GOS 1106010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574844
Annotathon code: GOS_1106010
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : morin
Annotated on : 2010-01-17 18:03:45
  • MORIN Stéphanie
  • RODRIGUEZ Rémy

Synopsis

  • Gene symbol: CKS
  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1093025574844 GOS_1106010 Genomic DNA
CTAGCATCATTGTAAGCTTGTTTGAAAGTTTCTTCAAAGGTAGTGCAAGTTTTTATTTCAGCGTCTTTATAAAGACTTTCTGCAGCAATATGTGAGTAAG
CACCAAGCTCACCTTGTATAGCAATTTTTTTTTTAATCATTGGTTTTCATTATCTTTTTGATTTCCTCTAAATCTTCTTCAGTATCTACACTTAGAGGTG
ATGAATTCACATAACCAACGTGTATAGACATTCCATTTTCCATTGCTCTTAATTGTTCTAATTTTCTTTCAATTTCCAGTTTTGATCTTTTAAGACCTAC
ATAACGCGATAAAGCTTTATTAGTAAAGGCGTAAATTCCAATATGATGGTAAGGTTGCAGTTTTTGTATATTTTTGAGTCTTACAAAATCTAAGGCTTTA
ACGTACATACCTGTTTTTAACTTTTCTTTTACCAAAACCTTAACTACATTTTCGTTCTCTAGCTCCTCATTTGAACTAATTTTACTTGCTAAAGTGCCTA
TTTCACAATAGCCTTTGTTCATATAATCGACTAAATTATTTATAGTTTCTGGTAAGATATTTGGCATATCACCTTGTAAATTGACAATTATTTTTGGATT
AGCATTTAAATTATTTTTAAAGACCTCATACACTCTATCGGTTCCAG

Translation

[3 - 512/647]   indirect strand
>GOS_1106010 Translation [3-512   indirect strand]
GTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQPYH
HIGIYAFTNKALSRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Nous avons mis en évidence un ORF de 170 acides aminés codant pour un domaine protéique probable de type Acylneuraminate cytidylyltransferase, comme montré via analyse des domaines fonctionnels, et étude des homologues Blast.


Notre ORF ne commence pas par une méthionine mais finit par un codon stop, il est donc incomplet en 5' et complet en 3'.

Les homologues trouvés par blast semblent confirmer que notre protéine est incomplète en 5', et complète en 3'.


Des résultats similaires ont pu être tirés de l'analyse de notre ORF par la méthode des alignements multiples, où l'on voit que notre ORF est bien incomplète en 5'.


Suite aux résultats du rapport taxonomique on suppose que notre ORF est d'origine a-protéobactérienne. L'analyse des derniers arbres phylogénétiques va dans ce sens également. De plus, notre ORF est très proche d'une séquence non classée à ce jour, avec laquelle elle pourrait former un sous-groupe d'a-proteobacteria.

Toujours sur l'analyse de ces derniers arbres, l'organisme le plus proche qui semble porter notre séquence est une Rickettsiales, c'est pour cela que notre groupe taxonomique d'appartenance le plus probable pour notre ORF est celui des a-proteobacteria.


L'analyse de la séquence GOS_1106010.76 suggère donc que celle ci possède un domaine protéique de type Acylneuraminate cytidylyltransferase. Sa fonction moléculaire est donc une activité transférase, et on peut proposer une hypothèse fonctionnelle pour notre ORF qui serait que notre protéine est impliquée dans le processus du métabolisme des lipides.

Pour aller plus loin dans notre hypothèse, on peut dire que notre protéine est une enzyme qui forme le CMP-acylneuraminic acids en transférant le résidu acide N-acylneuraminic au résidu terminal d'un sucre porté par un ganglioside ou une glycoproteine.

ORF finding

PROTOCOLE:


a) SMS/ ORF finder/ can begin with any codon/ 1,2 and 3 reading frame/ direct strand/ least 60 condons longs/ strandard genetic code.


b) SMS/ ORF finder/ can begin with any codon/ 1,2 and 3 reading frame/ reverse strand/ least 60 condons longs/ strandard genetic code.



ANALYSE DES RÉSULTATS:


Une seule ORF a été trouvée, dans le troisième cadre de lecture du sens indirect, de la base 3 à la base 515.

Elle ne commence pas par une méthionine, mais finit par un codon stop, on suppose que notre séquence est complète en 3' mais incomplète en 5'.

RÉSULTATS BRUTS:

a) sens direct:
ORF Finder results
Results for 647 residue sequence "GOS_1106010 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" starting "CTAGCATCAT"

No ORFs were found in reading frame 1. 
No ORFs were found in reading frame 2. 
No ORFs were found in reading frame 3. 

b) sens indirect:
ORF Finder results
Results for 647 residue sequence "GOS_1106010 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" starting "CTAGCATCAT"

No ORFs were found in reading frame 1. 
No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 515.
GGAACCGATAGAGTGTATGAGGTCTTTAAAAATAATTTAAATGCTAATCCAAAAATAATT
GTCAATTTACAAGGTGATATGCCAAATATCTTACCAGAAACTATAAATAATTTAGTCGAT
TATATGAACAAAGGCTATTGTGAAATAGGCACTTTAGCAAGTAAAATTAGTTCAAATGAG
GAGCTAGAGAACGAAAATGTAGTTAAGGTTTTGGTAAAAGAAAAGTTAAAAACAGGTATG
TACGTTAAAGCCTTAGATTTTGTAAGACTCAAAAATATACAAAAACTGCAACCTTACCAT
CATATTGGAATTTACGCCTTTACTAATAAAGCTTTATCGCGTTATGTAGGTCTTAAAAGA
TCAAAACTGGAAATTGAAAGAAAATTAGAACAATTAAGAGCAATGGAAAATGGAATGTCT
ATACACGTTGGTTATGTGAATTCATCACCTCTAAGTGTAGATACTGAAGAAGATTTAGAG
GAAATCAAAAAGATAATGAAAACCAATGATTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
GTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSNE
ELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQPYHHIGIYAFTNKALSRYVGLKR
SKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND*


Multiple Alignement

PROTOCOLE:


Phylogeny.fr/ Méthode MUSCLE avec utilisation de séquences au format FASTA (autres paramètres par défaut).

Extraction des résultats via Alignment in Clustal format.



ANALYSE DES RÉSULTATS:



De nombreux alignements entre notre ORF et les séquences de notre groupe d'étude (les a-proteobacteria) sont mis en évidence.

De plus, cet alignement multiple permet de confirmer le fait que notre séquence est incomplète en 5'. En effet, on voit que toutes les séquences, globalement de même longueurs, commencent par une méthionine sauf la notre qui démarre par G (et sauf alphapro6). Toutes ces M sont situées bien en amont du début de notre ORF (à plusieurs dizaines de codons). Il manque donc l'extrémité 5' de notre séquence.

On notera la présence de domaines extrêmement conservés, ce qui fait penser à la présence d'un domaine fonctionnel conservé.


RÉSULTATS BRUTS:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Alphapro24      -----------MKHSDVAVIIPSRLSSTRLKQKPLQLIGSITLIERVFKQVSQANLEHTY
Alphapro23      ----------------MAIIIPSRLSSTRLKQKPLQLIGSITLIERVFKQVNQAGLEHTY
Alphapro25      -----------MRHQDVAIIIPSRLSSTRLKQKPLQLIGSITLIERVFKQVNQAGLEHTY
GOS_110601      ------------------------------------------------------------
Betaprot1       --------------MSFKVVIPSRYNSTRLAGKPLIEIAGLPMVIHVARKARLSGADEVI
Alphapro13      -----------MADLNPIIVIPARMHATRLPGKPLADIHGEPMIIHVWRRAVQTGLGPVV
Alphapro4       -MANLAQPAAKELAGHPLVVIPARMASTRLPGKPLADICGTPMIVQVWRRAMEAGVGRVV
Alphapro9       ---------MTAAPRNPLIVIPARLAASRLPDKPLADIHGRPMIAHVLDRAREADIGPVV
Alphapro20      ------------MTLKPLILIPARMGSTRLPEKVLAEISGKPMIVHVAERAKEAALGPTI
Alphapro8       ------------MALEPIILIPARMGSTRLPQKALAEISGKPMIVHVAEQAKKAAIGRTI
Alphapro19      ------------MALEPIILIPARIGSTRLPQKALAEIGGKPMIVHVAEQAKKAAIGRTI
Alphapro5       ------MMILQPVSHHNLIVIPARMQATRLPGKPLADIAGTPMIVHVWRRAVAANAGDVI
Alphapro22      -------------MSDPLILIPARLGATRLPDKPLADICGEPMIVHVWRRAIAAGLGPVV
Alphapro7       -------MFPALSSERVLVLIPARMAATRLPGKPLADVGGRPMIVEVARRAAAAAIGPVA
Alphapro3       -MRPAPTCRFRMTRSKILVLIPARMASTRLPGKPLLDIAGVPMIVQVLRRAEEAAIGRVA
Alphapro1       -----------MTSPATLVLIPARMAATRLPGKPLLDIAGLPMVVQVLRRAQAAEIGRVA
Alphapro2       -----------MTAPRTLVLIPARMAATRLPGKPLLDIGGVPMVVHVLRRALAANIGRVA
Alphapro14      --------MNREQAGKALVLIPARMASTRLPGKPLADICGLPMIVQVARRAAEAEVGRIV
Alphapro16      --------MGDSNFDDVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRAKEAEIGRVV
Alphapro11      --------MSDSNLDGVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRAREAAIGRVV
Alphapro6       -------------------------------------------------------IGRVV
Alphapro12      --------MSDSNLDEVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRAKEAAIGRVV
Alphapro17      --------------MSTLILIPARMASTRLPGKPLADISGAPMIVHVARRAAEAGLGRVV
Alphapro10      ----------MLQTMKTLTLIPTRLGSTRLPNKPLADICGKPMIVHVADRAAAAKLGRTV
Alphapro15      ----------MLQTMKTLTLIPARLGSTRLPNKPLADICGKPMIVHVANRAAAAKLGRTV
Alphapro18      MPAPAFFHKAFAFRMNPIVVIPARMASTRLPGKPLAMIGKLPMILHVLARARAADIGPVI
Alphapro21      -------------MVSSLVVIPARLASTRLPGKPLADIAGRPMVLRVWDAAMAANIGPVV
Betaprot2       -------MNADSKAPDFLVVIPARLGSTRLPRKPLADIGGKPMVIRVAERAKQSLAHSVV
Gammapro4       --------------MSFVVVIPARYASTRLPGKPLSMIAGKTMLQHVFERAKTAGASRVV
Gammapro1       --------------MSFTVIIPARFASSRLPGKPLADIAGKPMIQHVFEKALQSGANRVI
Gammapro2       --------------MSFTVIIPARFASSRLPGKPLADIAGKPMIQHVFEKALQSGASRVI
Gammapro3       -------------MTQFTVIIPARYASNRLPGKPLADIVGKPMIQHVFEQAKQSGATRVI
                                                                            

Alphapro24      VTTDSEEIAKIIKKVGGKVIFTNSNIPTGTDRTYEAFKLIPNNQNINYIVNVQGDMPFIE
Alphapro23      VATDSEEIASVITKVGGKVIFTDSAIPTGTDRTYEAFKLIPNNQNINYIVNVQGDMPFIE
Alphapro25      VATDSEEIASVITKVGGKVIFTDSAIPTGTNRTYEAFKLIPNNQNINYIVNVQGDMPFIE
GOS_110601      ----------------------------GTDRVYEVFKN-NLNANPKIIVNLQGDMPNIL
Betaprot1       VATDDERIFNCVEQFGFKAIITDPEHSSGTDRINEVLNHTDWNDE-TIIINLQGDEPLID
Alphapro13      VACSETEVFDAVHAHGGKAVMTDPNHPSGSDRVWEAVMNVDPDGAFDAIVNVQGDLPTLE
Alphapro4       VAAAEKEIADAVREAGGEAVLTDPDLPSGSDRVWQAVCEVDPEGHHTVILNVQGDLPTLD
Alphapro9       VACADAAIADAVAAAGGRAVLTDPAHPSGSDRVWEAVCRVDPDGRHDAVVNVQGDLPTID
Alphapro20      IATDHDAIAQAVTAYGHEYVMTHTHHQSGSDRIYEALTRIDPEQRYNAILNVQGDLPTVT
Alphapro8       VATDHNDIAKAVAEYGHEYIITRGDHKSGSDRIYEALMRIDPEQRYNAILNIQGDLPTIM
Alphapro19      VATDHNDIAKAVADYGHECIITQGDHKSGSDRIYEALMRIDPEQRYNTILNIQGDLPTIM
Alphapro5       VATDSGEIADAVTAAGGKAIMTRTDHASGSDRVFEAVTKADPGQRAGIIVNLQGDLPTLD
Alphapro22      VCTDAPTVVAAVEAVGGLAVLTRPDHPSGSDRLAEALGIIDPEGRHDVVVNLQGDLPTID
Alphapro7       VATDSEEIAAAVRAAGVTAVLTRADHPSGSDRIFEALGALDPDGAVDVVVNVQGDLPTIA
Alphapro3       VATDTPEIAAAVTAAGGEVVMTRPDHPSGSDRIYEALCKLDPAGEADFVVNLQGDFPTID
Alphapro1       VATDAPEIAAAVTAHGGEVVMTRADHPSGSDRIFEALQTLDPDRKIETVINLQGDFPTIR
Alphapro2       VATDTPAIADAVRAHGGEVVMTRADHPSGSDRIHEALQTLDPQRTIETVINLQGDFPTIR
Alphapro14      VAVDHPEVFAAVSDAGFEAIMTRVDHQSGSDRIHEALLKADPQGEAEIVINVQGDLPTIE
Alphapro16      VAVDDPQVFDTVAAAGFEVVMTSKDHQSGSDRIFEALKKIDPDGKAKFIVNVQGDLPTIE
Alphapro11      VAVDETRVFDAVAAAGFEVVMTRVDHQSGSDRIFEALTKVDPEGKAKIIVNIQGDLPTID
Alphapro6       VAVDDQQVFDAVSAAGFDVVMTSRDHQSGSDRIFEALTKVDPAGKAKIIVNVQGDLPTID
Alphapro12      VAVDDQQVFDAVSAAGFDVVMTSSDHQSGSDRIFEALTKVDPDGKAKFIVNVQGDLPTID
Alphapro17      VATDTQSVAEAVRAHGFEAVMTRIDHESGSDRIHEALAALDPGRKVETIVNVQGDLPTID
Alphapro10      IATDSEEIFKVVAAHGHEAIMTRGDHESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTID
Alphapro15      IATDSEEIFKVVAAHGHEAIMTRGDHESGSDRIYEALAKLDPSGEFDAVVNVQGDLPTID
Alphapro18      VAVAETELARVVEDAGGTAVLTDPALPSGSDRVWQAVRAADPAGRHDVVVNLQGDLPGVA
Alphapro21      VAAADQEIYDTVTAAGGTAILTDPDLPSGSDRVWQATQAFDPDGKYDVLLNLQGDLPTFK
Betaprot2       VATDSPEIQAACDEHRIECLLTSENHPTGTDRIAEVAQLLKLPAN-ALVVNVQGDEPLIP
Gammapro4       VATDDSRIASACAGFGAEALMTSPDHASGTDRLAEVVEQLMLSDD-QIVVNVQGDEPMIP
Gammapro1       IATDNENVADVAKNFGAEVCMTSVNHNSGTERLAEVVEKLAIPDN-EIIVNIQGDEPLIP
Gammapro2       IATDNENVADVAKNFGAEVCMTSVNHNSGTERLAEVVEKLAIPDN-EIIVNIQGDEPLIP
Gammapro3       IATDNDLVAAAAKNFGAEVCMTAESHNSGTERLAEVVEKLAIPDN-EIIVNIQGDEPLIP
                                            *::*  :.            ::*:*** * . 

Alphapro24      PSSILKIIEYL-KNSEYDIVTPVVKVDKESVEAASNVTVAVNS--------AGKALYFSR
Alphapro23      PSSILKIIEYL-KNSKYDIVTPIVKVDRESVKASSNVTVVVDS--------AGTALYFSR
Alphapro25      PSSILKIIEYL-KNSKYDIVTPIVKVDRESVKASSNVTVAVDS--------AGTALYFSR
GOS_110601      PETINNLVDYM-NKGYCEIGTLASKISSNEELENENVVKVLVKEKLKTG-MYVKALDFVR
Betaprot1       PLLINKVAHGM-SELEVDYATAASSFERTEDFANVNNVKVVLGR-------DDYALYFSR
Alphapro13      PQIIRAVFAPL-AEPGVDVSTLVTEITVEEERTNPNVVKAVVGFESGQ--RVARALYFSR
Alphapro4       PALIRTAYEAL-VRPGADISTLAATITVEEERTNPNVVKAVASFGEGR---LARALYFTR
Alphapro9       PAAVRAVFGPL-ARPGTDIATLAAEIVRVEERTDPNVVKAVVELAPGA--RDGRALYFTR
Alphapro20      PNALISVLQLL-KNNLTDIATLGAEIIEDNEKNNPNIVKIIGTPIAQN---RLRALYFTR
Alphapro8       PREIIHALRPL-ENSFTDIATLGSQIIEESEKRDPNVVKIIGTPLSQN---RLRALYFTR
Alphapro19      PREIIHALRPL-ENSFTDIATLGARIIEENEKRDPNVVKIIGTPLSQN---RLRALYFTR
Alphapro5       PDLVTRCLAPL-SDPEVDIATLTAVITEPEERTNPNVVKVVGTPIADD---RLRALYFTR
Alphapro22      PGIVAAAVTPL-ADRAVDIATLCAVITRDEERTEPSVVKLVGSPITPT---RLRALYFTR
Alphapro7       PQTIRSALAPL-AEPAVDIATLCAEIVVEDERTDPNVVKVVGSPLDDN---LLRALYFTR
Alphapro3       PRSISDVLPPL-DDPAVDIATLAAQIHTEEESLNPNVVKAVGSPLGGR---RMRALYFTR
Alphapro1       PEQIGAVLGPL-ADPAVDIATLAAEIHTEEEATNPNVVKVIGSPLAAD---RLRALYFTR
Alphapro2       PEQIGAVLAPL-DDPAVDIATLAAEIHTEEESTNPNVVKVVGSHIGTT---RLRALYFTR
Alphapro14      PGPIRAALKPL-ENPSTDIATLTVAITDEHEKTNPNVVKVVGSPLSQS---RFRALYFTR
Alphapro16      PETVRAALRPL-ENEAVDIGTLTIEIDNEEDKTAPHIVKVIGSPISDN---RLRGLYFTR
Alphapro11      PETVRAALRPL-ENEAVDIGTLTTEIDNEEDKTAPHIVKIIGSPISGN---RLHALYFTR
Alphapro6       PETVRAALRPL-DNEAVDIGTLTTEIDNEEDKTAPHIVKIVGSPVSDT---RLHALYFTR
Alphapro12      PQTVRAALRPL-ENEAVDIGTLTTEIDDEDDKTAPHIVKIVGSPVSDT---RLHALYFTR
Alphapro17      PGIIAASLRPF-EDAAVDIATLGVEIVREEEKTNPNVVKIVGSPLSAT---RLRALYFTR
Alphapro10      PDTIRRALLPL-EDGPADIATLGVEITVEEEKTNPNVVKIVGSPLAGN--RRLRALYFTR
Alphapro15      PDTIRRALLPLEEDGPADIATLGVEITVEEEKTNPNVVKIVGSPLAGN--RRLRALYFTR
Alphapro18      PPTLAASLLPL-ADPATDIGTLVCPVADAGEAARDSVVKVACAFADDDARTVARALYFSR
Alphapro21      PQALRAVMDVM-ANPAYDVGTLVAPVTSDAEKNASSVVKVACDFSEDT--QTAPALYFSR
Betaprot2       PKLINQVARTLAEHEQCVISTVAVPITDAAEINNPNVVKVVLNR-------SGEALYFSR
Gammapro4       AAVIDQVAYNLAREQTASIATLCEAITSVEVLRDPNAVKVVFDE-------KGKALYFSR
Gammapro1       PVIVRQVADNL-AKFNVNMASLAVKIHDAEELFNPNAVKVLTDK-------DGYVLYFSR
Gammapro2       PVIVRQVADNL-AKFNVNMASLAVKIHDAEELFNPNAVKVLTDK-------DGYVLYFSR
Gammapro3       PAIVKQVAENL-SKYPVNMASLAVNIDEAEELFNPNVVKVLTDK-------DGYVLYFSR
                .  :      :         :    .           .                 * * *

