 [Drosophila willistoni] >gb|EDW86...  64.3    4e-09 Gene info
ref|XP_002011117.1|  GI16188 [Drosophila mojavensis] >gb|EDW05...  64.3    4e-09 Gene info
ref|XP_002036821.1|  GM12465 [Drosophila sechellia] >gb|EDW529...  64.3    5e-09 Gene info
ref|YP_796543.1|  oligopeptidase O1 [Lactococcus lactis subsp....  64.3    5e-09 Gene info
ref|ZP_01041073.1|  metalloendopeptidase PepO [Erythrobacter s...  64.3    5e-09
ref|XP_002054359.1|  GJ24401 [Drosophila virilis] >gb|EDW67879...  64.3    5e-09 Gene info
ref|XP_002010221.1|  GI15813 [Drosophila mojavensis] >gb|EDW07...  64.3    6e-09 Gene info
ref|ZP_04054374.1|  endopeptidase PepO [Porphyromonas uenonis ...  64.3    6e-09
ref|XP_001953886.1|  GF17991 [Drosophila ananassae] >gb|EDV424...  63.9    6e-09 Gene info
ref|XP_001999055.1|  GI23283 [Drosophila mojavensis] >gb|EDW14...  63.9    6e-09 Gene info
ref|XP_002155074.1|  PREDICTED: similar to predicted protein [...  63.9    6e-09 Gene info
ref|XP_002056828.1|  GJ16677 [Drosophila virilis] >gb|EDW62314...  63.9    6e-09 Gene info
ref|XP_001633564.1|  predicted protein [Nematostella vectensis...  63.9    7e-09 UniGene infoGene info
ref|XP_798822.2|  PREDICTED: similar to endothelin-converting ...  63.9    7e-09 UniGene infoGene info
ref|XP_001599431.1|  PREDICTED: similar to zinc metalloproteas...  63.5    8e-09 UniGene infoGene info
ref|XP_002106276.1|  GD16784 [Drosophila simulans] >gb|EDX1722...  63.5    8e-09 Gene info
ref|NP_975673.1|  endopeptidase O [Mycoplasma mycoides subsp. ...  63.5    8e-09 Gene info
ref|YP_811579.1|  oligopeptidase O1 [Lactococcus lactis subsp....  63.5    8e-09 Gene info
ref|XP_001963389.1|  GF20372 [Drosophila ananassae] >gb|EDV444...  63.5    8e-09 Gene info
ref|XP_002404996.1|  neutral endopeptidase, putative [Ixodes s...  63.5    9e-09 Gene info
sp|P42891.2|ECE1_BOVIN  RecName: Full=Endothelin-converting en...  63.5    9e-09 Gene info
emb|CAA84547.1|  endothelin-converting-enzyme 1 [Bos taurus] >...  63.5    9e-09 Gene info
gb|AAI33321.1|  ECE1 protein [Bos taurus]                          63.5    9e-09 Gene info
ref|XP_002053910.1|  GJ24140 [Drosophila virilis] >gb|EDW67430...  63.5    9e-09 Gene info
gb|EEY56351.1|  metalloprotease family M13, putative [Phytopht...  63.5    9e-09
ref|XP_001637273.1|  predicted protein [Nematostella vectensis...  63.5    9e-09 UniGene infoGene info
ref|XP_001552037.1|  hypothetical protein BC1G_09378 [Botryoti...  63.2    1e-08 Gene info
ref|ZP_00784342.1|  endopeptidase O [Streptococcus agalactiae ...  63.2    1e-08
ref|XP_001622584.1|  predicted protein [Nematostella vectensis...  63.2    1e-08 UniGene infoGene info
ref|XP_546737.2|  PREDICTED: similar to mel transforming oncog...  63.2    1e-08 UniGene infoGene info
ref|XP_392502.2|  PREDICTED: similar to Neprilysin 1 CG5905-PA...  63.2    1e-08 UniGene infoGene info
ref|YP_001033246.1|  putative neutral endopeptidase O2 [Lactoc...  63.2    1e-08 Gene info
gb|AAL28251.1|  GH14576p [Drosophila melanogaster]                 63.2    1e-08
ref|XP_001501619.2|  PREDICTED: similar to endothelin converti...  63.2    1e-08 UniGene infoGene info
ref|XP_002428736.1|  endothelin-converting enzyme, putative [P...  63.2    1e-08 Gene info
emb|CAG02177.1|  unnamed protein product [Tetraodon nigroviridis]  63.2    1e-08
ref|XP_001492475.2|  PREDICTED: similar to Membrane metallo-en...  62.8    1e-08 UniGene infoGene info
dbj|BAG60332.1|  unnamed protein product [Homo sapiens]            62.8    1e-08 Gene info
gb|AAY81997.1|  endothelin-converting enzyme-1a [Mus musculus]     62.8    1e-08 Gene info
ref|NP_001071260.1|  endothelin converting enzyme 1 [Danio rer...  62.8    1e-08 UniGene infoGene info
sp|P42893.2|ECE1_RAT  RecName: Full=Endothelin-converting enzy...  62.8    1e-08 Gene info
sp|P42359.1|YSC6_STRGC  RecName: Full=Putative zinc metallopro...  62.8    1e-08
gb|AAF67832.1|AF179267_1  endopeptidase PepO2 [Lactococcus lac...  62.8    1e-08
ref|XP_002166665.1|  PREDICTED: similar to predicted protein [...  62.8    1e-08 UniGene infoGene info
ref|XP_002113430.1|  hypothetical protein TRIADDRAFT_63323 [Tr...  62.8    1e-08 Gene info
emb|CAI20193.1|  endothelin converting enzyme 1 [Homo sapiens]     62.8    2e-08 Gene info
ref|XP_001150860.1|  PREDICTED: membrane metallo-endopeptidase...  62.8    2e-08 UniGene infoGene info
ref|XP_001477565.1|  PREDICTED: similar to Endothelin converti...  62.8    2e-08 UniGene infoGene info
dbj|BAA06152.1|  endothelin-converting enzyme [Rattus norvegicus]  62.8    2e-08 Gene info
ref|XP_001363896.1|  PREDICTED: similar to Mme protein [Monode...  62.8    2e-08 UniGene infoGene info
ref|XP_001150798.1|  PREDICTED: membrane metallo-endopeptidase...  62.4    2e-08 UniGene infoGene info
ref|XP_002112168.1|  hypothetical protein TRIADDRAFT_37639 [Tr...  62.4    2e-08 Gene info
ref|NP_446048.2|  endothelin converting enzyme 1 [Rattus norve...  62.4    2e-08 UniGene infoGene info
sp|Q4PZA2.1|ECE1_MOUSE  RecName: Full=Endothelin-converting en...  62.4    2e-08 Gene info
gb|AAY81996.1|  endothelin-converting enzyme-1d [Mus musculus]     62.4    2e-08 Gene info
ref|NP_955011.1|  endothelin converting enzyme 1 [Mus musculus...  62.4    2e-08 UniGene infoGene info
ref|XP_001849326.1|  neprilysin [Culex quinquefasciatus] >gb|E...  62.4    2e-08 UniGene infoGene info
ref|XP_001994951.1|  GH13212 [Drosophila grimshawi] >gb|EDV915...  62.4    2e-08 Gene info
ref|XP_002000717.1|  GI22369 [Drosophila mojavensis] >gb|EDW16...  62.4    2e-08 Gene info
ref|XP_001641747.1|  predicted protein [Nematostella vectensis...  62.4    2e-08 UniGene infoGene info
ref|ZP_05033177.1|  peptidase family M13 [Brevundimonas sp. BA...  62.4    2e-08
emb|CAM15787.1|  membrane metallo-endopeptidase-like 1 [Mus mu...  62.4    2e-08 Gene info
ref|XP_001993583.1|  GH20297 [Drosophila grimshawi] >gb|EDV943...  62.4    2e-08 Gene info
gb|AAI01029.2|  MMEL1 protein [Homo sapiens]                       62.4    2e-08 Gene info
ref|XP_001992618.1|  GH24851 [Drosophila grimshawi] >gb|EDV923...  62.4    2e-08 Gene info
ref|XP_002408135.1|  neprilysin, putative [Ixodes scapularis] ...  62.4    2e-08 UniGene infoGene info
ref|XP_002072021.1|  GK22544 [Drosophila willistoni] >gb|EDW83...  62.4    2e-08 Gene info
ref|XP_001632932.1|  predicted protein [Nematostella vectensis...  62.0    2e-08 Gene info
ref|XP_002590443.1|  hypothetical protein BRAFLDRAFT_62750 [Br...  62.0    2e-08 UniGene infoGene info
ref|NP_001106818.1|  endothelin converting enzyme 1 isoform 3 ...  62.0    2e-08 Gene info
ref|XP_974542.2|  PREDICTED: similar to neprilysin [Tribolium ...  62.0    2e-08 UniGene infoGene info
ref|XP_001624098.1|  predicted protein [Nematostella vectensis...  62.0    2e-08 UniGene infoGene info
ref|NP_001388.1|  endothelin converting enzyme 1 isoform 1 [Ho...  62.0    2e-08 UniGene infoGene info
ref|XP_001162732.1|  PREDICTED: endothelin converting enzyme 1...  62.0    2e-08 Gene info
ref|XP_002162254.1|  PREDICTED: similar to predicted protein [...  62.0    2e-08 UniGene infoGene info
ref|NP_258428.2|  membrane metallo-endopeptidase-like 1 [Homo ...  62.0    2e-08 UniGene infoGene info
ref|XP_971821.2|  PREDICTED: similar to neprilysin [Tribolium ...  62.0    2e-08 UniGene infoGene info
gb|AAI01031.2|  Membrane metallo-endopeptidase-like 1 [Homo sa...  62.0    3e-08 Gene info
gb|AAL08942.1|AF336981_1  neprilysin-like metallopeptidase 2 [...  62.0    3e-08 Gene info
emb|CAM15785.1|  membrane metallo-endopeptidase-like 1 [Mus mu...  62.0    3e-08 Gene info
gb|AAX35820.1|  endothelin converting enzyme 1 [Homo sapiens]      62.0    3e-08 Gene info
emb|CAM15786.1|  membrane metallo-endopeptidase-like 1 [Mus mu...  62.0    3e-08 Gene info
dbj|BAG59124.1|  unnamed protein product [Homo sapiens]            62.0    3e-08 Gene info
ref|XP_001162388.1|  PREDICTED: endothelin converting enzyme 1...  62.0    3e-08 UniGene infoGene info
ref|NP_001106820.1|  endothelin converting enzyme 1 isoform 2 ...  62.0    3e-08 UniGene infoGene info
ref|XP_001162780.1|  PREDICTED: endothelin converting enzyme 1...  62.0    3e-08 UniGene infoGene info
emb|CAA84548.1|  endothelin-converting-enzyme 1 [Homo sapiens]...  62.0    3e-08 Gene info
ref|NP_001106819.1|  endothelin converting enzyme 1 isoform 4 ...  62.0    3e-08 UniGene infoGene info
ref|YP_001624744.1|  M13 family metallopeptidase [Renibacteriu...  62.0    3e-08 Gene info
ref|XP_001989732.1|  GH18955 [Drosophila grimshawi] >gb|EDV927...  62.0    3e-08 Gene info
ref|XP_002054361.1|  GJ24403 [Drosophila virilis] >gb|EDW67881...  62.0    3e-08 Gene info
ref|ZP_04985138.1|  hypothetical protein FTAG_00059 [Francisel...  62.0    3e-08
ref|XP_001162650.1|  PREDICTED: endothelin converting enzyme 1...  61.6    3e-08 UniGene infoGene info
gb|EAW94960.1|  endothelin converting enzyme 1, isoform CRA_d ...  61.6    3e-08 Gene info
ref|XP_001162429.1|  PREDICTED: endothelin converting enzyme 1...  61.6    3e-08 Gene info
gb|EDL29907.1|  endothelin converting enzyme 1 [Mus musculus]      61.6    3e-08 Gene info
