GOS 1106030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574884
Annotathon code: GOS_1106030
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : morin
Annotated on : 2010-01-17 18:03:45
  • MORIN Stéphanie
  • RODRIGUEZ Rémy

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_1093025574884 GOS_1106030 Genomic DNA
AAATATCAATGCTTAAAAAAATAATAGTTTATGGCAAATTAAGAAAATTTTTAGGTCAAAAAGAATTTGAAGTTGATTTAAATTCACCAGCAGAGGCATT
TAGTTTTTTATATTGCAATTTTAAAAATATACAAGAGCATATGGCAGAGCAATTATATGTAATAAAAGTTGGATCAAAAGTTATTACTGAAGATTTATTA
AATATACAAACAAAAGAAAATATAAAAATTATACCTGTTGTTCATGGTAATTTCTTTTCAATTGTTTTAGGTTTCGCTTTAAAATATGGTGCAAAAGAAT
ATATTAAAAATAAAATAATTCAAACAGTTGTTACCTATATTGGAACTACATTAATATTGCAAGGAGTTAATGAAATATTAGCACCACAAGAAAATACAAA
TCTTCCTACTGGACAGGATTCTTTAGACCCTTCTGCTCTTGCTTCTAATTATTCATTTACAGGACTTACTAATATTAGTAATGCAGGTGTTCCAATTAAT
TTAGTATATGGAGAAATACTGGTAGGCTCTATTGTGGTATCTAATGGTGTTGATACAGTTCAAGTAGAAGGAACAAATTAAATGGCTATACAAGAATTTA
ATCAAAATACAGTTTTTAATAATCCTGATTTACCTAGTGGTGCTTTATCGTCAAAACAATTTAATACAATTGTTGAACTTTTAGGTGAGGGAGAAATAGA
AGGTTCTGCCACTGCCTCAAAAGCTAATATTACTGATAAATCATCAACAGCATATAAAAATGCATTTTTAAAAGATGTTTTTTTAAATGGCACACAAATT
TTGCAAGAGGCTGCTAGTAATACATCTCCTGTTGATACTGATTTTAATTACAAAGATGTAGGGTTTGAATTTAGAACAGGTACAAGTACTCA

Translation

[9 - 578/892]   direct strand
>GOS_1106030 Translation [9-578   direct strand]
MLKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITEDLLNIQTKENIKIIPVVHGNFFSIVLGFALKYGAKEYIK
NKIIQTVVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYGEILVGSIVVSNGVDTVQVEGTN

Annotator commentaries

Nous avons mis en évidence une ORF de 190 acides aminés, complète en 3' et 5', comme montré par la présence de start et de stop, par l'analyse des homologues du blast et analyse de l'alignement multiple. Notre ORF possède un poids moléculaire de 20.89 kDa.


Notre ORF code pour un domaine protéique nommé Lambda_tail_I, cohérent selon toutes nos analyses. En effet, notre ORF et ses homologues trouvés par blast possède un domaine protéique similaire ("possible lambda tail protein I"), ce qui semble donc tout à fait cohérent.


A présent, concernant la taxonomie éventuelle de notre ORF, l'analyse de l'arbre phylogénétique nous montre que notre ORF appartient au groupe des proteobacteria. La séquence dont elle est la plus proche est une a-proteobacteria.

Cependant, l'éloignement entre notre ORF et son homologue le plus proche semble indiquer qu'il n'appartient pas à une a-proteobacteria donc ici on ne peut conclure plus précisément que les proteobacteria comme groupe d'appartenance taxonomique.


L'étude des fiches d'homologues ne fait apparaitre aucun processus biologique, ni de fonction moléculaire, ni même de symbole de gène.


Nous pouvons tout de même émettre une hypothèse quand à la fonction moléculaire de notre ORF: il pourrait s'agir d'une protéine virale impliquée dans la formation de la queue du phage lambda.

ORF finding

PROTOCOLE:


a) SMS/ ORF finder/ can begin with any codon/ 1,2 and 3 reading frame/ direct strand/ least 60 condons longs/ strandard genetic code.


b) SMS/ ORF finder/ can begin with any codon/ 1,2 and 3 reading frame/ reverse strand/ least 60 condons longs/ strandard genetic code.



ANALYSE DES RÉSULTATS:


Plusieurs ORFs ont été trouvés. Au total notre séquence contient 4 ORF putatifs.

La plupart sont incomplets en 5' et 3' et bien courts par rapport à celui que nous avons choisi.


En effet nous avons choisi l'ORF le plus long et le plus significatif qui se trouve en sens direct, dans le troisième cadre de lecture, de la base 3 à la base 581.

Il ne commence pas par une Met mais finit pas par un stop, on supposera qu'il est incomplet en 5' et complet en 3'.

Néanmoins, on notera la présence d'une méthionine en troisième position. L'alignement multiple montre que les homologues ont à peu près la même taille que notre ORF. Nous considèrerons la méthionine en position 3 comme le codon start.


Nous calculerons la masse moléculaire de cette protéine en supposant donc que celle-ci est complète en 5' comme en 3'.

RÉSULTATS BRUTS:


a) direct strand: 


Results for 892 residue sequence "GOS_1106030 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" starting "AAATATCAAT"

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 581.
ATATCAATGCTTAAAAAAATAATAGTTTATGGCAAATTAAGAAAATTTTTAGGTCAAAAA
GAATTTGAAGTTGATTTAAATTCACCAGCAGAGGCATTTAGTTTTTTATATTGCAATTTT
AAAAATATACAAGAGCATATGGCAGAGCAATTATATGTAATAAAAGTTGGATCAAAAGTT
ATTACTGAAGATTTATTAAATATACAAACAAAAGAAAATATAAAAATTATACCTGTTGTT
CATGGTAATTTCTTTTCAATTGTTTTAGGTTTCGCTTTAAAATATGGTGCAAAAGAATAT
ATTAAAAATAAAATAATTCAAACAGTTGTTACCTATATTGGAACTACATTAATATTGCAA
GGAGTTAATGAAATATTAGCACCACAAGAAAATACAAATCTTCCTACTGGACAGGATTCT
TTAGACCCTTCTGCTCTTGCTTCTAATTATTCATTTACAGGACTTACTAATATTAGTAAT
GCAGGTGTTCCAATTAATTTAGTATATGGAGAAATACTGGTAGGCTCTATTGTGGTATCT
AATGGTGTTGATACAGTTCAAGTAGAAGGAACAAATTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
ISMLKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKV
ITEDLLNIQTKENIKIIPVVHGNFFSIVLGFALKYGAKEYIKNKIIQTVVTYIGTTLILQ
GVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYGEILVGSIVVS
NGVDTVQVEGTN*

>ORF number 2 in reading frame 3 on the direct strand extends from base 582 to base 890.
ATGGCTATACAAGAATTTAATCAAAATACAGTTTTTAATAATCCTGATTTACCTAGTGGT
GCTTTATCGTCAAAACAATTTAATACAATTGTTGAACTTTTAGGTGAGGGAGAAATAGAA
GGTTCTGCCACTGCCTCAAAAGCTAATATTACTGATAAATCATCAACAGCATATAAAAAT
GCATTTTTAAAAGATGTTTTTTTAAATGGCACACAAATTTTGCAAGAGGCTGCTAGTAAT
ACATCTCCTGTTGATACTGATTTTAATTACAAAGATGTAGGGTTTGAATTTAGAACAGGT
ACAAGTACT

>Translation of ORF number 2 in reading frame 3 on the direct strand.
MAIQEFNQNTVFNNPDLPSGALSSKQFNTIVELLGEGEIEGSATASKANITDKSSTAYKN
AFLKDVFLNGTQILQEAASNTSPVDTDFNYKDVGFEFRTGTST


b) reverse strand:

Results for 892 residue sequence "GOS_1106030 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" starting "AAATATCAAT"

>ORF number 1 in reading frame 1 on the reverse strand extends from base 46 to base 291.
TTAAAATCAGTATCAACAGGAGATGTATTACTAGCAGCCTCTTGCAAAATTTGTGTGCCA
TTTAAAAAAACATCTTTTAAAAATGCATTTTTATATGCTGTTGATGATTTATCAGTAATA
TTAGCTTTTGAGGCAGTGGCAGAACCTTCTATTTCTCCCTCACCTAAAAGTTCAACAATT
GTATTAAATTGTTTTGACGATAAAGCACCACTAGGTAAATCAGGATTATTAAAAACTGTA
TTTTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LKSVSTGDVLLAASCKICVPFKKTSFKNAFLYAVDDLSVILAFEAVAEPSISPSPKSSTI
VLNCFDDKAPLGKSGLLKTVF*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 652 to base 837.
ACAACAGGTATAATTTTTATATTTTCTTTTGTTTGTATATTTAATAAATCTTCAGTAATA
ACTTTTGATCCAACTTTTATTACATATAATTGCTCTGCCATATGCTCTTGTATATTTTTA
AAATTGCAATATAAAAAACTAAATGCCTCTGCTGGTGAATTTAAATCAACTTCAAATTCT
TTTTGA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
TTGIIFIFSFVCIFNKSSVITFDPTFITYNCSAICSCIFLKLQYKKLNASAGEFKSTSNS
F*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:


phylogeny.fr/ méthode MUSCLE et importé au format Clustal



ANALYSE DES RÉSULTATS:


L'alignement multiple met en évidence trois domaines particulièrement conservés qui pourraient correspondre à des sites actifs. Ces régions conservées s'étendent quasiment sur la totalité de notre ORF qui est constituée de 190 acides aminés. Cela est donc en cohérence avec le domaine protéique trouvé sur INTERPRO qui lui aussi est situé sur la quasi totalité de notre ORF, des acides aminés 7 à 185.



Les séquences homologues sont de tailles semblables. Les positions semblables des méthionines des différentes séquences confirment notre hypothèse quant à la nature de codon start de la méthionine en position 3.

RÉSULTATS BRUTS:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


GOS_110603      ----------ISMLKKIIVYGKLRKFLGQKEFE--VDLNSPAEAFSFLYCNFKNIQEHMA
Alphapro1       ------------MMRTVRLYGSLAQKFGSS-FR--LDVRSLAEACRALGAQLPGFRQAIE
Gammapro6       -------------MAKITFHGDL-KRFSNQPFE--LEVSNFRELMSGLLTQIQGLREHLR
Gammapro10      -------------MARITFHGDL-KRFGNEPFE--LDVSNFRELMSGLLTQIQGLRNHLR
Gammapro1       -------------MIKVRFYGAL-KQFGEK-FE--LDCQDTAEVLRALMTQLKGLRQALQ
Gammapro2       -------------MTKIKFYGNL-KKFGSE-FS--LEVKDTAEAIRALCTQISGLREALR
Betaprot6       -------------MITVCLYGGL-REYGRR-FV--LHVETPAEALHALFTQIKGLRQRIR
Betaprot7       -------------MITVCLYGGL-RECGRR-FD--LQVASPAEAVHALTVQIPALRQKLR
Gammapro8       MATTDTLNMAAPAMVRICLYGDL-QRFGKR-IS--LSIKTAAEGIHALAIQLPGFRQRMN
Gammapro5       MAATHTLPLASPGMARICLYGDL-QRFGRR-ID--LRVKTGAEAIRALSTQLPAFRQKLN
Gammapro9       MAATHTLPLASPGMARICLYGDL-QRFGRR-ID--LRVKTGAEAIRALATQLPAFRQKLS
Gammapro7       -------------MRKIRLKGELGKRFGKV-HK--LAVKTPAEAIRALCVLKRGFKEFLL
Gammapro11      --------MDNNQCTIIKLSGSLAKKFGRE-HKRFLDTGTTTEAFSAIKNTVKGFEQFIK
Gammapro3       -----------MSLKTIQLYGVLGTQFGRE-HR--LAIDSPREAIKALSVLYDGFEQFLA
Gammapro4       -----------MSLKTIRLYGVLGAKFGRE-HK--LDIDSPREAIKALSVLYDGFEQFLA
Betaprot4       ------------------MYGKLGARFGRI-HR--LAVASAAEAVRALCALKPGFERELM
Betaprot5       ----------MTPLKTIRLYGKLGTRFGRI-HR--LAVASAAEAVRALCMTRPGFERELM
Betaprot3       ---------MTETLREVRLYGIAGVRFGRV-HR--LAVSSTAEAVRALSVLIPGFRKFLL
Betaprot1       ---------MDQKIRTVRLYGRLGARFGRV-FR--LAVGSPAEAVRALCAQVEDFRRELA
Betaprot2       ---------MEQRIRTVRLYGRLGARFGRV-FR--LAVGSPVEAVRALCVQVEGFRRELA
                                  . *      .       :      *    :      :   : 

GOS_110603      EQL-----YVIKVGSK-VI--TEDLL------NIQTKE--NIKIIPVVHGN-----FFSI
Alphapro1       DGR-----FRVTVGRSRRT--GWQLDKDLISFGLPEG---DLHIVPVIRARKSGLSVGKI
Gammapro6       NGY-----YKVRIGKN-YL--NNDQLQTNPMIGLDDKS--SIHFTPVIAGAGKGMGIGQL
Gammapro10      NGY-----YKVRIGRDRYL--DEEQLKNNPMITLNDKS--SVHFTPVMAGAGKGGGIFQA
Gammapro1       NGF-----YKVRIGSQ-CI--DSRYLEKGLYYRLKEGM--TVHITPVVKGA-KRAGVFQA
Gammapro2       DGV-----YKVRIGKQ-YL--DPSALEKGLFYCLKKGQ--TIHFTPVIKGA-KSGGVFNF
Betaprot6       DGV-----YQVRFDGK-DQ--SEETIGSVF--RRPADG--VLHIVPRVQGAGKNGGLIQT
Betaprot7       QGF-----YQVRFGRR-DW--SEGELKSGF--GQPAGG--VLHIVPRVQGAGKNGGIIQT
Gammapro8       EGW-----YQVRIAGS-DM--APDTLTARLNESLPPGA--VVHIVPRMAGA--KNGIWQV
Gammapro5       EGW-----YQVRIAGR-DA--GENELSARLNESLANGA--VIHIVPRLAGA-KSGGVFQA
Gammapro9       DGW-----YQVRIAGR-DV--STSGLTAQLHETLPDGA--VIHIVPRVAGA-KSGGVFQI
Gammapro7       ESEKHGIVYRFLVQRE-ELTTSSDEF------QMRYGAQAEFHLIPIIRGS-KRGGFFQL
Gammapro11      EQAKLGLRYAIFRNGK-NT--AEDEF------DLAGSR--EIRIVPVIGGS-KRGGVLQT
Gammapro3       NAHLKGLEFAVFKGKR-NI--KEDEL------YLDTSE--DIRIVPVIKGS-KRGGFFQT
Gammapro4       NAHLKGLEFAVFKGKR-NI--SEDEL------HLDTTE--DIRIAPIIKGS-KRGGFFQT
Betaprot4       TSRDRGIGYAVFLGKK-NL--KAEQL------AETADDR-DIRIAPMLRGA-GLGGIFQV
Betaprot5       TSRDRGVDYAVFLGKK-NI--SQEEL------ADPAGKD-DIRIAPVLQGA-SKGGIFQI
Betaprot3       DARDNGLTFAVFNGRR-NL--SEDDL------SAPVGAE-AIRIAPVIIGS-KSGGLFQT
Betaprot1       TSHERGIRYACFVGRR-NI--GQSEL------ELPPGAD-DIRIAPVLAGA-KQAGLFQT
Betaprot2       TSHERGIRYACFVGRR-NI--GEAEL------ELPPGAD-DIRIAPVLAGA-KQAGLFQT
                        :                                ..: * : .      . . 