Alphapro24      SLIPNG---------------AEEFLYHVGIYGFCKSALEKFISIKPTFLEKTERLEQLR
Alphapro23      SLIPNG---------------AEEFLYHVGMYGFRKNALEKFVSLKPTFLEKTERLEQLR
Alphapro25      SLIPNG---------------AEEFLYHVGMYGFRKNALEKFVSLKPTFLEKTERLEQLR
GOS_110601      LKNIQ----------------KLQPYHHIGIYAFTNKALSRYVGLKRSKLEIERKLEQLR
Betaprot1       SMIPYDRV------SGEDSIAQGAL-QHIGIYGYTAKFLRFFCGLPKSNLERIEGLEQLR
Alphapro13      ATVPAN---------------DGPHYHHIGLYAYRRDSLRRFVSLPQGVLERREKLEQLR
Alphapro4       ATAPWG---------------EGPLYHHIGLYGYRREALARFVALPPSPLEVREKLEQLR
Alphapro9       ATAPWG---------------EGPLFHHIGLYAYRREALARFVALPPAALERREKLEQLR
Alphapro20      ATAPYG---------------NGPLYHHIGLYAYRRKALEKFVSLKPSTLEQREKLEQLR
Alphapro8       TTSPYG---------------DGPLYHHIGIYAYRREALEKFVSFKPSTLEIREKLEQLR
Alphapro19      TTAPYG---------------DGPLYHHIGIYAYRREALEKFISFKPSTLEQREKLEQLR
Alphapro5       ASAPSG---------------DGPLYHHIGIYAYRRASLERFVSLPPSPLEKREKLEQLR
Alphapro22      ATAPWG---------------EGPLYHHIGLYAYRRRALERFVSLSPSVLERREKLEQLR
Alphapro7       ATAPFG---------------AGPLYHHIGLYAYRRPALARFVALAPSMLEQREKLEQLR
Alphapro3       ATAPHG---------------DGPRYHHIGLYAYRRAALERFVRLPPSPLEQQEKLEQLR
Alphapro1       ATAPWG---------------DGPRYHHIGLYGYRRAALERFVALPPSPLELREKLEQLR
Alphapro2       ATAPWG---------------DGPRYHHIGLYAYRRAALERFVALPPSPLEQREKLEQLR
Alphapro14      ATAPYG---------------EGPLYHHIGLYAYRRRALETFVSLKPSALEKRESLEQLR
Alphapro16      ATAPYG---------------KGPLYHHIGLYAYRRAALERFVSLGPSTLERRESLEQLR
Alphapro11      ATAPYG---------------QGPLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLR
Alphapro6       ATAPHG---------------KGPLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLR
Alphapro12      ATAPHG---------------KGPLYHHIGLYAYRRAALERFVSLGPSTLERRESLEQLR
Alphapro17      ATAPWG---------------EGPLYHHVGLYAYRRSALERFVALKPSPLERRERLEQLR
Alphapro10      ATAPYG---------------EGPLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLR
Alphapro15      ATAPYG---------------EGPLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLR
Alphapro18      AAVPWG---------------AGALWHHVGIYAYRRAALARFVSLPEAALERRERLEQLR
Alphapro21      QPIPWG---------------NGPLWHHIGVYGWRRAALERFVALPPSGLEKRESLEQLR
Betaprot2       APIPFVRD--------PQSSQKTMHLRHLGIYAYRADFLQAYTRLEPASPEQAEALEQLR
Gammapro4       ASIPWPRDHSWDSTDMP----GGLYYRHIGLYAYRAAFLRRYTQWQPAPLELCESLEQLR
Gammapro1       SVIPYDRDQFMNLQDVQKVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLR
Gammapro2       SVIPYDRDQFMNLQNVQKVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLR
Gammapro3       AVIPWDRDQFAQMDDVAKLQLNTQYLRHIGIYAYRAGFIKQYVQWQPTALEHIEKLEQLR
                                           *:*:*.:    :  :        *    *****

Alphapro24      ILENNIAIGTCLV-NNVPISVDTEEDLQKAIKFYENISKL-------------------
Alphapro23      ALENGMTIGTCLV-ENVPISVDTEEDLKKAVKFYENISKLGL-----------------
Alphapro25      VLENGMTIGTCLV-ENVPISVDTEEDLKKAVKFYENISKLGL-----------------
GOS_110601      AMENGMSIHVGYV-NSSPLSVDTEEDLEEIKKIMKTND---------------------
Betaprot1       ALENHQKIKVFKYDGAHSIGVDTQEDLDKIKKILGSN----------------------
Alphapro13      ALENGMRIDCALV-DTVPLGVDTPADLERARALLKA-----------------------
Alphapro4       ALEAGMAIEVALV-DTVPLGVDTPADLEKARAALARRSV--------------------
Alphapro9       ALAAGMTIAVAIV-DTVPLGVDTAADLERARALLDPRTGARPALP--------------
Alphapro20      ALENNMRIDVEIV-DTALLGVDTHHDLEKVRKILA------------------------
Alphapro8       ALEHNMRIDVEIV-DTIPLGVDTQRDLERVRKILA------------------------
Alphapro19      ALEHNMRIDVEIV-DTIPLGVDTQRDLDRVRKILA------------------------
Alphapro5       ALEAGMRIDVAIV-DTVPLGVDTPADLERARSLIAT-----------------------
Alphapro22      ALEAGMRIDAVVV-DDVPLGVDTPHDLDRARAVMAARRLN-------------------
Alphapro7       ALEAGMRIDVAVV-DAVPLGVDTQAHLDRARAILALEAAEQK-----------------
Alphapro3       ALEAGMRIDVMVV-DAVPRGVDTPADLETARRLLSKA----------------------
Alphapro1       ALEAGMRIDVGIV-DTVPRGVDTPADLETARRVLGG-----------------------
Alphapro2       ALEAGMRIDVGIV-DSVPRGVDTPADLETARRVLAG-----------------------
Alphapro14      ALEAGMRIDVEIV-DSVPLGVDTPADLDKARRILSARA---------------------
Alphapro16      ALEAGMRIDAEIV-DTVPLGVDTPADLEKARRILSARQN--------------------
Alphapro11      ALEAGMRIDAEVV-DTVPLGVDTPADLEKARRILSAKSN--------------------
Alphapro6       ALEAGMRIDVEIV-DTVPLGVDTPADLEKARRILSARTG--------------------
Alphapro12      ALEAGMRIDVEIV-DTVPLGVDTPADLEKARRILSARTG--------------------
Alphapro17      ALEAGMRIDAEIV-RSLPLGVDTPQDLERARTILSN-----------------------
Alphapro10      ALEAGMRIDVEIV-KTVPLGVDTQADLDRARTFCSQAGTI-------------------
Alphapro15      ALEAGMRIDVEIV-KTVPLGVDTQADLDRARIFCSQAGTI-------------------
Alphapro18      ALEAGMTIGCCRI-GTAPFGVDTPDDLDRARRVMAEAA---------------------
Alphapro21      ALEAGMRIGCTRL-ASAPFGVDTPEDLERARRAFGA-----------------------
Betaprot2       ALWNGYRIAVHTAPEAPPAGVDTPEDLERVRQLLARS----------------------
Gammapro4       ALYKGEGIHVEQACEAVPGGIDTAEDLQRVRAQFGESSIDPARFTAATGSTTGSNTESE
Gammapro1       VLYNGERIHVELAKEVPAVGVDTAEDLEKVRAILAAN----------------------
Gammapro2       VLYNGERIHVELAKEVPAVGVDTAEDLEKVRLILAKD----------------------
Gammapro3       VLWNGEKIHVELAKEVPAVGVDTAEDLEKVRSILAKKSH--------------------
                 :     *           .:**   *.                               

Protein Domains

PROTOCOLE:

Analyse des domaines sur Interpro, avec paramètres par défaut.


ANALYSE DES RÉSULTATS:


Un seul domaine protéique validé par Interpro est présent : Acylneuraminate cytidylyltransferase.

Il est situé entre les acides aminés 1 et 141, avec une E Value de 2.1e-21.

Ce domaine a pour numéro d'accession IPR003329 (interpro).

De plus, il est en cohérence avec les fonctions des homologues trouvés par blast.


Nous signalons la présence de domaines non intégrés à interpro que nous n'analyserons pas ici.

RÉSULTATS BRUTS:

Translation	4026562EBD816EB4	170	Gene3D	G3DSA:3.90.550.10	no description	1	166	2.2e-24	T	22-Oct-2009	NULL	NULL	
Translation	4026562EBD816EB4	170	HMMPanther	PTHR21485:SF4	CMP-2-KETO-3-DEOCTULOSONATE (CMP-KDO) CYTIDYLTRANSFERASE	1	169	7.2e-32	T	22-Oct-2009	NULL	NULL	
Translation	4026562EBD816EB4	170	HMMPanther	PTHR21485	CMP-N-ACETYLNEURAMINIC ACID SYNTHASE	1	169	7.2e-32	T	22-Oct-2009	NULL	NULL	
Translation	4026562EBD816EB4	170	superfamily	SSF53448	Nucleotide-diphospho-sugar transferases	1	169	9.7e-19	T	22-Oct-2009	NULL	NULL	
Translation	4026562EBD816EB4	170	HMMPfam	PF02348	CTP_transf_3	1	141	2.1e-21	T	22-Oct-2009	IPR003329	Acylneuraminate cytidylyltransferase	Biological Process: lipopolysaccharide biosynthetic process (GO:0009103)

Phylogeny

PROTOCOLE:


a)phylogeny.fr/ phylogeny analysis/ "a la carte" paramètres par défaut sauf step by step pour run workflow/ Gblocks/ méthode PhyML


b)phylogeny.fr/ phylogeny analysis/ "a la carte" paramètres par défaut sauf step by step pour run workflow/ Gblocks/ méthode BioNJ pas de boostraps




ANALYSE DES RÉSULTATS:


Obtention de deux arbres d'apparence correcte, où la topologie de nos arbres est cohérente avec ce que l'on connait de la taxonomie.

Nos arbres comprennent chacun 2 groupes monophylétiques distincts: les a-proteobacteria d'un coté et les

b+g-proteobacteria de l'autre.


En analysant ces résultats, on s'aperçoit que notre séquence ne sort pas au mileu des a-protéobactéries contrairement à ce que l'on attendait puisque les a-proteobacteria constituent notre groupe d'étude. Donc ce résultat n'est pas cohérent avec ce que l'on attendait, que l'on utilise la méthode PhyML ou la méthode BioNJ.


Cependant, sur les résultats du blast, on remarque que notre séquence est très proche de deux autres séquences issues d'organismes séquencés mais non identifiés à ce jour. C'est pour cela que j'ai rajouté une séquence inconnue nommée "uncultured marine microorganism" sur chacun des arbres. Cette séquence n'appartient ni à notre groupe d'étude ni à notre groupe extérieur. Cependant cette séquence non identifiée possède un hit de 169 ( et une e-value de 9e-41) et on voit clairement sur les arbres que cette séquence est la plus proche de notre séquence.


Afin de connaitre plus précisément l'origine de notre séquence et pour pouvoir dire que notre séquence provient au moins des proteobacteria, j'ai refait deux arbres dans lesquels j'ai rajouté des séquences issues de "CFB group bacteria" et de fusobacteria. Il s'agit donc de séquences qui n'appartiennent ni à notre groupe d'étude ni à notre groupe extérieur.


Après analyse de ces deux derniers arbres, on s'aperçoit donc que notre séquence et la séquence non identifiée appartiennent aux a-proteobacteria, parmi lesquelles ces deux séquences forment un sous-groupe.


On a ainsi pu identifier le groupe d'appartenance de notre séquence d'intérêt et de cette séquence inconnue très proche de notre ORF.

RÉSULTATS BRUTS:

a) arbre par méthode PhyML, avec groupe d'étude, groupe extérieur, séquence GOS et 
séquence uncultured marine microorganism:


                                                                                            ---0.2--
 
                                  +Gammapro1_Haemophilus_influenzae_R2846/Gammaproteobacteria/gi_53
                            +-----+
                            |     +Gammapro2_Haemophilus_influenzae_PittEE/Gammaproteobacteria/gi_1
                 +----------+
               +-+          +Gammapro3_Aggregatibacter/Gammaproteobacteria/gi_251792697_ref_Y
               | |
       +-------+ +----------------Gammapro4_gamma/Gammaproteobacteria/gi_254514448_ref_ZP_05126509
       |       |
 +-----+       +--------------Betaprot2_Polynucleobacter_necessarius_STIR1/Betaproteobacteria/
 |     |
 |     +-------------------------------Betaprot1_Methylophilales_bacterium_HTCC2181/Betaproteobacteria/
 |
 |
 |                              +-----------------------n1_uncultured_marine//gi_167041260_gb_ABZ06016.1_gi_167041260_gb
 |    +-------------------------+
 |    |                         +-----GOS_1106010_Traduction_3-512_sens_indirect
 |    |
 |    |                                +Alphapro23_Rickettsia_rickettsii_str._Sheila_Smith_/Alphaproteob
 |    | +------------------------------+
 |    | |                              |-----Alphapro24_Rickettsia_canadensis_str._McKiel/Alphaproteobacteria
 |    | |                              |
 +----+ |                              +Alphapro25_Rickettsia/Alphaproteobacteria/gi_238650932_ref_YP_00
      | |
      | |                +---------------Alphapro18_Gluconacetobacter_diazotrophicus_PAl_5/Alphaproteobac
      | |      +---------+
      | |      |         +--------------Alphapro21_Acetobacter/Alphaproteobacteria/gi_258542282_ref_YP_0
      | |      |
      | |      |    +-----Alphapro5_Hyphomicrobium/Alphaproteobacteria/gi_255334183_ref_ZP
      +-+      |   ++
        |      |   |+----------Alphapro22_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteri
        |      |   |
        |      |   |   +------Alphapro7_Xanthobacter_autotrophicus_Py2/Alphaproteobacteria/gi
        |      |   | +-+
        |      |   | | +-----Alphapro9_Rhodospirillum_centenum_SW/Alphaproteobacteria/gi_2099
        |      |   | |
        |      |   |-+
        |      |   | | +-------Alphapro13_Magnetospirillum_magnetotacticum_MS-1/Alphaproteobact
        +------+   | +-+
               |   |   +------Alphapro4_Parvibaculum_lavamentivorans_DS-1/Alphaproteobacteria/
               |   |
               |   |          +-----Alphapro20_Bartonella_bacilliformis_KC583/Alphaproteobacteria/gi
               |   |  +-------+
               |   |  |       |    +--Alphapro8_Bartonella/Alphaproteobacteria/gi_163867531_ref_YP_001
               |   |  |       +----+
               |   |  |            +-Alphapro19_Bartonella/Alphaproteobacteria/gi_240849900_ref_YP_00
               |   |  |
               |   |  | +-----Alphapro14_Sinorhizobium_medicae_WSM419/Alphaproteobacteria/gi_1
               |   |  | |
               |   |--+ |    +-Alphapro16_Rhizobium_etli_CFN_42/Alphaproteobacteria/gi_86355792
               |   |  |-+    |
               +---+  | |    |-Alphapro11_Rhizobium_leguminosarum_bv._viciae_3841/Alphaproteoba
                   |  | |   ++
                   |  | |   |+Alphapro6_Rhizobium/Alphaproteobacteria/gi_218663838_ref_ZP_0351
                   |  | +---+
                   |  |     +-Alphapro12_Rhizobium/Alphaproteobacteria/gi_190889802_ref_YP_001
                   |  |
                   |  |
                   |  |+-------Alphapro17_Mesorhizobium_loti_MAFF303099/Alphaproteobacteria/gi
                   |  ++
                   |   |  +Alphapro10_Brucella_suis_1330/Alphaproteobacteria/gi_23500953_re
                   |   +--+
                   |      +Alphapro15_Brucella/Alphaproteobacteria/gi_254718259_ref_ZP_0518
                   |
                   |   +-----Alphapro3_Bradyrhizobium_sp._ORS278/Alphaproteobacteria/gi_14633
                   +---+
                       | +-Alphapro1_Rhodopseudomonas_palustris_TIE-1/Alphaproteobacteria/g
                       +-+
                         +Alphapro2_Rhodopseudomonas_palustris_HaA2/Alphaproteobacteria/gi
                                           



b) arbre par méthode BioNJ, avec groupe d'étude, groupe extérieur, séquence GOS et 
séquence uncultured marine microorganism:


                                                                 -------0.2-----
 
       +-----------------------------------------Betaprot1_Methylophilales_bacterium_HTCC2181/Betaproteobacteria/
       |
 +-----+   +-------------------Betaprot2_Polynucleobacter_necessarius_STIR1/Betaproteobacteria/
 |     |   |
 |     +---+   +------------------Gammapro4_gamma/Gammaproteobacteria/gi_254514448_ref_ZP_05126509
 |         |   |
 |         |   |                    +Gammapro1_Haemophilus_influenzae_R2846/Gammaproteobacteria/gi_53
 |         +---+              +-----+
 |             |              |     +Gammapro2_Haemophilus_influenzae_PittEE/Gammaproteobacteria/gi_1
 |             +--------------+
 |                            +----Gammapro3_Aggregatibacter/Gammaproteobacteria/gi_251792697_ref_Y
 |
 |
 |                            +-------------------------n1_uncultured_marine//gi_167041260_gb_ABZ06016.1_gi_167041260_gb
 |     +----------------------+
 |     |                      +---------------GOS_1106010_Traduction_3-512_sens_indirect
 |     |
 |     |                  +-------Alphapro3_Bradyrhizobium_sp._ORS278/Alphaproteobacteria/gi_14633
 |     |             +----+
 |     |             |    |  +--Alphapro1_Rhodopseudomonas_palustris_TIE-1/Alphaproteobacteria/g
 |     |             |    +--+
 |     |             |       +-Alphapro2_Rhodopseudomonas_palustris_HaA2/Alphaproteobacteria/gi
 |     |             |
 |     |             |+---------Alphapro5_Hyphomicrobium/Alphaproteobacteria/gi_255334183_ref_ZP
 |     |            +++
 |     |            ||+-----------Alphapro22_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteri
 |     |            ||
 |     |            ||         +---------Alphapro20_Bartonella_bacilliformis_KC583/Alphaproteobacteria/gi
 |     |            ||         |
 |     |            || +-------+       +--Alphapro8_Bartonella/Alphaproteobacteria/gi_163867531_ref_YP_001
 |     |            || |       +-------+
 |     |            || |               +--Alphapro19_Bartonella/Alphaproteobacteria/gi_240849900_ref_YP_00
 |     |            || |
 |     |            || |+-------Alphapro14_Sinorhizobium_medicae_WSM419/Alphaproteobacteria/gi_1
 |     |            || ||
 +-----+            |+-+|
       |            |  ||       +--Alphapro16_Rhizobium_etli_CFN_42/Alphaproteobacteria/gi_86355792
       |            |  |+      ++
       |            |  ||      |+-Alphapro11_Rhizobium_leguminosarum_bv._viciae_3841/Alphaproteoba
       |      +-----+  ||      |
       |      |     |  |+------+-Alphapro6_Rhizobium/Alphaproteobacteria/gi_218663838_ref_ZP_0351
       |      |     |  |       |
       |      |     |  |       +-Alphapro12_Rhizobium/Alphaproteobacteria/gi_190889802_ref_YP_001
       |      |     |  |
       |      |     |  |+----------Alphapro17_Mesorhizobium_loti_MAFF303099/Alphaproteobacteria/gi
       |      |     |  ||
       |      |     |  ++     +Alphapro10_Brucella_suis_1330/Alphaproteobacteria/gi_23500953_re
       |      |     |   +-----+
       |      |     |         +Alphapro15_Brucella/Alphaproteobacteria/gi_254718259_ref_ZP_0518
       |+-----+     |
       ||     |     |   +-----------Alphapro13_Magnetospirillum_magnetotacticum_MS-1/Alphaproteobact
       ||     |     | +-+
       ||     |     | | +---------Alphapro4_Parvibaculum_lavamentivorans_DS-1/Alphaproteobacteria/
       ||     |     | |
       ||     |     | |---------Alphapro9_Rhodospirillum_centenum_SW/Alphaproteobacteria/gi_2099
       ||     |     +-+
       ||     |       |
       ++     |       +--------Alphapro7_Xanthobacter_autotrophicus_Py2/Alphaproteobacteria/gi
        |     |
        |     |      +-------------------Alphapro18_Gluconacetobacter_diazotrophicus_PAl_5/Alphaproteobac
        |     +------+
        |            +--------------------Alphapro21_Acetobacter/Alphaproteobacteria/gi_258542282_ref_YP_0
        |
        |                                +--------Alphapro24_Rickettsia_canadensis_str._McKiel/Alphaproteobacteria
        +--------------------------------+
                                         ++lphapro23_Rickettsia_rickettsii_str._Sheila_Smith_/Alphaproteob
                                         ++
                                          +-Alphapro25_Rickettsia/Alphaproteobacteria/gi_238650932_ref_YP_00










arbre PhyMl avec des séquences supplémentaires différentes des groupes d'étude et extérieur:

                                                                                                -------0.5------
 
                              +Bacteroi4_Porphyromonas_gingivalis_W83/Bacteroidetes/ref_NP_9059
                   +----------+
                   |          +Bacteroi5_Porphyromonas_gingivalis_ATCC_33277/Bacteroidetes/ref
                  ++
                  |+---Bacteroi2_Bacteroides/Bacteroidetes/ref_ZP_05287334.1_gi_2550152
                  |
               +--+---------Bacteroi6_Alistipes_putredinis_DSM_17216/Bacteroidetes/ref_ZP_02
               |  |
         +-----+  +----------Bacteroi1_Pedobacter_sp._BAL39/Bacteroidetes/ref_ZP_01883937.1_g
         |     |
         |     +------------------------------Bacteroi3_Algoriphagus_sp._PR1/Bacteroidetes/ref_ZP_01717482.1_g
     +---+
     |   |    +------------------Betaprot1_Methylophilales_bacterium_HTCC2181/Betaproteobacteria/
     |   |    |
     |   +----+
     |        |        +----Fusobact2_Fusobacterium/Fusobacteria/ref_ZP_05633311.1_gi_257469
     |        +--------+
 +---+                 |  +--Fusobact1_Fusobacterium/Fusobacteria/ref_ZP_05617425.1_gi_257452
 |   |                 +--+
 |   |                    +---Fusobact3_Fusobacterium/Fusobacteria/ref_ZP_05627387.1_gi_257462
 |   |
 |   |       +--------Betaprot2_Polynucleobacter_necessarius_STIR1/Betaproteobacteria/
 |   |       |
 |   +-------+     +---------Gammapro4_gamma/Gammaproteobacteria/gi_254514448_ref_ZP_05126509
 |           |     |
 |           +-----+          +Gammapro1_Haemophilus_influenzae_R2846/Gammaproteobacteria/gi_53
 |                 |       +--+
 |                 +-------+  +Gammapro2_Haemophilus_influenzae_PittEE/Gammaproteobacteria/gi_1
 |                         |
 |                         +Gammapro3_Aggregatibacter/Gammaproteobacteria/gi_251792697_ref_Y
 |
 |                                  +-------------------n1_uncultured_marine//gi_167041260_gb_ABZ06016.1_gi_167041260_gb
 |                 +----------------+
 |                 |                +GOS_1106010_Traduction_3-512_sens_indirect
 |         +-------+
 |         |       |           +Alphapro23_Rickettsia_rickettsii_str._Sheila_Smith_/Alphaproteob
 |         |       |           |
 |         |       +-----------++----Alphapro24_Rickettsia_canadensis_str._McKiel/Alphaproteobacteria
 |         |                   ++
 |         |                    +Alphapro25_Rickettsia/Alphaproteobacteria/gi_238650932_ref_YP_00
 +---------+
           |         +-----------Alphapro18_Gluconacetobacter_diazotrophicus_PAl_5/Alphaproteobac
           |         |
           |     +---+
           |     |   +--------Alphapro21_Acetobacter/Alphaproteobacteria/gi_258542282_ref_YP_0
           |     |
           +-----++----Alphapro5_Hyphomicrobium/Alphaproteobacteria/gi_255334183_ref_ZP
                 ||
                 ||  +----Alphapro3_Bradyrhizobium_sp._ORS278/Alphaproteobacteria/gi_14633
                 ||+-+
                 ++| |+--Alphapro1_Rhodopseudomonas_palustris_TIE-1/Alphaproteobacteria/g
                  || ++
                  ||  +Alphapro2_Rhodopseudomonas_palustris_HaA2/Alphaproteobacteria/gi
                  ||
                  || +------Alphapro13_Magnetospirillum_magnetotacticum_MS-1/Alphaproteobact
                  ++-+
                   | | +-----Alphapro4_Parvibaculum_lavamentivorans_DS-1/Alphaproteobacteria/
                   | +-+
                   |   +----Alphapro9_Rhodospirillum_centenum_SW/Alphaproteobacteria/gi_2099
                   |
                   |+-----Alphapro7_Xanthobacter_autotrophicus_Py2/Alphaproteobacteria/gi
                   ||
                   ||   +Alphapro10_Brucella_suis_1330/Alphaproteobacteria/gi_23500953_re
                   ||+--+
                   |||  +Alphapro15_Brucella/Alphaproteobacteria/gi_254718259_ref_ZP_0518
                   ++|
                    || +-Alphapro16_Rhizobium_etli_CFN_42/Alphaproteobacteria/gi_86355792
                    || |
                    || |-Alphapro11_Rhizobium_leguminosarum_bv._viciae_3841/Alphaproteoba
                    || |
                    ++ |-Alphapro12_Rhizobium/Alphaproteobacteria/gi_190889802_ref_YP_001
                     |++
                     |||
                     ||+Alphapro6_Rhizobium/Alphaproteobacteria/gi_218663838_ref_ZP_0351
                     ||
                     ||       +----Alphapro20_Bartonella_bacilliformis_KC583/Alphaproteobacteria/gi
                     ++ +-----+
                      | |     |   +-Alphapro8_Bartonella/Alphaproteobacteria/gi_163867531_ref_YP_001
                      | |     +---+
                      |++         +Alphapro19_Bartonella/Alphaproteobacteria/gi_240849900_ref_YP_00
                      |||
                      ||| +----Alphapro22_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteri
                      +++-+
                       |  +---Alphapro17_Mesorhizobium_loti_MAFF303099/Alphaproteobacteria/gi
                       |
                       +---Alphapro14_Sinorhizobium_medicae_WSM419/Alphaproteobacteria/gi_1





arbre BioNJ avec des séquences supplémentaires différentes des groupes d'étude et extérieur:

                                                                                                ------0.2-----
 
         +----------------Betaprot2_Polynucleobacter_necessarius_STIR1/Betaproteobacteria/
         |
    +----+    +----------------Gammapro4_gamma/Gammaproteobacteria/gi_254514448_ref_ZP_05126509
    |    |    |
    |    +----+              +Gammapro1_Haemophilus_influenzae_R2846/Gammaproteobacteria/gi_53
    |         |          +---+
    |         |          |   +Gammapro2_Haemophilus_influenzae_PittEE/Gammaproteobacteria/gi_1
    |         +----------+
    |                    +---Gammapro3_Aggregatibacter/Gammaproteobacteria/gi_251792697_ref_Y
 +--+
 |  |    +---------------------------Bacteroi3_Algoriphagus_sp._PR1/Bacteroidetes/ref_ZP_01717482.1_g
 |  |    |
 |  |    |     +-----------------------Betaprot1_Methylophilales_bacterium_HTCC2181/Betaproteobacteria/
 |  |    |     |
 |  |    |+----+
 |  +----+|    |          +----------Fusobact2_Fusobacterium/Fusobacteria/ref_ZP_05633311.1_gi_257469
 |       ||    +----------+
 |       ||               |     +----Fusobact1_Fusobacterium/Fusobacteria/ref_ZP_05617425.1_gi_257452
 |       ||               +-----+
 |       ||                     +--Fusobact3_Fusobacterium/Fusobacteria/ref_ZP_05627387.1_gi_257462
 |       ++
 |        |                            +Bacteroi4_Porphyromonas_gingivalis_W83/Bacteroidetes/ref_NP_9059
 |        |           +----------------+
 |        |           |                +Bacteroi5_Porphyromonas_gingivalis_ATCC_33277/Bacteroidetes/ref
 |        |         +-+
 |        |         | |+-----------------Bacteroi1_Pedobacter_sp._BAL39/Bacteroidetes/ref_ZP_01883937.1_g
 |        +---------+ ++
 |                  |  +-------------Bacteroi2_Bacteroides/Bacteroidetes/ref_ZP_05287334.1_gi_2550152
 |                  |
 |                  +-----------Bacteroi6_Alistipes_putredinis_DSM_17216/Bacteroidetes/ref_ZP_02
 |
 |                            +-------------------------n1_uncultured_marine//gi_167041260_gb_ABZ06016.1_gi_167041260_gb
 |       +--------------------+
 |       |                    +------------GOS_1106010_Traduction_3-512_sens_indirect
 |     +-+
 |     | |                         +Alphapro23_Rickettsia_rickettsii_str._Sheila_Smith_/Alphaproteob
 |     | |                         |
 |     | +-------------------------+--------Alphapro24_Rickettsia_canadensis_str._McKiel/Alphaproteobacteria
 |     |                           |
 |     |                           +-Alphapro25_Rickettsia/Alphaproteobacteria/gi_238650932_ref_YP_00
 |     |
 |     |                       +--------Alphapro20_Bartonella_bacilliformis_KC583/Alphaproteobacteria/gi
 |     |                       |
 |     |                +------+
 |     |                |      |       +-Alphapro8_Bartonella/Alphaproteobacteria/gi_163867531_ref_YP_001
 |     |                |      +-------+
 |     |                |              +-Alphapro19_Bartonella/Alphaproteobacteria/gi_240849900_ref_YP_00
 |     |                |
 |     |                |------Alphapro14_Sinorhizobium_medicae_WSM419/Alphaproteobacteria/gi_1
 |     |                |
 |     |               ++     +--Alphapro16_Rhizobium_etli_CFN_42/Alphaproteobacteria/gi_86355792
 |     |               ||    ++
 |     |               ||    |+-Alphapro11_Rhizobium_leguminosarum_bv._viciae_3841/Alphaproteoba
 |     |               ||    |
 |     |              +++----+-Alphapro6_Rhizobium/Alphaproteobacteria/gi_218663838_ref_ZP_0351
 |     |              ||     |
 |     |              ||     +-Alphapro12_Rhizobium/Alphaproteobacteria/gi_190889802_ref_YP_001
 |     |              ||
 +-----+              ||    +Alphapro10_Brucella_suis_1330/Alphaproteobacteria/gi_23500953_re
       |             +++----+
       |             ||     +Alphapro15_Brucella/Alphaproteobacteria/gi_254718259_ref_ZP_0518
       |             ||
       |             || +--------Alphapro22_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteri
       |            +++-+
       |            ||  +------Alphapro17_Mesorhizobium_loti_MAFF303099/Alphaproteobacteria/gi
       |            ||
       |            ||+--------Alphapro5_Hyphomicrobium/Alphaproteobacteria/gi_255334183_ref_ZP
       |            |||
       |            |++   +------Alphapro3_Bradyrhizobium_sp._ORS278/Alphaproteobacteria/gi_14633
       |           ++ |   |
       |           || +---+  +--Alphapro1_Rhodopseudomonas_palustris_TIE-1/Alphaproteobacteria/g
       |           ||     |  |
       |           ||     +--+
       |          ++|        +Alphapro2_Rhodopseudomonas_palustris_HaA2/Alphaproteobacteria/gi
       |          |||
       |          ||+--------Alphapro7_Xanthobacter_autotrophicus_Py2/Alphaproteobacteria/gi
       |          ||
       |       +--+| +---------Alphapro4_Parvibaculum_lavamentivorans_DS-1/Alphaproteobacteria/
       |       |  |+-+
       |       |  |  +-------Alphapro9_Rhodospirillum_centenum_SW/Alphaproteobacteria/gi_2099
       |       |  |
       +-------+  +----------Alphapro13_Magnetospirillum_magnetotacticum_MS-1/Alphaproteobact
               |
               |    +------------------Alphapro18_Gluconacetobacter_diazotrophicus_PAl_5/Alphaproteobac
               +----+
                    +-------------------Alphapro21_Acetobacter/Alphaproteobacteria/gi_258542282_ref_YP_0




Taxonomy report

PROTOCOLE:


BLAST NCBI de type Blastp, contre une base NR, " max target sequence" limites de 1000 (Autres réglages par défaut.)



ANALYSE DES RÉSULTATS:


Ce rapport taxonomique fait apparaitre au dessus du seuil d'homologie des a, b, d, et g-proteobactéria.

Cependant les a-protéobactéries constituent le groupe qui possède les e-value les plus élevées. Nous prendrons donc les a-protéobactéries comme groupe d'étude car il s'agit bien d'une lignée taxonomique réelle. De plus les a-proteobacteria forment un groupe monophylétique.


Notre groupe extérieur sera constitué des b et g-protéobactéries car il s'agit d'un ensemble de lignées de même niveau taxonomique que notre groupe d’étude.



Groupe d'étude: (a-proteobacteria)


ref|ZP_06055742.1| 133 6e-30 [alpha proteobacterium HIMB114] a-protéobactéria


ref|YP_001993187.1| 130 5e-29 [Rhodopseudomonas palustris TIE-1] a-proteobacteria


sp|Q2IZ84.2| 128 2e-28 CMP-KDO synthetase a-proteobacteria


ref|YP_001203152.1| 125 1e-27 [Bradyrhizobium sp. ORS278] a-proteobacteria


ref|YP_001411531.1| 125 2e-27 [Parvibaculum lavamentivorans DS-1] a-proteobacteria


ref|ZP_05375100.1| 125 2e-27 [Hyphomicrobium denitrificans ATCC 51888] a-proteobacteria


ref|ZP_03519768.1| 122 1e-26 [Rhizobium etli IE4771] a-proteobacteria


ref|YP_001417529.1| 121 3e-26 [Xanthobacter autotrophicus Py2] a-proteobacteria


ref|YP_001608730.1| 120 5e-26 [Bartonella tribocorum CIP 105476] a-proteobacteria


ref|YP_002299577.1| 120 6e-26 [Rhodospirillum centenum SW] a-proteobacteria


ref|NP_697080.1| 120 7e-26 [Brucella suis 1330] a-proteobacteria


ref|YP_765745.1| 119 1e-25 [Rhizobium leguminosarum bv. viciae 3841] a-proteobacteria


ref|YP_001976344.1| 119 2e-25 [Rhizobium tli CIAT 652] a-proteobacteria


ref|ZP_00055493.2| 118 2e-25 [Magnetospirillum magnetotacticum MS-1] a-proteobacteria


ref|YP_001329080.1| 117 5e-25 [Sinorhizobium medicae WSM419] a-proteobacteria


ref|ZP_05180070.1| 117 5e-25 [Brucella sp. 83/13] a-proteobacteria


ref|YP_467684.1| 115 1e-24 [Rhizobium etli CFN 42] a-proteobacteria


ref|NP_106153.1| 115 2e-24 [Mesorhizobium loti MAFF303099] a-proteobacteria


ref|YP_001602122.1| 114 2e-24 [Gluconacetobacter diazotrophicus PAl 5] a-proteobacteria


ref|YP_002971289.1| 114 4e-24 [Bartonella grahamii as4aup] a-proteobacteria


ref|YP_989485.1| 112 2e-23 [Bartonella bacilliformis KC583] a-proteobacteria


ref|YP_003187715.1| 110 4e-23 [Acetobacter pasteurianus IFO 3283-01] a-proteobacteria


ref|YP_002495856.1| 106 1e-21 [Methylobacterium nodulans ORS 2060] a-proteobacteria


ref|YP_001494640.1| 102 2e-20 [Rickettsia rickettsii str. 'Sheila Smith'] a-proteobacteria


ref|YP_001492423.1| 99.4 1e-19 [Rickettsia canadensis str. McKiel] a-proteobacteria


ref|YP_002916788.1| 96.3 1e-18 [Rickettsia peacockii str. Rustic] a-proteobacteria





Groupe extérieur: (b et g-proteobacteria)



ref|ZP_00154788.2| 100 5e-20 [Haemophilus influenzae R2846] g-proteobacteria


ref|YP_001290415.1| 99.0 2e-19 [Haemophilus influenzae PittEE] g-proteobacteria


ref|YP_003007423.1| 97.8 3e-19 [Aggregatibacter aphrophilus NJ8700] g-proteobacteria


ref|ZP_01552499.1| 97.1 5e-19 [Methylophilales bacterium HTCC2181] b-proteobacteria


ref|YP_001797217.1| 95.5 2e-18 [Polynucleobacter necessarius subsp. necessarius STIR1] b-proteobacteria


ref|YP_003255820.1| 92.8 1e-17 [Aggregatibacter actinomycetemcomitans D11S-1] g-proteobacteria


ref|ZP_05126509.1| 90.9 4e-17 [gamma proteobacterium OR5-3] g-proteobacteria









































RÉSULTATS BRUTS:

Lineage Report

root
. prokaryotic environmental samples [unclassified]
. . uncultured marine microorganism HF4000_005D21 --------------------------  169  1 hit  [unclassified]           putative cytidylyltransferase [uncultured marine microorgan
. . uncultured marine microorganism HF4000_141E02 ..........................   98  1 hit  [unclassified]           putative cytidylyltransferase [uncultured marine microorgan
. . uncultured marine microorganism HF4000_006O13 ..........................   98  1 hit  [unclassified]           putative cytidylyltransferase [uncultured marine microorgan
. uncultured marine bacterium HF4000_APKG3108 ------------------------------  169  1 hit  [bacteria]               putative cytidylyltransferase [uncultured marine microorgan
. Rhodopseudomonas palustris CGA009 ........................................  131  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Rhodopseudomonas palustris ...............................................  131  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Chelativorans sp. BNC1 ...................................................  131  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mesorhizob
. Candidatus Pelagibacter sp. HTCC7211 .....................................  130  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidat
. Rhodopseudomonas palustris TIE-1 .........................................  130  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopse
. Rhodopseudomonas palustris HaA2 ..........................................  129  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Bradyrhizobium sp. BTAi1 .................................................  127  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizo
. Nitrobacter hamburgensis X14 .............................................  126  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Nitrobacte
. Bradyrhizobium sp. ORS278 ................................................  125  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizo
. Rhodopseudomonas palustris BisB5 .........................................  125  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Parvibaculum lavamentivorans DS-1 ........................................  125  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Parvibacul
. Azorhizobium caulinodans ORS 571 .........................................  125  3 hits [a-proteobacteria]       RecName: Full=3-deoxy-manno-octulosonate cytidylyltransfera
. Rhodopseudomonas palustris BisA53 ........................................  125  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Hyphomicrobium denitrificans ATCC 51888 ..................................  125  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Hyphomic
. Rhodopseudomonas palustris BisB18 ........................................  124  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseud
. Oligotropha carboxidovorans OM5 ..........................................  124  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Oligotro
. Rhizobium etli IE4771 ....................................................  122  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Hoeflea phototrophica DFL-43 .............................................  121  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO sy
. Magnetospirillum magneticum AMB-1 ........................................  121  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Magnetospi
. Candidatus Pelagibacter ubique HTCC1062 ..................................  121  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Xanthobacter autotrophicus Py2 ...........................................  121  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Xanthoba
. Candidatus Pelagibacter ubique HTCC1002 ..................................  121  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Fulvimarina pelagi HTCC2506 ..............................................  121  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Fulvimarin
. Nitrobacter sp. Nb-311A ..................................................  120  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Nitrobacte
. Bartonella tribocorum CIP 105476 .........................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Rhizobium sp. NGR234 .....................................................  120  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhizobiu
. Brucella neotomae 5K33 ...................................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella n
. Brucella ovis ATCC 25840 .................................................  120  3 hits [a-proteobacteria]       RecName: Full=3-deoxy-manno-octulosonate cytidylyltransfera
. Rhodospirillum centenum SW ...............................................  120  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase, putative
. Granulibacter bethesdensis CGDNIH1 .......................................  120  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Granulibac
. Brucella abortus NCTC 8038 ...............................................  120  2 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella abortus bv. 6 str. 870 ..........................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella abortus bv. 4 str. 292 ..........................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella abortus bv. 2 str. 86/8/59 ......................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella abortus bv. 9 str. C68 ..........................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella abortus bv. 3 str. Tulya ........................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella ceti M13/05/1 ...................................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella ceti B1/94 ......................................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella pinnipedialis M163/99/10 ........................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella pinnipedialis B2/94 .............................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella ceti M644/93/1 ..................................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella suis bv. 5 str. 513 .............................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella sp. F5/99 .......................................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella abortus NCTC
. Brucella suis bv. 4 str. 40 ..............................................  120  2 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella suis bv. 4 s
. Brucella suis bv. 3 str. 686 .............................................  120  3 hits [a-proteobacteria]       acylneuraminate cytidylyltransferase [Brucella suis bv. 4 s
. Brucella abortus bv. 1 str. 9-941 ........................................  120  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis biovar Abortus 2308 ..................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis bv. 1 str. 16M .......................................  120  4 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella suis ATCC 23445 .................................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella abortus S19 .....................................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis ATCC 23457 ...........................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella pinnipedialis M292/94/1 .........................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis bv. 1 str. Rev.1 .....................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis bv. 3 str. Ether .....................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella ceti M490/95/1 ..................................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis bv. 2 str. 63/9 ......................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella microti CCM 4915 ................................................  120  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella abortus .........................................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella melitensis ......................................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella a
. Brucella suis 1330 .......................................................  120  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella s
. Brucella canis ATCC 23365 ................................................  120  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella s
. Brucella suis ............................................................  120  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella s
. Brucella abortus str. 2308 A .............................................  119  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Brucella
. Rhizobium leguminosarum bv. trifolii WSM1325 .............................  119  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhizobiu
. Rhizobium leguminosarum bv. viciae 3841 ..................................  119  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Rhizobium etli Brasil 5 ..................................................  119  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Rhizobium etli CIAT 652 ..................................................  119  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase protein [Rh
. Agrobacterium vitis S4 ...................................................  118  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Agrobact
. Nitrobacter winogradskyi Nb-255 ..........................................  118  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Nitrobacte
. Magnetospirillum magnetotacticum MS-1 ....................................  118  2 hits [a-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Mag
. Sinorhizobium meliloti 1021 ..............................................  118  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Sinorhizob
. Sinorhizobium meliloti ...................................................  118  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Sinorhizob
. Sinorhizobium medicae WSM419 .............................................  117  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Sinorhizob
. Methylobacterium radiotolerans JCM 2831 ..................................  117  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Brucella sp. 83/13 .......................................................  117  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Brucella s
. Rhizobium etli GR56 ......................................................  116  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Candidatus Liberibacter asiaticus str. psy62 .............................  116  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Bradyrhizobium japonicum USDA 110 ........................................  116  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizo
. Bradyrhizobium japonicum .................................................  116  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizo
. Rhizobium etli CFN 42 ....................................................  115  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Agrobacterium tumefaciens str. C58 .......................................  115  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Agrobacter
. Acidiphilium cryptum JF-5 ................................................  115  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Acidiphili
. Bartonella henselae str. Houston-1 .......................................  115  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Bartonella henselae ......................................................  115  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Mesorhizobium loti MAFF303099 ............................................  115  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mesorhizob
. Mesorhizobium loti .......................................................  115  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mesorhizob
. Gluconacetobacter diazotrophicus PAl 5 ...................................  115  4 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Gluconacet
. Asticcacaulis excentricus CB 48 ..........................................  115  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Asticcac
. Rhizobium leguminosarum bv. trifolii WSM2304 .............................  115  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Methylobacterium populi BJ001 ............................................  114  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Aurantimonas manganoxydans SI85-9A1 ......................................  114  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Aurantimon
. Agrobacterium radiobacter K84 ............................................  114  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase protein [Ag
. Bartonella grahamii as4aup ...............................................  114  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Methylobacterium extorquens PA1 ..........................................  114  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Methylobacterium extorquens AM1 ..........................................  114  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Methylobacterium extorquens DM4 ..........................................  114  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Methylobacterium chloromethanicum CM4 ....................................  114  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Bartonella quintana str. Toulouse ........................................  114  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Bartonella quintana ......................................................  114  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. Ochrobactrum intermedium LMG 3301 ........................................  113  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Ochrobac
. Ochrobactrum anthropi ATCC 49188 .........................................  113  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ochrobactr
. Gluconobacter oxydans 621H ...............................................  112  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Gluconobac
. Bartonella bacilliformis KC583 ...........................................  112  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bartonella
. alpha proteobacterium BAL199 .............................................  111  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [alpha prot
. Mesorhizobium opportunistum WSM2075 ......................................  111  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhiz
. Acetobacter pasteurianus IFO 3283-01 .....................................  110  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-03 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-07 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-22 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-26 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-32 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-01-42C .................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Acetobacter pasteurianus IFO 3283-12 .....................................  110  1 hit  [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acetobac
. Rhizobium etli CIAT 894 ..................................................  107  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium 
. Methylobacterium nodulans ORS 2060 .......................................  106  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Labrenzia aggregata IAM 12614 ............................................  105  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Stappia ag
. Methylobacterium sp. 4-46 ................................................  105  3 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylob
. Trichoplax adhaerens .....................................................  105  2 hits [placozoans]             hypothetical protein TRIADDRAFT_34782 [Trichoplax adhaerens
. Anaeromyxobacter sp. Fw109-5 .............................................  105  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Anaeromy
. Thermodesulfovibrio yellowstonii DSM 11347 ...............................  103  3 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Thermode
. Rhodospirillum rubrum ATCC 11170 .........................................  102  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rhodospiri
. Rickettsia rickettsii str. 'Sheila Smith' ................................  102  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia rickettsii str. Iowa ..........................................  101  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia akari str. Hartford ...........................................  100  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Haemophilus influenzae R2846 .............................................  100  1 hit  [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Hae
. Haemophilus influenzae 86-028NP ..........................................  100  3 hits [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Hae
. Haemophilus influenzae PittHH ............................................  100  2 hits [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Hae
. Haemophilus influenzae Rd KW20 ...........................................  100  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus influenzae RdAW ..............................................  100  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus influenzae ...................................................  100  8 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus influenzae PittAA ............................................  100  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Anaeromyxobacter dehalogenans 2CP-1 ......................................  100  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Anaeromy
. Rickettsia felis URRWXCal2 ...............................................  100  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia felis .........................................................  100  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia massiliae MTU5 ................................................  100  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Labrenzia alexandrii DFL-11 ..............................................   99  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Labrenzi
. Anaeromyxobacter sp. K ...................................................   99  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Anaeromy
. Haemophilus parasuis 29755 ...............................................   99  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Candidatus Koribacter versatilis Ellin345 ................................   99  3 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidat
. Anaeromyxobacter dehalogenans 2CP-C ......................................   99  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Anaeromy
. Rickettsia canadensis str. McKiel ........................................   99  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia bellii RML369-C ...............................................   98  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia bellii OSU 85-389 .............................................   98  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia prowazekii str. Madrid E ......................................   98  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia prowazekii ....................................................   98  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Haemophilus influenzae PittEE ............................................   98  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus influenzae 7P49H1 ............................................   98  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus somnus 2336 ..................................................   98  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Haemophi
. Haemophilus influenzae NT127 .............................................   98  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Haemophi
. Alcanivorax sp. DG881 ....................................................   98  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Alcanivo
. Rickettsia africae ESF-5 .................................................   98  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia endosymbiont of Ixodes scapularis .............................   98  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Ricketts
. Haemophilus parasuis SH0165 ..............................................   98  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus somnus 129PT .................................................   98  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Rickettsia sibirica 246 ..................................................   98  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Haemophilus influenzae R3021 .............................................   97  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Rickettsia conorii str. Malish 7 .........................................   97  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia conorii .......................................................   97  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Aggregatibacter aphrophilus NJ8700 .......................................   97  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Aggregat
. Haemophilus influenzae 22.4-21 ...........................................   97  2 hits [g-proteobacteria]       hypothetical protein CGSHiR3021_11024 [Haemophilus influenz
. Haemophilus influenzae R2866 .............................................   97  1 hit  [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Hae
. Haemophilus influenzae PittII ............................................   97  2 hits [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Hae
. Haemophilus influenzae 3655 ..............................................   97  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus influenzae 6P18H1 ............................................   97  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Elusimicrobium minutum Pei191 ............................................   97  3 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Elusimic
. Haemophilus influenzae PittGG ............................................   97  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Methylophilales bacterium HTCC2181 .......................................   97  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Methylophi
. Actinobacillus pleuropneumoniae L20 ......................................   97  6 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Alcanivorax borkumensis SK2 ..............................................   96  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Alcanivo
. Actinobacillus minor 202 .................................................   96  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Denitrovibrio acetiphilus DSM 12809 ......................................   96  2 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Denitrov
. Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................   96  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................   96  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Rickettsia peacockii str. Rustic .........................................   96  3 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Acidobacterium capsulatum ATCC 51196 .....................................   96  3 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Acidobac
. Polynucleobacter necessarius subsp. necessarius STIR1 ....................   95  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Polynucl
. Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................   95  2 hits [g-proteobacteria]       COG1212: CMP-2-keto-3-deoxyoctulosonic acid synthetase [Act
. Kangiella koreensis DSM 16069 ............................................   95  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonatecytidylyltransferase [Kangiella
. Vibrio furnissii CIP 102972 ..............................................   95  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio fur
. Dickeya dadantii Ech586 ..................................................   95  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Dickeya 
. Yersinia mollaretii ATCC 43969 ...........................................   95  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia m
. Haemophilus ducreyi 35000HP ..............................................   95  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Haemophilus ducreyi ......................................................   95  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Bordetella parapertussis 12822 ...........................................   95  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Bordetella parapertussis .................................................   95  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Desulfovibrio vulgaris DP4 ...............................................   94  3 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Desulfovib
. Helicobacter pullorum MIT 98-5489 ........................................   94  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Helicobact
. Actinobacillus minor NM305 ...............................................   94  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Bordetella pertussis Tohama I ............................................   94  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Bordetella pertussis .....................................................   94  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Mannheimia haemolytica PHL213 ............................................   94  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mannheimia
. Mannheimia haemolytica serotype A2 str. BOVINE ...........................   94  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mannheimia
. Mannheimia haemolytica serotype A2 str. OVINE ............................   94  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mannheimia
. Dechloromonas aromatica RCB ..............................................   94  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Dechloro
. Pedobacter heparinus DSM 2366 ............................................   93  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Pedobact
. Selenomonas flueggei ATCC 43531 ..........................................   93  2 hits [firmicutes]             3-deoxy-manno-octulosonate cytidylyltransferase [Selenomona
. Lutiella nitroferrum 2002 ................................................   93  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Lutiella
. Bordetella bronchiseptica RB50 ...........................................   93  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Bordetella bronchiseptica ................................................   93  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Vibrio sp. Ex25 ..........................................................   93  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Vibrio s
. Chthoniobacter flavus Ellin428 ...........................................   93  2 hits [verrucomicrobia]        3-deoxy-D-manno-octulosonate cytidylyltransferase [Chthonio
. Gemmatimonas aurantiaca T-27 .............................................   93  3 hits [bacteria]               3-deoxy-manno-octulosonate cytidylyltransferase [Gemmatimon
. Fusobacterium mortiferum ATCC 9817 .......................................   93  2 hits [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Caulobacter sp. K31 ......................................................   93  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Caulobacte
. Ralstonia solanacearum GMI1000 ...........................................   92  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Ralstonia solanacearum ...................................................   92  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............   92  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Polynucl
. Aggregatibacter actinomycetemcomitans D11S-1 .............................   92  1 hit  [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Aggregat
. Desulfovibrio vulgaris str. Hildenborough ................................   92  3 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Desulfovib
. Desulfovibrio vulgaris RCH1 ..............................................   92  2 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Desulfovib
. Pasteurella dagmatis ATCC 43325 ..........................................   92  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Pasteure
. Pedobacter sp. BAL39 .....................................................   92  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter
. Chromobacterium violaceum ATCC 12472 .....................................   92  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Chromobact
. Chromobacterium violaceum ................................................   92  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Chromobact
. Yersinia ruckeri ATCC 29473 ..............................................   92  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia r
. Providencia stuartii ATCC 25827 ..........................................   92  2 hits [enterobacteria]         hypothetical protein PROSTU_01761 [Providencia stuartii ATC
. Parvularcula bermudensis HTCC2503 ........................................   92  2 hits [a-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Parvular
. Bacteroides sp. 2_1_7 ....................................................   92  1 hit  [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Parabacteroides sp. D13 ..................................................   92  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Yersinia intermedia ATCC 29909 ...........................................   92  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia i
. Parabacteroides distasonis ATCC 8503 .....................................   92  3 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Parabacter
. Dickeya dadantii Ech703 ..................................................   92  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Dickeya 
. Desulfovibrio salexigens DSM 2638 ........................................   92  2 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Desulfov
. Vibrio alginolyticus 12G01 ...............................................   92  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio alg
. Limnobacter sp. MED105 ...................................................   91  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Limnobac
. marine gamma proteobacterium HTCC2143 ....................................   91  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [marine gam
. Algoriphagus sp. PR1 .....................................................   91  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Algoriphag
. Helicobacter canadensis MIT 98-5491 ......................................   91  3 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Helicobact
. Providencia rettgeri DSM 1131 ............................................   91  2 hits [enterobacteria]         hypothetical protein PROVRETT_03167 [Providencia rettgeri D
. Planctomyces maris DSM 8797 ..............................................   91  2 hits [planctomycetes]         3-deoxy-manno-octulosonate cytidylyltransferase [Planctomyc
. Idiomarina baltica OS145 .................................................   91  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Idiomarina
. Vibrio orientalis CIP 102891 .............................................   91  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio ori
. Sodalis glossinidius str. 'morsitans' ....................................   90  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Sodalis gl
. Helicobacter winghamensis ATCC BAA-430 ...................................   90  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Helicobact
. Phenylobacterium zucineum HLK1 ...........................................   90  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Phenylobac
. gamma proteobacterium NOR5-3 .............................................   90  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [gamma pr
. Bordetella avium 197N ....................................................   90  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Providencia alcalifaciens DSM 30120 ......................................   90  2 hits [enterobacteria]         hypothetical protein PROVALCAL_00847 [Providencia alcalifac
. Fusobacterium sp. 3_1_5R .................................................   90  1 hit  [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Fusobacterium gonidiaformans ATCC 25563 ..................................   90  1 hit  [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Caulobacter crescentus CB15 ..............................................   90  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Caulobacte
. Caulobacter crescentus NA1000 ............................................   90  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Caulobacte
. Pseudomonas entomophila L48 ..............................................   90  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Allochromatium vinosum DSM 180 ...........................................   90  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Allochro
. Pseudomonas stutzeri A1501 ...............................................   90  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Pseudomo
. Dickeya zeae Ech1591 .....................................................   90  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Dickeya 
. Providencia rustigianii DSM 4541 .........................................   90  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Providenci
. Ralstonia solanacearum UW551 .............................................   90  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Ralstonia solanacearum IPO1609 ...........................................   90  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................   90  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Aeromona
. Idiomarina loihiensis L2TR ...............................................   89  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Idiomarina
. Idiomarina loihiensis ....................................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Idiomarina
. Vibrio parahaemolyticus RIMD 2210633 .....................................   89  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus AQ3810 ...........................................   89  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus K5030 ............................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus AN-5034 ..........................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus Peru-466 .........................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus AQ4037 ...........................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Vibrio parahaemolyticus ..................................................   89  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio par
. Azotobacter vinelandii DJ ................................................   89  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Azotobac
. Serratia proteamaculans 568 ..............................................   89  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Serratia p
. Vibrio vulnificus YJ016 ..................................................   89  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio vul
. Tolumonas auensis DSM 9187 ...............................................   89  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Tolumona
. marine gamma proteobacterium HTCC2148 ....................................   89  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [marine g
. Fusobacterium ulcerans ATCC 49185 ........................................   89  1 hit  [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Vibrio harveyi HY01 ......................................................   89  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Vibrio h
. Photorhabdus luminescens subsp. laumondii TTO1 ...........................   89  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Photorhabd
. Photorhabdus luminescens subsp. laumondii ................................   89  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Photorhabd
. Cytophaga hutchinsonii ATCC 33406 ........................................   89  3 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Cytophaga 
. Leptotrichia hofstadii F0254 .............................................   89  2 hits [fusobacteria]           3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotri
. Vibrio harveyi ATCC BAA-1116 .............................................   88  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio har
. Lawsonia intracellularis PHE/MN1-00 ......................................   88  3 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Lawsonia i
. Chloroherpeton thalassium ATCC 35110 .....................................   88  3 hits [green sulfur bacteria]  3-deoxy-D-manno-octulosonate cytidylyltransferase [Chlorohe
. Akkermansia muciniphila ATCC BAA-835 .....................................   88  2 hits [verrucomicrobia]        3-deoxy-D-manno-octulosonate cytidylyltransferase [Akkerman
. Candidatus Cloacamonas acidaminovorans ...................................   88  2 hits [bacteria]               3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Alteromonas macleodii 'Deep ecotype' .....................................   88  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Alteromona
. Psychromonas sp. CNPT3 ...................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Psychromon
. Victivallis vadensis ATCC BAA-548 ........................................   88  2 hits [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Victival
. Vibrio cholerae O1 biovar El Tor str. N16961 .............................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae 2740-80 ..................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae V52 ......................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae O395 .....................................................   88  4 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae MAK 757 ..................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae NCTC 8457 ................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae B33 ......................................................   88  4 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae M66-2 ....................................................   88  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae BX 330286 ................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae RC9 ......................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae MJ-1236 ..................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae RC385 ....................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae MO10 .....................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholera CIRS 101 ..................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae ..........................................................   88  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Pseudomonas fluorescens SBW25 ............................................   88  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Candidatus Solibacter usitatus Ellin6076 .................................   88  3 hits [bacteria]               3-deoxy-manno-octulosonate cytidylyltransferase [Solibacter
. Bordetella petrii DSM 12804 ..............................................   88  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Bordetella petrii ........................................................   88  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Bordetella
. Geobacter lovleyi SZ .....................................................   88  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacte
. Porphyromonas gingivalis W83 .............................................   88  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromo
. Porphyromonas gingivalis .................................................   88  1 hit  [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromo
. Marinomonas sp. MED121 ...................................................   88  4 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Marinomona
. Vibrio cholerae 1587 .....................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae TM 11079-80 ..............................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae bv. albensis VL426 .......................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae 12129(1) .................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae V51 ......................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Vibrio cholerae AM-19226 .................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Bacteroides caccae ATCC 43185 ............................................   88  2 hits [CFB group bacteria]     hypothetical protein BACCAC_00683 [Bacteroides caccae ATCC 
. Vibrio cholerae TMA 21 ...................................................   88  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Aeromonas salmonicida subsp. salmonicida A449 ............................   87  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Aeromonas 
. Ralstonia pickettii 12D ..................................................   87  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Ralstoni
. Gemmata obscuriglobus UQM 2246 ...........................................   87  1 hit  [planctomycetes]         3-deoxy-manno-octulosonate cytidylyltransferase [Gemmata ob
. Rickettsia typhi str. Wilmington .........................................   87  2 hits [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Rickettsia typhi .........................................................   87  1 hit  [a-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Rickettsia
. Ralstonia pickettii 12J ..................................................   87  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Ralstoni
. Vibrio cholerae MZO-3 ....................................................   87  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Yersinia rohdei ATCC 43380 ...............................................   87  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia r
. Chlorobium phaeovibrioides DSM 265 .......................................   87  3 hits [green sulfur bacteria]  3-deoxy-manno-octulosonate cytidylyltransferase [Prosthecoc
. Bacteroides fragilis 3_1_12 ..............................................   87  1 hit  [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Burkholderia glumae BGR1 .................................................   87  2 hits [b-proteobacteria]       CMP-2-keto-3-deoxyoctulosonic acid synthetase [Burkholderia
. Parabacteroides merdae ATCC 43184 ........................................   87  2 hits [CFB group bacteria]     hypothetical protein PARMER_04001 [Parabacteroides merdae A
. Sideroxydans lithotrophicus ES-1 .........................................   87  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Sideroxy
. Pseudomonas syringae pv. syringae B728a ..................................   87  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Azoarcus sp. BH72 ........................................................   87  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Azoarcus s
. Acaryochloris marina MBIC11017 ...........................................   87  3 hits [cyanobacteria]          3-deoxy-manno-octulosonate cytidylyltransferase [Acaryochlo
. Porphyromonas gingivalis ATCC 33277 ......................................   87  3 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromo
. Fusobacterium sp. D12 ....................................................   87  1 hit  [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Pseudomonas fluorescens Pf-5 .............................................   87  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Vibrio sp. RC341 .........................................................   87  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio sp.
. Vibrio vulnificus CMCP6 ..................................................   87  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio vul
. Vibrio vulnificus ........................................................   87  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio vul
. Pseudomonas syringae pv. phaseolicola 1448A ..............................   87  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Pseudomonas syringae pv. tabaci ATCC 11528 ...............................   87  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Dialister invisus DSM 15470 ..............................................   86  2 hits [firmicutes]             3-deoxy-D-manno-octulosonate cytidylyltransferase [Dialiste
. Escherichia albertii TW07627 .............................................   86  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Marinobacter aquaeolei VT8 ...............................................   86  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Marinoba
. Cellvibrio japonicus Ueda107 .............................................   86  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Cellvibrio
. Stigmatella aurantiaca DW4/3-1 ...........................................   86  2 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Stigmate
. Bacteroides ovatus ATCC 8483 .............................................   86  2 hits [CFB group bacteria]     hypothetical protein BACOVA_02480 [Bacteroides ovatus ATCC 
. Burkholderia phymatum STM815 .............................................   86  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Alistipes putredinis DSM 17216 ...........................................   86  2 hits [CFB group bacteria]     hypothetical protein ALIPUT_01386 [Alistipes putredinis DSM
. Blastopirellula marina DSM 3645 ..........................................   86  4 hits [planctomycetes]         3-deoxy-manno-octulosonate cytidylyltransferase [Blastopire
. Syntrophobacter fumaroxidans MPOB ........................................   86  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Syntroph
. Vibrio coralliilyticus ATCC BAA-450 ......................................   86  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cor
. Vibrio splendidus LGP32 ..................................................   86  4 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio spl
. Burkholderia phytofirmans PsJN ...........................................   86  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Vibrio cholerae MZO-2 ....................................................   86  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Photobacterium angustum S14 ..............................................   86  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio ang