ref|XP_001099089.1|  PREDICTED: endothelin converting enzyme 1...  61.6    3e-08 UniGene infoGene info
ref|ZP_04820701.1|  peptidase family M13 [Clostridium botulinu...  61.6    3e-08
ref|XP_001650510.1|  neprilysin [Aedes aegypti] >gb|EAT43387.1...  61.6    3e-08 UniGene infoGene info
ref|XP_002192864.1|  PREDICTED: phosphate regulating endopepti...  61.6    3e-08 UniGene infoGene info
ref|ZP_04983473.1|  M13 family metallopeptidase [Francisella t...  61.6    3e-08
ref|XP_544514.2|  PREDICTED: similar to endothelin converting ...  61.6    3e-08 UniGene infoGene info
ref|XP_001162607.1|  PREDICTED: endothelin converting enzyme 1...  61.6    3e-08 UniGene infoGene info
ref|XP_002157184.1|  PREDICTED: similar to predicted protein [...  61.6    3e-08 UniGene infoGene info
ref|ZP_02274755.1|  M13 family metallopeptidase [Francisella t...  61.6    3e-08
ref|YP_806692.1|  neutral endopeptidase [Lactobacillus casei A...  61.6    3e-08 Gene info
ref|XP_001592776.1|  hypothetical protein SS1G_05697 [Scleroti...  61.6    4e-08 Gene info
ref|XP_001627207.1|  predicted protein [Nematostella vectensis...  61.2    4e-08 UniGene infoGene info
ref|ZP_04674474.1|  neutral endopeptidase [Lactobacillus parac...  61.2    4e-08
ref|YP_001987634.1|  Oligoendopeptidase O [Lactobacillus casei...  61.2    4e-08 Gene info
ref|NP_990048.1|  endothelin converting enzyme 1 [Gallus gallu...  61.2    4e-08 UniGene infoGene info
emb|CAF91668.1|  unnamed protein product [Tetraodon nigroviridis]  61.2    4e-08
ref|XP_001631659.1|  predicted protein [Nematostella vectensis...  61.2    4e-08 Gene info
sp|P97739.1|ECE1_CAVPO  RecName: Full=Endothelin-converting en...  61.2    5e-08
ref|XP_001358742.2|  GA13054 [Drosophila pseudoobscura pseudoo...  61.2    5e-08 Gene info
ref|XP_001601166.1|  PREDICTED: similar to endothelin converti...  61.2    5e-08 UniGene infoGene info
ref|XP_002432266.1|  endothelin-converting enzyme, putative [P...  61.2    5e-08 Gene info
ref|XP_002013543.1|  GL24195 [Drosophila persimilis] >gb|EDW24...  60.8    5e-08 Gene info
ref|NP_964045.1|  endopeptidase O [Lactobacillus johnsonii NCC...  60.8    5e-08 Gene info
gb|ABA40757.1|  endothelin converting enzyme-1 [Canis familiaris]  60.8    5e-08 Gene info
gb|EEY20316.1|  endothelin-converting enzyme [Verticillium alb...  60.8    6e-08
ref|NP_733186.1|  neprilysin 5, isoform B [Drosophila melanoga...  60.8    6e-08 UniGene infoGene info
dbj|BAG58256.1|  unnamed protein product [Homo sapiens]            60.8    6e-08 Gene info
ref|XP_001843319.1|  endothelin-converting enzyme 1 [Culex qui...  60.8    6e-08 UniGene infoGene info
pdb|1DMT|A  Chain A, Structure Of Human Neutral Endopeptidase ...  60.8    6e-08 Related structuresPubChem BioAssay Info
ref|XP_001955660.1|  GF16131 [Drosophila ananassae] >gb|EDV442...  60.5    7e-08 Gene info
ref|YP_001727430.1|  metalloendopeptidase [Leuconostoc citreum...  60.5    7e-08 Gene info
ref|XP_002630394.1|  Hypothetical protein CBG04333 [Caenorhabd...  60.5    7e-08 Gene info
ref|XP_001955653.1|  GF18872 [Drosophila ananassae] >gb|EDV442...  60.5    7e-08 Gene info
ref|XP_516827.1|  PREDICTED: hypothetical protein isoform 11 [...  60.5    7e-08 Gene info
emb|CAH89405.1|  hypothetical protein [Pongo abelii]               60.5    7e-08 Gene info
ref|NP_009218.2|  membrane metallo-endopeptidase [Homo sapiens...  60.5    7e-08 UniGene infoGene info
ref|XP_002187751.1|  PREDICTED: membrane metallo-endopeptidase...  60.5    7e-08 UniGene infoGene info
gb|AAI43466.1|  Membrane metallo-endopeptidase [Homo sapiens]      60.5    8e-08 Gene info
gb|AAA51915.1|  common acute lymphoblastic leukemia antigen pr...  60.5    8e-08 Gene info
emb|CAH89938.1|  hypothetical protein [Pongo abelii]               60.5    8e-08 Gene info
emb|CAA30157.1|  unnamed protein product [Homo sapiens]            60.5    8e-08 Gene info
sp|Q5RE69.2|NEP_PONAB  RecName: Full=Neprilysin; AltName: Full...  60.5    8e-08 Gene info
gb|ABN11956.1|  putative neprilysin [Maconellicoccus hirsutus]     60.5    8e-08
gb|AAH46653.1|  Ece1 protein [Xenopus laevis]                      60.5    8e-08 Gene info
gb|ABO33468.1|  endothelin converting enzyme-1 [Xenopus laevis]    60.5    8e-08 Gene info
ref|XP_001981601.1|  GG12146 [Drosophila erecta] >gb|EDV53471....  60.5    8e-08 Gene info
ref|NP_001080378.1|  Endothelin-converting enzyme 1 [Xenopus l...  60.1    9e-08 UniGene infoGene info
ref|XP_001903796.1|  unnamed protein product [Podospora anseri...  60.1    9e-08 Gene info
gb|AAB32062.1|  endothelin converting enzyme; ECE [Bos taurus]     60.1    9e-08 Gene info
ref|NP_851352.1|  endothelin converting enzyme 1 [Bos taurus] ...  60.1    9e-08 UniGene infoGene info
ref|XP_001488195.1|  PREDICTED: membrane metallo-endopeptidase...  60.1    1e-07 UniGene infoGene info
ref|XP_002189586.1|  PREDICTED: endothelin converting enzyme 1...  60.1    1e-07 UniGene infoGene info
ref|XP_002098843.1|  GE10593 [Drosophila yakuba] >gb|EDW98555....  59.7    1e-07 Gene info
sp|P0C1T0.1|MMEL1_RAT  RecName: Full=Membrane metallo-endopept...  59.7    1e-07 Gene info
ref|XP_001511376.1|  PREDICTED: similar to endothelin-converti...  59.7    1e-07 UniGene infoGene info
ref|XP_416801.2|  PREDICTED: similar to X-linked hypophosphate...  59.7    1e-07 UniGene infoGene info
ref|XP_001605702.1|  PREDICTED: similar to ENSANGP00000001161 ...  59.7    1e-07 UniGene infoGene info
ref|XP_312504.3|  AGAP002441-PA [Anopheles gambiae str. PEST] ...  59.7    1e-07 UniGene infoGene info
ref|XP_001105708.1|  PREDICTED: membrane metallo-endopeptidase...  59.7    1e-07 UniGene infoGene info
gb|EDL78004.1|  endothelin-converting enzyme 2, isoform CRA_a ...  59.7    1e-07 Gene info
ref|NP_494537.1|  hypothetical protein F18A12.1 [Caenorhabditi...  59.7    1e-07 UniGene infoGene info
ref|XP_002041451.1|  GM10139 [Drosophila sechellia] >gb|EDW451...  59.7    1e-07 Gene info
ref|XP_616885.3|  PREDICTED: similar to membrane metallo endop...  59.7    1e-07 UniGene infoGene info
ref|XP_002371503.1|  endothelin-converting enzyme, putative [T...  59.3    1e-07 Gene info
tpe|CBF83425.1|  TPA: endothelin-converting enzyme (AFU_orthol...  59.3    1e-07
ref|XP_660695.1|  hypothetical protein AN3091.2 [Aspergillus n...  59.3    1e-07 Gene info
gb|EAW56080.1|  membrane metallo-endopeptidase-like 1, isoform...  59.3    2e-07 Gene info
ref|NP_001126748.1|  membrane metallo-endopeptidase [Pongo abe...  59.3    2e-07 Gene info
ref|XP_001602853.1|  PREDICTED: similar to neprilysin [Nasonia...  58.9    2e-07 UniGene infoGene info
ref|XP_001624094.1|  predicted protein [Nematostella vectensis...  58.9    2e-07 Gene info
ref|XP_874253.3|  PREDICTED: similar to Membrane metallo-endop...  58.9    2e-07 UniGene infoGene info
ref|XP_001147959.1|  PREDICTED: hypothetical protein isoform 1...  58.9    2e-07 UniGene infoGene info
ref|NP_001004412.1|  membrane metallo-endopeptidase [Gallus ga...  58.9    2e-07 UniGene infoGene info
ref|XP_534313.2|  PREDICTED: similar to membrane metallo endop...  58.9    2e-07 UniGene infoGene info
ref|XP_001865245.1|  neprilysin [Culex quinquefasciatus] >gb|E...  58.9    2e-07 UniGene infoGene info
ref|XP_002105118.1|  GD18099 [Drosophila simulans] >gb|EDX1462...  58.9    2e-07 Gene info
ref|XP_001952872.1|  PREDICTED: similar to neutral endopeptida...  58.9    2e-07 UniGene infoGene info
ref|XP_002589136.1|  hypothetical protein BRAFLDRAFT_213755 [B...  58.9    2e-07 Gene info
ref|ZP_04441001.1|  M13 family peptidase [Lactobacillus rhamno...  58.5    2e-07
ref|XP_001105564.1|  PREDICTED: membrane metallo-endopeptidase...  58.5    3e-07 UniGene infoGene info
ref|ZP_03211805.1|  neutral endopeptidase [Lactobacillus rhamn...  58.5    3e-07
ref|YP_003171224.1|  neutral endopeptidase (Endopeptidase O) [...  58.5    3e-07 Gene info
gb|AAD51382.1|AF104361_1  neutral endopeptidase [Aplysia calif...  58.5    3e-07
gb|AAA37386.1|  CD10 neutral endopeptidase 24.11                   58.5    3e-07 Gene info
gb|EDL35389.1|  membrane metallo endopeptidase, isoform CRA_a ...  58.5    3e-07 Gene info
ref|XP_001931492.1|  endothelin-converting enzyme 1 [Pyrenopho...  58.5    3e-07 Gene info
gb|AAH66840.1|  Mme protein [Mus musculus]                         58.5    3e-07 Gene info
ref|NP_032630.2|  membrane metallo endopeptidase [Mus musculus...  58.5    3e-07 UniGene infoGene info
ref|NP_001095155.1|  membrane metallo-endopeptidase [Oryctolag...  58.2    3e-07 UniGene infoGene info
ref|NP_808871.2|  endothelin converting enzyme 2 isoform 2a-2 ...  58.2    3e-07 UniGene infoGene info
ref|XP_001994953.1|  GH13190 [Drosophila grimshawi] >gb|EDV915...  58.2    3e-07 Gene info
emb|CAG05447.1|  unnamed protein product [Tetraodon nigroviridis]  58.2    4e-07
ref|XP_001920941.1|  PREDICTED: similar to endothelin converti...  58.2    4e-07 UniGene infoGene info
ref|XP_001949011.1|  PREDICTED: similar to neprilysin [Acyrtho...  58.2    4e-07 UniGene infoGene info
ref|NP_776471.2|  endothelin converting enzyme 2 isoform 2a-1 ...  57.8    4e-07 UniGene infoGene info