GOS_110603      VLGFALKYGAKEYIK--NKIIQ--------------TVVTYIGTTLILQGVNEILAPQEN
Alphapro1       IVGTLI-AVATWWMG--GP-----------------AWLISMGAMVALQGVSSLLSPK--
Gammapro6       ILGVVL-VAAAFYTG--GASLLAWSSGA--------TMMGAMGASLILGGAISLLSKT--
Gammapro10      IVGVVL-VAAAFWTG--GASIAAWDAGV--------VMMGAMGASLILGGAISLLTKT--
Gammapro1       VLGVAL-VGAAILLGPVGGVIGKSAA----------LMLGGMGASMMLGGVAQMLTKM--
Gammapro2       VLGAAL-IGAAFFTG--GASIAAWGAGA--------KMMGMLGASMLLGGVSQMLTKM--
Betaprot6       IVGVVL-IVVGAYTS--------WASG---------AQLIAVGIGMVAGGVAQMLTKQ--
Betaprot7       VLGVVL-IVVGALTS--------WSGG---------ASLVVAGIGMVAGGVAQMLTKP--
Gammapro8       VAGAAL-IGASFIPG--LNAVAA-------------AVLFSAGTSMALGGVAQMLTPV--
Gammapro5       VLGAAL-IAVAWWNP--VGWLGAAAV----------SGMYAAGASMILGGVAQMLAPK--
Gammapro9       VLGAAA-IAGSFFTA--GATLATWGAAIGAGGMT--GILFSLGASMVLGGVAQMLAPK--
Gammapro7       IAGAAM-IGLAFWNP--LGWATIGGTGFLSSAA---TLPLTIGASLVLGGISQLLVPV--
Gammapro11      IAGAVL-IIAGAFVS--GMSFGMAAPLG--------GAMISAGIGMVAGGVIQMLSPQ--
Gammapro3       ILGVAL-IGAAAFLS--GGLSVAFTAVGAWG-----GALAMSGAAMALGGVVQMLSPQ--
Gammapro4       VLGIAM-IGLAVWNP--AFLAMSATTN---------SALMLGGAAMAIGGIVQMLSPQ--
Betaprot4       IAGVAL-IAVACIIT--GGMPLASMMAFNLGIMP--GILSNIGFMLMMSGITQMLSPQ--
Betaprot5       ILGAAL-MVFAMWAQ--GSFTSLGSLSEALKAKSWIGVTAMMGMSMMMGGVLQLLSPQ--
Betaprot3       ILGAALAVAGFAFSQ---------------------PTLIGLGVSMALGGITQMLSPQ--
Betaprot1       ILGAVL-IAAATFYT--GGLAGIGSGGFG-------GFMGAMGVSMALGGVMQMLSPQ--
Betaprot2       ILGAVL-IAAATFYT--GGFAGIGAGGFG-------GFMGAMGVSMMLGGVVQMLSPQ--
                : *                                       *  :   *  .:*     

GOS_110603      TNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYG--EILVGSIVVSNGVDTVQVE
Alphapro1       ---------KKTEKQKKSYMFQGADNVSEQGIPVPLVYG--RAMVNPITISAGVTTANST
Gammapro6       ---PEMSSGVKEGEKKQSTSFSNIRNLTPQGRPIPLLYG--KMMTSLVLISQGIETFDDV
Gammapro10      ---PDMTTGTSDSEKKQSTSFSNIKNLTPQGRPIPLLYG--KMMTSLVLISQGIETFDDA
Gammapro1       ---PSMGGAGKEAEKKSSTSFNSLQNMAAQGQSVPLAYG--RILVGSMIISQGVEVFDAE
Gammapro2       ---PKAPTMGNETEKESSTAFSNLNNLVTQGKPVPLAYG--LIRTGSLVISQGVETITIK
Betaprot6       ---PKLDADGKGVEESKNSAFSNLANTTAQGRPVPLAYG--LCYCGSRVVSQGVQSRRIE
Betaprot7       ---PKFE-QGKGVESSRNSSFSNLSNTAAQGQSMPLAYG--RIYCGSRVVSQGIESRRIE
Gammapro8       ---PKTPTVGQADNGKQNTYFSSLENMVAQGNPVPVLYG--EMKIGSRVISQMMSTRDES
Gammapro5       ---ARTPTATSTDNGKQNTYFSSLDNMVAQGNVLPVLYG--EMRVGSRVVSQEISTADEG
Gammapro9       ---ARTPRTQTTDNGKQNTYFSSLDNMVAQGNVLPVLYG--EMRVGSRVASQEISTADEG
Gammapro7       ---PKVSGPQERPENKPSYLFNGTVNTTEQGQPIPLLYG--ELIVGSAVVSAGLTDKEIP
Gammapro11      ---AKGLKGREAAENAPSYAFGGAVNTTAAGNPVGIGYG--KRRIGGAIISAGIYAEDIA
Gammapro3       ---PQGLSMRQDADNKPSYAFGGVVNTTSQGNPVPLLYGLERREVGGAIISAGIYTEDQK
Gammapro4       ---PRGLSIRQDADNKPSYAFGGTVNTTAQGNPVPLFYGLDRREIGGAIISAGIYTEDQQ
Betaprot4       ---PKGLSARNSPANEPSYTFNGVVNTTAQGGPVPLGYG--RMIVGSAVISAGIYSADRL
Betaprot5       ---MKGLSTRDNVENGASYAFNGAVNTTAQGNPVPVGYG--RMIVGSAVISAGIYAMDQK
Betaprot3       ---QAGLAG--AADNGTSYYFNGAVNSAAQGEPVPLVYG--EMVVGSKVVSSGIYTEDQV
Betaprot1       ---QAGLSASDSPDNGASYNFNGPVNTSAQGNPVPLLYG--EMVVGSAVISAGIYAEDQV
Betaprot2       ---QAGLSVSDSPDNGASYNFNGPVNTSAQGNPVPLLYG--EMVVGSAVISAGIYAEDQV
                                 .  * .  *    *  : : **      .    *  :      

GOS_110603      GTN---------------------------------------------------------
Alphapro1       GLPTA-------------------------------------------------------
Gammapro6       EALNN-------------------------------------------------------
Gammapro10      EALKA-------------------------------------------------------
Gammapro1       TAEASQQSAKWIYRNGKKVQK---------------------------------------
Gammapro2       ENQPASNKKTGFRK----------------------------------------------
Betaprot6       PSSTAASSGAVLNLGLSKTFVQGVAATAPNGQKYRTDFSDDSVRARNYKAAFSG------
Betaprot7       GNSTAANGNSVVRMVFDAAKIKNPNGNSDPMAVDLTLGMKKTFIQGVAATAPNGQKYNTD
Gammapro8       TSGKVVVIGSPLQANTTSRQDGGITRPSVVIRQ---------------------------
Gammapro5       DGGQVVVIGR--------------------------------------------------
Gammapro9       DGGQVVVIGR--------------------------------------------------
Gammapro7       IRTNSTSNNETRGKLKFKRVSG--------------------------------------
Gammapro11      TTKRPIQSGNGNGVKEP-------------------------------------------
Gammapro3       ------------------------------------------------------------
Gammapro4       ------------------------------------------------------------
Betaprot4       ------------------------------------------------------------
Betaprot5       ------------------------------------------------------------
Betaprot3       ------------------------------------------------------------
Betaprot1       ------------------------------------------------------------
Betaprot2       ------------------------------------------------------------
                                                                            

GOS_110603      ------------------
Alphapro1       ------------------
Gammapro6       ------------------
Gammapro10      ------------------
Gammapro1       ------------------
Gammapro2       ------------------
Betaprot6       ------------------
Betaprot7       FENDSVRAMNYEAVYTVD
Gammapro8       ------------------
Gammapro5       ------------------
Gammapro9       ------------------
Gammapro7       ------------------
Gammapro11      ------------------
Gammapro3       ------------------
Gammapro4       ------------------
Betaprot4       ------------------
Betaprot5       ------------------
Betaprot3       ------------------
Betaprot1       ------------------
Betaprot2

Protein Domains

PROTOCOLE:


Interpro / paramètres par défaut.



ANALYSE DES RÉSULTATS:



Un seul domaine protéique validé par Interpro est présent : Lambda_tail_I.

Il est situé entre les acides aminés 7 et 185, avec une E Value de 5.6e-10.

Ce domaine a pour numéro d'accession PF06805 (HMMPfam).

Il est également accessible sous le numéro IPR010654 (interpro) avec pour nom : "Bacteriophage lambda tail assembly I".

Il s'agirait donc d'un domaine protéique codant pour une protéine probablement impliquée dans l'assemblage de la queue du bactériophage lambda.


De plus, ce domaine protéique est en cohérence avec les fonctions des homologues trouvés par blast ("possible lambda tail protein I").


RÉSULTATS BRUTS:

GOS_1106030	54DA776BF0E2277D	190	HMMPfam	PF06805	Lambda_tail_I	7	185	5.6e-10	T	14-Dec-2009	IPR010654	Bacteriophage lambda tail assembly I	

Phylogeny

PROTOCOLE:


a) phylogeny.fr/ phylogeny analysis "à la carte"/ choisir step by step/ puis Gblocks dans curation/ puis méthode PhyML


b) phylogeny.fr/ phylogeny analysis "à la carte"/ choisir step by step/ puis Gblocks dans curation/ puis méthode BioNJ avec 0 bootstraps



ANALYSE DES RÉSULTATS:


L'arbre laisse apparaitre différents groupes n'étant pas monophylétiques au sein desquels sont présentes des séquences de groupes extérieurs sans doute dus à des transferts horizontaux. Ce qui est bien corrélé avec la nature virale de la protéine. De telles analyses sont valables pour nos deux arbres (Méthode PhyML et BioNJ).



Notre séquence sort au milieu des proteobacteria. Néanmoins, à cause de nombreux transferts horizontaux, il nous est impossible de définir clairement des groupes monophylétiques qui pourraient correspondre à un groupe d'étude ou un groupe extérieur. De plus, notre séquence sort en dehors des principaux groupes présents, et la séquence la plus proche de la notre est une a-proteobacteria bien que tout de même relativement éloignée.

Tous ces éléments et la nature virale de notre protéine nous amène à considérer les protéobactéries comme classification la plus précise que nous pouvons donner. Dans l'objectif de valider cette hypothèse, il faudrait enraciner l'arbre à l'aide d'une séquence clairement extérieure au groupe des protéobactéries, mais une telle séquence n'existe pas en dessus de notre seuil d'homologie, déjà fixé relativement bas. Le fait que des organismes extérieurs aux protéobactéries ne soient pas présents semble cohérent avec la nature virale de notre protéine, qui devrait sans doute appartenir à un bactériophage spécifique des protéobactéries.

RÉSULTATS BRUTS:

Arbre PhyML:

                                                                                                         ---0.2--
 
                                            +Gammapro6_Actinobacillus_pleuropneumoniae_serovar/Gammaproteobac
                 +--------------------------+
                 |                          +--Gammapro10_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/
            +----+
            |    +-Gammapro2_Mannheimia_haemolytica_PHL213/Gammaproteobacteria/ref
        +---+
        |   +-----------Gammapro1_Actinobacillus/Gammaproteobacteria/ref_ZP_04752848.1_g
     +--+
     |  |
     |  |        +------Betaprot6_Neisseria_meningitidis_FAM18/Betaproteobacteria/ref_YP
     |  +--------+
  +--+           +-------Betaprot7_Neisseria/Betaproteobacteria/ref_ZP_03719879.1_gi_2250
  |  |
  |  |    +-------Gammapro8_Salmonella_typhimurium_LT2/Gammaproteobacteria/ref_NP
  |  |    |
  |  +----+   +-Gammapro5_Escherichia_coli_APEC_O1/Gammaproteobacteria/ref_YP_85
 ++       +---+
 ||           +Gammapro9_Escherichia/Gammaproteobacteria/ref_YP_002402167.1_gi
 ||
 ||         +-------------------------------------------GOS_1106030_Traduction_3-578_sens_direct
 |+---------+
 |          |
 |          +--------------Alphapro1_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
 |
 |       +----------Gammapro7_Haemophilus_influenzae_PittII/Gammaproteobacteria/ref
 |       |
 |       |          +-Gammapro3_Providencia/Gammaproteobacteria/ref_ZP_03317875.1_gi_2
 |       |          |
 +-------+----------+  +--------------------------------Gammapro11_Shewanella_baltica_OS223/Gammaproteobacteria/ref_YP_0
         |          +--+
         |             +Gammapro4_Providencia/Gammaproteobacteria/ref_ZP_02962279.1_gi_1
         |
         |           +-------Betaprot4_Oxalobacter/Betaproteobacteria/ref_ZP_04576753.1_gi_23
         |     +-----+
         |     |     |
         |     |     +-----Betaprot5_Oxalobacter/Betaproteobacteria/ref_ZP_04578709.1_gi_23
         |  +--+
         |  |  |    +--Betaprot1_Ralstonia_solanacearum_GMI1000/Betaproteobacteria/ref
         +--+  +----+
            |       +-Betaprot2_Ralstonia/Betaproteobacteria/ref_YP_002254504.1_gi_207
            |
            +--------Betaprot3_Burkholderia_cenocepacia_PC184/Betaproteobacteria/ref



Arbre BioNJ:


                                                                                                   ------0.2-----
 
              +-------------------------------------------------------GOS_1106030_Traduction_3-578_sens_direct
    +---------+
    |         +------------------------Alphapro1_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
    |
    |              +---------Betaprot6_Neisseria_meningitidis_FAM18/Betaproteobacteria/ref_YP
    |      +-------+
 +--+      |       +------------Betaprot7_Neisseria/Betaproteobacteria/ref_ZP_03719879.1_gi_2250
 |  |      |
 |  |      |
 |  |      |     +---------------Gammapro1_Actinobacillus/Gammaproteobacteria/ref_ZP_04752848.1_g
 |  +------+     |
 |         |+----+                                   +-Gammapro6_Actinobacillus_pleuropneumoniae_serovar/Gammaproteobac
 |         ||    |+----------------------------------+
 |         ||    ++                                  +--Gammapro10_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/
 |         ||     |
 |         ++     +------------Gammapro2_Mannheimia_haemolytica_PHL213/Gammaproteobacteria/ref
 |          |
 |          |        +---------Gammapro8_Salmonella_typhimurium_LT2/Gammaproteobacteria/ref_NP
 |          |        |
 |          +--------+        +--Gammapro5_Escherichia_coli_APEC_O1/Gammaproteobacteria/ref_YP_85
 |                   +--------+
 |                            |
 |                            +--Gammapro9_Escherichia/Gammaproteobacteria/ref_YP_002402167.1_gi
 |
 |  +------------------Gammapro7_Haemophilus_influenzae_PittII/Gammaproteobacteria/ref
 |  |
 |  |+-----------Betaprot3_Burkholderia_cenocepacia_PC184/Betaproteobacteria/ref
 +--+|
    ||      +------------------------------------Gammapro11_Shewanella_baltica_OS223/Gammaproteobacteria/ref_YP_0
    ||      |
    ++------+           +--Gammapro3_Providencia/Gammaproteobacteria/ref_ZP_03317875.1_gi_2
     |      +-----------+
     |                  +-----Gammapro4_Providencia/Gammaproteobacteria/ref_ZP_02962279.1_gi_1
     |
     |
     |          +------------Betaprot4_Oxalobacter/Betaproteobacteria/ref_ZP_04576753.1_gi_23
     |  +-------+
     |  |       +--------Betaprot5_Oxalobacter/Betaproteobacteria/ref_ZP_04578709.1_gi_23
     +--+
        |      +----Betaprot1_Ralstonia_solanacearum_GMI1000/Betaproteobacteria/ref
        +------+
               +---Betaprot2_Ralstonia/Betaproteobacteria/ref_YP_002254504.1_gi_207alid

Taxonomy report

PROTOCOLE:


a) BLAST NCBI de type Blastp, contre une base NR, "max target sequences" limites de 1000 (Autres réglages par défaut.)