. Pseudomonas syringae pv. oryzae str. 1_6 .................................   86  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Candidatus Blochmannia pennsylvanicus str. BPEN ..........................   86  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Cyanothece sp. PCC 7425 ..................................................   86  2 hits [cyanobacteria]          3-deoxy-D-manno-octulosonate cytidylyltransferase [Cyanothe
. Vibrio cholerae 623-39 ...................................................   86  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cho
. Dyadobacter fermentans DSM 18053 .........................................   85  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonatecytidylyltransferase [Dyadobact
. Actinobacillus succinogenes 130Z .........................................   85  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Actinobaci
. Brevundimonas sp. BAL3 ...................................................   85  2 hits [a-proteobacteria]       Cytidylyltransferase, putative [Brevundimonas sp. BAL3] >gi
. Pseudomonas syringae pv. tomato str. DC3000 ..............................   85  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Pseudomonas syringae pv. tomato T1 .......................................   85  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Pseudomonas syringae pv. tomato ..........................................   85  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Bacteroides thetaiotaomicron VPI-5482 ....................................   85  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Bacteroides sp. 1_1_6 ....................................................   85  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Bacteroides thetaiotaomicron .............................................   85  1 hit  [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Vibrio fischeri ES114 ....................................................   85  5 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio fis
. Lentisphaera araneosa HTCC2155 ...........................................   85  4 hits [bacteria]               3-deoxy-manno-octulosonate cytidylyltransferase [Lentisphae
. Legionella pneumophila str. Lens .........................................   85  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Legionella
. Bacteroides intestinalis DSM 17393 .......................................   85  2 hits [CFB group bacteria]     hypothetical protein BACINT_02241 [Bacteroides intestinalis
. Burkholderia sp. H160 ....................................................   85  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Burkholderia ubonensis Bu ................................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............   85  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Legionella
. Cronobacter sakazakii ATCC BAA-894 .......................................   85  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Enterobact
. Edwardsiella ictaluri 93-146 .............................................   85  3 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase, putative
. Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   85  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Klebsiella
. Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................   85  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Klebsiella
. Photorhabdus asymbiotica .................................................   85  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Photorhabd
. Yersinia enterocolitica subsp. enterocolitica 8081 .......................   85  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia e
. Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................   85  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Pectobacte
. Leptospirillum ferrodiazotrophum .........................................   85  1 hit  [bacteria]               3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptospi
. Hahella chejuensis KCTC 2396 .............................................   85  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Hahella ch
. Vibrio mimicus VM573 .....................................................   85  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase synthetase 
. Bacteroides coprophilus DSM 18228 ........................................   85  2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_02576 [Bacteroides coprophilu
. Neptuniibacter caesariensis ..............................................   85  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Oceanosp
. Vibrio mimicus VM603 .....................................................   85  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase synthetase 
. Parabacteroides johnsonii DSM 18315 ......................................   85  2 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_02840 [Parabacteroides joh
. Pasteurella multocida subsp. multocida str. Pm70 .........................   85  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pasteurell
. Pasteurella multocida ....................................................   85  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pasteurell
. Yersinia bercovieri ATCC 43970 ...........................................   85  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia b
. Pseudomonas mendocina ymp ................................................   85  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Bacteroides eggerthii DSM 20697 ..........................................   85  2 hits [CFB group bacteria]     hypothetical protein BACEGG_02593 [Bacteroides eggerthii DS
. Burkholderia pseudomallei DM98 ...........................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 14 .............................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei B7210 ..........................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 7894 ...........................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei BCC215 .........................................   85  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei S13 ............................................   85  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Laribacter hongkongensis HLHK9 ...........................................   85  2 hits [b-proteobacteria]       KdsB [Laribacter hongkongensis HLHK9] >gi|226714958|gb|ACO7
. Pectobacterium wasabiae WPP163 ...........................................   85  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Pectobac
. Leptospira borgpetersenii serovar Hardjo-bovis L550 ......................   85  3 hits [spirochetes]            3-deoxy-manno-octulosonate cytidylyltransferase [Leptospira
. Leptospira borgpetersenii serovar Hardjo-bovis JB197 .....................   85  3 hits [spirochetes]            3-deoxy-manno-octulosonate cytidylyltransferase [Leptospira
. Acinetobacter sp. ATCC 27244 .............................................   85  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Acinetobac
. Methylibium petroleiphilum PM1 ...........................................   85  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Methylibiu
. Vibrio sp. AND4 ..........................................................   84  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio cam
. Yersinia aldovae ATCC 35236 ..............................................   84  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia a
. gamma proteobacterium HTCC5015 ...........................................   84  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [gamma pr
. Ralstonia solanacearum MolK2 .............................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cmp-kdo synthetase (partial sequ
. Haemophilus influenzae 22.1-21 ...........................................   84  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Haemophilu
. Leptotrichia buccalis DSM 1135 ...........................................   84  2 hits [fusobacteria]           3-deoxy-D-manno-octulosonatecytidylyltransferase [Leptotric
. Yersinia kristensenii ATCC 33638 .........................................   84  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia k
. Burkholderia thailandensis E264 ..........................................   84  4 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia thailandensis TXDOH .........................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia thailandensis Bt4 ...........................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Legionella pneumophila str. Paris ........................................   84  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Legionella
. Bacteroides finegoldii DSM 17565 .........................................   84  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Bacteroi
. Pectobacterium atrosepticum SCRI1043 .....................................   84  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Pectobacte
. Pectobacterium atrosepticum ..............................................   84  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Pectobacte
. Yersinia frederiksenii ATCC 33641 ........................................   84  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia f
. Bacteroides cellulosilyticus DSM 14838 ...................................   84  2 hits [CFB group bacteria]     hypothetical protein BACCELL_04692 [Bacteroides cellulosily
. Leptotrichia goodfellowii F0264 ..........................................   84  1 hit  [fusobacteria]           3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotri
. Halorhodospira halophila SL1 .............................................   84  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Halorhod
. Eikenella corrodens ATCC 23834 ...........................................   84  2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_00136 [Eikenella corrodens AT
. Microscilla marina ATCC 23134 ............................................   84  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Microsci
. Legionella pneumophila str. Corby ........................................   84  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Legionella
. Shewanella amazonensis SB2B ..............................................   84  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Bacteroides stercoris ATCC 43183 .........................................   84  2 hits [CFB group bacteria]     hypothetical protein BACSTE_01334 [Bacteroides stercoris AT
. Burkholderia pseudomallei 1710b ..........................................   84  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Aliivibrio salmonicida LFI1238 ...........................................   84  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Aliivibrio
. Cupriavidus taiwanensis ..................................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Cupriavidu
. gamma proteobacterium HTCC2207 ...........................................   84  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [marine g
. Burkholderia pseudomallei K96243 .........................................   84  2 hits [b-proteobacteria]       putative 3-deoxy-manno-octulosonate cytidylyltransferase [B
. Escherichia coli E22 .....................................................   84  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Escherichia coli B171 ....................................................   84  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Escherichia coli O103:H2 str. 12009 ......................................   84  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Klebsiella pneumoniae NTUH-K2044 .........................................   84  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Klebsiella
. Burkholderia mallei ATCC 23344 ...........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei GB8 horse 4 ..........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei SAVP1 ................................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei NCTC 10229 ...........................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 668 ............................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei NCTC 10247 ...........................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 1106a ..........................................   84  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 305 ............................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei PRL-20 ...............................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 91 .............................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 9 ..............................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei NCTC 13177 .....................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 112 ............................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 576 ............................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei MSHR346 ........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 1106b ..........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei ATCC 10399 ...........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 1655 ...........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei Pasteur 52237 ..................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei JHU ..................................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 1710a ..........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei 406e ...........................................   84  4 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei 2002721280 ...........................................   84  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia mallei ......................................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia pseudomallei ................................................   84  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia xenovorans LB400 ............................................   83  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Pectobacterium carotovorum subsp. carotovorum WPP14 ......................   83  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Pectobacte
. Fusobacterium varium ATCC 27725 ..........................................   83  2 hits [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Burkholderia dolosa AUO158 ...............................................   83  2 hits [b-proteobacteria]       CMP-2-keto-3-deoxyoctulosonic acid synthetase [Burkholderia
. Pseudoalteromonas tunicata D2 ............................................   83  2 hits [g-proteobacteria]       CTP:CMP-3-deoxy-D-manno-octulosonate transferase [Pseudoalt
. Pseudomonas putida W619 ..................................................   83  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Ralstonia eutropha H16 ...................................................   83  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Bacteroides sp. D2 .......................................................   83  1 hit  [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Burkholderia thailandensis MSMB43 ........................................   83  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Photobacterium sp. SKA34 .................................................   83  2 hits [g-proteobacteria]       putative 3-deoxy-manno-octulosonate cytidylyltransferase [P
. Pseudomonas aeruginosa UCBPP-PA14 ........................................   83  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Burkholderia graminis C4D1M ..............................................   83  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Burkholderia pseudomallei Pakistan 9 .....................................   83  2 hits [b-proteobacteria]       conserved hypothetical protein [Burkholderia pseudomallei P
. Pseudomonas fluorescens Pf0-1 ............................................   83  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Pseudomonas aeruginosa PACS2 .............................................   83  1 hit  [g-proteobacteria]       hypothetical protein PaerPA_01003592 [Pseudomonas aeruginos
. Pseudomonas aeruginosa LESB58 ............................................   83  3 hits [g-proteobacteria]       hypothetical protein PaerPA_01003592 [Pseudomonas aeruginos
. Pseudomonas aeruginosa C3719 .............................................   83  2 hits [g-proteobacteria]       hypothetical protein PaerPA_01003592 [Pseudomonas aeruginos
. Pseudomonas aeruginosa 2192 ..............................................   83  2 hits [g-proteobacteria]       hypothetical protein PaerPA_01003592 [Pseudomonas aeruginos
. Campylobacter jejuni subsp. jejuni 81116 .................................   83  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Campylobacter jejuni subsp. jejuni 81-176 ................................   83  3 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Campylobacter jejuni subsp. jejuni 260.94 ................................   83  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Campylobacter jejuni subsp. jejuni HB93-13 ...............................   83  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Campylobacter jejuni .....................................................   83  1 hit  [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Campylobacter jejuni subsp. jejuni CG8486 ................................   83  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Bacteroides sp. 2_2_4 ....................................................   83  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Bacteroides sp. D1 .......................................................   83  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroide
. Diaphorobacter sp. TPSY ..................................................   83  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Diaphoro
. Klebsiella pneumoniae 342 ................................................   83  3 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Klebsiel
. Erwinia pyrifoliae Ep1/96 ................................................   83  2 hits [enterobacteria]         CTP:CMP-3-deoxy-D-manno-octulosonate transferase [Erwinia p
. Burkholderia cenocepacia MC0-3 ...........................................   83  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Photobacterium profundum 3TCK ............................................   83  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Photobacte
. Mannheimia succiniciproducens MBEL55E ....................................   83  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Mannheimia
. Shigella flexneri 2a str. 301 ............................................   83  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella f
. Shigella flexneri 2a str. 2457T ..........................................   83  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella f
. Shigella flexneri 5 str. 8401 ............................................   83  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella f
. Shigella flexneri ........................................................   83  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella f
. Escherichia coli B7A .....................................................   83  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Shigella sonnei Ss046 ....................................................   83  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Shigella boydii Sb227 ....................................................   83  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Shigella boydii CDC 3083-94 ..............................................   83  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Escherichia coli O26:H11 str. 11368 ......................................   83  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Escherichia coli O111:H- str. 11128 ......................................   83  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Vibrio fischeri MJ11 .....................................................   83  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio fis
. Shigella sp. D9 ..........................................................   83  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella s
. Escherichia fergusonii ATCC 35469 ........................................   83  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Verrucomicrobiae bacterium DG1235 ........................................   83  2 hits [verrucomicrobia]        3-deoxy-D-manno-octulosonate cytidylyltransferase [Verrucom
. Shigella dysenteriae Sd197 ...............................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Shigella d
. Prevotella melaninogenica ATCC 25845 .....................................   82  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotel
. Pelobacter propionicus DSM 2379 ..........................................   82  3 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pelobacter
. Escherichia coli E24377A .................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli E110019 .................................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli SE11 ....................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli IAI1 ....................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli 55989 ...................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Acidovorax sp. JS42 ......................................................   82  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acidovor
. Janthinobacterium sp. Marseille ..........................................   82  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO sy
. Yersinia pestis KIM ......................................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Microtus str. 91001 ...............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pseudotuberculosis IP 32953 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis Antiqua ..................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis Nepal516 .................................................   82  5 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis Pestoides F ..............................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis CA88-4125 ................................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pseudotuberculosis IP 31758 .....................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis Angola ...................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Orientalis str. F1991016 ..........................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Orientalis str. IP275 .............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Antiqua str. E1979001 .............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Antiqua str. B42003004 ............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Antiqua str. UG05-0454 ............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Orientalis str. MG05-1020 .........................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Mediaevalis str. K1973002 .........................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis FV-1 .....................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pseudotuberculosis YPIII ........................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pseudotuberculosis PB1/+ ........................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis CO92 .....................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Orientalis str. PEXU2 .............................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis biovar Orientalis str. India 195 .........................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis Pestoides A ..............................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pestis ..........................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Yersinia pseudotuberculosis ..............................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia p
. Pectobacterium carotovorum subsp. carotovorum PC1 ........................   82  3 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Pectobac
. Burkholderia vietnamiensis G4 ............................................   82  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Vibrio parahaemolyticus 16 ...............................................   82  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Vibrio p
. Helicobacter hepaticus ATCC 51449 ........................................   82  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Helicobact
. Escherichia coli O157:H7 EDL933 ..........................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. Sakai ......................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4113 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4401 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4501 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4486 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4196 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4076 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC869 ......................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC508 ......................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4024 .....................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4206 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4045 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4042 .....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. EC4115 .....................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. TW14588 ....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. TW14359 ....................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. FRIK2000 ...................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 str. FRIK966 ....................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O157:H7 .................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli .........................................................   82 10 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli str. K-12 substr. MG1655 ................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli str. K-12 substr. W3110 .................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli HS ......................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli ATCC 8739 ...............................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli str. K-12 substr. DH10B .................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli 53638 ...................................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli 101-1 ...................................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli BW2952 ..................................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli BL21(DE3) ...............................................   82  4 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli B str. REL606 ...........................................   82  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia sp. 4_1_40B ..................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli K-12 ....................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli LW1655F+ ................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli DH1 .....................................................   82  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Geobacter sp. M18 ........................................................   82  2 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacte
. Photobacterium profundum SS9 .............................................   82  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Photobacte
. Photobacterium profundum .................................................   82  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Photobacte
. Campylobacter jejuni RM1221 ..............................................   82  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Campylobacter jejuni subsp. jejuni CG8421 ................................   82  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Shigella dysenteriae 1012 ................................................   82  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Shigella
. Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Campylobacter jejuni subsp. jejuni CF93-6 ................................   82  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Campylobacter jejuni subsp. jejuni 84-25 .................................   82  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Campylobacter jejuni subsp. jejuni NCTC 11168 ............................   82  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Desulfomicrobium baculatum DSM 4028 ......................................   82  2 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonatecytidylyltransferase [Desulfomi
. Pseudomonas aeruginosa PAO1 ..............................................   82  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Pseudomonas aeruginosa ...................................................   82  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Citrobacter youngae ATCC 29220 ...........................................   82  2 hits [enterobacteria]         hypothetical protein CIT292_01929 [Citrobacter youngae ATCC
. Escherichia coli SMS-3-5 .................................................   82  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Escherichia coli IAI39 ...................................................   82  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Escherichia coli UMN026 ..................................................   82  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Escheric
. Alteromonas macleodii ATCC 27126 .........................................   82  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Alteromona
. Burkholderia multivorans CGD1 ............................................   82  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Chlamydia trachomatis 434/Bu .............................................   82  3 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis L2b/UCH-1/proctitis ................................   82  3 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis ....................................................   82  2 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Neisseria meningitidis 053442 ............................................   82  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Neisseria meningitidis alpha14 ...........................................   82  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonatecytidylyltransferase [Neisseria
. Selenomonas sputigena ATCC 35185 .........................................   82  2 hits [firmicutes]             3-deoxy-D-manno-octulosonate cytidylyltransferase [Selenomo
. Candidatus Blochmannia floridanus ........................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Pseudomonas putida GB-1 ..................................................   82  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Escherichia coli O127:H6 str. E2348/69 ...................................   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Nitrosococcus oceani ATCC 19707 ..........................................   82  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrosoc
. Neisseria meningitidis alpha275 ..........................................   82  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Fusobacterium sp. 2_1_31 .................................................   82  2 hits [fusobacteria]           3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacter
. Neisseria meningitidis ...................................................   82  1 hit  [b-proteobacteria]       Cap29eG protein [Neisseria meningitidis]
. Burkholderia oklahomensis EO147 ..........................................   82  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia oklahomensis C6786 ..........................................   82  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Bacteroides plebeius DSM 17135 ...........................................   82  2 hits [CFB group bacteria]     hypothetical protein BACPLE_03404 [Bacteroides plebeius DSM
. Halothiobacillus neapolitanus c2 .........................................   82  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Halothio
. Polaromonas sp. JS666 ....................................................   82  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Polaromo
. Burkholderia ambifaria MC40-6 ............................................   82  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   82  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Acinetobacter sp. ADP1 ...................................................   82  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Acinetobac
. Neisseria meningitidis alpha153 ..........................................   82  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Shewanella piezotolerans WP3 .............................................   82  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Shewanel
. Rhodopirellula baltica SH 1 ..............................................   82  2 hits [planctomycetes]         3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopirel
. Rhodopirellula baltica ...................................................   82  1 hit  [planctomycetes]         3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopirel
. Shewanella benthica KT99 .................................................   82  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Erwinia tasmaniensis Et1/99 ..............................................   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Erwinia ta
. Erwinia tasmaniensis .....................................................   81  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Erwinia ta
. Burkholderia multivorans CGD2M ...........................................   81  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Burkholderia multivorans CGD2 ............................................   81  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Myxococcus xanthus DK 1622 ...............................................   81  3 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Myxococc
. Campylobacter jejuni subsp. doylei 269.97 ................................   81  2 hits [e-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Campylobac
. Prevotella sp. oral taxon 472 str. F0295 .................................   81  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotel
. Verrucomicrobium spinosum DSM 4136 .......................................   81  1 hit  [verrucomicrobia]        3-deoxy-manno-octulosonate cytidylyltransferase [Verrucomic
. Vibrio sp. MED222 ........................................................   81  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio sp.
. Burkholderia sp. 383 .....................................................   81  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Citrobacter sp. 30_2 .....................................................   81  2 hits [enterobacteria]         CMP-2-keto-3-deoxyoctulosonic acid synthetase [Citrobacter 
. Thermosinus carboxydivorans Nor1 .........................................   81  2 hits [firmicutes]             3-deoxy-D-manno-octulosonate cytidylyltransferase [Thermosi
. Burkholderia multivorans ATCC 17616 ......................................   81  5 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Ralstonia eutropha JMP134 ................................................   81  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Bacteroides coprocola DSM 17136 ..........................................   81  2 hits [CFB group bacteria]     hypothetical protein BACCOP_02044 [Bacteroides coprocola DS
. Prevotella veroralis F0319 ...............................................   81  2 hits [CFB group bacteria]     3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotel
. Bacteroides uniformis ATCC 8492 ..........................................   81  2 hits [CFB group bacteria]     hypothetical protein BACUNI_02732 [Bacteroides uniformis AT
. Pantoea sp. At-9b ........................................................   81  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Pantoea 
. Sphingobacterium spiritivorum ATCC 33300 .................................   81  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobac
. Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........   81  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   81  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   81  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhimurium ..................   81  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica ......................................................   81  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   81  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Pseudoalteromonas atlantica T6c ..........................................   81  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Pseudoal
. Campylobacter coli RM2228 ................................................   81  2 hits [e-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Campylob
. Chlamydia trachomatis 70 .................................................   81  1 hit  [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis 70s ................................................   81  1 hit  [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia muridarum (agent of mouse pneumon...) ..........................   81  1 hit  [chlamydias]             RecName: Full=3-deoxy-manno-octulosonate cytidylyltransfera
. Chlamydia muridarum Nigg .................................................   81  2 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   81  3 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Salmonel
. Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   80  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Paratyphi A ..................   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Pseudomonas aeruginosa PA7 ...............................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Burkholderia ambifaria MEX-5 .............................................   80  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Pelobacter carbinolicus DSM 2380 .........................................   80  3 hits [d-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pelobacter
. Escherichia coli UTI89 ...................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli 536 .....................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli F11 .....................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli S88 .....................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli ED1a ....................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia sp. 3_2_53FAA ................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Proteus penneri ATCC 35198 ...............................................   80  2 hits [enterobacteria]         hypothetical protein PROPEN_04616 [Proteus penneri ATCC 351
. Chlamydia trachomatis D/UW-3/CX ..........................................   80  2 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis A/HAR-13 ...........................................   80  3 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis B/TZ1A828/OT .......................................   80  2 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis 6276 ...............................................   80  1 hit  [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis 6276s ..............................................   80  1 hit  [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Chlamydia trachomatis D(s)2923 ...........................................   80  1 hit  [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Cronobacter turicensis ...................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Cronobacte
. Escherichia coli CFT073 ..................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli 83972 ...................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Escherichia coli O6 ......................................................   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Vibrio metschnikovii CIP 69.14 ...........................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrio met
. Ralstonia metallidurans CH34 .............................................   80  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Ralstonia 
. Shewanella denitrificans OS217 ...........................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Stenotrophomonas maltophilia K279a .......................................   80  3 hits [g-proteobacteria]       putative 3-deoxy-manno-octulosonate cytidylyltransferase [S
. Citrobacter koseri ATCC BAA-895 ..........................................   80  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Citrobacte
. Gallionella ferruginea ES-2 ..............................................   80  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Gallione
. Neisseria meningitidis FAM18 .............................................   80  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Neisseria meningitidis 8013 ..............................................   80  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO sy
. Leptothrix cholodnii SP-6 ................................................   80  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptothr
. Haliangium ochraceum DSM 14365 ...........................................   80  2 hits [d-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Haliangi
. Rhodoferax ferrireducens T118 ............................................   80  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodofer
. Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........   80  1 hit  [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Salmonella enterica subsp. enterica serovar Typhi ........................   80  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Salmonella
. Acidovorax citrulli AAC00-1 ..............................................   80  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acidovor
. Marinobacter algicola DG893 ..............................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Marinobact
. Burkholderia cenocepacia AU 1054 .........................................   80  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Burkholderia cenocepacia HI2424 ..........................................   80  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Methylococcus capsulatus str. Bath .......................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Methylococ
. Methylococcus capsulatus .................................................   80  1 hit  [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Methylococ
. Escherichia coli APEC O1 .................................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Escherichi
. Burkholderia cenocepacia J2315 ...........................................   80  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   80  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Salmonel
. Candidatus Vesicomyosocius okutanii HA ...................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus
. Burkholderia ambifaria AMMD ..............................................   80  3 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Burkholder
. Verminephrobacter eiseniae EF01-2 ........................................   80  3 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Verminep
. Methylovorus sp. SIP3-4 ..................................................   80  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Methylov
. Chlamydia trachomatis B/Jali20/OT ........................................   80  2 hits [chlamydias]             3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia 
. Acinetobacter radioresistens SK82 ........................................   80  2 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Acinetob
. Neisseria meningitidis MC58 ..............................................   80  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Neisseria meningitidis serogroup B .......................................   80  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...   80  2 hits [enterobacteria]         3-deoxy-D-manno-octulosonate cytidylyltransferase [Salmonel
. Marinobacter sp. ELB17 ...................................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Marinobact
. Shewanella putrefaciens CN-32 ............................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Flavobacteria bacterium BAL38 ............................................   80  2 hits [CFB group bacteria]     3-deoxy-manno-octulosonate cytidylyltransferase [Flavobacte
. Vibrionales bacterium SWAT-3 .............................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Vibrionale
. Beggiatoa sp. PS .........................................................   80  2 hits [g-proteobacteria]       Acylneuraminate cytidylyltransferase [Beggiatoa sp. PS] >gi
. Neisseria lactamica ATCC 23970 ...........................................   80  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Burkholderia ambifaria IOP40-10 ..........................................   80  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Burkhold
. Shewanella sp. W3-18-1 ...................................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Shewanella putrefaciens 200 ..............................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella
. Colwellia psychrerythraea 34H ............................................   80  3 hits [g-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Colwelli
. Proteus mirabilis HI4320 .................................................   80  3 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Proteus mi
. Proteus mirabilis ATCC 29906 .............................................   80  2 hits [enterobacteria]         3-deoxy-manno-octulosonate cytidylyltransferase [Proteus mi
. Pseudomonas putida KT2440 ................................................   80  3 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Acidaminococcus sp. D21 ..................................................   80  2 hits [firmicutes]             3-deoxy-D-manno-octulosonate cytidylyltransferase [Acidamin
. Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................   80  2 hits [b-proteobacteria]       3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidat
. Pseudomonas putida F1 ....................................................   80  2 hits [g-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Pseudomona
. Neisseria meningitidis Z2491 .............................................   79  2 hits [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Neisseria meningitidis serogroup A .......................................   79  1 hit  [b-proteobacteria]       3-deoxy-manno-octulosonate cytidylyltransferase [Neisseria 
. Mitsuokella multacida DSM 20544 ..........................................   79  2 hits [firmicutes]             3-deoxy-D-manno-octulosonate cytidylyltransferase [Mitsuoke
. Saccharophagus degradans 2-40 ............................................   79  3 hits [g-proteobacteria]       chorismate synthase [Saccharophagus degradans 2-40] >gi|122