gb|ACB13196.1|  metalloproteinase [Necator americanus]             57.8    4e-07
ref|XP_002646874.1|  C. briggsae CBR-NEP-2 protein [Caenorhabd...  57.8    4e-07 Gene info
sp|Q10711.2|ECE2_BOVIN  RecName: Full=Endothelin-converting en...  57.8    4e-07 Gene info
ref|XP_001497654.1|  PREDICTED: endothelin converting enzyme 2...  57.8    4e-07 UniGene infoGene info
pir||I46078  endothelin converting enzyme (EC 3.4.24.-) 2 - bo...  57.8    5e-07
ref|NP_036740.1|  membrane metallo endopeptidase [Rattus norve...  57.8    5e-07 UniGene infoGene info
ref|XP_002165583.1|  PREDICTED: similar to endothelin converti...  57.8    5e-07 Gene info
ref|XP_001624095.1|  predicted protein [Nematostella vectensis...  57.4    5e-07 Gene info
ref|XP_001990117.1|  GH18413 [Drosophila grimshawi] >gb|EDV931...  57.4    6e-07 Gene info
gb|AAO72361.1|AF489574_1  endothelin-converting enzyme 2a-2 [B...  57.4    6e-07 Gene info
ref|NP_808873.2|  endothelin converting enzyme 2 isoform 2b-2 ...  57.4    6e-07 UniGene infoGene info
ref|XP_002054360.1|  GJ24402 [Drosophila virilis] >gb|EDW67880...  57.4    6e-07 Gene info
ref|XP_002056122.1|  GJ10399 [Drosophila virilis] >gb|EDW59234...  57.4    6e-07 Gene info
gb|AAO72363.1|AF489576_1  endothelin-converting enzyme 2b-2 [B...  57.4    6e-07 Gene info
ref|XP_526410.2|  PREDICTED: endothelin converting enzyme 2 is...  57.4    6e-07 UniGene infoGene info
ref|NP_808872.2|  endothelin converting enzyme 2 isoform 2b-1 ...  57.4    6e-07 UniGene infoGene info
gb|AAO72360.1|AF489573_1  endothelin-converting enzyme 2a-1 [B...  57.4    6e-07 Gene info
gb|AAO72362.1|AF489575_1  endothelin-converting enzyme 2b-1 [B...  57.0    7e-07 Gene info
ref|XP_001099223.1|  PREDICTED: endothelin converting enzyme 2...  57.0    8e-07 UniGene infoGene info
ref|NP_001093590.1|  endothelin converting enzyme 2 isoform D ...  57.0    8e-07 UniGene infoGene info
ref|XP_001497697.2|  PREDICTED: endothelin converting enzyme 2...  57.0    8e-07 UniGene infoGene info
ref|XP_001599927.1|  PREDICTED: similar to neutral endopeptida...  57.0    8e-07 UniGene infoGene info
gb|EAW56081.1|  membrane metallo-endopeptidase-like 1, isoform...  57.0    8e-07 Gene info
ref|XP_002094921.1|  GE19949 [Drosophila yakuba] >gb|EDW94633....  57.0    9e-07 Gene info
ref|NP_055508.3|  endothelin converting enzyme 2 isoform A [Ho...  57.0    9e-07 UniGene infoGene info
ref|XP_001497665.1|  PREDICTED: endothelin converting enzyme 2...  57.0    9e-07 UniGene infoGene info
ref|XP_001147750.1|  PREDICTED: similar to endothelin converti...  57.0    9e-07 UniGene infoGene info
ref|XP_001632926.1|  predicted protein [Nematostella vectensis...  56.6    9e-07 Gene info
ref|XP_002648301.1|  Hypothetical protein CBG24463 [Caenorhabd...  56.6    9e-07 Gene info
ref|XP_002000719.1|  GI22368 [Drosophila mojavensis] >gb|EDW16...  56.6    1e-06 Gene info
pir||D88082  protein T05A8.4 [imported] - Caenorhabditis elegans   56.6    1e-06
gb|ACU00912.1|  putative metalloprotease [Arthrobacter sp. 32c]    56.6    1e-06
ref|YP_504449.1|  endothelin-converting protein 1 [Methanospir...  56.6    1e-06 Gene info
ref|NP_494343.2|  NEPrilysin metallopeptidase family member (n...  56.6    1e-06 UniGene infoGene info
ref|XP_002072025.1|  GK22542 [Drosophila willistoni] >gb|EDW83...  56.6    1e-06 Gene info
ref|XP_002000721.1|  GI22367 [Drosophila mojavensis] >gb|EDW16...  56.6    1e-06 Gene info
emb|CAG06377.1|  unnamed protein product [Tetraodon nigroviridis]  56.6    1e-06
ref|YP_201920.1|  metallopeptidase [Xanthomonas oryzae pv. ory...  56.6    1e-06 Gene info
gb|EDK97579.1|  endothelin converting enzyme 2, isoform CRA_c ...  56.6    1e-06 Gene info
ref|NP_808810.1|  endothelin converting enzyme 2 isoform a [Mu...  56.2    1e-06 UniGene infoGene info
ref|NP_808809.1|  endothelin converting enzyme 2 isoform b [Mu...  56.2    1e-06 UniGene infoGene info
ref|XP_849610.1|  PREDICTED: similar to Endothelin-converting ...  56.2    1e-06 UniGene infoGene info
ref|XP_002069740.1|  GK11412 [Drosophila willistoni] >gb|EDW80...  56.2    1e-06 Gene info
ref|XP_001148106.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 UniGene infoGene info
ref|XP_001098704.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 UniGene infoGene info
ref|NP_651643.1|  CG14528 [Drosophila melanogaster] >gb|AAF568...  56.2    1e-06 UniGene infoGene info
gb|AAM50307.1|  RE71324p [Drosophila melanogaster]                 56.2    1e-06
ref|XP_002001941.1|  GI17111 [Drosophila mojavensis] >gb|EDW11...  56.2    1e-06 Gene info
ref|XP_859328.1|  PREDICTED: similar to endothelin converting ...  56.2    1e-06 UniGene infoGene info
gb|EAW78274.1|  hCG2022032, isoform CRA_b [Homo sapiens]           56.2    1e-06 Gene info
gb|AAL30386.1|AF428263_1  endothelin converting enzyme-2A [Hom...  56.2    1e-06 Gene info
gb|EAW78279.1|  hCG2022032, isoform CRA_g [Homo sapiens]           56.2    1e-06 Gene info
gb|EAW78275.1|  hCG2022032, isoform CRA_c [Homo sapiens]           56.2    1e-06 Gene info
ref|XP_001099014.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 Gene info
ref|XP_001099330.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 UniGene infoGene info
ref|NP_001093591.1|  endothelin converting enzyme 2 isoform E ...  56.2    1e-06 UniGene infoGene info
dbj|BAA25530.2|  KIAA0604 protein [Homo sapiens]                   56.2    1e-06 Gene info
ref|XP_001148031.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 UniGene infoGene info
ref|XP_002105262.1|  GD21385 [Drosophila simulans] >gb|EDX1476...  56.2    1e-06 Gene info
ref|XP_002098665.1|  GE23807 [Drosophila yakuba] >gb|EDW98377....  56.2    1e-06 Gene info
ref|XP_001099122.1|  PREDICTED: endothelin converting enzyme 2...  56.2    1e-06 UniGene infoGene info
ref|NP_001002815.2|  endothelin-converting enzyme 2 [Rattus no...  56.2    1e-06 UniGene infoGene info
ref|NP_001032401.1|  endothelin converting enzyme 2 isoform B ...  56.2    1e-06 UniGene infoGene info
tpe|CAE48383.1|  TPA: endothelin-converting enzyme 2 [Rattus n...  56.2    1e-06 Gene info
gb|EAW78278.1|  hCG2022032, isoform CRA_f [Homo sapiens]           56.2    1e-06 Gene info
ref|NP_494297.1|  hypothetical protein K02F6.9 [Caenorhabditis...  56.2    1e-06 UniGene infoGene info
gb|AAI42951.1|  Endothelin converting enzyme 2 [Homo sapiens] ...  56.2    2e-06 Gene info
ref|XP_001213326.1|  hypothetical protein ATEG_04148 [Aspergil...  56.2    2e-06 Gene info
ref|XP_001805503.1|  hypothetical protein SNOG_15353 [Phaeosph...  55.8    2e-06 Gene info
ref|XP_002037124.1|  GM12742 [Drosophila sechellia] >gb|EDW532...  55.8    2e-06 Gene info
ref|XP_001994952.1|  GH13201 [Drosophila grimshawi] >gb|EDV915...  55.8    2e-06 Gene info
gb|AAK83919.1|  endothelin converting enzyme-2 [Mus musculus]      55.8    2e-06 Gene info
ref|XP_975632.1|  PREDICTED: similar to AGAP002441-PA [Triboli...  55.8    2e-06 UniGene infoGene info
ref|XP_001981482.1|  GG11584 [Drosophila erecta] >gb|EDV53352....  55.8    2e-06 Gene info
ref|NP_643056.1|  metallopeptidase [Xanthomonas axonopodis pv....  55.8    2e-06 Gene info
ref|XP_001263221.1|  peptidase family M13 protein [Neosartorya...  55.8    2e-06 Gene info
ref|NP_647454.2|  endothelin converting enzyme 2 isoform d [Mu...  55.8    2e-06 UniGene infoGene info
ref|NP_808811.1|  endothelin converting enzyme 2 isoform e [Mu...  55.8    2e-06 UniGene infoGene info
ref|XP_001947360.1|  PREDICTED: similar to neutral endopeptida...  55.8    2e-06 Gene info
ref|XP_001641913.1|  predicted protein [Nematostella vectensis...  55.8    2e-06 Gene info
ref|XP_370146.1|  hypothetical protein MGG_06643 [Magnaporthe ...  55.8    2e-06 UniGene infoGene info
ref|XP_002631845.1|  Hypothetical protein CBG17784 [Caenorhabd...  55.5    2e-06 Gene info
dbj|BAG57280.1|  unnamed protein product [Homo sapiens]            55.5    2e-06 Gene info
ref|YP_364631.1|  metallopeptidase precursor [Xanthomonas camp...  55.5    2e-06 Gene info
ref|XP_002072023.1|  GK22543 [Drosophila willistoni] >gb|EDW83...  55.5    2e-06 Gene info
ref|XP_001120510.1|  PREDICTED: similar to Neprilysin 5 CG6265...  55.5    2e-06 UniGene infoGene info
gb|AAH30900.1|  Ece2 protein [Mus musculus]                        55.5    3e-06 Gene info
ref|XP_001953885.1|  GF17990 [Drosophila ananassae] >gb|EDV424...  55.5    3e-06 Gene info
ref|XP_001376715.1|  PREDICTED: similar to pol polyprotein [Mo...  55.5    3e-06 UniGene infoGene info
ref|XP_002042071.1|  GM26075 [Drosophila sechellia] >gb|EDW459...  55.1    3e-06 Gene info
gb|EDP52509.1|  endothelin-converting enzyme [Aspergillus fumi...  55.1    3e-06
dbj|BAG59165.1|  unnamed protein product [Homo sapiens]            55.1    3e-06 Gene info
ref|XP_002562001.1|  Pc18g01570 [Penicillium chrysogenum Wisco...  55.1    3e-06 Gene info
ref|XP_002631844.1|  Hypothetical protein CBG17783 [Caenorhabd...  55.1    3e-06 Gene info
ref|XP_002372894.1|  endothelin-converting enzyme [Aspergillus...  55.1    3e-06 Gene info
ref|XP_002128536.1|  PREDICTED: similar to phosphate regulatin...  55.1    3e-06 Gene info