ANALYSE DES RÉSULTATS:


Notre panel de séquences comporte des a, b, et des g-proteobacteria au dessus du score seuil.


ref|ZP_04752848.1| 76.6 1e-12 [Actinobacillus minor NM305] g-proteobacteria

ref|ZP_04976626.1| 74.3 5e-12 [Mannheimia haemolytica PHL213] g-proteobacteria

ref|ZP_03317875.1| 73.2 1e-11 [Providencia alcalifaciens DSM 30120] g-proteobacteria

ref|ZP_02962279.1| 70.9 7e-11 [Providencia stuartii ATCC 25827] g-proteobacteria

ref|YP_852549.1| 63.5 9e-09 [Escherichia coli APEC O1] g-proteobacteria

ref|YP_001968297.1| 63.5 9e-09 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] g-proteobacteria

ref|ZP_01795641.1| 62.4 2e-08 [Haemophilus influenzae PittII] g-proteobacteria

ref|NP_460022.1| 62.0 3e-08 [Phage Gifsy-2] g-proteobacteria

ref|YP_002402167.1| 60.8 6e-08 [Escherichia coli 55989] g-proteobacteria

ref|YP_001344548.1| 58.2 5e-07 [Actinobacillus succinogenes 130Z] g-proteobacteria

ref|YP_002358541.1| 55.5 3e-06 [Shewanella baltica OS223] g-proteobacteria


ref|NP_519817.1| 68.2 4e-10 [Ralstonia solanacearum GMI1000] b-proteobacteria

ref|YP_002254504.1| 63.9 7e-09 [Ralstonia solanacearum MolK2] b-proteobacteria

ref|ZP_04938651.1| 61.6 4e-08 [Burkholderia cenocepacia PC184] b-proteobacteria

ref|ZP_04576753.1| 59.3 2e-07 [Oxalobacter formigenes HOxBLS] b-proteobacteria

ref|ZP_04578709.1| 57.0 8e-07 [Oxalobacter formigenes OXCC13] b-proteobacteria

ref|YP_974947.1| 52.8 2e-05 [Neisseria meningitidis FAM18] b-proteobacteria

ref|ZP_03719879.1| 52.4 2e-05 [Neisseria flavescens NRL30031/H210] b-proteobacteria


ref|YP_002500883.1| 62.4 2e-08 [Methylobacterium nodulans ORS 2060] a-proteobacteria