BLAST

PROTOCOLE:


a. BLAST NCBI de type Blastp, contre une base NR, "max target sequences" limites de 1000 (Autres réglages par défaut.)

b. BLAST NCBI de type Blastp, contre une base Swissprot, "max target sequence" limites de 1000 (Autres réglages par défaut.)


ANALYSE DES RÉSULTATS:


a. Banque NR


De nombreux homologues ont été trouvés, notre séquence est alignée à partir du 75e acide aminé de ces séquences environ, ce qui confirme le fait que notre séquence est incomplète en 5'.

La fin de notre ORF correspond à la fin des protéines homologues, ce qui semble confirmer que notre séquence est complète en 3'.

Au vu des résultats obtenus, il est fort probable que notre séquence corresponde à une protéine proche de la 3-deoxy-manno-octulosonate cytidylyltransferase.

Nous avons cherché à déterminer le seuil d'homologie, et l'avons placé après ZP 01385231.1 (E Value 2e-08) :

en effet, toutes les séquences suivantes possèdent des similarités inférieures à 30% sur 80% de la séquence, et celles situées au dessus possèdent des similarités de plus de 30% sur plus de 80% de la séquence.

NCBI annonce de plus que notre séquence possède un domaine correspondant à la superfamille glyco_tranf_GTA_type.


b. Banque Swissprot


Les résultats semblables à ceux de la base NR confirment la nature de la protéine correspondant à notre séquence : 3-deoxy-manno-octulosonate cytidylyltransferase.

De plus on observe un saut de E Value très important après SP|B2VS61.1 , passant de 6e-08 à 0,43, ce qui confirme l'ordre de grandeur de notre seuil d'homologie.

RÉSULTATS BRUTS

a. Banque NR

Translation of ORF number 1 in reading frame...
Results for: What's this?

Your BLAST job specified more than one input sequence. This box lets you choose which input sequence to show BLAST results for.

Query ID
    lcl|87488
Description
    Translation of ORF number 1 in reading frame 3 on the reverse strand.
Molecule type
    amino acid
Query Length
    171