ref|NP_494679.1|  hypothetical protein C49D10.10 [Caenorhabdit...  54.7    3e-06 UniGene infoGene info
ref|XP_001952773.1|  PREDICTED: similar to Neprilysin 5 CG6265...  54.7    4e-06 UniGene infoGene info
ref|XP_001817759.1|  hypothetical protein [Aspergillus oryzae ...  54.7    4e-06 Gene info
ref|XP_001633799.1|  predicted protein [Nematostella vectensis...  54.7    4e-06 UniGene infoGene info
ref|XP_002088496.1|  GE12141 [Drosophila yakuba] >gb|EDW88208....  54.7    4e-06 Gene info
ref|XP_001606289.1|  PREDICTED: similar to neutral endopeptida...  54.7    4e-06 Gene info
gb|AAQ89362.1|  ECE2 [Homo sapiens]                                54.7    4e-06 Gene info
gb|AAC50552.1|  metalloendopeptidase homolog [Homo sapiens]        54.7    4e-06 Gene info
ref|XP_754379.1|  endothelin-converting enzyme [Aspergillus fu...  54.3    5e-06 Gene info
ref|XP_002079246.1|  GD22107 [Drosophila simulans] >gb|EDX0483...  54.3    5e-06 Gene info
dbj|BAC27618.1|  unnamed protein product [Mus musculus]            54.3    5e-06 Gene info
gb|AAB42219.1|  phosphate regulator [Homo sapiens]                 54.3    5e-06 Gene info
ref|XP_002626806.1|  neprilysin [Ajellomyces dermatitidis SLH1...  54.3    5e-06 Gene info
emb|CAR97838.1|  C. elegans protein F54F11.2b, partially confi...  54.3    5e-06
ref|XP_001659372.1|  zinc metalloprotease [Aedes aegypti] >gb|...  54.3    5e-06 UniGene infoGene info
ref|ZP_02242679.1|  metallopeptidase [Xanthomonas oryzae pv. o...  54.3    5e-06
ref|XP_001989331.1|  GH11667 [Drosophila grimshawi] >gb|EDW041...  54.3    5e-06 Gene info
ref|XP_002402090.1|  neprilysin, putative [Ixodes scapularis] ...  53.9    6e-06 Gene info
ref|NP_637924.1|  metallopeptidase [Xanthomonas campestris pv....  53.9    6e-06 Gene info
ref|XP_001271237.1|  peptidase family M13 protein [Aspergillus...  53.9    6e-06 Gene info
pir||T31991  hypothetical protein C49D10.10 - Caenorhabditis e...  53.9    6e-06
ref|XP_973762.2|  PREDICTED: similar to soluble secreted endop...  53.9    7e-06 UniGene infoGene info
ref|YP_001902991.1|  Metallopeptidase [Xanthomonas campestris ...  53.5    8e-06 Gene info
gb|EEQ84240.1|  peptidase family M13 protein [Ajellomyces derm...  53.5    8e-06
ref|XP_001659850.1|  zinc metalloprotease [Aedes aegypti] >gb|...  53.5    8e-06 UniGene infoGene info
sp|Q80Z60.2|ECE2_MOUSE  RecName: Full=Endothelin-converting en...  53.5    8e-06 Gene info
gb|ABN49261.1|  IP13510p [Drosophila melanogaster]                 53.5    9e-06
gb|EEU39080.1|  hypothetical protein NECHADRAFT_43284 [Nectria...  53.5    1e-05
ref|XP_001893799.1|  peptidase family M13 containing protein [...  53.1    1e-05 Gene info
ref|NP_609577.2|  CG15485 [Drosophila melanogaster] >gb|AAF532...  53.1    1e-05 UniGene infoGene info
ref|XP_002014789.1|  GL18760 [Drosophila persimilis] >gb|EDW28...  53.1    1e-05 Gene info
ref|XP_002631842.1|  Hypothetical protein CBG17780 [Caenorhabd...  53.1    1e-05 Gene info
ref|XP_002192127.1|  PREDICTED: similar to Alg3 protein [Taeni...  53.1    1e-05 UniGene infoGene info
ref|XP_001356562.2|  GA13765 [Drosophila pseudoobscura pseudoo...  53.1    1e-05 Gene info
gb|AAO72356.1|AF489569_1  endothelin-converting enzyme 2a-1 [M...  53.1    1e-05 Gene info
gb|AAO72357.1|AF489570_1  endothelin-converting enzyme 2a-2 [M...  53.1    1e-05 Gene info
gb|AAO72359.1|AF489572_1  endothelin-converting enzyme 2b-2 [M...  53.1    1e-05 Gene info
gb|AAO72358.1|AF489571_1  endothelin-converting enzyme 2b-1 [M...  53.1    1e-05 Gene info
ref|XP_002098727.1|  GE23774 [Drosophila yakuba] >gb|EDW98439....  52.8    1e-05 Gene info
ref|NP_494532.2|  hypothetical protein F18A12.6 [Caenorhabditi...  52.8    1e-05 UniGene infoGene info
ref|XP_001969719.1|  GG10248 [Drosophila erecta] >gb|EDV58778....  52.8    1e-05 Gene info
ref|XP_002059219.1|  GJ16149 [Drosophila virilis] >gb|EDW71277...  52.8    2e-05 Gene info
ref|XP_001183175.1|  PREDICTED: hypothetical protein, partial ...  52.4    2e-05 UniGene infoGene info
ref|NP_494497.2|  hypothetical protein F39E9.4 [Caenorhabditis...  52.4    2e-05 UniGene infoGene info
ref|XP_001865246.1|  zinc metalloprotease [Culex quinquefascia...  52.4    2e-05 UniGene infoGene info
ref|NP_494529.2|  hypothetical protein T06D4.3 [Caenorhabditis...  52.4    2e-05 UniGene infoGene info
ref|XP_001606264.1|  PREDICTED: similar to neutral endopeptida...  52.4    2e-05 Gene info
gb|EEH08617.1|  peptidase family M13 protein [Ajellomyces caps...  52.4    2e-05
ref|XP_001952780.1|  PREDICTED: similar to AGAP002441-PA [Acyr...  52.4    2e-05 UniGene infoGene info
ref|XP_001947331.1|  PREDICTED: similar to neutral endopeptida...  52.4    2e-05 Gene info
ref|XP_001539079.1|  hypothetical protein HCAG_06684 [Ajellomy...  52.0    2e-05 Gene info
ref|XP_002065537.1|  GK14618 [Drosophila willistoni] >gb|EDW76...  52.0    3e-05 Gene info
gb|AAC03561.1|  putative zinc metallopeptidase precursor; MEP1...  52.0    3e-05
ref|XP_002415356.1|  endothelin-converting enzyme, putative [I...  51.6    3e-05 Gene info
ref|XP_001999081.1|  GI24316 [Drosophila mojavensis] >gb|EDW14...  51.6    3e-05 Gene info
ref|XP_001951427.1|  PREDICTED: similar to neutral endopeptida...  51.6    4e-05 Gene info
emb|CAA99352.1|  zinc metallopeptidase [Haemonchus contortus]      51.6    4e-05
ref|XP_002645291.1|  Hypothetical protein CBG00200 [Caenorhabd...  51.6    4e-05 Gene info
ref|XP_002479485.1|  endothelin-converting enzyme [Talaromyces...  51.6    4e-05 Gene info
ref|XP_001618093.1|  hypothetical protein NEMVEDRAFT_v1g9646 [...  51.6    4e-05 Gene info
ref|XP_002042996.1|  GM16367 [Drosophila sechellia] >gb|EDW491...  51.6    4e-05 Gene info
ref|XP_001981423.1|  GG11619 [Drosophila erecta] >gb|EDV53293....  51.6    4e-05 Gene info
ref|ZP_01811993.1|  peptidase, M13 family protein [Vibrionales...  51.2    4e-05
ref|XP_002072046.1|  GK22638 [Drosophila willistoni] >gb|EDW83...  51.2    4e-05 Gene info
ref|XP_002136954.1|  GA26947 [Drosophila pseudoobscura pseudoo...  50.8    5e-05 Gene info
ref|XP_001358250.2|  GA18951 [Drosophila pseudoobscura pseudoo...  50.8    6e-05 Gene info
gb|AAZ91348.1|  Hypothetical protein F39E9.4 [Caenorhabditis e...  50.4    7e-05
ref|XP_002411097.1|  endothelin-converting enzyme, putative [I...  50.4    7e-05 Gene info
ref|XP_001954700.1|  GF18401 [Drosophila ananassae] >gb|EDV432...  50.4    7e-05 Gene info
gb|AAG29105.1|AF273705_1  zinc metallopeptidase 2 MEP2 [Ancylo...  50.1    9e-05
ref|XP_002012966.1|  GL23645 [Drosophila persimilis] >gb|EDW23...  50.1    9e-05 Gene info
ref|XP_002143184.1|  endothelin-converting enzyme [Penicillium...  50.1    9e-05 Gene info
ref|XP_382924.1|  hypothetical protein FG02748.1 [Gibberella z...  50.1    1e-04 Gene info
ref|XP_002399889.1|  endothelin-converting enzyme, putative [I...  50.1    1e-04 Gene info
ref|XP_001981424.1|  GG11618 [Drosophila erecta] >gb|EDV53294....  49.7    1e-04 Gene info
ref|NP_651603.1|  CG5527 [Drosophila melanogaster] >gb|AAF5676...  49.7    1e-04 UniGene infoGene info
ref|XP_002413259.1|  neprilysin, putative [Ixodes scapularis] ...  49.7    1e-04 Gene info
ref|XP_002105208.1|  GD21361 [Drosophila simulans] >gb|EDX1471...  49.7    1e-04 Gene info
gb|AAY55188.1|  IP13936p [Drosophila melanogaster]                 49.7    1e-04
ref|XP_001599983.1|  PREDICTED: similar to neprilysin-like pro...  49.3    2e-04 UniGene infoGene info
ref|XP_002413587.1|  endothelin-converting enzyme, putative [I...  49.3    2e-04 Gene info
ref|XP_002434314.1|  neprilysin, putative [Ixodes scapularis] ...  48.9    2e-04 Gene info
ref|XP_001962888.1|  GF15663 [Drosophila ananassae] >gb|EDV321...  48.5    3e-04 Gene info
ref|XP_001903522.1|  unnamed protein product [Podospora anseri...  48.5    3e-04 Gene info
ref|NP_496842.1|  hypothetical protein F54F11.2 [Caenorhabditi...  48.5    3e-04 UniGene infoGene info
ref|XP_002400890.1|  endothelin-converting enzyme, putative [I...  48.5    3e-04 Gene info
gb|AAQ75757.1|  zinc metallopeptidase 7 [Ancylostoma ceylanicum]   48.1    4e-04
ref|XP_001228534.1|  hypothetical protein CHGG_10607 [Chaetomi...  48.1    4e-04 Gene info
ref|XP_002413364.1|  neprilysin, putative [Ixodes scapularis] ...  47.8    5e-04 Gene info
ref|XP_002433213.1|  zinc metalloprotease, putative [Pediculus...  47.4    6e-04 Gene info
gb|AAQ75756.1|  zinc metallopeptidase 6 [Ancylostoma ceylanicum]   47.4    6e-04
ref|XP_002411400.1|  neprilysin, putative [Ixodes scapularis] ...  47.0    8e-04 Gene info
gb|AAC31568.1|  putative zinc metallopeptidase [Haemonchus con...  47.0    9e-04
ref|XP_002098666.1|  GE23806 [Drosophila yakuba] >gb|EDW98378....  47.0    0.001 Gene info
ref|XP_001599905.1|  PREDICTED: similar to neutral endopeptida...  46.6    0.001 UniGene infoGene info
gb|AAG29103.2|AF273084_1  zinc metallopeptidase 1 [Ancylostoma...  46.2    0.001
ref|XP_002406712.1|  acetylcholinesterase, putative [Ixodes sc...  45.8    0.002 Gene info
ref|NP_001022540.1|  hypothetical protein ZK970.1 [Caenorhabdi...  45.8    0.002 UniGene infoGene info