RÉSULTATS BRUTS:
root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Gammaproteobacteria [g-proteobacteria]
. . . . . Pasteurellaceae     [g-proteobacteria]
. . . . . . Actinobacillus      [g-proteobacteria]
. . . . . . . Actinobacillus minor NM305 -------------------------------------------   76  2 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Actinobacillus minor 
. . . . . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ..................   63  2 hits [g-proteobacteria]  putative phage tail assembly protein [Actinobacillus pleuro
. . . . . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ..................   61  1 hit  [g-proteobacteria]  COG4723: Phage-related protein, tail component [Actinobacil
. . . . . . . Actinobacillus succinogenes 130Z .....................................   57  2 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Actinobacillus succin
. . . . . . . Actinobacillus pleuropneumoniae L20 ..................................   49  2 hits [g-proteobacteria]  putative phage tail assembly protein [Actinobacillus pleuro
. . . . . . Mannheimia haemolytica PHL213 ------------------------------------------   74  6 hits [g-proteobacteria]  possible bacteriophage tail protein [Mannheimia haemolytica
. . . . . . Mannheimia haemolytica serotype A2 str. OVINE ..........................   72  4 hits [g-proteobacteria]  bacteriophage tail protein [Mannheimia haemolytica serotype
. . . . . . Haemophilus influenzae 22.1-21 .........................................   62  2 hits [g-proteobacteria]  probable phage hk022 gp20-related protein [Haemophilus infl
. . . . . . Haemophilus influenzae PittII ..........................................   62  2 hits [g-proteobacteria]  probable phage hk022 gp20-related protein [Haemophilus infl
. . . . . . Haemophilus parasuis 29755 .............................................   54  2 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Haemophilus parasuis 
. . . . . . Haemophilus parasuis SH0165 ............................................   52  2 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Haemophilus parasuis 
. . . . . . Haemophilus influenzae PittAA ..........................................   49  2 hits [g-proteobacteria]  prophage LambdaSo, tail assembly protein I [Haemophilus inf
. . . . . . Aggregatibacter aphrophilus NJ8700 .....................................   48  3 hits [g-proteobacteria]  putative phage tail assembly protein [Aggregatibacter aphro
. . . . . . Mannheimia haemolytica serotype A2 str. BOVINE .........................   36  2 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Mannheimia haemolytic
. . . . . . Pasteurella multocida ..................................................   35  1 hit  [g-proteobacteria]  hypothetical protein [Pasteurella multocida]
. . . . . Proteus mirabilis HI4320 -------------------------------------------------   74  2 hits [enterobacteria]    phage tail assembly protein [Proteus mirabilis HI4320] >gi|
. . . . . Proteus mirabilis ATCC 29906 .............................................   74  2 hits [enterobacteria]    phage tail assembly protein [Proteus mirabilis HI4320] >gi|
. . . . . Providencia alcalifaciens DSM 30120 ......................................   73  8 hits [enterobacteria]    hypothetical protein PROVALCAL_00795 [Providencia alcalifac
. . . . . Providencia stuartii ATCC 25827 ..........................................   70  4 hits [enterobacteria]    hypothetical protein PROSTU_04387 [Providencia stuartii ATC
. . . . . Escherichia coli SE11 ....................................................   63 11 hits [enterobacteria]    putative phage tail fiber component [Escherichia coli SE11]
. . . . . Escherichia coli APEC O1 .................................................   63 13 hits [enterobacteria]    putative tail component of prophage [Escherichia coli APEC 
. . . . . Escherichia coli O111:H- .................................................   63  2 hits [enterobacteria]    putative tail assembly protein [Escherichia coli O111:H-]
. . . . . Escherichia fergusonii ATCC 35469 ........................................   62  5 hits [enterobacteria]    Tail assembly protein I from putative prophage [Escherichia
. . . . . Providencia rustigianii DSM 4541 .........................................   62  1 hit  [enterobacteria]    putative tail assembly protein [Providencia rustigianii DSM
. . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........   62  6 hits [enterobacteria]    tail assembly protein [Phage Gifsy-2] >gi|169257316|ref|YP_
. . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......   62  3 hits [enterobacteria]    tail assembly protein [Phage Gifsy-2] >gi|169257316|ref|YP_
. . . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   62  2 hits [enterobacteria]    Tail Assembly Protein [Salmonella enterica subsp. enterica 
. . . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   62  4 hits [enterobacteria]    Gifsy-2 prophage tail assembly protein [Salmonella enterica
. . . . . Cronobacter sakazakii ATCC BAA-894 .......................................   61  2 hits [enterobacteria]    hypothetical protein ESA_01043 [Enterobacter sakazakii ATCC
. . . . . Escherichia coli UMN026 ..................................................   61 11 hits [enterobacteria]    Tail assembly protein I from putative prophage [Escherichia
. . . . . Escherichia coli O103:H2 str. 12009 ......................................   61 20 hits [enterobacteria]    Tail assembly protein I from putative prophage [Escherichia
. . . . . Pseudomonas aeruginosa PACS2 .............................................   61  1 hit  [g-proteobacteria]  hypothetical protein PaerPA_01000624 [Pseudomonas aeruginos
. . . . . Pseudomonas aeruginosa UCBPP-PA14 ........................................   61  2 hits [g-proteobacteria]  hypothetical protein PaerPA_01000624 [Pseudomonas aeruginos
. . . . . Pseudomonas aeruginosa 2192 ..............................................   61  6 hits [g-proteobacteria]  hypothetical protein PaerPA_01000624 [Pseudomonas aeruginos
. . . . . Escherichia coli IAI39 ...................................................   61 11 hits [enterobacteria]    Tail assembly protein I from putative prophage [Escherichia
. . . . . Escherichia coli 55989 ...................................................   60 11 hits [enterobacteria]    Tail assembly protein I [Escherichia coli 55989] >gi|218351
. . . . . Escherichia coli O26:H11 str. 11368 ......................................   60 26 hits [enterobacteria]    putative tail assembly protein [Escherichia coli O26:H11 st
. . . . . Escherichia coli IAI1 ....................................................   60  7 hits [enterobacteria]    putative phage tail component [Escherichia coli SE11] >gi|2
. . . . . Escherichia coli O157:H7 EDL933 ..........................................   60 14 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli O157:H7 str. Sakai ......................................   60 18 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli O157:H7 str. EC4024 .....................................   60  9 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli O157:H7 str. TW14359 ....................................   60 20 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli UTI89 ...................................................   60  9 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli O127:H6 str. E2348/69 ...................................   60 11 hits [enterobacteria]    predicted tail assembly protein [Escherichia coli O127:H6 s
. . . . . Pseudomonas aeruginosa PA7 ...............................................   60  4 hits [g-proteobacteria]  putative bacteriophage protein [Pseudomonas aeruginosa PA7]
. . . . . Pseudomonas aeruginosa C3719 .............................................   60  2 hits [g-proteobacteria]  putative bacteriophage protein [Pseudomonas aeruginosa PA7]
. . . . . Escherichia coli ED1a ....................................................   60 13 hits [enterobacteria]    Tail assembly protein I [Escherichia coli ED1a] >gi|2184268
. . . . . Escherichia coli CFT073 ..................................................   60  8 hits [enterobacteria]    putative tail component of prophage [Escherichia coli CFT07
. . . . . Escherichia coli S88 .....................................................   59 11 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Escherichia coli 536 .....................................................   59  5 hits [enterobacteria]    tail assembly protein I [Escherichia coli 536] >gi|11762336
. . . . . Escherichia coli 83972 ...................................................   59  6 hits [enterobacteria]    tail assembly protein I [Escherichia coli 536] >gi|11762336
. . . . . Cronobacter turicensis ...................................................   59  1 hit  [enterobacteria]    hypothetical protein Ctu_17610 [Cronobacter turicensis] >gi
. . . . . Cronobacter turicensis z3032 .............................................   59  1 hit  [enterobacteria]    hypothetical protein Ctu_17610 [Cronobacter turicensis] >gi
. . . . . Escherichia coli SMS-3-5 .................................................   59  5 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O111:H- str. 11128 ......................................   59 20 hits [enterobacteria]    putative tail assembly protein [Escherichia coli O157:H7 st
. . . . . Escherichia coli BL21(DE3) ...............................................   59  4 hits [enterobacteria]    tail component [Enterobacteria phage lambda] >gi|139637|sp|
. . . . . Pseudomonas aeruginosa PAO1 ..............................................   58  2 hits [g-proteobacteria]  putative bacteriophage protein [Pseudomonas aeruginosa PAO1
. . . . . Xanthomonas campestris pv. campestris str. B100 ..........................   58  1 hit  [g-proteobacteria]  putative phage tail assembly protein I [Xanthomonas campest
. . . . . Xanthomonas campestris pv. campestris ....................................   58  1 hit  [g-proteobacteria]  putative phage tail assembly protein I [Xanthomonas campest
. . . . . Shigella sonnei Ss046 ....................................................   58  7 hits [enterobacteria]    putative tail component of prophage [Shigella sonnei Ss046]
. . . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   58  2 hits [enterobacteria]    tail assembly protein I-like [Salmonella typhimurium LT2] >
. . . . . Shewanella sp. W3-18-1 ...................................................   56  4 hits [g-proteobacteria]  bacteriophage lambda tail assembly I [Shewanella sp. W3-18-
. . . . . Shewanella baltica OS223 .................................................   55  4 hits [g-proteobacteria]  lambda tail assembly I [Shewanella baltica OS223] >gi|21749
. . . . . Erwinia tasmaniensis Et1/99 ..............................................   53  2 hits [enterobacteria]    Putative phage tail assembly protein [Erwinia tasmaniensis 
. . . . . Pseudomonas aeruginosa ...................................................   53  2 hits [g-proteobacteria]  phage-related protein tail component [Pseudomonas aeruginos
. . . . . Escherichia coli B7A .....................................................   52  4 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4196 .....................................   51 18 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4113 .....................................   51 18 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4076 .....................................   51 22 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4401 .....................................   51 18 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4206 .....................................   51 20 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4045 .....................................   51 20 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4042 .....................................   51 20 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4115 .....................................   51 23 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli E22 .....................................................   51 12 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Citrobacter sp. 30_2 .....................................................   51  2 hits [enterobacteria]    gp20 [Citrobacter sp. 30_2] >gi|226906698|gb|EEH92616.1| gp
. . . . . Escherichia coli O157:H7 str. EC4501 .....................................   51 20 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. TW14588 ....................................   51 16 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC4486 .....................................   51 16 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Shigella boydii Sb227 ....................................................   50  7 hits [enterobacteria]    putative tail component [Shigella boydii Sb227] >gi|8124512
. . . . . Shigella boydii CDC 3083-94 ..............................................   50  9 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Shigella boyd
. . . . . Escherichia coli ATCC 8739 ...............................................   50  2 hits [enterobacteria]    lambda tail assembly I [Escherichia coli ATCC 8739] >gi|169
. . . . . Escherichia coli O157:H7 str. EC869 ......................................   50 18 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Shigella flexneri 2a str. 301 ............................................   50  4 hits [enterobacteria]    putative tail component [Shigella flexneri 2a str. 301] >gi
. . . . . Shigella flexneri 5 str. 8401 ............................................   50  7 hits [enterobacteria]    putative tail component [Shigella flexneri 2a str. 301] >gi
. . . . . Escherichia coli B171 ....................................................   50 12 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. EC508 ......................................   50 20 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli F11 .....................................................   50  6 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli 101-1 ...................................................   50  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia albertii TW07627 .............................................   50  4 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia a
. . . . . Escherichia coli E110019 .................................................   49 18 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Escherichia c
. . . . . Escherichia coli O157:H7 str. FRIK2000 ...................................   49  3 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Yersinia pestis KIM 10 ...................................................   48  6 hits [enterobacteria]    unknown [Yersinia pestis KIM]
. . . . . Shigella flexneri 2a str. 2457T ..........................................   48  4 hits [enterobacteria]    putative tail component [Shigella flexneri 2a str. 2457T] >
. . . . . Shigella dysenteriae 1012 ................................................   48  2 hits [enterobacteria]    putative tail component [Shigella flexneri 2a str. 2457T] >
. . . . . Yersinia pestis CO92 .....................................................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Microtus str. 91001 ...............................   48  2 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis ..........................................................   48  2 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis Antiqua ..................................................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis Nepal516 .................................................   48  8 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis Pestoides F ..............................................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis CA88-4125 ................................................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis Angola ...................................................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Orientalis str. F1991016 ..........................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Orientalis str. IP275 .............................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Antiqua str. E1979001 .............................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Antiqua str. B42003004 ............................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis FV-1 .....................................................   48  2 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis Pestoides A ..............................................   48  2 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis biovar Orientalis str. India 195 .........................   48  4 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis D106004 ..................................................   48  1 hit  [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Yersinia pestis D182038 ..................................................   48  2 hits [enterobacteria]    putative phage tail protein [Yersinia pestis CO92] >gi|3179
. . . . . Pseudomonas fluorescens Pf-5 .............................................   48  2 hits [g-proteobacteria]  prophage LambdaSo, tail assembly protein I [Pseudomonas flu
. . . . . Escherichia coli O157:H7 str. FRIK966 ....................................   48  3 hits [enterobacteria]    putative tail component of prophage CP-933K [Escherichia co
. . . . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............   47  2 hits [enterobacteria]    putative phage tail protein [Salmonella enterica subsp. ent
. . . . . Escherichia coli 53638 ...................................................   47  4 hits [enterobacteria]    putative tail component of prophage [Shigella sonnei Ss046]
. . . . . Enterobacter sp. 638 .....................................................   45  2 hits [enterobacteria]    bacteriophage lambda tail assembly I [Enterobacter sp. 638]
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   44  2 hits [enterobacteria]    Gifsy-2 prophage probable tail assembly protein [Salmonella
. . . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...   44  4 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   44  4 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Shewanella oneidensis MR-1 ...............................................   43  2 hits [g-proteobacteria]  prophage LambdaSo, tail assembly protein I [Shewanella onei
. . . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................   42  2 hits [enterobacteria]    putative phage tail assembly protein [Yersinia enterocoliti
. . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........   41  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   41  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   41  6 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   41  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Yersinia kristensenii ATCC 33638 .........................................   41  2 hits [enterobacteria]    Bacteriophage lambda tail assembly I [Yersinia kristensenii
. . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   40  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   40  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...   40  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   40  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   40  8 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Pantoea sp. At-9b ........................................................   40  2 hits [enterobacteria]    lambda tail assembly I [Pantoea sp. At-9b] >gi|258534155|gb
. . . . . Escherichia sp. 3_2_53FAA ................................................   40  6 hits [enterobacteria]    tail assembly protein I [Escherichia sp. 3_2_53FAA] >gi|226
. . . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........   39  4 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Sodalis glossinidius str. 'morsitans' ....................................   39  4 hits [enterobacteria]    putative phage tail assembly protein [Sodalis glossinidius 
. . . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   38  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Pseudomonas fluorescens Pf0-1 ............................................   38  2 hits [g-proteobacteria]  heavy metal efflux pump CzcA [Pseudomonas fluorescens Pf0-1
. . . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   36  2 hits [enterobacteria]    bacteriophage lambda tail assembly protein I [Salmonella en
. . . . . Escherichia coli BW2952 ..................................................   35  2 hits [enterobacteria]    Tail assembly protein I [Escherichia coli BW2952] >gi|23886
. . . . . Pseudomonas syringae pv. oryzae str. 1_6 .................................   34  2 hits [g-proteobacteria]  phage tail assembly protein [Pseudomonas syringae pv. oryza
. . . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   33  1 hit  [enterobacteria]    hypothetical protein SentesTe_12996 [Salmonella enterica su
. . . . . Shigella dysenteriae Sd197 ...............................................   33  3 hits [enterobacteria]    homoserine O-succinyltransferase [Shigella dysenteriae Sd19
. . . . . Escherichia coli O6 ......................................................   33  1 hit  [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli CFT073] 
. . . . . Escherichia coli E24377A .................................................   33  3 hits [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli E24377A]
. . . . . Escherichia coli HS ......................................................   33  3 hits [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli E24377A]
. . . . . Shigella sp. D9 ..........................................................   33  1 hit  [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli E24377A]
. . . . . Escherichia coli O157:H7 .................................................   33  1 hit  [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli O157:H7 
. . . . . Escherichia coli .........................................................   33  4 hits [enterobacteria]    homoserine O-succinyltransferase [Escherichia coli O157:H7 
. . . . Ralstonia solanacearum GMI1000 ---------------------------------------------   67  2 hits [b-proteobacteria]  phage HK022 GP20-like protein [Ralstonia solanacearum GMI10
. . . . Ralstonia solanacearum MolK2 ...............................................   63  2 hits [b-proteobacteria]  phage hk022 gp20-related protein [Ralstonia solanacearum Mo
. . . . Methylobacterium nodulans ORS 2060 .........................................   62 14 hits [a-proteobacteria]  lambda tail assembly I [Methylobacterium nodulans ORS 2060]
. . . . Burkholderia cenocepacia PC184 .............................................   61  2 hits [b-proteobacteria]  gp63 phage protein [Burkholderia cenocepacia PC184] >gi|124
. . . . Burkholderia phymatum STM815 ...............................................   61  2 hits [b-proteobacteria]  lambda tail assembly I [Burkholderia phymatum STM815] >gi|1
. . . . Burkholderia pseudomallei 305 ..............................................   59  2 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Neisseria sicca ATCC 29256 .................................................   59  2 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Neisseria sic
. . . . Oxalobacter formigenes HOxBLS ..............................................   59  4 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Oxalobacter f
. . . . Oxalobacter formigenes OXCC13 ..............................................   56  4 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Oxalobacter f
. . . . Burkholderia graminis C4D1M ................................................   55  2 hits [b-proteobacteria]  lambda tail assembly I [Burkholderia graminis C4D1M] >gi|17
. . . . Neisseria meningitidis FAM18 ...............................................   52  2 hits [b-proteobacteria]  putative phage-related protein [Neisseria meningitidis FAM1
. . . . Neisseria meningitidis alpha14 .............................................   52  2 hits [b-proteobacteria]  putative phage-related protein [Neisseria meningitidis FAM1
. . . . Neisseria flavescens NRL30031/H210 .........................................   52  2 hits [b-proteobacteria]  hypothetical protein NEIFLAOT_01731 [Neisseria flavescens N
. . . . Burkholderia multivorans ATCC 17616 ........................................   49  4 hits [b-proteobacteria]  gp63 [Burkholderia phage Bcep176] >gi|161520429|ref|YP_0015
. . . . Burkholderia pseudomallei 1710a ............................................   49  2 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia pseudomallei MSHR346 ..........................................   49  2 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia oklahomensis C6786 ............................................   47  1 hit  [b-proteobacteria]  Bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia pseudomallei 1710b ............................................   46  2 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia thailandensis E264 ............................................   46  3 hits [b-proteobacteria]  bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia thailandensis TXDOH ...........................................   44  1 hit  [b-proteobacteria]  Bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Rhodopseudomonas palustris TIE-1 ...........................................   43  2 hits [a-proteobacteria]  putative phage HK022 GP20-related protein [Rhodopseudomonas
. . . . Burkholderia thailandensis Bt4 .............................................   43  1 hit  [b-proteobacteria]  Bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Burkholderia oklahomensis EO147 ............................................   42  1 hit  [b-proteobacteria]  Bacteriophage lambda tail assembly protein I [Burkholderia 
. . . . Geobacter metallireducens GS-15 ............................................   36  2 hits [d-proteobacteria]  CoA-binding protein [Geobacter metallireducens GS-15] >gi|7
. . . . Pseudovibrio sp. JE062 .....................................................   34  2 hits [a-proteobacteria]  ABC transporter permease protein [Pseudovibrio sp. JE062] >
. . . Jonquetella anthropi E3_33 E1 ------------------------------------------------   48  2 hits [bacteria]          prophage PSPPH03, putative tail assembly protein I [Jonquet
. . . Dialister invisus DSM 15470 ..................................................   35  2 hits [firmicutes]        cation efflux family protein [Dialister invisus DSM 15470] 
. . . Anaerococcus tetradius ATCC 35098 ............................................   35  2 hits [firmicutes]        phosphate ABC superfamily ATP binding cassette transporter,
. . . Anaerocellum thermophilum DSM 6725 ...........................................   34  2 hits [firmicutes]        protein of unknown function DUF554 [Anaerocellum thermophil
. . Populus trichocarpa (black cottonwood) -----------------------------------------   59  2 hits [eudicots]          predicted protein [Populus trichocarpa] >gi|222870390|gb|EE
. . Coccidioides posadasii C735 delta SOWgp ........................................   34  1 hit  [ascomycetes]       hypothetical protein CPC735_071770 [Coccidioides posadasii 
. . Oryza sativa Japonica Group (Japanese rice) ....................................   33  1 hit  [monocots]          hypothetical protein OsJ_03390 [Oryza sativa Japonica Group]
. . Plasmodium berghei str. ANKA ...................................................   33  1 hit  [apicomplexans]     diacylglycerol kinase [Plasmodium berghei strain ANKA] >gi|
. . Plasmodium berghei .............................................................   33  1 hit  [apicomplexans]     diacylglycerol kinase [Plasmodium berghei strain ANKA] >gi|
. Enterobacteria phage cdtI --------------------------------------------------------   62  2 hits [viruses]           putative tail component [Phage cdtI] >gi|148524728|dbj|BAF6
. Phage Gifsy-2 ....................................................................   62  1 hit  [viruses]           tail assembly protein [Phage Gifsy-2] >gi|169257316|ref|YP_
. Burkholderia phage KS9 ...........................................................   61  2 hits [viruses]           tail component protein gp18 [Burkholderia phage KS9] >gi|25
. Enterobacteria phage VT1-Sakai ...................................................   59  1 hit  [viruses]           putative tail assembly protein [Escherichia coli O157:H7 st
. Enterobacteria phage lambda ......................................................   59  3 hits [viruses]           tail component [Enterobacteria phage lambda] >gi|139637|sp|
. Enterobacteria phage DE3 .........................................................   59  1 hit  [viruses]           tail component [Enterobacteria phage lambda] >gi|139637|sp|
. Enterobacteria phage YYZ-2008 ....................................................   59  2 hits [viruses]           putative tail assembly protein [Enterobacteria phage YYZ-20
. Salmonella phage Fels-1 ..........................................................   59  1 hit  [viruses]           putative phage tail assembly protein [Salmonella phage Fels
. Phage Gifsy-1 ....................................................................   58  1 hit  [viruses]           tail assembly protein I-like [Salmonella typhimurium LT2] >
. Stx2-converting phage 1717 .......................................................   58  2 hits [viruses]           putative tail assembly protein [Escherichia coli O157:H7 st
. Enterobacteria phage 2851 ........................................................   58  1 hit  [viruses]           tail assembly protein I. [Enterobacteria phage 2851]
. Enterobacteria phage BP-4795 .....................................................   57  2 hits [viruses]           putative tail component [Phage BP-4795] >gi|76556246|emb|CA
. Neisseria meningitidis phage 2120 ................................................   52  1 hit  [viruses]           putative phage-related protein [Neisseria meningitidis FAM1
. Burkholderia phage Bcep176 .......................................................   49  2 hits [viruses]           gp63 [Burkholderia phage Bcep176] >gi|161520429|ref|YP_0015
. Enterobacteria phage HK022 .......................................................   49  2 hits [viruses]           gp21 [Enterobacteria phage HK022] >gi|9634177|ref|NP_037714
. Enterobacteria phage HK97 ........................................................   49  2 hits [viruses]           gp21 [Enterobacteria phage HK022] >gi|9634177|ref|NP_037714
. Klebsiella phage phiKO2 ..........................................................   47  2 hits [viruses]           Gp20 [Klebsiella phage phiKO2] >gi|40218250|gb|AAR83036.1| 
. Burkholderia phage phi1026b ......................................................   47  2 hits [viruses]           gp19 [Burkholderia phage phi1026b] >gi|38505401|gb|AAR23170
. Enterobacteria phage N15 .........................................................   47  2 hits [viruses]           gp20 [Enterobacteria phage N15] >gi|3192703|gb|AAC19056.1| 
. Burkholderia phage phiE125 .......................................................   47  2 hits [viruses]           putative tail component protein [Burkholderia phage phiE125
. Enterobacteria phage JK06 ........................................................   45  2 hits [viruses]           hypothetical tail assembly protein I [Enterobacteria phage 
. Enterobacteria phage TLS .........................................................   45  2 hits [viruses]           gp49 [Enterobacteria phage TLS] >gi|38046781|gb|AAR09280.1|
. Enterobacteria phage CP-1639 .....................................................   44  1 hit  [viruses]           putative tail fiber component I [Bacteriophage CP-1639]
. Burkholderia phage phi644-2 ......................................................   44  2 hits [viruses]           gp20, bacteriophage lambda tail assembly protein I [Burkhol
. Enterobacteria phage RTP .........................................................   44  2 hits [viruses]           putative tail assembly protein [Enterobacteria phage RTP] >
. Enterobacteria phage SSL-2009a ...................................................   42  2 hits [viruses]           putative phage tail assembly protein I [Enterobacteria phag
. Sodalis phage SO-1 ...............................................................   41  1 hit  [viruses]           gp21 [Sodalis phage SO-1]
. Enterobacteria phage T1 ..........................................................   41  2 hits [viruses]           putative tail assembly protein [Enterobacteria phage T1] >g
. Enterobacteria phage ES18 ........................................................   33  2 hits [viruses]           gp28 [Enterobacteria phage ES18] >gi|58339084|gb|AAW70499.1

BLAST

PROTOCOLE:


a. BLAST NCBI de type Blastp, contre une base NR, "max target sequences" limites de 1000 (Autres réglages par défaut.)

b. BLAST NCBI de type Blastp, contre une base Swissprot, "max target sequence" limites de 1000 (Autres réglages par défaut.)



ANALYSE DES RÉSULTATS:



On obtient peu d'homologues, avec de très faibles e-values. De plus, notre séquence semble correspondre à une protéine virale, donc particulièrement soumise aux transferts horizontaux.

Nous nous abstiendrons donc de définir un groupe d'étude et un groupe extérieur. La suite de notre analyse sera donc basée sur un panel d'homologues situés au dessus d'un score seuil fixé arbitrairement à 50.


Le Blast contre Swissprot n'est pas contributif: une quinzaine de séquences sont trouvées avec des e-values comprises entre 0,5 et 9. Ceci peut s'expliquer par le faible nombre de séquences que comporte la banque Swissprot.


Nous noterons aussi le fait que les homologues trouvés sont plutot bien alignés par rapport à notre séquence d'intérêt, ce qui conforte notre hypothèse d'une ORF complète en 5' et 3'.