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTP 2.2.22+ Citation

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ABZ06016.1|  putative cytidylyltransferase [uncultured mari...   169    8e-41
ref|NP_949032.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   131    3e-29 Gene info
ref|YP_676618.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   131    3e-29 Gene info
ref|ZP_05068841.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   130    4e-29
ref|YP_001993187.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   130    5e-29 Gene info
ref|YP_485387.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   129    1e-28 Gene info
sp|Q2IZ84.2|KDSB_RHOP2  RecName: Full=3-deoxy-manno-octulosona...   128    2e-28
ref|YP_001242846.1|  3-deoxy-manno-octulosonate cytidylyltrans...   127    4e-28 Gene info
ref|YP_575727.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   126    9e-28 Gene info
ref|YP_001203152.1|  3-deoxy-manno-octulosonate cytidylyltrans...   125    1e-27 Gene info
sp|A4YLY9.2|KDSB_BRASO  RecName: Full=3-deoxy-manno-octulosona...   125    2e-27
ref|YP_570661.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   125    2e-27 Gene info
ref|YP_001411531.1|  3-deoxy-manno-octulosonate cytidylyltrans...   125    2e-27 Gene info
sp|A8IGU8.2|KDSB_AZOC5  RecName: Full=3-deoxy-manno-octulosona...   125    2e-27
ref|YP_001523053.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   125    2e-27 Gene info
ref|YP_782678.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   125    2e-27 Gene info
ref|ZP_05375100.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   125    2e-27
ref|YP_533585.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   124    2e-27 Gene info
ref|YP_002290403.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   124    4e-27 Gene info
ref|ZP_03519768.1|  3-deoxy-manno-octulosonate cytidylyltransf...   122    1e-26
ref|ZP_02164732.1|  3-deoxy-manno-octulosonate cytidylyltransf...   121    2e-26
ref|YP_423531.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_265930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_001417529.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   121    3e-26 Gene info
ref|ZP_01264324.1|  3-deoxy-manno-octulosonate cytidylyltransf...   121    3e-26
ref|ZP_01437309.1|  3-deoxy-manno-octulosonate cytidylyltransf...   121    3e-26
ref|ZP_01044510.1|  3-deoxy-manno-octulosonate cytidylyltransf...   120    4e-26
ref|YP_001608730.1|  3-deoxy-manno-octulosonate cytidylyltrans...   120    4e-26 Gene info
ref|YP_002828027.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   120    5e-26 Gene info
ref|ZP_05963355.1|  3-deoxy-manno-octulosonate cytidylyltransf...   120    5e-26
ref|ZP_05450361.1|  3-deoxy-manno-octulosonate cytidylyltransf...   120    6e-26
sp|A5VMY8.2|KDSB_BRUO2  RecName: Full=3-deoxy-manno-octulosona...   120    6e-26
ref|YP_002299577.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   120    6e-26 Gene info
ref|YP_745814.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   120    6e-26 Gene info
ref|ZP_05822060.1|  acylneuraminate cytidylyltransferase [Bruc...   120    6e-26
ref|ZP_05837783.1|  acylneuraminate cytidylyltransferase [Bruc...   120    6e-26
ref|YP_001258085.1|  3-deoxy-manno-octulosonate cytidylyltrans...   120    6e-26 Gene info
ref|YP_220819.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   120    7e-26 Gene info
ref|NP_697080.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   120    7e-26 Gene info
gb|AAL53085.1|  3-deoxy-manno-octulosonate cytidylyltransferas...   119    8e-26 Gene info
ref|ZP_04593511.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   119    8e-26
ref|YP_002978181.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   119    1e-25 Gene info
ref|YP_765745.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   119    1e-25 Gene info
ref|ZP_05833606.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   119    1e-25
ref|ZP_03508205.1|  3-deoxy-manno-octulosonate cytidylyltransf...   119    1e-25
ref|YP_001976344.1|  3-deoxy-manno-octulosonate cytidylyltrans...   119    2e-25 Gene info
ref|YP_002548058.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   118    2e-25 Gene info
ref|YP_316905.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   118    2e-25 Gene info
ref|ZP_00055493.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   118    2e-25
ref|NP_384329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   118    2e-25 Gene info
ref|YP_001329080.1|  3-deoxy-manno-octulosonate cytidylyltrans...   117    5e-25 Gene info
ref|YP_001756308.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   117    5e-25 Gene info
ref|ZP_05180070.1|  3-deoxy-manno-octulosonate cytidylyltransf...   117    5e-25
ref|ZP_03524858.1|  3-deoxy-manno-octulosonate cytidylyltransf...   116    7e-25
ref|YP_003065178.1|  3-deoxy-manno-octulosonate cytidylyltrans...   116    7e-25 Gene info
ref|NP_768062.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   116    9e-25 Gene info
ref|YP_467684.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    1e-24 Gene info
ref|NP_353135.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    1e-24 Gene info
ref|YP_001233783.1|  3-deoxy-manno-octulosonate cytidylyltrans...   115    1e-24 Gene info
ref|YP_033089.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    2e-24 Gene info
ref|NP_106153.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    2e-24 Gene info
ref|YP_002274516.1|  3-deoxy-manno-octulosonate cytidylyltrans...   115    2e-24 Gene info
ref|ZP_04769559.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   115    2e-24
ref|YP_002283572.1|  3-deoxy-manno-octulosonate cytidylyltrans...   115    2e-24 Gene info
ref|YP_001602122.1|  putative 3-deoxy-manno-octulosonate cytid...   114    2e-24 Gene info
ref|YP_001923132.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   114    3e-24 Gene info
ref|ZP_01227690.1|  3-deoxy-manno-octulosonate cytidylyltransf...   114    4e-24
ref|YP_002542871.1|  3-deoxy-manno-octulosonate cytidylyltrans...   114    4e-24 Gene info
ref|YP_002971289.1|  3-deoxy-manno-octulosonate cytidylyltrans...   114    4e-24 Gene info
ref|YP_001637835.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   114    4e-24 Gene info
ref|YP_002419249.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   114    4e-24 Gene info
ref|YP_031930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   114    4e-24 Gene info
ref|ZP_04679190.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   113    6e-24
ref|ZP_00050998.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   113    7e-24
ref|YP_001368577.1|  3-deoxy-manno-octulosonate cytidylyltrans...   113    8e-24 Gene info
ref|YP_190516.2|  3-deoxy-manno-octulosonate cytidylyltransfer...   112    1e-23 Gene info
ref|YP_989485.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   112    2e-23 Gene info
gb|AAW59860.1|  3-Deoxy-manno-octulosonate cytidylyltransferas...   112    2e-23 Gene info
ref|ZP_02186247.1|  3-deoxy-manno-octulosonate cytidylyltransf...   111    2e-23
ref|ZP_05810269.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   111    3e-23
ref|YP_003187715.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   110    4e-23 Gene info
ref|ZP_03528442.1|  3-deoxy-manno-octulosonate cytidylyltransf...   107    6e-22
ref|YP_002495856.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   106    1e-21 Gene info
ref|ZP_01547912.1|  3-deoxy-manno-octulosonate cytidylyltransf...   105    1e-21
ref|YP_001768551.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   105    2e-21 Gene info
sp|B0UNK9.2|KDSB_METS4  RecName: Full=3-deoxy-manno-octulosona...   105    2e-21
ref|XP_002118807.1|  hypothetical protein TRIADDRAFT_34782 [Tr...   105    2e-21 Gene info
ref|YP_001381481.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   105    2e-21 Gene info
ref|YP_002247865.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   103    7e-21 Gene info
ref|YP_428245.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   102    2e-20 Gene info
sp|Q2RPI7.2|KDSB_RHORT  RecName: Full=3-deoxy-manno-octulosona...   102    2e-20
ref|YP_001494640.1|  3-deoxy-manno-octulosonate cytidylyltrans...   102    2e-20 Gene info
ref|YP_001649896.1|  3-deoxy-manno-octulosonate cytidylyltrans...   101    2e-20 Gene info
ref|YP_001493369.1|  3-deoxy-manno-octulosonate cytidylyltrans...   100    5e-20 Gene info
ref|ZP_00154788.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   100    5e-20
ref|NP_438231.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   100    5e-20 GeoGene info
pdb|1VIC|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...   100    6e-20 Related structures
ref|ZP_01790947.1|  3-deoxy-manno-octulosonate cytidylyltransf...   100    6e-20
ref|YP_002494711.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   100    6e-20 Gene info
ref|YP_246610.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   100    7e-20 Gene info
ref|YP_001499282.1|  3-deoxy-manno-octulosonate cytidylyltrans...   100    8e-20 Gene info
ref|ZP_05115256.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  99.8    8e-20
ref|YP_002136638.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  99.8    8e-20 Gene info
ref|ZP_02478741.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.8    8e-20
ref|YP_589652.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  99.4    1e-19 Gene info
ref|YP_467376.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  99.4    1e-19 Gene info
ref|YP_001492423.1|  3-deoxy-manno-octulosonate cytidylyltrans...  99.4    1e-19 Gene info
pdb|3DUV|A  Chain A, Crystal Structure Of 3-Deoxy-Manno-Octulo...  99.4    1e-19 Related structures
pdb|1VH3|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...  99.0    1e-19 Related structures
ref|YP_538158.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  99.0    1e-19 Gene info
ref|NP_220762.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  99.0    2e-19 Gene info
ref|YP_001290415.1|  3-deoxy-manno-octulosonate cytidylyltrans...  99.0    2e-19 Gene info
ref|YP_001784328.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  99.0    2e-19 Gene info
gb|ABZ06711.1|  putative cytidylyltransferase [uncultured mari...  99.0    2e-19
gb|ABZ06170.1|  putative cytidylyltransferase [uncultured mari...  98.6    2e-19
ref|ZP_05849819.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  98.6    2e-19
ref|ZP_05041457.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  98.6    2e-19
ref|YP_002845149.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.6    2e-19 Gene info
ref|ZP_04698963.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  98.6    2e-19
ref|YP_002475545.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.2    2e-19 Gene info
ref|YP_718870.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  98.2    3e-19 Gene info
ref|ZP_00142038.1|  3-deoxy-manno-octulosonate cytidylyltransf...  98.2    3e-19
ref|ZP_01786422.1|  3-deoxy-manno-octulosonate cytidylyltransf...  97.8    3e-19
ref|NP_360161.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  97.8    3e-19 Gene info
ref|YP_003007423.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  97.8    3e-19 Gene info
ref|ZP_01797708.1|  hypothetical protein CGSHiR3021_11024 [Hae...  97.4    4e-19
ref|ZP_00157565.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  97.4    4e-19
ref|ZP_01789110.1|  3-deoxy-manno-octulosonate cytidylyltransf...  97.4    4e-19
ref|YP_001875795.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  97.1    5e-19 Gene info
ref|YP_001291965.1|  3-deoxy-manno-octulosonate cytidylyltrans...  97.1    5e-19 Gene info
ref|ZP_01552499.1|  3-deoxy-manno-octulosonate cytidylyltransf...  97.1    5e-19
ref|YP_001052798.1|  3-deoxy-manno-octulosonate cytidylyltrans...  97.1    6e-19 Gene info
ref|YP_692777.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  96.7    8e-19 Gene info
ref|ZP_03612302.1|  3-deoxy-manno-octulosonate cytidylyltransf...  96.7    8e-19
ref|ZP_03905412.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  96.3    9e-19
ref|YP_001651135.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    1e-18 Gene info
ref|YP_002916788.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    1e-18 Gene info
ref|YP_002755830.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  96.3    1e-18 Gene info
ref|YP_001797217.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  95.5    2e-18 Gene info
ref|ZP_00135509.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  95.5    2e-18
ref|YP_003146553.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  95.5    2e-18 Gene info
ref|ZP_05877838.1|  3-deoxy-manno-octulosonate cytidylyltransf...  95.5    2e-18
ref|ZP_05723508.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  95.5    2e-18
ref|ZP_04639372.1|  3-deoxy-manno-octulosonate cytidylyltransf...  95.5    2e-18
ref|NP_872922.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  95.1    2e-18 Gene info
ref|NP_884789.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  95.1    2e-18 Gene info
ref|YP_965718.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    3e-18 Gene info
ref|ZP_04809763.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.7    3e-18
ref|ZP_04752737.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.7    3e-18
ref|NP_881372.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    3e-18 Gene info
ref|ZP_04976803.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.4    3e-18
ref|YP_286406.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.4    4e-18 Gene info
ref|YP_003092848.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  94.0    5e-18 Gene info
ref|ZP_04659293.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.0    5e-18
ref|ZP_03699378.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  93.6    6e-18
ref|NP_888551.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.6    6e-18 Gene info
ref|ZP_00133756.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  93.2    7e-18
ref|ZP_04922434.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  93.2    8e-18
ref|ZP_03130139.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  93.2    8e-18
ref|YP_002761137.1|  3-deoxy-manno-octulosonate cytidylyltrans...  93.2    8e-18 Gene info
ref|ZP_04567202.1|  3-deoxy-manno-octulosonate cytidylyltransf...  93.2    9e-18
ref|YP_001686199.1|  3-deoxy-manno-octulosonate cytidylyltrans...  93.2    9e-18 Gene info
ref|NP_520653.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  92.8    1e-17 Gene info
ref|YP_001155067.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  92.8    1e-17 Gene info
gb|ACX82601.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  92.8    1e-17
ref|YP_012325.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  92.8    1e-17 Gene info
ref|ZP_05920788.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  92.8    1e-17
ref|ZP_01883937.1|  3-deoxy-manno-octulosonate cytidylyltransf...  92.4    1e-17
ref|NP_903014.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  92.4    1e-17 Gene info
ref|ZP_04614875.1|  3-deoxy-manno-octulosonate cytidylyltransf...  92.4    1e-17
ref|ZP_02959862.1|  hypothetical protein PROSTU_01761 [Provide...  92.4    1e-17
ref|ZP_01017409.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  92.4    1e-17
ref|ZP_05287334.1|  3-deoxy-manno-octulosonate cytidylyltransf...  92.4    1e-17
ref|ZP_04636024.1|  3-deoxy-manno-octulosonate cytidylyltransf...  92.4    1e-17
ref|YP_001301920.1|  3-deoxy-manno-octulosonate cytidylyltrans...  92.4    2e-17 Gene info
ref|YP_002987814.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  92.0    2e-17 Gene info
ref|YP_002990583.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  92.0    2e-17 Gene info
ref|ZP_01260428.1|  3-deoxy-manno-octulosonate cytidylyltransf...  92.0    2e-17
ref|ZP_01916342.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  91.7    2e-17
ref|ZP_01618423.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.7    2e-17
ref|ZP_01717482.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.7    3e-17
ref|ZP_03656990.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    3e-17
ref|ZP_03640071.1|  hypothetical protein PROVRETT_03167 [Provi...  91.3    3e-17
ref|ZP_01853368.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    3e-17
ref|ZP_01042329.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    4e-17
ref|ZP_05945880.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    4e-17
ref|YP_454678.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.9    4e-17 Gene info
ref|ZP_04582489.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    4e-17
ref|YP_002129204.1|  3-deoxy-manno-octulosonate cytidylyltrans...  90.9    4e-17 Gene info
ref|ZP_05126509.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  90.9    4e-17
ref|YP_786619.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.9    4e-17 Gene info
ref|ZP_03317927.1|  hypothetical protein PROVALCAL_00847 [Prov...  90.9    4e-17
ref|ZP_05617425.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    4e-17
ref|NP_421728.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.5    5e-17 Gene info
ref|YP_607270.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.5    5e-17 Gene info
ref|ZP_04774851.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  90.5    6e-17
ref|YP_001173126.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  90.1    6e-17 Gene info
ref|YP_003004627.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  90.1    7e-17 Gene info
ref|ZP_05971927.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.1    7e-17
ref|ZP_00946919.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.1    7e-17
ref|YP_857280.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  90.1    7e-17 Gene info
ref|YP_155897.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.7    9e-17 Gene info
ref|NP_797363.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.7    9e-17 Gene info
ref|YP_002798669.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  89.7    1e-16 Gene info
ref|YP_001477951.1|  3-deoxy-manno-octulosonate cytidylyltrans...  89.7    1e-16 Gene info
ref|NP_935146.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.7    1e-16 Gene info
ref|YP_002893416.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  89.4    1e-16 Gene info
ref|ZP_05094015.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  89.4    1e-16
ref|ZP_05633311.1|  3-deoxy-manno-octulosonate cytidylyltransf...  89.4    1e-16
ref|ZP_01987907.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  89.4    1e-16
ref|NP_928922.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.4    1e-16 Gene info
ref|YP_679435.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.4    1e-16 Gene info
ref|ZP_05902629.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  89.4    1e-16
ref|YP_001444735.1|  3-deoxy-manno-octulosonate cytidylyltrans...  89.0    1e-16 Gene info
ref|YP_595364.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.0    1e-16 Gene info
ref|YP_001996754.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  89.0    2e-16 Gene info
ref|YP_001876794.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  89.0    2e-16 Gene info
ref|YP_001741835.1|  3-deoxy-manno-octulosonate cytidylyltrans...  88.6    2e-16 Gene info
ref|YP_002126157.1|  3-deoxy-manno-octulosonate cytidylyltrans...  88.6    2e-16 Gene info
ref|ZP_01215100.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.6    2e-16
ref|ZP_01925499.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  88.6    2e-16
ref|NP_231509.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.6    2e-16 Gene info
ref|YP_002873324.1|  3-deoxy-manno-octulosonate cytidylyltrans...  88.6    2e-16 Gene info
ref|YP_827427.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.6    2e-16 Gene info
ref|YP_001631282.1|  3-deoxy-manno-octulosonate cytidylyltrans...  88.2    2e-16 Gene info
ref|YP_001951964.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  88.2    2e-16 Gene info
ref|NP_905914.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.2    3e-16 Gene info
ref|ZP_01075931.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    3e-16
ref|ZP_01076606.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    3e-16
sp|A9IQ35.2|KDSB_BORPD  RecName: Full=3-deoxy-manno-octulosona...  88.2    3e-16
ref|ZP_01948595.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    3e-16
ref|ZP_01959087.1|  hypothetical protein BACCAC_00683 [Bactero...  88.2    3e-16
ref|ZP_04404715.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    3e-16
ref|YP_001141390.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.8    3e-16 Gene info
ref|YP_002982347.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  87.8    3e-16 Gene info
ref|ZP_02735278.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.8    3e-16
ref|YP_067329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.8    3e-16 Gene info
ref|YP_001900365.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  87.8    3e-16 Gene info
ref|ZP_02957712.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.8    3e-16
ref|ZP_04611266.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.8    3e-16
ref|YP_001129928.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.8    3e-16 Gene info
ref|ZP_05281410.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.8    4e-16
ref|YP_002912678.1|  CMP-2-keto-3-deoxyoctulosonic acid synthe...  87.8    4e-16 Gene info
ref|ZP_02033960.1|  hypothetical protein PARMER_04001 [Parabac...  87.8    4e-16
ref|ZP_05337554.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  87.4    4e-16
ref|YP_234722.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.4    5e-16 Gene info
ref|YP_932976.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.4    5e-16 Gene info
ref|YP_001516521.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.4    5e-16 Gene info
ref|YP_001929866.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.0    5e-16 Gene info
ref|ZP_05627387.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.0    5e-16
ref|YP_258900.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.0    6e-16 Gene info
ref|ZP_05924812.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.0    6e-16
ref|NP_760949.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.0    6e-16 Gene info
ref|YP_273873.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.0    6e-16 Gene info
ref|ZP_05733246.2|  3-deoxy-D-manno-octulosonate cytidylyltran...  86.7    7e-16
ref|ZP_02903665.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  86.7    7e-16
ref|YP_959009.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  86.7    7e-16 Gene info
ref|YP_001982259.1|  3-deoxy-manno-octulosonate cytidylyltrans...  86.7    8e-16 Gene info
ref|ZP_01462487.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  86.7    8e-16
ref|ZP_02065499.1|  hypothetical protein BACOVA_02480 [Bactero...  86.7    8e-16
ref|YP_001856774.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  86.7    8e-16 Gene info
ref|ZP_02425242.1|  hypothetical protein ALIPUT_01386 [Alistip...  86.7    8e-16
ref|ZP_01094168.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.7    8e-16
ref|YP_844149.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  86.3    9e-16 Gene info
ref|ZP_05885080.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.3    9e-16
ref|YP_002415901.1|  3-deoxy-manno-octulosonate cytidylyltrans...  86.3    1e-15 Gene info
ref|YP_001896814.1|  3-deoxy-manno-octulosonate cytidylyltrans...  86.3    1e-15 Gene info
ref|ZP_01977877.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.3    1e-15
ref|ZP_01235323.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.3    1e-15
ref|ZP_04588797.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.3    1e-15
ref|YP_277886.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  86.3    1e-15 Gene info
ref|YP_002484874.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  86.3    1e-15 Gene info
ref|ZP_01983471.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.3    1e-15
ref|YP_003089413.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  85.9    1e-15 Gene info
ref|YP_001345013.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.9    1e-15 Gene info
ref|ZP_05031774.1|  Cytidylyltransferase, putative [Brevundimo...  85.9    1e-15
ref|NP_793615.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|NP_809658.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|YP_203561.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|ZP_01092929.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.9    1e-15
ref|ZP_01876253.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.9    1e-15
ref|YP_127221.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|ZP_03014663.1|  hypothetical protein BACINT_02241 [Bactero...  85.9    1e-15
ref|ZP_03269757.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  85.9    1e-15
ref|ZP_02378056.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.9    1e-15
ref|YP_095936.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|YP_001438508.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.5    2e-15 Gene info
ref|YP_002933852.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  85.5    2e-15 Gene info
ref|YP_001334611.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.5    2e-15 Gene info
ref|YP_003041648.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.5    2e-15 Gene info
ref|YP_001005844.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.5    2e-15 Gene info
ref|ZP_03825607.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.5    2e-15
gb|EES51525.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  85.5    2e-15
ref|YP_433917.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.5    2e-15 Gene info
ref|ZP_05716411.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.5    2e-15
ref|ZP_03644200.1|  hypothetical protein BACCOPRO_02576 [Bacte...  85.5    2e-15
ref|ZP_01165839.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  85.5    2e-15
ref|ZP_05721611.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.1    2e-15
ref|ZP_03477160.1|  hypothetical protein PRABACTJOHN_02840 [Pa...  85.1    2e-15
ref|NP_245795.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.1    2e-15 Gene info
ref|ZP_04628546.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.1    2e-15
ref|YP_001187112.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.1    2e-15 Gene info
ref|ZP_03459795.1|  hypothetical protein BACEGG_02593 [Bactero...  85.1    2e-15
ref|ZP_02401640.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.1    2e-15
ref|YP_002795105.1|  KdsB [Laribacter hongkongensis HLHK9] >gb...  85.1    2e-15 Gene info
ref|YP_003259430.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  85.1    2e-15
ref|YP_799012.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.1    2e-15 Gene info
ref|ZP_03823433.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.1    2e-15
ref|YP_001021677.1|  3-deoxy-manno-octulosonate cytidylyltrans...  85.1    2e-15 Gene info
ref|ZP_02196005.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.7    3e-15
ref|ZP_04618812.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.7    3e-15
ref|ZP_05061531.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.7    3e-15
ref|YP_002252182.1|  3-deoxy-manno-octulosonate cmp-kdo synthe...  84.7    3e-15 Gene info
ref|ZP_01784878.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.7    3e-15
ref|YP_003164904.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  84.7    3e-15 Gene info
ref|ZP_04624312.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.7    3e-15
ref|YP_441296.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.7    3e-15 Gene info
ref|YP_124211.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.7    3e-15 Gene info
ref|ZP_05416235.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.3    3e-15
ref|YP_050645.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.3    3e-15 Gene info
ref|ZP_04633095.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.3    3e-15
ref|ZP_03680322.1|  hypothetical protein BACCELL_04692 [Bacter...  84.3    3e-15
gb|EEY34150.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  84.3    4e-15
ref|YP_001002821.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  84.3    4e-15 Gene info
ref|ZP_03712476.1|  hypothetical protein EIKCOROL_00136 [Eiken...  84.3    4e-15
ref|ZP_01691791.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.3    4e-15
ref|YP_001250673.1|  3-deoxy-manno-octulosonate cytidylyltrans...  84.3    4e-15 Gene info
ref|YP_927515.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.3    4e-15 Gene info
ref|ZP_02435097.1|  hypothetical protein BACSTE_01334 [Bactero...  84.3    4e-15
gb|ABA48705.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  84.3    4e-15 Gene info
ref|YP_002265044.1|  3-deoxy-manno-octulosonate cytidylyltrans...  84.3    4e-15 Gene info
ref|YP_002004613.1|  3-deoxy-manno-octulosonate cytidylyltrans...  84.3    4e-15 Gene info
ref|ZP_01223759.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.3    4e-15
emb|CAH34868.1|  putative 3-deoxy-manno-octulosonate cytidylyl...  84.3    4e-15 Gene info
ref|ZP_03045765.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.3    4e-15
ref|YP_002918708.1|  3-deoxy-manno-octulosonate cytidylyltrans...  84.3    4e-15 Gene info
ref|YP_103838.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.3    4e-15 Gene info
ref|YP_560222.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    4e-15 Gene info
ref|ZP_03833399.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    4e-15
ref|ZP_04858818.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    5e-15
ref|ZP_04944915.1|  CMP-2-keto-3-deoxyoctulosonic acid synthet...  84.0    5e-15
ref|ZP_01876474.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    5e-15
ref|ZP_01134818.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  84.0    5e-15
ref|YP_001748387.1|  3-deoxy-manno-octulosonate cytidylyltrans...  84.0    5e-15 Gene info
ref|YP_725120.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    5e-15 Gene info
ref|ZP_05761116.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    5e-15
gb|ABE32170.1|  3-deoxy-D-manno-octulosonatecytidylyltransfera...  84.0    5e-15 Gene info
ref|ZP_02462575.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    5e-15
ref|ZP_01162194.1|  putative 3-deoxy-manno-octulosonate cytidy...  84.0    5e-15
ref|YP_790194.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    6e-15 Gene info
ref|ZP_02884683.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.0    6e-15
ref|ZP_03788485.1|  conserved hypothetical protein [Burkholder...  83.6    6e-15
ref|YP_349901.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.6    6e-15 Gene info
ref|ZP_01366446.1|  hypothetical protein PaerPA_01003592 [Pseu...  83.6    6e-15
ref|YP_001482340.1|  3-deoxy-manno-octulosonate cytidylyltrans...  83.6    6e-15 Gene info
ref|ZP_01070401.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.6    6e-15
ref|ZP_01810652.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.6    6e-15
ref|ZP_04549125.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.6    6e-15
ref|ZP_04545162.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.6    6e-15
ref|YP_002553013.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  83.6    7e-15 Gene info
ref|YP_002239434.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  83.6    7e-15 Gene info
ref|YP_002649269.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...  83.6    7e-15
ref|YP_001765854.1|  3-deoxy-manno-octulosonate cytidylyltrans...  83.6    7e-15 Gene info
ref|ZP_01221111.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.2    8e-15
ref|YP_088127.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    8e-15 Gene info
ref|NP_706836.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    8e-15 Gene info
ref|ZP_03028812.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.2    8e-15
ref|YP_309894.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    8e-15 Gene info
ref|YP_206385.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    9e-15 Gene info
ref|ZP_05434819.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.2    9e-15
ref|YP_002382225.1|  3-deoxy-manno-octulosonate cytidylyltrans...  83.2    9e-15 Gene info
ref|ZP_05057132.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.2    9e-15
ref|YP_403908.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|ZP_04833115.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.8    1e-14
ref|YP_901286.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|YP_001462136.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.8    1e-14 Gene info
ref|YP_986545.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  82.8    1e-14 Gene info
ref|YP_001354267.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.8    1e-14 Gene info
ref|NP_670073.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|YP_003017349.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  82.8    1e-14 Gene info
ref|YP_001120467.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.8    1e-14 Gene info
ref|ZP_05120636.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.8    1e-14
ref|NP_859699.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|NP_286793.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|NP_415438.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|ZP_05311614.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.8    1e-14
ref|YP_130569.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|YP_178906.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|ZP_03063684.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.8    1e-14
ref|YP_001570997.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.8    1e-14 Gene info
ref|ZP_01068423.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.8    1e-14
ref|YP_003156678.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  82.8    1e-14 Gene info
ref|NP_251669.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    1e-14 Gene info
ref|ZP_03836101.1|  hypothetical protein CIT292_01929 [Citroba...  82.4    1e-14
ref|YP_001744252.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  82.4    1e-14 Gene info
ref|ZP_04714211.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.4    1e-14
ref|ZP_03584420.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.4    1e-14
ref|YP_001654510.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.4    1e-14 Gene info
ref|YP_001598780.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.4    1e-14 Gene info
ref|YP_003082775.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  82.4    1e-14 Gene info
ref|ZP_05897548.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.4    1e-14
ref|NP_878667.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.4    1e-14 Gene info
ref|YP_001667719.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.4    1e-14 Gene info
ref|YP_002328474.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.4    1e-14 Gene info
ref|YP_344816.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  82.4    2e-14 Gene info
emb|CBA04188.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  82.4    2e-14
ref|ZP_04569603.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.4    2e-14
emb|CAE11288.1|  Cap29eG protein [Neisseria meningitidis]          82.4    2e-14
ref|ZP_02354730.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.4    2e-14
ref|ZP_03209726.1|  hypothetical protein BACPLE_03404 [Bactero...  82.0    2e-14
ref|ZP_03740293.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.0    2e-14
ref|YP_549763.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  82.0    2e-14 Gene info
ref|YP_001809159.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.0    2e-14 Gene info
sp|Q129C7.2|KDSB_POLSJ  RecName: Full=3-deoxy-manno-octulosona...  82.0    2e-14
ref|YP_002243030.1|  3-deoxy-manno-octulosonate cytidylyltrans...  82.0    2e-14 Gene info
ref|YP_046963.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    2e-14 Gene info
emb|CBA03570.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  82.0    2e-14
ref|YP_002312023.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  82.0    2e-14 Gene info
ref|NP_870651.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    2e-14 Gene info
ref|ZP_02159396.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.0    2e-14
ref|YP_001908060.1|  3-deoxy-manno-octulosonate cytidylyltrans...  81.6    2e-14 Gene info
ref|ZP_03572260.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.6    2e-14
ref|YP_629360.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  81.6    2e-14 Gene info
ref|YP_001398266.1|  3-deoxy-manno-octulosonate cytidylyltrans...  81.6    3e-14 Gene info
ref|ZP_05918735.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.6    3e-14
ref|ZP_02927838.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.6    3e-14
ref|ZP_01065252.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.6    3e-14
ref|YP_370116.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.6    3e-14 Gene info