ref|XP_001625514.1|  predicted protein [Nematostella vectensis...  45.8    0.002 UniGene infoGene info
ref|YP_561915.1|  putative peptidase M13 family protein [Shewa...  45.8    0.002 Gene info
ref|NP_001022539.1|  hypothetical protein ZK970.1 [Caenorhabdi...  45.8    0.002 Gene info
ref|XP_002629854.1|  Hypothetical protein CBG20236 [Caenorhabd...  45.4    0.002 Gene info
ref|NP_651641.1|  CG14529 [Drosophila melanogaster] >gb|AAF568...  45.4    0.003 UniGene infoGene info
ref|XP_783448.2|  PREDICTED: similar to endothelin converting ...  45.4    0.003 Gene info
ref|XP_001182069.1|  PREDICTED: similar to endothelin-converti...  45.1    0.003 Gene info
ref|XP_002001409.1|  GI10776 [Drosophila mojavensis] >gb|EDW16...  45.1    0.003 Gene info
ref|XP_002435699.1|  endothelin-converting enzyme, putative [I...  45.1    0.003 Gene info
ref|XP_002400967.1|  neprilysin, putative [Ixodes scapularis] ...  44.7    0.004 Gene info
ref|XP_002168946.1|  PREDICTED: similar to predicted protein, ...  44.7    0.004 Gene info
ref|XP_001122158.1|  PREDICTED: similar to mel transforming on...  44.7    0.004 UniGene infoGene info
ref|XP_001628087.1|  predicted protein [Nematostella vectensis...  44.7    0.005 Gene info
ref|XP_002409534.1|  endothelin-converting enzyme, putative [I...  44.3    0.005 Gene info
gb|EEY15841.1|  neprilysin-1 [Verticillium albo-atrum VaMs.102]    44.3    0.005
ref|XP_002416067.1|  endothelin-converting enzyme, putative [I...  44.3    0.006 Gene info
ref|NP_509528.1|  hypothetical protein T25B6.2 [Caenorhabditis...  43.9    0.007 UniGene infoGene info
ref|XP_002414910.1|  endothelin-converting enzyme, putative [I...  43.9    0.007 Gene info
ref|XP_002631588.1|  Hypothetical protein CBG20766 [Caenorhabd...  43.9    0.008 Gene info
ref|XP_002020198.1|  GL13855 [Drosophila persimilis] >gb|EDW39...  43.5    0.009 Gene info
ref|NP_494533.2|  hypothetical protein F18A12.4 [Caenorhabditi...  43.5    0.009 UniGene infoGene info
ref|XP_002136953.1|  GA26946 [Drosophila pseudoobscura pseudoo...  43.5    0.010 Gene info
ref|XP_002577782.1|  family M13 unassigned peptidase (M13 fami...  43.1    0.011 UniGene infoGene info
ref|XP_002416301.1|  neprilysin, putative [Ixodes scapularis] ...  42.7    0.016 Gene info
ref|XP_002158904.1|  PREDICTED: similar to predicted protein, ...  42.7    0.018 Gene info
ref|XP_002433869.1|  conserved hypothetical protein [Ixodes sc...  42.4    0.018 Gene info
ref|XP_974287.2|  PREDICTED: similar to endothelin converting ...  42.4    0.019 Gene info
ref|XP_002413251.1|  endothelin-converting enzyme, putative [I...  42.4    0.022 Gene info
ref|YP_142873.1|  putative peptidase, unknown [Acanthamoeba po...  42.4    0.023 Gene info
ref|XP_002599559.1|  hypothetical protein BRAFLDRAFT_121777 [B...  41.6    0.030 Gene info
ref|XP_973730.1|  PREDICTED: similar to endothelin-converting ...  41.6    0.030 UniGene infoGene info
ref|XP_001732592.1|  hypothetical protein MGL_0367 [Malassezia...  41.2    0.040 Gene info
ref|XP_001953875.1|  GF17015 [Drosophila ananassae] >gb|EDV424...  40.8    0.052 Gene info
ref|XP_001993937.1|  GH18312 [Drosophila grimshawi] >gb|EDV946...  40.8    0.055 Gene info
ref|XP_002411303.1|  endothelin-converting enzyme, putative [I...  40.4    0.077 Gene info
ref|ZP_02873940.1|  metallopeptidase [candidate division TM7 s...  40.4    0.087
ref|XP_002606246.1|  hypothetical protein BRAFLDRAFT_84013 [Br...  40.0    0.094 Gene info
ref|NP_494531.2|  hypothetical protein F18A12.5 [Caenorhabditi...  40.0    0.11  UniGene infoGene info
ref|XP_002058371.1|  GJ14375 [Drosophila virilis] >gb|EDW58339...  39.3    0.16  Gene info
ref|XP_002407376.1|  endothelin-converting enzyme, putative [I...  39.3    0.17  Gene info
ref|XP_002011504.1|  GI11063 [Drosophila mojavensis] >gb|EDW05...  38.9    0.23  Gene info
gb|AAC28740.1|  putative zinc metallopeptidase [Haemonchus con...  38.5    0.26 
ref|XP_002433347.1|  hypothetical protein IscW_ISCW000249 [Ixo...  38.5    0.29  Gene info
ref|XP_002088192.1|  GE18448 [Drosophila yakuba] >gb|EDW87904....  38.1    0.38  Gene info
ref|XP_002002658.1|  GI11574 [Drosophila mojavensis] >gb|EDW12...  38.1    0.43  Gene info
gb|AAL13495.1|  GH01974p [Drosophila melanogaster]                 37.7    0.49 
ref|NP_651098.2|  CG4721 [Drosophila melanogaster] >gb|AAF5606...  37.7    0.49  UniGene infoGene info
ref|XP_002032268.1|  GM23611 [Drosophila sechellia] >gb|EDW432...  37.7    0.52  Gene info
ref|XP_002104486.1|  GD18421 [Drosophila simulans] >gb|EDX1398...  37.7    0.53  Gene info
ref|NP_494530.1|  hypothetical protein T06D4.4 [Caenorhabditis...  37.7    0.56  UniGene infoGene info
ref|XP_002112169.1|  hypothetical protein TRIADDRAFT_55930 [Tr...  37.4    0.60  Gene info
ref|XP_001980781.1|  GG17004 [Drosophila erecta] >gb|EDV49739....  37.4    0.61  Gene info
ref|NP_001082818.1|  phosphate regulating gene with homologues...  37.0    0.76  UniGene infoGene info
ref|XP_001992089.1|  GH24402 [Drosophila grimshawi] >gb|EDV917...  37.0    0.77  Gene info
ref|XP_002415818.1|  neprilysin, putative [Ixodes scapularis] ...  37.0    0.81  Gene info
ref|XP_002405332.1|  endothelin-converting enzyme, putative [I...  37.0    0.95  Gene info
emb|CAA76114.1|  metallopeptidase [Rattus norvegicus]              37.0    0.95  Gene info
ref|XP_002630818.1|  Hypothetical protein CBG02520 [Caenorhabd...  36.6    0.99  Gene info
ref|XP_002065265.1|  GK15358 [Drosophila willistoni] >gb|EDW76...  36.6    1.2   Gene info
ref|XP_001605127.1|  PREDICTED: similar to nuclear pore comple...  36.6    1.2   UniGene infoGene info
ref|XP_002098350.1|  GE24002 [Drosophila yakuba] >gb|EDW98062....  36.2    1.5   Gene info
ref|XP_002069623.1|  GK11619 [Drosophila willistoni] >gb|EDW80...  36.2    1.5   Gene info
ref|XP_001982218.1|  GG12480 [Drosophila erecta] >gb|EDV54088....  36.2    1.5   Gene info
ref|ZP_04677868.1|  cca-adding enzyme [Staphylococcus warneri ...  36.2    1.5  
ref|XP_001770202.1|  predicted protein [Physcomitrella patens ...  36.2    1.6   UniGene infoGene info
emb|CAX82871.1|  Endothelin-converting enzyme [Schistosoma jap...  35.8    1.7  
ref|NP_609023.3|  CG42370 [Drosophila melanogaster] >gb|AAF523...  35.8    1.7   UniGene infoGene info
gb|ACN40231.1|  unknown [Picea sitchensis]                         35.8    1.7  
ref|XP_002414313.1|  conserved hypothetical protein [Ixodes sc...  35.8    1.9   Gene info
ref|XP_002038090.1|  GM17944 [Drosophila sechellia] >gb|EDW545...  35.8    1.9   Gene info
ref|XP_002078365.1|  GD22581 [Drosophila simulans] >gb|EDX0395...  35.8    1.9   Gene info
ref|XP_002411966.1|  neprilysin, putative [Ixodes scapularis] ...  35.4    2.2   Gene info
ref|XP_002027596.1|  GL22967 [Drosophila persimilis] >gb|EDW36...  35.4    2.2   Gene info
ref|XP_001354443.2|  GA17680 [Drosophila pseudoobscura pseudoo...  35.4    2.3   Gene info
ref|XP_002401528.1|  conserved hypothetical protein [Ixodes sc...  35.4    2.3   Gene info
ref|XP_001954483.1|  GF18283 [Drosophila ananassae] >gb|EDV430...  35.4    2.4   Gene info
ref|XP_002409898.1|  neprilysin, putative [Ixodes scapularis] ...  35.4    2.6   Gene info
ref|XP_002002661.1|  GI17505 [Drosophila mojavensis] >gb|EDW12...  35.4    2.8   Gene info
ref|XP_873331.2|  PREDICTED: similar to Protein Shroom2 (Apica...  35.0    3.0   UniGene infoGene info
ref|XP_002410243.1|  endothelin-converting enzyme, putative [I...  35.0    3.0   Gene info
ref|XP_002096983.1|  GE25972 [Drosophila yakuba] >gb|EDW96695....  35.0    3.1   Gene info
ref|NP_509680.1|  hypothetical protein F19C6.4 [Caenorhabditis...  34.7    3.9   UniGene infoGene info
ref|XP_002433926.1|  hypothetical protein IscW_ISCW003765 [Ixo...  34.7    4.1   Gene info
ref|NP_001123135.1|  hypothetical protein F19C6.4 [Caenorhabdi...  34.3    4.9   Gene info
ref|XP_002406851.1|  neprilysin, putative [Ixodes scapularis] ...  34.3    5.4   Gene info
ref|XP_002415016.1|  endothelin-converting enzyme, putative [I...  34.3    6.1   Gene info
ref|ZP_05027833.1|  RNase H, putative [Microcoleus chthonoplas...  33.9    6.5  
ref|XP_001978341.1|  GG17740 [Drosophila erecta] >gb|EDV47268....  33.9    6.6   Gene info
ref|NP_500348.1|  hypothetical protein F09D12.2 [Caenorhabditi...  33.9    7.3   UniGene infoGene info
ref|XP_002100390.1|  GE17029 [Drosophila yakuba] >gb|EDX01498....  33.9    8.0   Gene info
ref|XP_002415488.1|  endothelin-converting enzyme, putative [I...  33.5    8.3   Gene info
ref|XP_002577789.1|  family M13 unassigned peptidase (M13 fami...  33.5    8.5   Gene info
ref|ZP_05634654.1|  hypothetical protein FulcA4_14556 [Fusobac...  33.5    8.6  
ref|XP_002414686.1|  endothelin-converting enzyme, putative [I...  33.5    8.8   Gene info
emb|CAX74956.1|  Endothelin-converting enzyme 1 [Schistosoma j...  33.5    9.3  
ref|XP_002607260.1|  hypothetical protein BRAFLDRAFT_88208 [Br...  33.5    9.3   Gene info
ref|NP_503005.2|  hypothetical protein Y116A8C.5 [Caenorhabdit...  33.5    9.3   UniGene infoGene info
ref|ZP_04859986.1|  extracellular solute-binding protein [Fuso...  33.5    9.8  