RÉSULTATS BRUTS:

Blast NR :
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_04752848.1|  bacteriophage lambda tail assembly I [Acti...  76.6    1e-12
ref|YP_002150297.1|  phage tail assembly protein [Proteus mira...  74.7    5e-12 Gene info
ref|ZP_04976626.1|  possible bacteriophage tail protein [Mannh...  74.7    5e-12
ref|ZP_03317875.1|  hypothetical protein PROVALCAL_00795 [Prov...  73.2    1e-11
ref|ZP_05991699.1|  bacteriophage tail protein [Mannheimia hae...  72.4    2e-11
ref|ZP_02962279.1|  hypothetical protein PROSTU_04387 [Provide...  70.9    7e-11
ref|ZP_03318821.1|  hypothetical protein PROVALCAL_01760 [Prov...  70.5    9e-11
ref|NP_519817.1|  phage HK022 GP20-like protein [Ralstonia sol...  67.8    5e-10 Gene info
ref|ZP_04978010.1|  bacteriophage tail protein [Mannheimia hae...  66.6    1e-09
ref|YP_002291886.1|  putative phage tail fiber component [Esch...  63.9    7e-09 Gene info
ref|YP_002254504.1|  phage hk022 gp20-related protein [Ralston...  63.9    7e-09 Gene info
ref|YP_852549.1|  putative tail component of prophage [Escheri...  63.5    9e-09 Gene info
ref|YP_001968297.1|  putative phage tail assembly protein [Act...  63.5    1e-08 Gene info
dbj|BAG66597.1|  putative tail assembly protein [Escherichia c...  63.5    1e-08
ref|ZP_01785662.1|  probable phage hk022 gp20-related protein ...  62.8    2e-08
ref|ZP_01795641.1|  probable phage hk022 gp20-related protein ...  62.4    2e-08
ref|YP_002500883.1|  lambda tail assembly I [Methylobacterium ...  62.4    2e-08 Gene info
ref|ZP_04976943.1|  possible bacteriophage tail protein [Mannh...  62.4    2e-08
ref|YP_001272530.1|  putative tail component [Phage cdtI] >dbj...  62.4    2e-08 Gene info
ref|YP_002385460.1|  Tail assembly protein I from putative pro...  62.0    3e-08 Gene info
ref|ZP_05971971.1|  putative tail assembly protein [Providenci...  62.0    3e-08
ref|NP_460022.1|  tail assembly protein [Phage Gifsy-2] >ref|Y...  62.0    3e-08 Gene info
ref|YP_002226266.1|  Tail Assembly Protein [Salmonella enteric...  62.0    3e-08 Gene info
ref|YP_215987.1|  Gifsy-2 prophage tail assembly protein [Salm...  62.0    3e-08 Gene info
ref|YP_002499240.1|  lambda tail assembly I [Methylobacterium ...  61.6    4e-08 Gene info
ref|ZP_03319521.1|  hypothetical protein PROVALCAL_02465 [Prov...  61.6    4e-08
ref|YP_001437148.1|  hypothetical protein ESA_01043 [Enterobac...  61.6    4e-08 Gene info
ref|ZP_04938651.1|  gp63 phage protein [Burkholderia cenocepac...  61.6    4e-08
ref|YP_001859583.1|  lambda tail assembly I [Burkholderia phym...  61.6    4e-08 Gene info
ref|YP_002412552.1|  Tail assembly protein I from putative pro...  61.2    5e-08 Gene info
ref|ZP_00134778.2|  COG4723: Phage-related protein, tail compo...  61.2    5e-08
ref|YP_003090194.1|  tail component protein gp18 [Burkholderia...  61.2    5e-08
ref|ZP_01363528.1|  hypothetical protein PaerPA_01000624 [Pseu...  61.2    5e-08
ref|YP_002410741.1|  Tail assembly protein I from putative pro...  61.2    5e-08 Gene info
ref|YP_002402167.1|  Tail assembly protein I [Escherichia coli...  60.8    6e-08 Gene info
ref|YP_003230110.1|  putative tail assembly protein [Escherich...  60.8    6e-08 Gene info
ref|YP_003227695.1|  putative tail assembly protein [Escherich...  60.8    7e-08 Gene info
ref|YP_003229218.1|  putative tail assembly protein [Escherich...  60.8    7e-08 Gene info
ref|YP_002293324.1|  putative phage tail component [Escherichi...  60.5    7e-08 Gene info
ref|NP_286527.1|  putative tail component of prophage CP-933K ...  60.5    8e-08 Gene info
ref|YP_544063.1|  putative tail component of prophage CP-933K ...  60.5    8e-08 Gene info
ref|YP_002328805.1|  predicted tail assembly protein [Escheric...  60.5    8e-08 Gene info
ref|YP_002292920.1|  putative phage tail component [Escherichi...  60.5    9e-08 Gene info
ref|YP_001346179.1|  putative bacteriophage protein [Pseudomon...  60.5    9e-08 Gene info
ref|NP_287598.1|  putative tail component of prophage CP-933O ...  60.5    9e-08 Gene info
ref|YP_002397457.1|  Tail assembly protein I [Escherichia coli...  60.1    1e-07 Gene info
ref|NP_755037.1|  putative tail component of prophage [Escheri...  60.1    1e-07 Gene info
ref|YP_002412182.1|  Tail assembly protein I [Escherichia coli...  60.1    1e-07 Gene info
ref|YP_002402762.1|  Tail assembly protein I from putative pro...  60.1    1e-07 Gene info
ref|YP_860047.1|  putative tail component of prophage CP-933K ...  59.7    1e-07 Gene info
ref|ZP_01764197.1|  bacteriophage lambda tail assembly protein...  59.7    1e-07
ref|YP_003221999.1|  putative tail assembly protein [Escherich...  59.7    1e-07 Gene info
ref|YP_669096.1|  tail assembly protein I [Escherichia coli 53...  59.7    2e-07 Gene info
ref|YP_003210124.1|  hypothetical protein Ctu_17610 [Cronobact...  59.7    2e-07 Gene info
ref|NP_753497.1|  putative tail component of prophage [Escheri...  59.7    2e-07 Gene info
ref|YP_001743263.1|  bacteriophage lambda tail assembly protei...  59.7    2e-07 Gene info
ref|NP_310189.1|  putative tail assembly protein [Escherichia ...  59.3    2e-07 Gene info
ref|XP_002338035.1|  predicted protein [Populus trichocarpa] >...  59.3    2e-07 Gene info
ref|ZP_05318259.1|  bacteriophage lambda tail assembly protein...  59.3    2e-07
ref|YP_002502067.1|  lambda tail assembly I [Methylobacterium ...  59.3    2e-07 Gene info
ref|NP_040599.1|  tail component [Enterobacteria phage lambda]...  59.3    2e-07 Gene info
ref|YP_002274203.1|  putative tail assembly protein [Enterobac...  59.3    2e-07 Gene info
ref|NP_459900.1|  putative phage tail assembly protein [Salmon...  59.3    2e-07 Gene info
ref|ZP_04576753.1|  bacteriophage lambda tail assembly protein...  59.3    2e-07
ref|YP_002501333.1|  lambda tail assembly I [Methylobacterium ...  59.3    2e-07 Gene info
ref|YP_003228670.1|  putative tail assembly protein [Escherich...  59.3    2e-07 Gene info
ref|YP_003237201.1|  putative tail assembly protein [Escherich...  58.9    2e-07 Gene info
ref|NP_249331.1|  putative bacteriophage protein [Pseudomonas ...  58.9    2e-07 Gene info
ref|NP_288647.1|  putative tail component of prophage CP-933V ...  58.9    2e-07 Gene info
ref|YP_002398026.1|  Tail assembly protein I [Escherichia coli...  58.9    2e-07 Gene info
ref|YP_001904732.1|  putative phage tail assembly protein I [X...  58.9    2e-07 Gene info
ref|YP_002406903.1|  Tail assembly protein I [Escherichia coli...  58.9    3e-07 Gene info
ref|YP_311289.1|  putative tail component of prophage [Shigell...  58.9    3e-07 Gene info
ref|YP_003221375.1|  putative tail assembly protein [Escherich...  58.9    3e-07 Gene info
ref|YP_002390408.1|  Tail assembly protein I [Escherichia coli...  58.5    3e-07 Gene info
ref|NP_461526.1|  tail assembly protein I-like [Salmonella typ...  58.5    3e-07 Gene info
gb|ACY87959.1|  tail assembly protein I-like protein [Salmonel...  58.5    3e-07
ref|NP_309674.1|  tail assembly protein [Escherichia coli O157...  58.5    3e-07 Gene info
ref|NP_309145.1|  putative tail assembly protein [Escherichia ...  58.5    3e-07 Gene info
emb|CAQ82055.1|  tail assembly protein I. [Enterobacteria phag...  58.5    3e-07
ref|YP_002498741.1|  lambda tail assembly I [Methylobacterium ...  58.5    3e-07 Gene info
ref|YP_003233947.1|  putative tail assembly protein [Escherich...  58.5    3e-07 Gene info
ref|YP_002397653.1|  Tail assembly protein I [Escherichia coli...  58.5    3e-07 Gene info
ref|ZP_03321024.1|  hypothetical protein PROVALCAL_03993 [Prov...  58.5    4e-07
ref|YP_002397076.1|  Tail assembly protein I [Escherichia coli...  58.2    4e-07 Gene info
ref|ZP_03084562.1|  putative tail assembly protein [Escherichi...  58.2    4e-07
ref|YP_003234435.1|  putative tail assembly protein [Escherich...  58.2    4e-07 Gene info
ref|YP_002412110.1|  Tail assembly protein I [Escherichia coli...  58.2    4e-07 Gene info
ref|YP_002402488.1|  Tail assembly protein I [Escherichia coli...  58.2    5e-07 Gene info
ref|YP_003227943.1|  putative tail assembly protein [Escherich...  57.8    5e-07 Gene info
ref|YP_002328597.1|  predicted tail assembly protein [Escheric...  57.8    5e-07 Gene info
ref|YP_003230607.1|  putative tail assembly protein [Escherich...  57.8    5e-07 Gene info
ref|ZP_03080599.1|  putative tail assembly protein [Escherichi...  57.8    5e-07
ref|ZP_03085362.1|  putative tail assembly protein [Escherichi...  57.8    6e-07
ref|YP_003222156.1|  putative tail assembly protein [Escherich...  57.8    6e-07 Gene info
ref|YP_001344548.1|  bacteriophage lambda tail assembly I [Act...  57.8    6e-07 Gene info
ref|YP_003221194.1|  putative tail assembly protein [Escherich...  57.4    6e-07 Gene info
ref|YP_001449308.1|  putative tail component [Phage BP-4795] >...  57.4    7e-07 Gene info
ref|YP_002328975.1|  predicted tail assembly protein [Escheric...  57.4    7e-07 Gene info
ref|YP_003229599.1|  putative tail assembly protein [Escherich...  57.4    7e-07 Gene info
ref|YP_003228287.1|  putative tail assembly protein [Escherich...  57.4    8e-07 Gene info
ref|NP_287968.1|  putative tail assembly protein of cryptic pr...  57.0    8e-07 Gene info
ref|ZP_04578709.1|  bacteriophage lambda tail assembly protein...  57.0    9e-07
ref|YP_003228557.1|  putative tail assembly protein [Escherich...  57.0    1e-06 Gene info
ref|ZP_04005848.1|  phage tail protein [Escherichia coli 83972...  56.6    1e-06
dbj|BAG66580.1|  putative tail assembly protein [Escherichia c...  56.6    1e-06
ref|YP_002328282.1|  predicted tail assembly protein [Escheric...  56.6    1e-06 Gene info
ref|YP_963835.1|  bacteriophage lambda tail assembly I [Shewan...  56.2    1e-06 Gene info
ref|YP_002499084.1|  lambda tail assembly I [Methylobacterium ...  56.2    2e-06 Gene info
ref|ZP_04938431.1|  Phage-related protein, tail component [Pse...  55.8    2e-06
ref|YP_540524.1|  putative tail component of prophage CP-933K ...  55.5    2e-06 Gene info
ref|YP_003228213.1|  putative tail assembly protein [Escherich...  55.5    3e-06 Gene info
ref|YP_002358541.1|  lambda tail assembly I [Shewanella baltic...  55.5    3e-06 Gene info
ref|ZP_02887101.1|  lambda tail assembly I [Burkholderia grami...  55.1    4e-06
ref|ZP_03084915.1|  putative tail assembly protein [Escherichi...  54.7    5e-06
ref|ZP_02478995.1|  bacteriophage lambda tail assembly I [Haem...  54.3    7e-06
ref|YP_001347792.1|  bacteriophage lambda tail assembly I [Pse...  53.5    1e-05 Gene info
ref|YP_001908344.1|  Putative phage tail assembly protein [Erw...  53.5    1e-05 Gene info
gb|ACD38862.1|  phage-related protein tail component [Pseudomo...  53.1    1e-05
ref|YP_003220784.1|  putative tail assembly protein [Escherich...  53.1    2e-05 Gene info
ref|YP_974947.1|  putative phage-related protein [Neisseria me...  52.8    2e-05 Gene info
gb|ACD38789.1|  phage tail assembly protein [Pseudomonas aerug...  52.8    2e-05
ref|ZP_03719879.1|  hypothetical protein NEIFLAOT_01731 [Neiss...  52.4    2e-05
ref|ZP_03028754.1|  bacteriophage lambda tail assembly protein...  52.4    2e-05
ref|YP_002475191.1|  bacteriophage lambda tail assembly I [Hae...  52.4    2e-05 Gene info
ref|ZP_02992860.1|  bacteriophage lambda tail assembly protein...  51.6    4e-05
ref|ZP_03047487.1|  bacteriophage lambda tail assembly protein...  51.6    4e-05
ref|ZP_04561640.1|  gp20 [Citrobacter sp. 30_2] >gb|EEH92616.1...  51.2    5e-05
ref|ZP_03007387.1|  bacteriophage lambda tail assembly protein...  51.2    5e-05
ref|ZP_03007071.1|  bacteriophage lambda tail assembly protein...  51.2    5e-05
ref|ZP_02808391.2|  bacteriophage lambda tail assembly protein...  50.8    6e-05
ref|YP_407662.1|  putative tail component [Shigella boydii Sb2...  50.8    6e-05 Gene info
ref|YP_001879747.1|  bacteriophage lambda tail assembly protei...  50.8    7e-05 Gene info
ref|YP_001725075.1|  lambda tail assembly I [Escherichia coli ...  50.8    7e-05 Gene info
ref|ZP_03006942.1|  bacteriophage lambda tail assembly protein...  50.8    7e-05
ref|ZP_02992920.1|  bacteriophage lambda tail assembly protein...  50.8    7e-05
ref|ZP_03043687.1|  bacteriophage lambda tail assembly protein...  50.8    7e-05
ref|ZP_03007739.1|  bacteriophage lambda tail assembly protein...  50.8    8e-05
ref|ZP_03007785.1|  bacteriophage lambda tail assembly protein...  50.4    8e-05
ref|ZP_03043965.1|  bacteriophage lambda tail assembly protein...  50.4    8e-05
ref|ZP_03007725.1|  bacteriophage lambda tail assembly protein...  50.4    8e-05
ref|NP_706645.1|  putative tail component [Shigella flexneri 2...  50.4    9e-05 Gene info
ref|YP_963888.1|  bacteriophage lambda tail assembly I [Shewan...  50.4    9e-05 Gene info
ref|ZP_03060487.1|  bacteriophage lambda tail assembly protein...  50.4    9e-05
ref|ZP_02992815.1|  bacteriophage lambda tail assembly protein...  50.4    9e-05
ref|ZP_03008077.1|  bacteriophage lambda tail assembly protein...  50.4    1e-04
ref|ZP_04578708.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|ZP_03034693.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|ZP_03069285.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|ZP_03007287.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|ZP_02904478.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|ZP_03007141.1|  bacteriophage lambda tail assembly protein...  50.1    1e-04
ref|YP_355398.1|  gp63 [Burkholderia phage Bcep176] >ref|YP_00...  49.7    1e-04 Gene info
ref|NP_037681.1|  gp21 [Enterobacteria phage HK022] >ref|NP_03...  49.7    1e-04 Gene info
ref|ZP_03052361.1|  bacteriophage lambda tail assembly protein...  49.7    1e-04
ref|ZP_02992983.1|  bacteriophage lambda tail assembly protein...  49.7    1e-04
ref|ZP_03059270.1|  bacteriophage lambda tail assembly protein...  49.7    1e-04
ref|ZP_03008023.1|  bacteriophage lambda tail assembly protein...  49.7    2e-04
ref|NP_286900.1|  putative tail component encoded by cryptic p...  49.7    2e-04 Gene info
ref|ZP_05939690.1|  putative tail component of prophage CP-933...  49.7    2e-04
ref|ZP_03051019.1|  bacteriophage lambda tail assembly protein...  49.7    2e-04
ref|ZP_03048577.1|  bacteriophage lambda tail assembly protein...  49.7    2e-04
ref|ZP_03008090.1|  bacteriophage lambda tail assembly protein...  49.7    2e-04
ref|ZP_04952504.1|  bacteriophage lambda tail assembly protein...  49.3    2e-04
ref|ZP_02992770.1|  bacteriophage lambda tail assembly protein...  49.3    2e-04
ref|ZP_03045668.1|  bacteriophage lambda tail assembly protein...  49.3    2e-04
ref|ZP_03007805.1|  bacteriophage lambda tail assembly protein...  49.3    2e-04
ref|YP_001053232.1|  putative phage tail assembly protein [Act...  49.3    2e-04 Gene info
ref|ZP_01791546.1|  prophage LambdaSo, tail assembly protein I...  49.3    2e-04
ref|ZP_04521102.1|  bacteriophage lambda tail assembly protein...  49.3    2e-04
ref|NP_753374.1|  putative tail assembly protein of cryptic pr...  49.3    2e-04 Gene info
ref|ZP_04576752.1|  gp19 [Oxalobacter formigenes HOxBLS] >gb|E...  48.9    2e-04
ref|ZP_03052242.1|  bacteriophage lambda tail assembly protein...  48.9    3e-04
ref|YP_003037059.1|  lambda tail assembly I [Escherichia coli ...  48.9    3e-04 Gene info
ref|YP_003007012.1|  putative phage tail assembly protein [Agg...  48.9    3e-04 Gene info
ref|ZP_03052184.1|  bacteriophage lambda tail assembly protein...  48.9    3e-04
ref|ZP_03034619.1|  bacteriophage lambda tail assembly protein...  48.9    3e-04
ref|ZP_03062556.1|  bacteriophage lambda tail assembly protein...  48.9    3e-04
ref|ZP_03051422.1|  bacteriophage lambda tail assembly protein...  48.9    3e-04
ref|ZP_03050523.1|  bacteriophage lambda tail assembly protein...  48.5    3e-04
gb|AAC13231.1|  unknown [Yersinia pestis KIM]                      48.5    3e-04 Gene info
ref|NP_836423.1|  putative tail component [Shigella flexneri 2...  48.5    3e-04 Gene info
ref|NP_395343.1|  putative phage tail protein [Yersinia pestis...  48.5    3e-04 Gene info
ref|YP_260846.1|  prophage LambdaSo, tail assembly protein I [...  48.1    4e-04 Gene info
ref|ZP_05860262.1|  prophage PSPPH03, putative tail assembly p...  48.1    4e-04
ref|ZP_05951156.1|  putative tail component of prophage CP-933...  48.1    5e-04
ref|ZP_02774800.1|  bacteriophage lambda tail assembly protein...  47.8    5e-04
ref|YP_006600.1|  Gp20 [Klebsiella phage phiKO2] >gb|AAR83036....  47.8    5e-04 Gene info
ref|NP_945049.1|  gp19 [Burkholderia phage phi1026b] >gb|AAR23...  47.8    5e-04 Gene info
ref|NP_046915.1|  gp20 [Enterobacteria phage N15] >gb|AAC19056...  47.8    6e-04 Gene info
ref|NP_569525.1|  putative phage tail protein [Salmonella ente...  47.8    6e-04 Gene info
ref|NP_536376.1|  putative tail component protein [Burkholderi...  47.8    6e-04 Gene info
ref|ZP_02367124.1|  Bacteriophage lambda tail assembly protein...  47.8    6e-04
ref|YP_310685.1|  putative tail component of prophage [Shigell...  47.4    7e-04 Gene info
ref|ZP_05940216.1|  tail assembly protein I [Escherichia coli ...  47.4    8e-04
ref|ZP_03007088.1|  bacteriophage lambda tail assembly protein...  47.0    0.001
ref|ZP_02992923.1|  bacteriophage lambda tail assembly protein...  47.0    0.001
ref|YP_333096.1|  bacteriophage lambda tail assembly protein I...  46.6    0.001 Gene info
ref|ZP_02825759.1|  bacteriophage lambda tail assembly protein...  46.2    0.002
ref|YP_439258.1|  bacteriophage lambda tail assembly protein I...  46.2    0.002 Gene info
ref|YP_001176945.1|  bacteriophage lambda tail assembly I [Ent...  45.8    0.002 Gene info
ref|YP_002358491.1|  lambda tail assembly I [Shewanella baltic...  45.8    0.002 Gene info
ref|YP_002292727.1|  putative phage tail component [Escherichi...  45.8    0.002 Gene info
ref|ZP_05951548.1|  tail assembly protein I [Escherichia coli ...  45.8    0.002
ref|YP_001880078.1|  bacteriophage lambda tail assembly protei...  45.1    0.003 Gene info
ref|YP_277443.1|  hypothetical tail assembly protein I [Entero...  45.1    0.004 Gene info
ref|YP_001285539.1|  gp49 [Enterobacteria phage TLS] >gb|AAR09...  45.1    0.004 Gene info
ref|ZP_02775330.1|  bacteriophage lambda tail assembly protein...  44.7    0.004
emb|CAH23258.1|  putative tail fiber component I [Bacteriophag...  44.7    0.005
ref|YP_001111099.1|  gp20, bacteriophage lambda tail assembly ...  44.7    0.005 Gene info
ref|YP_002638244.1|  Gifsy-2 prophage probable tail assembly p...  44.7    0.005 Gene info
ref|ZP_02574509.1|  bacteriophage lambda tail assembly protein...  44.3    0.006
ref|YP_398986.1|  putative tail assembly protein [Enterobacter...  44.3    0.006 Gene info
ref|ZP_02370531.1|  Bacteriophage lambda tail assembly protein...  44.3    0.006
ref|ZP_04933718.1|  hypothetical protein PA2G_01043 [Pseudomon...  44.3    0.007
ref|NP_718510.1|  prophage LambdaSo, tail assembly protein I [...  43.9    0.007 Gene info
ref|NP_288442.1|  putative tail fiber component I of prophage ...  43.9    0.008 Gene info
ref|YP_001992947.1|  putative phage HK022 GP20-related protein...  43.5    0.010 Gene info
ref|ZP_02389686.1|  Bacteriophage lambda tail assembly protein...  43.1    0.012
ref|ZP_02359361.1|  Bacteriophage lambda tail assembly protein...  42.7    0.020
ref|YP_001006526.1|  putative phage tail assembly protein [Yer...  42.4    0.021 Gene info
ref|ZP_03062491.1|  bacteriophage lambda tail assembly protein...  42.4    0.022
ref|YP_002720061.1|  putative phage tail assembly protein I [E...  42.4    0.023 Gene info
ref|ZP_02668765.1|  bacteriophage lambda tail assembly protein...  42.0    0.029
ref|YP_216220.1|  Gifsy-1 prophage VtiI [Salmonella enterica s...  41.6    0.037 Gene info
ref|ZP_02833831.2|  bacteriophage lambda tail assembly protein...  41.6    0.040
gb|ACV84113.1|  gp21 [Sodalis phage SO-1]                          41.6    0.045
ref|ZP_04623739.1|  Bacteriophage lambda tail assembly I [Yers...  41.2    0.049
ref|YP_003911.1|  putative tail assembly protein [Enterobacter...  41.2    0.049 Gene info
ref|ZP_03047855.1|  bacteriophage lambda tail assembly protein...  40.8    0.061
ref|YP_002113670.1|  bacteriophage lambda tail assembly protei...  40.8    0.064 Gene info
ref|YP_002041855.1|  bacteriophage lambda tail assembly protei...  40.8    0.066 Gene info
ref|ZP_05729190.1|  lambda tail assembly I [Pantoea sp. At-9b]...  40.8    0.067
ref|ZP_04537306.1|  tail assembly protein I [Escherichia sp. 3...  40.4    0.083
ref|ZP_03216927.1|  bacteriophage lambda tail assembly protein...  39.3    0.20 
ref|YP_454770.1|  putative phage tail assembly protein [Sodali...  39.3    0.21  Gene info
ref|YP_002215258.1|  bacteriophage lambda tail assembly protei...  38.9    0.28  Gene info
ref|NP_669499.1|  phage tail protein [Yersinia pestis KIM] >re...  38.9    0.28  Gene info
ref|YP_349350.1|  heavy metal efflux pump CzcA [Pseudomonas fl...  38.1    0.51  Gene info
ref|ZP_03161882.1|  bacteriophage lambda tail assembly protein...  37.0    0.97 
ref|YP_383276.1|  CoA-binding protein [Geobacter metallireduce...  37.0    1.1   Gene info
ref|ZP_05988949.1|  bacteriophage lambda tail assembly I [Mann...  36.6    1.2  
ref|ZP_04535751.1|  conserved hypothetical protein [Escherichi...  36.6    1.4  
ref|ZP_05733075.2|  cation efflux family protein [Dialister in...  35.8    2.0  
emb|CAD92752.1|  hypothetical protein [Pasteurella multocida]      35.8    2.1  
ref|ZP_02960020.1|  hypothetical protein PROSTU_01921 [Provide...  35.4    2.6  
ref|YP_002928932.1|  Tail assembly protein I [Escherichia coli...  35.4    2.9   Gene info
ref|ZP_03931368.1|  phosphate ABC superfamily ATP binding cass...  35.0    4.0  
ref|ZP_04589605.1|  phage tail assembly protein [Pseudomonas s...  34.7    4.8  
gb|EER29495.1|  hypothetical protein CPC735_071770 [Coccidioid...  34.7    4.8  
ref|ZP_03216333.1|  gp28 [Salmonella enterica subsp. enterica ...  34.7    5.3  
ref|YP_002574459.1|  protein of unknown function DUF554 [Anaer...  34.7    5.6   Gene info
ref|ZP_05082942.1|  ABC transporter permease protein [Pseudovi...  34.3    6.6  
gb|EAZ13474.1|  hypothetical protein OsJ_03390 [Oryza sativa J...  33.9    8.0  
ref|XP_678945.1|  diacylglycerol kinase [Plasmodium berghei st...  33.9    8.0   Gene info
ref|NP_838881.1|  homoserine O-succinyltransferase [Shigella f...  33.9    8.7   Gene info
ref|ZP_04655868.1|  hypothetical protein SentesTe_12996 [Salmo...  33.9    8.9  
ref|ZP_02904351.1|  homoserine O-succinyltransferase [Escheric...  33.9    8.9  
ref|YP_002385082.1|  homoserine O-succinyltransferase [Escheri...  33.9    9.0   Gene info
ref|YP_405713.1|  homoserine O-succinyltransferase [Shigella d...  33.9    9.0   Gene info
ref|NP_756822.1|  homoserine O-succinyltransferase [Escherichi...  33.9    9.0   Gene info
ref|YP_001465505.1|  homoserine O-succinyltransferase [Escheri...  33.9    9.2   Gene info
ref|YP_410297.1|  homoserine O-succinyltransferase [Shigella b...  33.9    9.2   Gene info
ref|YP_312921.1|  homoserine O-succinyltransferase [Shigella s...  33.9    9.6   Gene info
ref|YP_224166.1|  gp28 [Enterobacteria phage ES18] >gb|AAW7049...  33.9    9.7   Gene info
ref|NP_290640.1|  homoserine O-succinyltransferase [Escherichi...  33.5    9.9   Gene info