>ref|YP_003309260.1| Gene info Endothelin-converting enzyme 1 [Sebaldella termitidis ATCC 33386]
 gb|ACZ09329.1| Gene info Endothelin-converting enzyme 1 [Sebaldella termitidis ATCC 33386]
Length=654

 GENE ID: 8597940 Sterm_2476 | Endothelin-converting enzyme 1
[Sebaldella termitidis ATCC 33386]

 Score =  111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 93/160 (58%), Gaps = 11/160 (6%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRDGIIF  74
            IG  IGHE++H+ DD GSKFDE GNL DWWT  DRKN+ K+ + + KQY  +   DG + 
Sbjct  496  IGAVIGHEITHAFDDEGSKFDEMGNLKDWWTREDRKNYEKRTEALAKQYSRYKSGDGKL-  554

Query  75   DATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLAQMYMNLAVQARQQIYKNA  134
            +  +++GE++AD+ G++      +  +++N+E +     NL + +   AV  R  + K  
Sbjct  555  NGKLTLGENIADLGGVS------VALEIVNNENSD----NLEEFFEAYAVIWRNLVTKER  604

Query  135  IKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMW  174
                +K +PH   +YR N  L  ++ F  +Y ++  DGM+
Sbjct  605  ESYLVKIDPHSPGRYRVNGILTNIDDFYKVYNVRSSDGMY  644