>ref|ZP_04752848.1|  bacteriophage lambda tail assembly I [Actinobacillus minor NM305]
 gb|EER47775.1|  bacteriophage lambda tail assembly I [Actinobacillus minor NM305]
Length=215

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 96/199 (48%), Gaps = 22/199 (11%)

Query  6    KIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVIT---  62
            K+  YG L++F G+K FE+D    AE    L    K +++ +    Y +++GS+ I    
Sbjct  3    KVRFYGALKQF-GEK-FELDCQDTAEVLRALMTQLKGLRQALQNGFYKVRIGSQCIDSRY  60

Query  63   -EDLLNIQTKEN--IKIIPVVHG----NFFSIVLGFAL-----KYGAKEYIKNKIIQTVV  110
             E  L  + KE   + I PVV G      F  VLG AL       G    +  K    ++
Sbjct  61   LEKGLYYRLKEGMTVHITPVVKGAKRAGVFQAVLGVALVGAAILLGPVGGVIGKSAALML  120

Query  111  TYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYG  170
              +G +++L GV ++L     T +P+   +   +   S+ SF  L N++  G  + L YG
Sbjct  121  GGMGASMMLGGVAQML-----TKMPSMGGAGKEAEKKSSTSFNSLQNMAAQGQSVPLAYG  175

Query  171  EILVGSIVVSNGVDTVQVE  189
             ILVGS+++S GV+    E
Sbjct  176  RILVGSMIISQGVEVFDAE  194


>ref|YP_002150297.1| Gene info phage tail assembly protein [Proteus mirabilis HI4320]
 ref|ZP_03842761.1|  phage tail protein [Proteus mirabilis ATCC 29906]
 emb|CAR41274.1| Gene info putative phage tail assembly protein [Proteus mirabilis HI4320]
 gb|EEI46377.1|  phage tail protein [Proteus mirabilis ATCC 29906]
Length=195

 GENE ID: 6800671 PMI0526 | phage tail assembly protein
[Proteus mirabilis HI4320] (10 or fewer PubMed links)

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 96/200 (48%), Gaps = 29/200 (14%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEA---FSFLYCNFKNI--QEHMAEQLYVIKVGS  58
            LK I +YG L    G +E ++D++SP EA    S LY  F+      H+    + +  G 
Sbjct  3    LKTIRLYGVLGAKFG-REHKLDIDSPREAIKALSVLYDGFELFLANAHLKGLEFAVFKGK  61

Query  59   KVITEDLLNIQTKENIKIIPVV----HGNFFSIVLGFAL-------KYGAKEYIKNKIIQ  107
            + I ED L++ TKE I+I P++     G FF  +LG A+        +G   +  +    
Sbjct  62   RNIAEDELHLDTKEEIRIAPIIKGSKRGGFFQTMLGIAMIGVATFAPWGTALFASD----  117

Query  108  TVVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINL  167
             ++  IG  + L GV ++L+PQ     P G      S    +Y+F G  N +  G P+ L
Sbjct  118  -LIGAIGLGVALGGVYQMLSPQ-----PRGLSMRQDSDNKPSYAFGGAVNSTAQGNPVPL  171

Query  168  VYG--EILVGSIVVSNGVDT  185
            +YG     VG  ++S G+ T
Sbjct  172  LYGLDRREVGGAIISAGIYT  191


>ref|ZP_04976626.1|  possible bacteriophage tail protein [Mannheimia haemolytica PHL213]
 gb|EDN73022.1|  possible bacteriophage tail protein [Mannheimia haemolytica PHL213]
Length=208

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 98/202 (48%), Gaps = 24/202 (11%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITE  63
            + KI  YG L+KF    EF +++   AEA   L      ++E + + +Y +++G + +  
Sbjct  1    MTKIKFYGNLKKF--GSEFSLEVKDTAEAIRALCTQISGLREALRDGVYKVRIGKQYLDP  58

Query  64   DLLN------IQTKENIKIIPVVHG----NFFSIVLGFALKYGAKEYIKNKIIQT-----  108
              L       ++  + I   PV+ G      F+ VLG AL  GA  +     I       
Sbjct  59   SALEKGLFYCLKKGQTIHFTPVIKGAKSGGVFNFVLGAAL-IGAAFFTGGASIAAWGAGA  117

Query  109  -VVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINL  167
             ++  +G +++L GV+++L     T +P      + +   S+ +F+ L N+   G P+ L
Sbjct  118  KMMGMLGASMLLGGVSQML-----TKMPKAPTMGNETEKESSTAFSNLNNLVTQGKPVPL  172

Query  168  VYGEILVGSIVVSNGVDTVQVE  189
             YG I  GS+V+S GV+T+ ++
Sbjct  173  AYGLIRTGSLVISQGVETITIK  194


>ref|ZP_03317875.1|  hypothetical protein PROVALCAL_00795 [Providencia alcalifaciens 
DSM 30120]
 gb|EEB47086.1|  hypothetical protein PROVALCAL_00795 [Providencia alcalifaciens 
DSM 30120]
Length=201

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 98/203 (48%), Gaps = 29/203 (14%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEA---FSFLYCNFKNI--QEHMAEQLYVIKVGS  58
            LK I +YG L    G +E  + ++SP EA    S LY  F+      H+    + +  G 
Sbjct  3    LKTIQLYGVLGTQFG-REHRLAIDSPREAIKALSVLYDGFEQFLANAHLKGLEFAVFKGK  61

Query  59   KVITEDLLNIQTKENIKIIPVV----HGNFFSIVLGFALKYGAKEYIKNKI---------  105
            + I ED L + T E+I+I+PV+     G FF  +LG AL  GA  ++   +         
Sbjct  62   RNIKEDELYLDTSEDIRIVPVIKGSKRGGFFQTILGVAL-IGAAAFLSGGLSVAFTAVGA  120

Query  106  IQTVVTYIGTTLILQGVNEILAPQENTNLPTGQDSLD-PSALASNYSFTGLTNISNAGVP  164
                +   G  + L GV ++L+PQ    L   QD+ + PS     Y+F G+ N ++ G P
Sbjct  121  WGGALAMSGAAMALGGVVQMLSPQPQ-GLSMRQDADNKPS-----YAFGGVVNTTSQGNP  174

Query  165  INLVYG--EILVGSIVVSNGVDT  185
            + L+YG     VG  ++S G+ T
Sbjct  175  VPLLYGLERREVGGAIISAGIYT  197


>ref|ZP_05991699.1|  bacteriophage tail protein [Mannheimia haemolytica serotype A2 
str. OVINE]
 gb|EEY10319.1|  bacteriophage tail protein [Mannheimia haemolytica serotype A2 
str. OVINE]
Length=209

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 94/202 (46%), Gaps = 23/202 (11%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITE  63
            + KI  YG L+KF    EF +++   AEA   L      ++E + + +Y +++G + +  
Sbjct  1    MTKIKFYGNLKKF--GSEFSLEVKDTAEAIRALCTQISGLREALRDGVYKVRIGKQYLDP  58

Query  64   DLLN------IQTKENIKIIPVVHG----NFFSIVLGFALKYGAKEY------IKNKIIQ  107
              L       ++  + I   PVV G      F  VLG AL   A         +      
Sbjct  59   SALEKGLFYCLKKGQTIHFTPVVKGAKSGGIFQAVLGVALIGAAFALGPIGLGLVGSATA  118

Query  108  TVVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINL  167
              V  +G +++L GV+++L     T +P      + +   S+ +F+ L N+   G P+ L
Sbjct  119  MTVGAMGASMLLGGVSQML-----TKMPKAPTMGNETEKESSTAFSNLNNLVAQGKPVPL  173

Query  168  VYGEILVGSIVVSNGVDTVQVE  189
             YG I  GS+V+S GV+T+ ++
Sbjct  174  AYGLIRTGSLVISQGVETITIK  195


>ref|ZP_02962279.1|  hypothetical protein PROSTU_04387 [Providencia stuartii ATCC 
25827]
 gb|EDU57611.1|  hypothetical protein PROSTU_04387 [Providencia stuartii ATCC 
25827]
Length=197

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 96/198 (48%), Gaps = 23/198 (11%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEA---FSFLYCNFKNI--QEHMAEQLYVIKVGS  58
            LK I +YG L    G +E ++D++SP EA    S LY  F+      H+    + +  G 
Sbjct  3    LKTIRLYGVLGAKFG-REHKLDIDSPREAIKALSVLYDGFEQFLANAHLKGLEFAVFKGK  61

Query  59   KVITEDLLNIQTKENIKIIPVV----HGNFFSIVLGFAL----KYGAKEYIKNKIIQTVV  110
            + I+ED L++ T E+I+I P++     G FF  VLG A+     +       +    + +
Sbjct  62   RNISEDELHLDTTEDIRIAPIIKGSKRGGFFQTVLGIAMIGLAVWNPAFLAMSATTNSAL  121

Query  111  TYIGTTLILQGVNEILAPQENTNLPTGQDSLD-PSALASNYSFTGLTNISNAGVPINLVY  169
               G  + + G+ ++L+PQ    L   QD+ + PS     Y+F G  N +  G P+ L Y
Sbjct  122  MLGGAAMAIGGIVQMLSPQPR-GLSIRQDADNKPS-----YAFGGTVNTTAQGNPVPLFY  175

Query  170  G--EILVGSIVVSNGVDT  185
            G     +G  ++S G+ T
Sbjct  176  GLDRREIGGAIISAGIYT  193


>ref|ZP_03318821.1|  hypothetical protein PROVALCAL_01760 [Providencia alcalifaciens 
DSM 30120]
 gb|EEB46302.1|  hypothetical protein PROVALCAL_01760 [Providencia alcalifaciens 
DSM 30120]
Length=201

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 95/203 (46%), Gaps = 29/203 (14%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEA---FSFLYCNFKNI--QEHMAEQLYVIKVGS  58
            LK I +YG L    G +E ++ ++SP EA    S LY  F+      H+    + +  G 
Sbjct  3    LKTIRLYGVLGTQFG-REHQLAIDSPREAIKALSVLYDGFEQFLANAHLKGLEFAVFKGQ  61

Query  59   KVITEDLLNIQTKENIKIIPVV----HGNFFSIVLGFALKYGAKEYIKN--KIIQTVVTY  112
            + I ED L++ T E I+I PV+     G FF  +LG AL  GA  ++     +  T    
Sbjct  62   RNIAEDELHLDTSEEIRIAPVIKGSKRGGFFQTILGVAL-IGAAAFLSGGLSVAFTAAGT  120

Query  113  IGTTLILQGVN-------EILAPQENTNLPTGQDSLD-PSALASNYSFTGLTNISNAGVP  164
             G  L L G         ++L+PQ    L   QD+ + PS     Y+F G  N +  G P
Sbjct  121  WGGALALSGAAMAIGGLVQMLSPQPQ-GLSMRQDADNKPS-----YAFGGAVNTTAQGNP  174

Query  165  INLVYG--EILVGSIVVSNGVDT  185
            + L+YG     VG  ++S G+ T
Sbjct  175  VPLLYGLDRREVGGAIISAGIYT  197


>ref|NP_519817.1| Gene info phage HK022 GP20-like protein [Ralstonia solanacearum GMI1000]
 emb|CAD15398.1| Gene info probable phage hk022 gp20-related protein [Ralstonia solanacearum 
GMI1000]
Length=200

 GENE ID: 1220532 RSc1696 | phage HK022 GP20-like protein
[Ralstonia solanacearum GMI1000] (10 or fewer PubMed links)

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 91/196 (46%), Gaps = 22/196 (11%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQ-----LYVIKVGS  58
            ++ + +YG+L    G + F + + SPAEA   L    ++ +  +A        Y   VG 
Sbjct  5    IRTVRLYGRLGARFG-RVFRLAVGSPAEAVRALCAQVEDFRRELATSHERGIRYACFVGR  63

Query  59   KVITEDLLNIQT-KENIKIIPVVHG----NFFSIVLGFALKYGAKEYIKNKIIQTVVTYI  113
            + I +  L +    ++I+I PV+ G      F  +LG  L   A  Y           + 
Sbjct  64   RNIGQSELELPPGADDIRIAPVLAGAKQAGLFQTILGAVLIAAATFYTGGLAGIGSGGFG  123

Query  114  GT------TLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINL  167
            G       ++ L GV ++L+PQ+      G  + D     ++Y+F G  N S  G P+ L
Sbjct  124  GFMGAMGVSMALGGVMQMLSPQQ-----AGLSASDSPDNGASYNFNGPVNTSAQGNPVPL  178

Query  168  VYGEILVGSIVVSNGV  183
            +YGE++VGS V+S G+
Sbjct  179  LYGEMVVGSAVISAGI  194


>ref|ZP_04978010.1|  bacteriophage tail protein [Mannheimia haemolytica PHL213]
 gb|EDN74406.1|  bacteriophage tail protein [Mannheimia haemolytica PHL213]
Length=209

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 23/196 (11%)

Query  10   YGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITEDLLN--  67
            YG L+ F    +F++ +   AEA   L    K ++E + + +Y +++G + +    L   
Sbjct  7    YGHLKTF--GTDFKILVKDIAEAIRALCSQLKGLREALRDGVYKVRIGKQYLDPSALEKG  64

Query  68   ----IQTKENIKIIPVVHG----NFFSIVLGFALKYGAKEY------IKNKIIQTVVTYI  113
                ++  + I   PVV G      F  VLG AL   A         +        V  +
Sbjct  65   LFYCLKKGQTIHFTPVVKGAKSGGIFQAVLGVALIGAAFALGPIGLGLVGSATAMTVGAM  124

Query  114  GTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYGEIL  173
            G +++L GV+++L     T +P      + +   S+ +F+ L N+   G P+ L YG I 
Sbjct  125  GASMLLGGVSQML-----TKMPKAPTMGNETEKESSTAFSNLNNLVAQGKPVPLAYGLIR  179

Query  174  VGSIVVSNGVDTVQVE  189
             GS+V+S GV+T+ ++
Sbjct  180  TGSLVISQGVETITIK  195


>ref|YP_002291886.1| Gene info putative phage tail fiber component [Escherichia coli SE11]
 dbj|BAG76135.1| Gene info putative phage tail fiber component [Escherichia coli SE11]
Length=223

 GENE ID: 6998982 ECSE_0611 | putative phage tail fiber component
[Escherichia coli SE11]

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 91/204 (44%), Gaps = 28/204 (13%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITE  63
            + +I +YG L++F   +  ++ + + AEA   L       ++ +++  Y +++  + ++ 
Sbjct  14   MARICLYGDLQRF--GRRIDLRVKTGAEAIRALATQLPAFRQKLSDGWYQVRIAGRDVST  71

Query  64   DLLNIQTKEN------IKIIPVV----HGNFFSIVLGFA------LKYGAKEYIKNKIIQ  107
              L  Q  E       I I+P V     G  F IVLG A         GA        I 
Sbjct  72   SGLTAQLHETLPDGAVIHIVPRVAGAKSGGVFQIVLGAAAIAGSFFTAGATLAAWGAAIG  131

Query  108  T-----VVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAG  162
            T     ++  +G +++L GV ++LAP+  T      D+        N  F+ L N+   G
Sbjct  132  TGGMTGILFSLGASMVLGGVAQMLAPKARTPTAASTDNGK-----QNTYFSSLDNMVAQG  186

Query  163  VPINLVYGEILVGSIVVSNGVDTV  186
              + ++YGE+ VGS VVS  + T 
Sbjct  187  NVLPVLYGEMRVGSRVVSQEISTA  210


b: Blast Swissprot

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P03730.1|VTAI_LAMBD  RecName: Full=Tail assembly protein I      59.3    1e-08 Gene info
sp|Q0SXZ2.1|META_SHIF8  RecName: Full=Homoserine O-succinyltra...  33.9    0.59  Gene info
sp|B7LKA1.1|META_ESCF3  RecName: Full=Homoserine O-succinyltra...  33.9    0.61  Gene info
sp|Q328N3.1|META_SHIDS  RecName: Full=Homoserine O-succinyltra...  33.9    0.61  Gene info
sp|Q8FB64.3|META_ECOL6  RecName: Full=Homoserine O-succinyltra...  33.9    0.61 
sp|A7ZUM6.1|META_ECO24  RecName: Full=Homoserine O-succinyltra...  33.9    0.62  Gene info
sp|Q31TY9.1|META_SHIBS  RecName: Full=Homoserine O-succinyltra...  33.9    0.62  Gene info
sp|Q3YUX6.1|META_SHISS  RecName: Full=Homoserine O-succinyltra...  33.9    0.65  Gene info
sp|Q8X610.2|META_ECO57  RecName: Full=Homoserine O-succinyltra...  33.5    0.67 
sp|A4J5Z6.1|HSLV_DESRM  RecName: Full=ATP-dependent protease hslV  33.1    0.89  Gene info
sp|B1IUN9.1|META_ECOLC  RecName: Full=Homoserine O-succinyltra...  32.7    1.4   Gene info
sp|P07623.4|META_ECOLI  RecName: Full=Homoserine O-succinyltra...  32.7    1.5  
sp|Q2NQZ8.1|META_SODGM  RecName: Full=Homoserine O-succinyltra...  32.0    2.0   Gene info
sp|A8ERN6.1|Y335_ARCB4  RecName: Full=UPF0059 membrane protein...  31.6    2.8   Gene info
sp|A1JRX9.1|META_YERE8  RecName: Full=Homoserine O-succinyltra...  31.6    2.8   Gene info
sp|Q80WE1.2|FMR1_RAT  RecName: Full=Fragile X mental retardati...  31.2    4.0   Gene info
sp|Q9TKY0.1|NDHK_NEPOL  RecName: Full=NAD(P)H-quinone oxidored...  30.8    4.9   Gene info
sp|Q7TN83.1|SYT16_MOUSE  RecName: Full=Synaptotagmin-16; AltNa...  30.8    5.1   Gene info
sp|Q98T94.1|GLIS2_XENLA  RecName: Full=Zinc finger protein GLI...  30.8    5.5   Gene info
sp|A8GKF8.1|META_SERP5  RecName: Full=Homoserine O-succinyltra...  30.4    6.8   Gene info
sp|Q13075.3|BIRC1_HUMAN  RecName: Full=Baculoviral IAP repeat-...  30.0    8.2   Gene info
sp|B1L9R3.1|GLGC_THESQ  RecName: Full=Glucose-1-phosphate aden...  30.0    8.9   Gene info