>ref|ZP_02949882.1|  neutral endopeptidase [Clostridium butyricum 5521]
 ref|ZP_04526600.1|  endothelin-converting enzyme 1 [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EDT75090.1|  neutral endopeptidase [Clostridium butyricum 5521]
 gb|EEP55369.1|  endothelin-converting enzyme 1 [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=681

 Score =  109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 92/167 (55%), Gaps = 12/167 (7%)

Query  9    EYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAK  68
            E NL  IG  IGHEL+H+ D++GS+FDE G L+DWWT SD K F ++ K VI  Y     
Sbjct  516  EKNLGGIGAVIGHELTHAFDNVGSQFDEDGQLNDWWTESDYKEFTERSKKVIDYYSNIEV  575

Query  69   RDGIIFDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLAQMYMNLAVQARQ  128
             +G   +  ++VGE+++D+ G+A +    ID         K+   NL  ++ N A   R 
Sbjct  576  ENGKFVNGALTVGENISDLGGIACV----ID------IAKKIDGYNLKDLFENYAAIWR-  624

Query  129  QIYKNAIKAQLKTN-PHPLEKYRTNCTLARLELFKTIYGIKKGDGMW  174
            ++    IK  L  N PH  +K R N  L++ E F   YGIK GD M+
Sbjct  625  EVSTTEIKDYLLNNDPHAPKKVRVNGVLSQFEEFYKTYGIKPGDKMY  671


>ref|ZP_04028615.1|  predicted metalloendopeptidase [Tsukamurella paurometabola DSM 
20162]
 gb|EEJ99222.1|  predicted metalloendopeptidase [Tsukamurella paurometabola DSM 
20162]
Length=697

 Score =  107 bits (266),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 56/179 (31%), Positives = 93/179 (51%), Gaps = 19/179 (10%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETF---AKRDG  71
            IG  IGHE+ H+ DD GSK+D  GNL DWW P+DR  F+K+ K +I QY T        G
Sbjct  509  IGAVIGHEIGHAFDDSGSKYDGDGNLKDWWAPADRAEFDKRTKALIAQYNTLVPIGAAPG  568

Query  72   IIFDATMSVGEDLADISGMAL-IEAYLIDNQVINSETN---------------KLKKINL  115
               +  M+VGE+LAD+ G+ + +EA+ +  +  ++ T                + +   L
Sbjct  569  STVNGAMTVGENLADLGGLGIAVEAFRLAVKNRDAGTEFADQSGSATPSASGPQAENAAL  628

Query  116  AQMYMNLAVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMW  174
              ++++ A   + +    A++  L T  H   ++RTN  +  ++ F   +G++ GDG W
Sbjct  629  VPLFLSYARSWQNKTRPEAVRESLATAMHAPPEFRTNQVVKNVDTFADTFGVRPGDGEW  687


>ref|ZP_05126103.1|  peptidase, M13 (neprilysin) family [gamma proteobacterium NOR5-3]
 gb|EED32650.1|  peptidase, M13 (neprilysin) family [gamma proteobacterium NOR5-3]
Length=639

 Score =  105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 93/167 (55%), Gaps = 4/167 (2%)

Query  10   YNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKR  69
            +N   IG TIGHE+ H  DD GSKFD  GNL  WWT +DR  F K+ + +++Q+  +  +
Sbjct  464  FNYGTIGATIGHEIGHGFDDQGSKFDGDGNLVSWWTDTDRTEFEKRTRGLVEQFNAYEVK  523

Query  70   DGIIFDATMSVGEDLADISGMAL-IEAYLIDNQVINSETNKLKKINLAQ-MYMNLAVQAR  127
             G+  +  +++GE++ D+ G A+ ++AY +  Q    E   +      Q  ++  A  +R
Sbjct  524  PGLRVNGELTLGENIGDLGGTAIALKAYRMSLQ--GKEAPVIDGFTAEQRFFLGTAQSSR  581

Query  128  QQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMW  174
             +     ++  +KT+PH  +  R N  L+ +  F + Y +++GDG++
Sbjct  582  VKWRDQFLEKLIKTDPHAPDVVRVNGVLSNIPAFYSAYDVQEGDGLY  628


>ref|YP_921363.1| Gene info endothelin-converting protein 1 [Nocardioides sp. JS614]
 gb|ABL79676.1| Gene info Endothelin-converting enzyme 1 [Nocardioides sp. JS614]
Length=649

 GENE ID: 4597580 Noca_0131 | endothelin-converting protein 1
[Nocardioides sp. JS614]

 Score =  105 bits (261),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 60/173 (34%), Positives = 93/173 (53%), Gaps = 13/173 (7%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRD--GI  72
            IG  IGHE+ H  DD G+++D  GNLHDWWTP D+  F  K K +I+QY+ F  R   G 
Sbjct  484  IGAVIGHEIGHGFDDQGAQYDGSGNLHDWWTPDDKAAFEVKSKALIEQYDGFEPRTLPGE  543

Query  73   IFDATMSVGEDLADISGMALIE-AYLIDNQVINSETNKLKKINLAQMYMNLAVQARQQIY  131
              +  ++VGE++ D+ G+ +   AYLI      S  ++ K      +++N A   R +  
Sbjct  544  RVNGALTVGENIGDLGGLTIGHTAYLIARGGSASVEDRQK------VFLNWAYCWRTKRR  597

Query  132  KNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMWWNNDT---IW  181
            K   +  L  +PH   ++R N  +  L+ F  ++G  +GDG+W + D    IW
Sbjct  598  KEQEQQYLTIDPHSPAEFRAN-IVRNLDEFHEVFGTVEGDGLWLDPDQRVRIW  649


-Blastp vs SWISSPROT:


Sequences producing significant alignments:                       (Bits)  Value

sp|O52071.1|PEPO_LACHE  RecName: Full=Neutral endopeptidase; A...  95.1    2e-19
sp|P78562.1|PHEX_HUMAN  RecName: Full=Phosphate-regulating neu...  73.9    4e-13 Gene info
sp|P70669.1|PHEX_MOUSE  RecName: Full=Metalloendopeptidase hom...  73.6    6e-13 Gene info
sp|O16796.2|NEPL2_CAEEL  RecName: Full=Neprilysin-2                71.6    2e-12 Gene info
sp|Q9JHL3.1|ECEL1_RAT  RecName: Full=Endothelin-converting enz...  70.1    6e-12 Gene info
sp|Q9JMI0.1|ECEL1_MOUSE  RecName: Full=Endothelin-converting e...  69.7    8e-12 Gene info
sp|O95672.3|ECEL1_HUMAN  RecName: Full=Endothelin-converting e...  69.3    1e-11 Gene info
sp|Q18673.3|NEPL1_CAEEL  RecName: Full=Neprilysin-1                68.9    2e-11 Gene info
sp|Q22523.2|YCYL_CAEEL  RecName: Full=Putative zinc metallopro...  67.4    4e-11 Gene info
sp|Q9JLI3.1|MMEL1_MOUSE  RecName: Full=Membrane metallo-endope...  65.9    1e-10 Gene info
sp|Q07744.3|PEPO_LACLA  RecName: Full=Neutral endopeptidase; A...  65.1    2e-10
sp|P0C2B4.2|PEPO_LACLC  RecName: Full=Neutral endopeptidase; A...  64.3    3e-10
sp|P42891.2|ECE1_BOVIN  RecName: Full=Endothelin-converting en...  63.5    6e-10 Gene info
sp|P42893.2|ECE1_RAT  RecName: Full=Endothelin-converting enzy...  62.8    9e-10 Gene info
sp|P42359.1|YSC6_STRGC  RecName: Full=Putative zinc metallopro...  62.8    9e-10
sp|Q4PZA2.1|ECE1_MOUSE  RecName: Full=Endothelin-converting en...  62.4    1e-09 Gene info
sp|P42892.2|ECE1_HUMAN  RecName: Full=Endothelin-converting en...  62.0    2e-09 Gene info
sp|Q495T6.2|MMEL1_HUMAN  RecName: Full=Membrane metallo-endope...  62.0    2e-09 Gene info
sp|P97739.1|ECE1_CAVPO  RecName: Full=Endothelin-converting en...  61.2    3e-09
sp|P08473.2|NEP_HUMAN  RecName: Full=Neprilysin; AltName: Full...  60.5    5e-09 Gene info
sp|Q5RE69.2|NEP_PONAB  RecName: Full=Neprilysin; AltName: Full...  60.5    6e-09 Gene info
sp|P0C1T0.1|MMEL1_RAT  RecName: Full=Membrane metallo-endopept...  59.7    8e-09 Gene info
sp|Q61391.3|NEP_MOUSE  RecName: Full=Neprilysin; AltName: Full...  58.5    2e-08 Gene info
sp|P08049.2|NEP_RABIT  RecName: Full=Neprilysin; AltName: Full...  58.2    2e-08 Gene info
sp|Q10711.2|ECE2_BOVIN  RecName: Full=Endothelin-converting en...  57.8    3e-08 Gene info
sp|P07861.2|NEP_RAT  RecName: Full=Neprilysin; AltName: Full=N...  57.8    3e-08 Gene info
sp|O60344.4|ECE2_HUMAN  RecName: Full=Endothelin-converting en...  57.0    6e-08 Gene info
sp|Q80Z60.2|ECE2_MOUSE  RecName: Full=Endothelin-converting en...  53.5    6e-07 Gene info
sp|Q5UQ76.1|YR519_MIMIV  RecName: Full=Putative zinc metallopr...  42.4    0.002 Gene info
sp|P48582.1|BRO1_YEAST  RecName: Full=Vacuolar-sorting protein...  32.3    1.5  
sp|Q3JE53.1|RUVX_NITOC  RecName: Full=Putative Holliday juncti...  32.0    1.9   Gene info
sp|Q5ZYH5.1|RIMM_LEGPH  RecName: Full=Ribosome maturation fact...  32.0    2.0   Gene info
sp|Q7TP36.1|SHRM2_RAT  RecName: Full=Protein Shroom2; AltName:...  30.8    4.0   Gene info
sp|Q13796.1|SHRM2_HUMAN  RecName: Full=Protein Shroom2; AltNam...  30.8    4.0   Gene info
sp|Q96J92.1|WNK4_HUMAN  RecName: Full=Serine/threonine-protein...  30.4    5.1   Gene info
sp|Q2KUU2.1|MTGA_BORA1  RecName: Full=Monofunctional biosynthe...  30.4    5.6   Gene info
sp|Q2S433.1|ATPD_SALRD  RecName: Full=ATP synthase subunit del...  30.4    6.4  
sp|Q7TPK6.3|WNK4_RAT  RecName: Full=Serine/threonine-protein k...  30.0    7.1   Gene info
sp|Q5RAB8.1|FARP1_PONAB  RecName: Full=FERM, RhoGEF and plecks...  30.0    7.2   Gene info
sp|C5C6R3.1|RL28_MICLC  RecName: Full=50S ribosomal protein L28    29.6    8.5  
sp|A6VUU9.1|ENO_MARMS  RecName: Full=Enolase; AltName: Full=2-...  29.6    9.9   Gene info
sp|Q80UE6.1|WNK4_MOUSE  RecName: Full=Serine/threonine-protein...  29.6    9.9   Gene info

Alignments Select All Get selected sequences Distance tree of results Multiple alignment New

>sp|O52071.1|PEPO_LACHE  RecName: Full=Neutral endopeptidase; AltName: Full=Endopeptidase 
O
Length=647

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 92/179 (51%), Gaps = 17/179 (9%)

Query  6    RGLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYET  65
            RG  Y    IG TIGHE+SH+ D+ G+KFDE GN+++WWT  D   FNK++  ++  ++ 
Sbjct  483  RGANYG--GIGATIGHEVSHAFDNSGAKFDEHGNMNNWWTDEDFAEFNKRVGQMVDIFDG  540

Query  66   FAKRDGIIFDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLAQMYMNLAVQ  125
                   I +    VGE++AD++G+A              +  K   ++L  ++ N A  
Sbjct  541  LQYGPAKI-NGKQVVGENIADLAGLACA-----------VQAGKNDNVDLKDLFENYARS  588

Query  126  ARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGMWWNND---TIW  181
              Q+    AIK +++ + H  +  R N  +   + F T + +K  DGMW + +   TIW
Sbjct  589  WMQKQRPEAIKTEVQVDVHAPQPTRVNIPVQCQDDFYTAFDVKPDDGMWLDPEDRITIW  647


>sp|P78562.1|PHEX_HUMAN Gene info RecName: Full=Phosphate-regulating neutral endopeptidase; AltName: 
Full=Metalloendopeptidase homolog PEX; AltName: Full=X-linked 
hypophosphatemia protein; Short=HYP; AltName: Full=Vitamin 
D-resistant hypophosphatemic rickets protein
Length=749

 GENE ID: 5251 PHEX | phosphate regulating endopeptidase homolog, X-linked
[Homo sapiens] (Over 10 PubMed links)

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 81/177 (45%), Gaps = 13/177 (7%)

Query  6    RGLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYET  65
            R L Y    IG  +GHE +H  D+ G K+D+ GNL  WW+    + F +K K +I QY  
Sbjct  567  RSLSYGA--IGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSTESEEKFKEKTKCMINQYSN  624

Query  66   FA-KRDGIIFDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLA-------Q  117
            +  K+ G+      ++GE++AD  G  L EA+    + IN     L++  L        Q
Sbjct  625  YYWKKAGLNVKGKRTLGENIADNGG--LREAFRAYRKWINDRRQGLEEPLLPGITFTNNQ  682

Query  118  MYMNLAVQARQQIYK-NAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGM  173
            ++       R   Y+  A + Q++   H   ++R N  ++  E F+  +       M
Sbjct  683  LFFLSYAHVRCNSYRPEAAREQVQIGAHSPPQFRVNGAISNFEEFQKAFNCPPNSTM  739


>sp|P70669.1|PHEX_MOUSE Gene info RecName: Full=Metalloendopeptidase homolog PEX; AltName: Full=Phosphate 
regulating neutral endopeptidase; AltName: Full=X-linked 
hypophosphatemia protein; Short=HYP; AltName: Full=Vitamin 
D-resistant hypophosphatemic rickets protein
Length=749

 GENE ID: 18675 Phex | phosphate regulating gene with homologies to
endopeptidases on the X chromosome (hypophosphatemia, vitamin D resistant
rickets) [Mus musculus] (Over 100 PubMed links)

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query  6    RGLEYNLVYIGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYET  65
            R L Y    IG  +GHE +H  D+ G K+D+ GNL  WW+    + F +K K +I QY  
Sbjct  567  RSLSYGA--IGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSVESEEKFKEKTKCMINQYSN  624

Query  66   FA-KRDGIIFDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLA-------Q  117
            +  K+ G+      ++GE++AD  G  L EA+    + IN     +++  L        Q
Sbjct  625  YYWKKAGLNVKGKRTLGENIADNGG--LREAFRAYRKWINDRRQGVEEPLLPGITFTNNQ  682

Query  118  MYMNLAVQARQQIYK-NAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGM  173
            ++       R   Y+  A + Q++   H   ++R N  ++  E F+  +   +   M
Sbjct  683  LFFLSYAHVRCNSYRPEAAREQVQIGAHSPPQFRVNGAISNFEEFQKAFNCPRNSTM  739


>sp|O16796.2|NEPL2_CAEEL Gene info RecName: Full=Neprilysin-2
Length=848

 GENE ID: 173685 peptidase | hypothetical protein [Caenorhabditis elegans]

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 83/165 (50%), Gaps = 23/165 (13%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFA-KRDGII  73
            IG  IGHE++H  DD GS++D+ GNLH+WW+ S   +F+ + + +++QY  +   +    
Sbjct  676  IGAVIGHEITHGFDDQGSQYDKDGNLHNWWSESSLNSFDTRRRCIVEQYGNYTVPKTNFR  735

Query  74   FDATMSVGEDLADISGMALIEAYLIDNQVINSETNKLKKINLAQMYMNLAVQARQQIY--  131
             +  ++ GE++AD  G+   EA+    + + +E  +  ++   Q Y N      +QI+  
Sbjct  736  VNGKLTQGENIADNGGVK--EAFQAYQKYV-TENGEEPRLPGLQQYTN------EQIFFV  786

Query  132  -----------KNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIY  165
                       + A   Q+ T+ H  E +R    L+ ++ F  +Y
Sbjct  787  SYAHFWCGKKKEAAAMQQVLTDEHSPEVFRVIGVLSNMQAFADVY  831


>sp|Q9JHL3.1|ECEL1_RAT Gene info RecName: Full=Endothelin-converting enzyme-like 1; AltName: Full=Xce 
protein; AltName: Full=Damage-induced neuronal endopeptidase
Length=775

 GENE ID: 60417 Ecel1 | endothelin converting enzyme-like 1 [Rattus norvegicus]
(10 or fewer PubMed links)

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 22/171 (12%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRDGIIF  74
            IG  IGHEL+H  DD G ++D  GNL  WWT +    F  K + +++ Y+ F   +  + 
Sbjct  606  IGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLHKAECIVRLYDNFTVYNQRV-  664

Query  75   DATMSVGEDLADISGMALIEAYLIDNQVINSET------------NKLKKINLAQMYMNL  122
            +   ++GE++AD+ G+ L  AY    + +                N+L  I  AQ   N 
Sbjct  665  NGKHTLGENIADMGGLKL--AYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQ---NW  719

Query  123  AVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGM  173
             ++ R Q    +I  Q+ T+ H  E YR   ++++ E F   +   K   M
Sbjct  720  CIKRRSQ----SIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPM  766


>sp|Q9JMI0.1|ECEL1_MOUSE Gene info RecName: Full=Endothelin-converting enzyme-like 1; AltName: Full=Xce 
protein; AltName: Full=Damage-induced neuronal endopeptidase
Length=775

 GENE ID: 13599 Ecel1 | endothelin converting enzyme-like 1 [Mus musculus]
(Over 10 PubMed links)

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 22/171 (12%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRDGIIF  74
            IG  IGHEL+H  DD G ++D  GNL  WWT +    F  K + +++ Y+ F   +  + 
Sbjct  606  IGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLHKAECIVRLYDNFTVYNQRV-  664

Query  75   DATMSVGEDLADISGMALIEAYLIDNQVINSET------------NKLKKINLAQMYMNL  122
            +   ++GE++AD+ G+ L  AY    + +                N+L  I  AQ   N 
Sbjct  665  NGKHTLGENIADMGGLKL--AYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQ---NW  719

Query  123  AVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGM  173
             ++ R Q    +I  Q+ T+ H  E YR   ++++ E F   +   K   M
Sbjct  720  CIKRRSQ----SIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPM  766


>sp|O95672.3|ECEL1_HUMAN Gene info RecName: Full=Endothelin-converting enzyme-like 1; AltName: Full=Xce 
protein
Length=775

 GENE ID: 9427 ECEL1 | endothelin converting enzyme-like 1 [Homo sapiens]
(Over 10 PubMed links)

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 81/171 (47%), Gaps = 22/171 (12%)

Query  15   IGYTIGHELSHSLDDLGSKFDEKGNLHDWWTPSDRKNFNKKIKNVIKQYETFAKRDGIIF  74
            IG  IGHEL+H  DD G ++D  GNL  WWT +    F +K + +++ Y+ F   +  + 
Sbjct  606  IGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRV-  664

Query  75   DATMSVGEDLADISGMALIEAYLIDNQVINSET------------NKLKKINLAQMYMNL  122
            +   ++GE++AD+ G+ L  AY    + +                ++L  I  AQ   N 
Sbjct  665  NGKHTLGENIADMGGLKL--AYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQ---NW  719

Query  123  AVQARQQIYKNAIKAQLKTNPHPLEKYRTNCTLARLELFKTIYGIKKGDGM  173
             ++ R Q    +I  Q+ T+ H  E YR   ++++ E F   +   K   M
Sbjct  720  CIKRRSQ----SIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPM  766
Personal tools