>sp|P03730.1|VTAI_LAMBD Gene info RecName: Full=Tail assembly protein I
Length=223

 GENE ID: 2703515 I | tail component [Enterobacteria phage lambda]
(Over 10 PubMed links)

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 93/204 (45%), Gaps = 28/204 (13%)

Query  4    LKKIIVYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITE  63
            + +I +YG L++F   +  ++ + + AEA   L       ++ +++  Y +++  + ++ 
Sbjct  14   MARICLYGDLQRF--GRRIDLRVKTGAEAIRALATQLPAFRQKLSDGWYQVRIAGRDVST  71

Query  64   DLLNIQTKEN------IKIIPVV----HGNFFSIVLGFALKYGA-----------KEYIK  102
              L  Q  E       I I+P V     G  F IVLG A   G+              I 
Sbjct  72   SGLTAQLHETLPDGAVIHIVPRVAGAKSGGVFQIVLGAAAIAGSFFTAGATLAAWGAAIG  131

Query  103  NKIIQTVVTYIGTTLILQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAG  162
               +  ++  +G +++L GV ++LAP+  T  P  Q + +      N  F+ L N+   G
Sbjct  132  AGGMTGILFSLGASMVLGGVAQMLAPKART--PRIQTTDNGK---QNTYFSSLDNMVAQG  186

Query  163  VPINLVYGEILVGSIVVSNGVDTV  186
              + ++YGE+ VGS VVS  + T 
Sbjct  187  NVLPVLYGEMRVGSRVVSQEISTA  210


>sp|Q0SXZ2.1|META_SHIF8 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 4210923 metA | homoserine O-succinyltransferase
[Shigella flexneri 5 str. 8401] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|B7LKA1.1|META_ESCF3 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 7121863 metA | homoserine O-succinyltransferase
[Escherichia fergusonii ATCC 35469]

 Score = 33.9 bits (76),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|Q328N3.1|META_SHIDS Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B6I5M1.1|META_ECOSE  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 3797901 metA | homoserine O-succinyltransferase
[Shigella dysenteriae Sd197] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|Q8FB64.3|META_ECOL6  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|Q1R3T4.1|META_ECOUT Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|Q0TA56.1|META_ECOL5 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|A1AII3.1|META_ECOK1 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7MIZ5.1|META_ECO45 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7UPG4.1|META_ECO27 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7MRD7.1|META_ECO81  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 Score = 33.9 bits (76),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|A7ZUM6.1|META_ECO24 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|A8A7A9.1|META_ECOHS Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7M7R7.1|META_ECO8A Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7LAV1.1|META_ECO55 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 5586756 metA | homoserine O-succinyltransferase
[Escherichia coli E24377A]

 Score = 33.9 bits (76),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|Q31TY9.1|META_SHIBS Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7NFU9.1|META_ECOLU Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B2TWJ5.1|META_SHIB3  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 3783016 metA | homoserine O-succinyltransferase
[Shigella boydii Sb227] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|Q3YUX6.1|META_SHISS Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 3669065 metA | homoserine O-succinyltransferase
[Shigella sonnei Ss046] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|Q8X610.2|META_ECO57  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B7NRU2.1|META_ECO7I Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B1LPH0.1|META_ECOSM Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B5Z0A5.1|META_ECO5E  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 Score = 33.5 bits (75),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQE
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQE  97


>sp|A4J5Z6.1|HSLV_DESRM Gene info RecName: Full=ATP-dependent protease hslV
Length=176

 GENE ID: 4958112 Dred_1981 | ATP-dependent protease peptidase subunit
[Desulfotomaculum reducens MI-1]

 Score = 33.1 bits (74),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 7/89 (7%)

Query  81   HGNFFSIVLGFALKYGAKEYIKNKIIQTVVTYIGTTLILQGVNEILAPQENTNLPTGQDS  140
            HGN     +  A  +   +Y++      +V      L+L G  E++ P E     T   S
Sbjct  73   HGNLMRAAVELAKAWRTDKYLRTLEAMLIVANQEHLLVLSGNGEVIEPDEGV---TAIGS  129

Query  141  LDPSALASNYSFTGLTNISNAGVPINLVY  169
              P ALA+  + T  TN+S    P ++ Y
Sbjct  130  GGPYALAAARALTKHTNLS----PKDITY  154


>sp|B1IUN9.1|META_ECOLC Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 6064575 EcolC_4017 | homoserine O-succinyltransferase
[Escherichia coli ATCC 8739]

 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQ+
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQD  97


>sp|P07623.4|META_ECOLI  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|B1XC12.1|META_ECODH  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
 sp|C5A0V0.1|META_ECOBW  RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 Score = 32.7 bits (73),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQ+
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQD  97


>sp|Q2NQZ8.1|META_SODGM Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 3868261 SG2152 | homoserine O-succinyltransferase
[Sodalis glossinidius str. 'morsitans'] (10 or fewer PubMed links)

 Score = 32.0 bits (71),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     +VD+           N+PAE  +  YCNF++IQ 
Sbjct  44  MPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESKNTPAEHLNNFYCNFEDIQH  97


>sp|A8ERN6.1|Y335_ARCB4 Gene info RecName: Full=UPF0059 membrane protein Abu_0335
Length=179

 GENE ID: 5623151 Abu_0335 | hypothetical protein [Arcobacter butzleri RM4018]
(10 or fewer PubMed links)

 Score = 31.6 bits (70),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 13/99 (13%)

Query  66   LNIQTKENIKIIPVVHGNFFSI------VLGFALKYGAKEYIK--NKIIQTVVTY-IGTT  116
            L I+ K+N+K + +  G FF I       LGF    G +EYI+  +KI+  ++   IG  
Sbjct  22   LGIKNKQNLKALALKAGLFFGIFQALMPFLGFLGGIGLREYIQGYDKIVAFILLLAIGGK  81

Query  117  LILQGVNEILAPQ----ENTNLPTGQDSLDPSALASNYS  151
            +I +  NE +  +     N  L T   +    A+A+ YS
Sbjct  82   MIYEAFNENVEEEISQITNKILLTLAIATSLDAMAAGYS  120


>sp|A1JRX9.1|META_YERE8 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 4714717 metA | homoserine O-succinyltransferase
[Yersinia enterocolitica subsp. enterocolitica 8081] (10 or fewer PubMed links)

 Score = 31.6 bits (70),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 11/55 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQEH  46
           M KKI    +  + L     ++D+           N+PAE  +  YC+F++IQE 
Sbjct  44  MPKKIETENQFLRLLSNSPLQIDIQLLRIDSRESKNTPAEHLNNFYCDFEDIQEQ  98


>sp|Q80WE1.2|FMR1_RAT Gene info RecName: Full=Fragile X mental retardation protein 1 homolog; 
Short=Protein FMR-1; Short=FMRP
Length=593

 GENE ID: 24948 Fmr1 | fragile X mental retardation 1 [Rattus norvegicus]
(10 or fewer PubMed links)

 Score = 31.2 bits (69),  Expect = 4.0, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query  104  KIIQTVVTYIGTTLI-LQGVNEILAPQENTNLPTGQDSLDPSALASNYSFTG  154
            K+IQ +V   G   + ++  NE   PQE  NLP       PS+L SN S  G
Sbjct  302  KLIQEIVDKSGVVRVRIEAENEKSVPQEEENLP-------PSSLPSNNSRVG  346


>sp|Q9TKY0.1|NDHK_NEPOL Gene info RecName: Full=NAD(P)H-quinone oxidoreductase subunit K, chloroplastic; 
AltName: Full=NAD(P)H dehydrogenase subunit K; AltName: 
Full=NADH-plastoquinone oxidoreductase subunit K
Length=237

 GENE ID: 802047 ndhK | NADH dehydrogenase 27 kDa subunit
[Nephroselmis olivacea] (10 or fewer PubMed links)

 Score = 30.8 bits (68),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 22/131 (16%)

Query  42   NIQEHMAEQLYVIKVGSKVITEDLLNIQTKENI----KIIPV---VHG------NFFSIV  88
             + E M +  YVI +G+  IT  + +  +   +    K+IPV   + G           V
Sbjct  103  RLYEQMPDPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAV  162

Query  89   LGFALKYGAKEYIKNKIIQTVVTYIGTTLILQGVNEILAPQ----ENTNLP-----TGQD  139
            +    K   ++  + + I+ +  Y   +  LQ V+ IL  Q    E    P     TG D
Sbjct  163  IKLRKKVAQEQTAERRGIEQIHRYFTLSHRLQPVSPILTGQYLQAETRQAPPRELATGLD  222

Query  140  SLDPSALASNY  150
            +L P +L +NY
Sbjct  223  TLVPRSLEANY  233


>sp|Q7TN83.1|SYT16_MOUSE Gene info RecName: Full=Synaptotagmin-16; AltName: Full=Synaptotagmin XIV-related 
protein; AltName: Full=Synaptotagmin 14-like protein
Length=639

 GENE ID: 238266 Syt16 | synaptotagmin XVI [Mus musculus] (Over 10 PubMed links)

 Score = 30.8 bits (68),  Expect = 5.1, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query  122  VNEILAPQENTNLPTGQDSLDPSALASNYSFTGLTNISNAGVPINLVYGEILVG  175
            V  +L P+  +NL +G+  L PS ++ + S +   ++S+ GVP      E+LVG
Sbjct  461  VTLVLEPR--SNLSSGESPLSPSVVSHSDSASSTQSLSHGGVP------ELLVG  506


>sp|Q98T94.1|GLIS2_XENLA Gene info RecName: Full=Zinc finger protein GLIS2; AltName: Full=GLI-similar 
2; AltName: Full=Neuronal Krueppel-like protein
Length=492

 GENE ID: 398220 glis2a | Kruppel-like zinc finger protein GLIS2
[Xenopus laevis] (10 or fewer PubMed links)

 Score = 30.8 bits (68),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 73/172 (42%), Gaps = 27/172 (15%)

Query  14   RKFLGQKEFEVDLNSPAEAFSFLYCN----FKNIQEHMAEQLYVIKV-GSKVITEDLLNI  68
            R   G+K +      P E  +  Y N    FK+ + H  ++ Y  K+ G +    D  ++
Sbjct  245  RSHTGEKPYMC----PYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCQKRYTDPSSL  300

Query  69   QTKENIKIIPVVHGNFFSIVLGFALKYGAKEYIKNKIIQTVVT-YI-GTTLILQGVNEIL  126
              +++IK     HG+F S      LK     +   K+  T  + Y  GT LI+     I 
Sbjct  301  --RKHIK----AHGHFISHQQRQLLKI----HQPPKLPATGDSNYTNGTQLIIPNPAAIF  350

Query  127  APQENTNLPTGQDSLDPSALASNYSFTGLTNISN-----AGVPINLVYGEIL  173
              Q +  +P     LD S+LA +   + L  + N     AG P+NL  G +L
Sbjct  351  GSQ-SLPIPLTPGPLDLSSLACSSVASALAGLPNPMLTLAGSPLNLAKGSLL  401


>sp|A8GKF8.1|META_SERP5 Gene info RecName: Full=Homoserine O-succinyltransferase; AltName: Full=Homoserine 
O-transsuccinylase; Short=HTS
Length=309

 GENE ID: 5606217 Spro_4504 | homoserine O-succinyltransferase
[Serratia proteamaculans 568]

 Score = 30.4 bits (67),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  3   MLKKIIVYGKLRKFLGQKEFEVDL-----------NSPAEAFSFLYCNFKNIQE  45
           M KKI    +  + L     ++D+           N+PAE  +  YC+F++IQ+
Sbjct  44  MPKKIETENQFLRLLSNSPLQIDIQLLRIDSRESKNTPAEHLNNFYCDFEDIQD  97


>sp|Q13075.3|BIRC1_HUMAN Gene info RecName: Full=Baculoviral IAP repeat-containing protein 1; AltName: 
Full=Neuronal apoptosis inhibitory protein
Length=1403

 GENE ID: 4671 NAIP | NLR family, apoptosis inhibitory protein [Homo sapiens]
(Over 10 PubMed links)

 Score = 30.0 bits (66),  Expect = 8.2, Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query  9     VYGKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITEDLLN-  67
             ++  L KFL  KE  VDL      FS +   F N   H  E+L +I++ ++     L+  
Sbjct  1094  IFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNF--HHMEKL-LIQISAEYDPSKLVKL  1150

Query  68    IQTKENIKIIPVVHGNFFS  86
             IQ   N+ +   +  NFFS
Sbjct  1151  IQNSPNLHVFH-LKCNFFS  1168


>sp|B1L9R3.1|GLGC_THESQ Gene info RecName: Full=Glucose-1-phosphate adenylyltransferase; AltName: 
Full=ADP-glucose synthase; AltName: Full=ADP-glucose pyrophosphorylase; 
Short=ADPGlc PPase
Length=423

 GENE ID: 6092125 glgC | glucose-1-phosphate adenylyltransferase
[Thermotoga sp. RQ2]

 Score = 30.0 bits (66),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 22/166 (13%)

Query  11   GKLRKFLGQKEFEVDLNSPAEAFSFLYCNFKNIQEHMAEQLYVIKVGSKVITEDLLNIQT  70
            G LR +    E  ++L  P   F+    N++            +  GSKV T   L  + 
Sbjct  246  GTLRSYW---EANLELVLPVPPFNLYDPNWRFFTHTEEMPPAYVAPGSKVSTS--LVSEG  300

Query  71   KENIKIIPVVHGNFFSIVLGFALKYGAKEYIKNKIIQTVVTYIGTTLILQGV--NEILAP  128
             E       V+GN F+ V+   +K G    +KN +I T  T IG    L+ V   E +  
Sbjct  301  AE-------VYGNVFNSVIFQGVKIGRGTVVKNSVIMT-RTEIGENCYLENVIIAENVKV  352

Query  129  QENTNLPTGQDS---LDPSALASNYSFTGLTNISNAGVPINLVYGE  171
              N  +  G+D+   LDP   +   +  G+ ++    +P ++V G+
Sbjct  353  GNNVRMGVGEDAESKLDPKVYSGLLTVVGMNSV----IPDDMVIGK  394