ref|ZP_04561362.1|  CMP-2-keto-3-deoxyoctulosonic acid synthet...  81.6    3e-14
ref|ZP_01667693.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.6    3e-14
ref|YP_001578941.1|  3-deoxy-manno-octulosonate cytidylyltrans...  81.6    3e-14 Gene info
ref|YP_294817.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.6    3e-14 Gene info
ref|ZP_03010174.1|  hypothetical protein BACCOP_02044 [Bactero...  81.3    3e-14
pdb|1VH1|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...  81.3    3e-14 Related structures
ref|ZP_05857928.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.3    3e-14
ref|ZP_02071294.1|  hypothetical protein BACUNI_02732 [Bactero...  81.3    3e-14
ref|ZP_05728893.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.3    3e-14
ref|ZP_03967252.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.3    3e-14
ref|NP_459963.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.3    3e-14 Gene info
ref|YP_661358.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  81.3    3e-14 Gene info
ref|ZP_00366952.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.3    3e-14
ref|ZP_05380546.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.3    4e-14
sp|Q9PKL1.2|KDSB_CHLMU  RecName: Full=3-deoxy-manno-octulosona...  81.3    4e-14
ref|NP_296831.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.3    4e-14 Gene info
ref|YP_002214912.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  81.3    4e-14 Gene info
ref|YP_151038.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|YP_001347554.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.9    4e-14 Gene info
ref|ZP_02910987.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.9    4e-14
ref|YP_357357.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|YP_540005.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|ZP_03806214.1|  hypothetical protein PROPEN_04616 [Proteus...  80.9    4e-14
ref|NP_219686.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|YP_003209887.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.9    4e-14 Gene info
ref|NP_752984.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|ZP_05881411.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.9    4e-14
ref|YP_582688.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|YP_563139.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    4e-14 Gene info
ref|YP_001971477.1|  putative 3-deoxy-manno-octulosonate cytid...  80.9    4e-14 Gene info
emb|CBA05708.1|  3-deoxy-D-manno-octulosonatecytidylyltransfer...  80.9    4e-14
ref|YP_001453712.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.9    4e-14 Gene info
ref|ZP_04831977.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.9    5e-14
ref|YP_974716.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    5e-14 Gene info
emb|CAX50537.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  80.9    5e-14
ref|YP_001791587.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.9    5e-14 Gene info
ref|ZP_03875850.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.9    5e-14
ref|YP_524397.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.9    5e-14 Gene info
ref|NP_455474.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    5e-14 Gene info
ref|YP_970909.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.9    5e-14 Gene info
ref|ZP_01895799.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.5    5e-14
ref|YP_621811.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.5    5e-14 Gene info
ref|YP_113150.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.5    6e-14 Gene info
ref|YP_852049.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.5    6e-14 Gene info
ref|YP_002231863.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.5    6e-14 Gene info
ref|ZP_02700444.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.5    6e-14
ref|YP_001219597.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.5    6e-14 Gene info
ref|YP_774485.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.5    6e-14 Gene info
ref|YP_999600.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.5    6e-14 Gene info
ref|YP_003050417.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.5    6e-14 Gene info
ref|YP_002887800.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.5    6e-14 Gene info
ref|ZP_05361702.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.1    6e-14
ref|NP_273717.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.1    7e-14 Gene info
ref|ZP_03220820.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.1    7e-14
ref|ZP_01738219.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    7e-14
ref|YP_001183647.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.1    7e-14 Gene info
ref|ZP_01735244.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    7e-14
ref|ZP_01816765.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    7e-14
ref|ZP_02002010.1|  Acylneuraminate cytidylyltransferase [Begg...  80.1    7e-14
ref|ZP_05987198.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    7e-14
ref|ZP_02889672.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.1    7e-14
ref|YP_963273.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.1    7e-14 Gene info
ref|YP_268854.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.1    8e-14 Gene info
ref|YP_002150488.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.1    8e-14 Gene info
ref|NP_744057.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.1    8e-14 Gene info
ref|ZP_03989195.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.1    8e-14
ref|YP_003165668.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.1    8e-14 Gene info
ref|YP_001269120.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.1    8e-14 Gene info
ref|YP_002342308.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.7    9e-14 Gene info
ref|ZP_05404303.2|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.7    1e-13
ref|YP_527530.1|  chorismate synthase [Saccharophagus degradan...  79.7    1e-13 Gene info
pdb|3JTJ|A  Chain A, 3-Deoxy-Manno-Octulosonate Cytidylyltrans...  79.7    1e-13 Related structures
emb|CAM76131.1|  Acylneuraminate cytidylyltransferase [Magneto...  79.7    1e-13
sp|Q74BY2.2|KDSB_GEOSL  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-13
ref|ZP_04600110.1|  hypothetical protein VEIDISOL_01558 [Veill...  79.3    1e-13
ref|YP_001707104.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.3    1e-13 Gene info
ref|ZP_04575406.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.3    1e-13
ref|YP_001760559.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.3    1e-13 Gene info
ref|ZP_03560571.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.3    1e-13
ref|YP_340174.1|  CTP:CMP-3-deoxy-D-manno-octulosonate transfe...  79.3    1e-13 Gene info
ref|NP_952945.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    1e-13 Gene info
ref|YP_001713940.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.3    1e-13 Gene info
ref|YP_002219111.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.3    1e-13 Gene info
ref|YP_172520.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    1e-13 Gene info
ref|ZP_05442218.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.3    1e-13
ref|YP_001209224.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.3    1e-13 Gene info
ref|YP_003022410.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.3    1e-13 Gene info
ref|YP_001745205.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.3    1e-13 Gene info
ref|YP_546195.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  79.3    1e-13 Gene info
ref|ZP_04056782.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.3    1e-13
ref|ZP_03718686.1|  hypothetical protein NEIFLAOT_00495 [Neiss...  79.3    1e-13
ref|YP_001474161.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.3    1e-13 Gene info
ref|ZP_01870352.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.3    1e-13
ref|YP_733982.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    1e-13 Gene info
ref|YP_001339992.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.0    1e-13 Gene info
ref|ZP_04756616.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.0    1e-13
ref|YP_904029.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  79.0    1e-13 Gene info
ref|YP_763823.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.0    2e-13 Gene info
ref|ZP_01254358.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.0    2e-13
ref|ZP_04780574.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.0    2e-13
ref|YP_002722053.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.0    2e-13 Gene info
ref|YP_001050737.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.0    2e-13 Gene info
ref|ZP_01983779.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  78.6    2e-13
ref|ZP_03301289.1|  hypothetical protein BACDOR_02668 [Bactero...  78.6    2e-13
ref|YP_001939609.1|  CMP-2-keto-3-deoxyoctulosonic acid synthe...  78.6    2e-13 Gene info
ref|YP_001490198.1|  3-deoxy-manno-octulosonate cytidylyltrans...  78.6    2e-13 Gene info
ref|YP_001554906.1|  3-deoxy-manno-octulosonate cytidylyltrans...  78.6    2e-13 Gene info
ref|YP_002603089.1|  KdsB [Desulfobacterium autotrophicum HRM2...  78.6    2e-13 Gene info
ref|ZP_05827418.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  78.6    2e-13
ref|ZP_05824311.1|  CMP-2-keto-3-deoxyoctulosonic acid synthet...  78.6    2e-13
ref|YP_002138413.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    2e-13 Gene info
ref|YP_002513447.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    2e-13 Gene info
ref|ZP_05292604.1|  3-deoxy-manno-octulosonate cytidylyltransf...  78.6    2e-13
ref|YP_001366564.1|  3-deoxy-manno-octulosonate cytidylyltrans...  78.6    2e-13 Gene info
ref|ZP_00950767.1|  ethanolamine utilization protein-like prot...  78.6    2e-13
ref|YP_001084586.2|  3-deoxy-manno-octulosonate cytidylyltrans...  78.6    2e-13 Gene info
ref|YP_384236.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  78.6    2e-13 Gene info
ref|ZP_00143436.1|  3-deoxy-manno-octulosonate cytidylyltransf...  78.6    2e-13
ref|YP_002728986.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.2    2e-13 Gene info
ref|YP_001674534.1|  3-deoxy-manno-octulosonate cytidylyltrans...  78.2    2e-13 Gene info
ref|YP_001837620.1|  3-deoxy-manno-octulosonate cytidylyltrans...  78.2    2e-13 Gene info
ref|YP_001358977.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.2    2e-13 Gene info
ref|YP_159908.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  78.2    2e-13 Gene info
ref|ZP_04580041.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  78.2    3e-13
ref|YP_898329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  78.2    3e-13 Gene info
ref|NP_718065.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    3e-13 Gene info
ref|ZP_04724679.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.8    3e-13
ref|ZP_04555910.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.8    3e-13
ref|ZP_03033352.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.8    3e-13
ref|ZP_01311477.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.8    3e-13
ref|YP_001176168.1|  3-deoxy-manno-octulosonate cytidylyltrans...  77.8    4e-13 Gene info
ref|ZP_02061783.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.8    4e-13
ref|YP_001269217.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  77.8    4e-13 Gene info
ref|ZP_04985563.1|  hypothetical protein FTAG_01438 [Francisel...  77.8    4e-13
ref|YP_001300576.1|  3-deoxy-manno-octulosonate cytidylyltrans...  77.8    4e-13 Gene info
ref|NP_713753.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    4e-13 Gene info
ref|YP_002019219.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  77.8    4e-13 Gene info
ref|ZP_04722536.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.8    4e-13
ref|ZP_01102813.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.8    4e-13
ref|NP_224444.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    4e-13 Gene info
ref|ZP_05620411.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.4    4e-13
ref|YP_001528855.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  77.4    4e-13 Gene info
gb|AAX77783.1|  unknown protein [synthetic construct]              77.4    4e-13
ref|YP_542343.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    4e-13 Gene info
sp|Q5NEX8.1|KDSB_FRATT  RecName: Full=3-deoxy-manno-octulosona...  77.4    4e-13
ref|ZP_05860574.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.4    4e-13
ref|ZP_04540382.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.4    5e-13
ref|YP_514054.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    5e-13 Gene info
ref|ZP_01061526.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.4    5e-13
ref|YP_670907.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    5e-13 Gene info
ref|YP_667546.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    5e-13 Gene info
pdb|1H6J|A  Chain A, The Three-Dimensional Structure Of Capsul...  77.4    5e-13 Related structures
ref|YP_002414087.1|  3-deoxy-manno-octulosonate cytidylyltrans...  77.4    5e-13 Gene info
ref|ZP_05982495.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.4    5e-13
ref|YP_982152.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  77.4    5e-13 Gene info
ref|YP_001093981.1|  3-deoxy-manno-octulosonate cytidylyltrans...  77.4    5e-13 Gene info
ref|YP_207410.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.0    5e-13 Gene info
ref|ZP_04971187.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.0    6e-13
gb|ACG42455.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  77.0    6e-13
ref|NP_001105657.1|  CMP-KDO synthetase1 [Zea mays] >emb|CAB89...  77.0    6e-13 UniGene infoGene info
ref|ZP_05317432.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.0    7e-13
ref|ZP_03068918.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  76.6    7e-13
ref|ZP_04763196.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  76.6    7e-13
ref|YP_003073892.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.6    7e-13 Gene info
ref|YP_001564587.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.6    8e-13 Gene info
ref|ZP_01627837.1|  3-deoxy-manno-octulosonate cytidylyltransf...  76.6    8e-13
ref|YP_001467119.1|  3-deoxy-manno-octulosonate cytidylyltrans...  76.6    8e-13 Gene info
ref|YP_002399451.1|  3-deoxy-manno-octulosonate cytidylyltrans...  76.6    8e-13 Gene info
ref|ZP_04731436.1|  3-deoxy-manno-octulosonate cytidylyltransf...  76.6    9e-13
ref|ZP_04577890.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  76.6    9e-13
ref|YP_001944046.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.3    1e-12 Gene info
ref|ZP_03542563.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  76.3    1e-12
emb|CAN72248.1|  hypothetical protein [Vitis vinifera]             76.3    1e-12
ref|ZP_00370040.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  76.3    1e-12
ref|YP_003046004.1|  KpsU protein [Escherichia coli B str. REL...  76.3    1e-12 Gene info
ref|YP_003197938.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  75.9    1e-12 Gene info
gb|ABC88657.1|  KpsU [Escherichia coli]                            75.9    1e-12
ref|YP_390135.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  75.9    1e-12 Gene info
ref|ZP_05104708.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.9    1e-12
ref|YP_001406579.1|  3-deoxy-manno-octulosonate cytidylyltrans...  75.9    1e-12 Gene info
ref|ZP_05978334.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.9    1e-12
ref|YP_001891488.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.9    1e-12 Gene info
ref|ZP_02536106.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.9    1e-12
ref|YP_002027788.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.9    1e-12 Gene info
ref|YP_463211.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  75.9    1e-12 Gene info
ref|ZP_05500740.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.9    1e-12
ref|XP_002262772.1|  PREDICTED: hypothetical protein [Vitis vi...  75.9    1e-12 UniGene infoGene info
ref|YP_001100737.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...  75.9    2e-12 Gene info
ref|ZP_01451303.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.5    2e-12
ref|YP_003120502.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  75.5    2e-12 Gene info
ref|YP_002429293.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.5    2e-12 Gene info
ref|ZP_01308575.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.5    2e-12
ref|ZP_04922860.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.5    2e-12
ref|ZP_03853131.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.5    2e-12
ref|YP_002944530.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.5    2e-12 Gene info
ref|NP_001056314.1|  Os05g0561500 [Oryza sativa (japonica cult...  75.5    2e-12 UniGene infoGene info
ref|ZP_04715599.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.5    2e-12
ref|YP_002923151.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...  75.5    2e-12 Gene info
ref|YP_001231725.1|  3-deoxy-manno-octulosonate cytidylyltrans...  75.5    2e-12 Gene info
ref|YP_742272.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  75.5    2e-12 Gene info
ref|YP_002890185.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.1    2e-12 Gene info
ref|YP_003095940.1|  3-deoxy-manno-octulosonate cytidylyltrans...  75.1    2e-12 Gene info
ref|ZP_04603028.1|  hypothetical protein GCWU000324_02510 [Kin...  75.1    2e-12
ref|YP_002409346.1|  3-deoxy-manno-octulosonate cytidylyltrans...  75.1    2e-12 Gene info
ref|ZP_01126065.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.1    2e-12
ref|ZP_04468333.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.1    2e-12
ref|ZP_03856290.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.1    2e-12
ref|NP_642410.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  75.1    3e-12 Gene info
ref|ZP_04729152.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.1    3e-12
ref|ZP_01898724.1|  3-deoxy-manno-octulosonate cytidylyltransf...  74.7    3e-12
ref|ZP_00652359.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  74.7    3e-12
ref|YP_007824.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    3e-12 Gene info
sp|Q87BW1.1|KDSB_XYLFT  RecName: Full=3-deoxy-manno-octulosona...  74.7    3e-12
ref|NP_779535.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    3e-12 Gene info
ref|YP_393241.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    3e-12 Gene info
ref|ZP_00683553.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  74.7    3e-12
ref|YP_001960456.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  74.7    3e-12 Gene info
gb|EEC79690.1|  hypothetical protein OsI_20971 [Oryza sativa I...  74.3    4e-12
ref|YP_001280288.1|  3-deoxy-manno-octulosonate cytidylyltrans...  74.3    4e-12 Gene info
ref|NP_908026.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.3    4e-12 Gene info
emb|CAB89847.1|  CMP-KDO synthetase [Zea mays]                     74.3    4e-12 Gene info
ref|YP_003140154.1|  3-deoxy-D-manno-octulosonatecytidylyltran...  74.3    4e-12 Gene info
ref|YP_580329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.3    4e-12 Gene info
ref|YP_001931170.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  73.9    5e-12 Gene info
ref|YP_002537727.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  73.9    5e-12 Gene info
ref|ZP_03658910.1|  3-deoxy-manno-octulosonate cytidylyltransf...  73.9    5e-12
ref|YP_912515.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.9    5e-12 Gene info
ref|YP_001913439.1|  3-deoxy-manno-octulosonate cytidylyltrans...  73.6    6e-12 Gene info
ref|ZP_00993330.1|  3-deoxy-manno-octulosonate cytidylyltransf...  73.6    6e-12
ref|NP_755564.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.6    6e-12 Gene info
ref|YP_200934.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.6    7e-12 Gene info
ref|YP_315263.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.6    7e-12 Gene info
ref|ZP_03610841.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.6    7e-12
ref|YP_001408050.1|  3-deoxy-manno-octulosonate cytidylyltrans...  73.2    8e-12 Gene info
ref|ZP_05362604.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.2    8e-12
ref|ZP_05814836.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.2    8e-12
ref|ZP_01106328.1|  3-deoxy-manno-octulosonate cytidylyltransf...  73.2    8e-12
ref|ZP_04428737.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.2    9e-12
emb|CAN62581.1|  hypothetical protein [Vitis vinifera]             73.2    9e-12
ref|YP_003048088.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  73.2    1e-11 Gene info
ref|YP_515325.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.2    1e-11 Gene info
ref|NP_299578.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.2    1e-11 Gene info
ref|YP_001903467.1|  3-deoxy-manno-octulosonate cytidylyltrans...  72.8    1e-11 Gene info
ref|NP_637479.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  72.8    1e-11 Gene info
sp|Q4UV63.1|KDSB_XANC8  RecName: Full=3-deoxy-manno-octulosona...  72.8    1e-11
ref|YP_001223956.1|  3-deoxy-manno-octulosonate cytidylyltrans...  72.8    1e-11 Gene info
ref|ZP_04958498.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.8    1e-11
ref|YP_573641.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  72.4    1e-11 Gene info
ref|YP_363987.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  72.4    1e-11 Gene info
ref|YP_219970.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  72.4    1e-11 Gene info
emb|CAJ72637.1|  strongly similar to 3-deoxy-manno-octulosonat...  72.4    1e-11
ref|ZP_04489281.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.4    2e-11
ref|ZP_02243478.1|  3-deoxy-manno-octulosonate cytidylyltransf...  72.4    2e-11
ref|YP_001226543.1|  3-deoxy-manno-octulosonate cytidylyltrans...  72.4    2e-11 Gene info
ref|YP_001295888.1|  3-deoxy-manno-octulosonate cytidylyltrans...  72.4    2e-11 Gene info
emb|CAJ23933.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  72.4    2e-11 Gene info
ref|XP_002284913.1|  PREDICTED: hypothetical protein [Vitis vi...  72.0    2e-11 UniGene infoGene info
ref|ZP_04580324.1|  CTP:CMP-3-deoxy-D-manno-octulosonate-cytid...  72.0    2e-11
ref|ZP_01084828.1|  3-deoxy-manno-octulosonate cytidylyltransf...  72.0    2e-11
ref|YP_755594.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  72.0    2e-11 Gene info
ref|ZP_01114393.1|  3-deoxy-manno-octulosonate cytidylyltransf...  72.0    2e-11
ref|YP_001889956.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  72.0    2e-11 Gene info
ref|YP_001678588.1|  3-deoxy-manno-octulosonate cytidylyltrans...  71.6    2e-11 Gene info
ref|YP_522507.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    2e-11 Gene info
ref|ZP_05045684.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  71.6    2e-11
ref|NP_603704.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    2e-11 Gene info
ref|ZP_04756205.1|  3-deoxy-manno-octulosonate cytidylyltransf...  71.6    2e-11
ref|YP_778062.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.6    3e-11 Gene info
ref|YP_374270.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    3e-11 Gene info
ref|ZP_01123616.1|  3-deoxy-manno-octulosonate cytidylyltransf...  71.6    3e-11
ref|NP_829460.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    3e-11 Gene info
ref|ZP_01890888.1|  3-deoxy-manno-octulosonate cytidylyltransf...  71.2    3e-11
ref|YP_378636.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.2    3e-11 Gene info
ref|YP_750447.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.2    4e-11 Gene info
ref|ZP_03724607.1|  3-deoxy-manno-octulosonate cytidylyltransf...  70.9    4e-11
ref|ZP_03736078.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.9    4e-11
ref|ZP_05734832.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.9    4e-11
ref|YP_892244.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.9    5e-11 Gene info
ref|ZP_02164138.1|  3-deoxy-manno-octulosonate cytidylyltransf...  70.9    5e-11
ref|YP_942344.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  70.9    5e-11 Gene info
ref|YP_002730368.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  70.5    5e-11 Gene info
gb|ABK23054.1|  unknown [Picea sitchensis]                         70.5    5e-11
ref|ZP_03391784.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.5    5e-11
ref|YP_626974.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.5    6e-11 Gene info
ref|YP_001424935.2|  3-deoxy-manno-octulosonate cytidylyltrans...  70.5    6e-11 Gene info
ref|ZP_02219566.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.5    6e-11
ref|ZP_05710911.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.5    6e-11
ref|XP_002517281.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cyt...  70.5    6e-11 Gene info
ref|YP_002575479.1|  3-deoxy-manno-octulosonate cytidylyltrans...  70.1    7e-11 Gene info
ref|YP_587862.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.1    7e-11 Gene info
ref|NP_967763.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.1    7e-11 Gene info
ref|ZP_00953339.1|  3-deoxy-manno-octulosonate cytidylyltransf...  70.1    7e-11
ref|XP_002329094.1|  predicted protein [Populus trichocarpa] >...  70.1    8e-11 UniGene infoGene info
ref|YP_001596409.1|  3-deoxy-manno-octulosonate cytidylyltrans...  70.1    8e-11 Gene info
gb|ACF06611.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  70.1    8e-11
ref|YP_003195567.1|  3-deoxy-manno-octulosonate cytidylyltrans...  69.7    9e-11
ref|YP_002016525.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  69.7    9e-11 Gene info
ref|NP_862007.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  69.7    9e-11 Gene info
ref|ZP_02423841.1|  hypothetical protein EUBSIR_02723 [Eubacte...  69.7    9e-11
ref|ZP_03436950.1|  hypothetical protein HPB128_21g3 [Helicoba...  69.7    9e-11
ref|ZP_01437376.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  69.7    1e-10
ref|YP_264598.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  69.7    1e-10 Gene info
ref|ZP_01947082.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  69.7    1e-10
ref|YP_002305702.1|  3-deoxy-manno-octulosonate cytidylyltrans...  69.3    1e-10 Gene info
ref|ZP_01468866.1|  3-deoxy-manno-octulosonate cytidylyltransf...  69.3    1e-10
ref|YP_001997996.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  69.3    1e-10 Gene info
ref|NP_662709.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  69.3    1e-10 Gene info
ref|XP_002316900.1|  predicted protein [Populus trichocarpa] >...  69.3    1e-10 UniGene infoGene info
ref|ZP_05522983.1|  3-deoxy-manno-octulosonate cytidylyltransf...  69.3    1e-10
ref|YP_001815905.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  68.9    1e-10 Gene info
ref|ZP_01052336.1|  3-deoxy-D-manno-octulosonatecytidylyltrans...  68.6    2e-10 Gene info
ref|NP_896279.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    2e-10 Gene info
ref|YP_376227.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    2e-10 Gene info
ref|NP_213474.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    2e-10 Gene info
ref|XP_002534236.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cyt...  68.6    2e-10 Gene info
ref|YP_002509636.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  68.6    2e-10 Gene info
ref|ZP_05706196.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  68.6    2e-10
ref|XP_002441511.1|  hypothetical protein SORBIDRAFT_09g028380...  68.2    3e-10 UniGene infoGene info
ref|XP_001784950.1|  predicted protein [Physcomitrella patens ...  68.2    3e-10 UniGene infoGene info
ref|YP_003057041.1|  3-deoxy-manno-octulosonate cytidylyltrans...  67.8    3e-10 Gene info
ref|ZP_02183184.1|  3-deoxy-manno-octulosonate cytidylyltransf...  67.8    3e-10
ref|YP_003250609.1|  3-deoxy-manno-octulosonate cytidylyltrans...  67.8    3e-10 Gene info
ref|ZP_03701191.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  67.8    4e-10
ref|YP_866024.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  67.4    4e-10 Gene info
ref|ZP_05782649.1|  3-deoxy-manno-octulosonate cytidylyltransf...  67.4    4e-10
ref|YP_002607616.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  67.4    4e-10 Gene info
ref|NP_207028.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.4    5e-10 Gene info
ref|NP_175708.2|  cytidylyltransferase family [Arabidopsis tha...  67.4    5e-10 UniGene infoGene info
ref|ZP_04340522.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  67.4    5e-10
ref|YP_861860.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.4    5e-10 Gene info
ref|NP_222936.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.4    5e-10 Gene info
gb|EAY56823.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  67.4    5e-10
gb|EDZ38097.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...  67.0    6e-10
ref|YP_002265843.1|  3-deoxy-manno-octulosonate cytidylyl tran...  67.0    6e-10 Gene info
ref|YP_664148.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.0    6e-10 Gene info
ref|ZP_04421539.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  67.0    6e-10
ref|YP_002120982.1|  3-deoxy-manno-octulosonate cytidylyltrans...  67.0    6e-10 Gene info
ref|YP_380511.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.0    7e-10 Gene info
ref|ZP_05547291.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  66.2    1e-09
ref|YP_001356460.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  66.2    1e-09 Gene info
ref|YP_001303972.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.9    1e-09 Gene info
ref|YP_001018549.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.9    2e-09 Gene info
ref|ZP_01614810.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  65.5    2e-09
ref|NP_895740.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  65.5    2e-09 Gene info
ref|ZP_05081599.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  65.5    2e-09
ref|YP_001501842.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.5    2e-09 Gene info
ref|ZP_05625588.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  65.5    2e-09
ref|YP_002300869.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.5    2e-09 Gene info
ref|ZP_05287961.1|  3-deoxy-manno-octulosonate cytidylyltransf...  65.1    2e-09
ref|YP_002436780.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.1    3e-09 Gene info
ref|ZP_04339418.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  64.7    3e-09
ref|ZP_01118271.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.7    3e-09
ref|YP_065950.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  64.7    3e-09 Gene info
ref|ZP_01203049.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.7    3e-09
ref|ZP_01471728.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.3    4e-09
ref|ZP_00999541.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.3    4e-09
ref|ZP_03240190.1|  3-deoxy-manno-octulosonate cytidylyltransf...  63.9    5e-09
ref|ZP_05536700.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  63.9    6e-09
ref|ZP_01289485.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  63.5    6e-09
ref|ZP_01291546.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  63.5    6e-09
ref|YP_761586.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  63.5    7e-09 Gene info
ref|ZP_01049060.1|  3-deoxy-manno-octulosonate cytidylyltransf...  63.5    7e-09
ref|ZP_01447401.1|  3-deoxy-manno-octulosonate cytidylyltransf...  63.5    8e-09
ref|YP_002319164.1|  3-deoxy-manno-octulosonate cytidylyltrans...  63.5    8e-09 Gene info
ref|ZP_01041362.1|  3-deoxy-manno-octulosonate cytidylyltransf...  63.2    9e-09
ref|YP_391229.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  62.8    1e-08 Gene info
gb|ABX59257.1|  CMP-2 keto-3-deoxyoctulosonic acid synthetase ...  62.8    1e-08
ref|ZP_03402272.1|  3-deoxy-manno-octulosonate cytidylyltransf...  62.4    1e-08
ref|YP_563668.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  62.4    2e-08 Gene info
ref|ZP_01385231.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  62.4    2e-08
ref|YP_099504.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  62.0    2e-08 Gene info
ref|ZP_02151259.1|  3-deoxy-manno-octulosonate cytidylyltransf...  61.6    2e-08
emb|CBA32774.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  61.6    3e-08
gb|ACN28946.1|  unknown [Zea mays]                                 61.6    3e-08
ref|YP_001818796.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  61.2    3e-08 Gene info
ref|ZP_02145346.1|  3-deoxy-manno-octulosonate cytidylyltransf...  61.2    4e-08
ref|ZP_03313034.1|  hypothetical protein DESPIG_02973 [Desulfo...  60.8    4e-08
ref|YP_392403.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  60.8    5e-08 Gene info
ref|ZP_05799250.1|  3-deoxy-manno-octulosonate cytidylyltransf...  60.8    5e-08
ref|ZP_03345257.1|  3-deoxy-manno-octulosonate cytidylyltransf...  60.8    5e-08
ref|YP_496562.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  60.8    5e-08 Gene info
ref|YP_002480621.1|  3-deoxy-manno-octulosonate cytidylyltrans...  60.1    7e-08 Gene info
ref|YP_002092.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  60.1    8e-08 Gene info
ref|ZP_01011644.1|  3-deoxy-manno-octulosonate cytidylyltransf...  60.1    8e-08
ref|ZP_01079010.1|  putative 3-deoxy-manno-octulosonate cytidy...  59.7    9e-08
ref|ZP_05072750.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  59.7    1e-07
ref|ZP_05741800.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  59.7    1e-07
ref|YP_003061547.1|  acylneuraminate cytidylyltransferase [Hir...  59.7    1e-07 Gene info
ref|YP_001196831.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  59.7    1e-07 Gene info
ref|ZP_05110113.1|  3-deoxy-manno-octulosonate cytidylyltransf...  59.3    1e-07
ref|ZP_05089905.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  58.9    2e-07
ref|NP_711806.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.9    2e-07 Gene info
ref|ZP_01871576.1|  3-deoxy-manno-octulosonate cytidylyltransf...  58.9    2e-07
ref|ZP_05083961.1|  3-deoxy-manno-octulosonate cytidylyltransf...  58.5    2e-07
ref|YP_797632.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.5    2e-07 Gene info
ref|NP_871254.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.2    3e-07 Gene info
dbj|BAC24397.1|  kdsB [Wigglesworthia glossinidia endosymbiont...  58.2    3e-07 Gene info
ref|ZP_01290476.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  58.2    3e-07
ref|YP_680781.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.2    3e-07 Gene info
ref|ZP_04502530.1|  CMP-2-keto-3-deoxyoctulosonic acid synthet...  57.8    4e-07
ref|ZP_02140462.1|  3-deoxy-manno-octulosonate cytidylyltransf...  57.8    4e-07
ref|YP_916086.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  57.8    4e-07 Gene info
ref|NP_841718.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  57.4    4e-07 Gene info
ref|YP_363734.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  57.4    6e-07 Gene info
ref|YP_367078.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  57.0    6e-07 Gene info
gb|ACX98852.1|  3-deoxy-manno-octulosonate cytidylyl transfera...  57.0    6e-07
ref|YP_001551182.1|  CMP-2-keto-3-deoxyoctulosonic acid synthe...  57.0    7e-07 Gene info
ref|YP_001909723.1|  3-deoxy-manno-octulosonate cytidylyltrans...  56.6    8e-07 Gene info
ref|ZP_02178798.1|  3-deoxy-manno-octulosonate cytidylyltransf...  56.2    1e-06
ref|YP_001130197.1|  3-deoxy-manno-octulosonate cytidylyltrans...  56.2    1e-06 Gene info
ref|YP_001997037.1|  3-deoxy-manno-octulosonate cytidylyltrans...  56.2    1e-06 Gene info
ref|ZP_01901480.1|  3-deoxy-manno-octulosonate cytidylyltransf...  55.8    1e-06
ref|ZP_01304764.1|  3-deoxy-manno-octulosonate cytidylyltransf...  55.8    2e-06
ref|YP_003226829.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  55.1    2e-06 Gene info
ref|YP_163224.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  55.1    2e-06 Gene info
ref|ZP_04759658.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  55.1    2e-06
ref|YP_002436311.1|  3-deoxy-manno-octulosonate cytidylyltrans...  55.1    2e-06 Gene info
ref|ZP_04048679.1|  CMP-2-keto-3-deoxyoctulosonic acid synthet...  55.1    2e-06
ref|YP_612009.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  55.1    2e-06 Gene info
ref|ZP_00371145.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  54.7    3e-06
ref|ZP_01885924.1|  3-deoxy-manno-octulosonate cytidylyltransf...  54.7    3e-06
ref|YP_009565.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  54.7    3e-06 Gene info
ref|ZP_01055400.1|  3-deoxy-manno-octulosonate cytidylyltransf...  54.7    3e-06
ref|YP_746677.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  54.7    4e-06 Gene info
ref|ZP_04932777.1|  hypothetical protein PA2G_00068 [Pseudomon...  54.7    4e-06
ref|ZP_01754139.1|  3-deoxy-manno-octulosonate cytidylyltransf...  54.3    4e-06
gb|AAP35723.1|  unknown [Pseudomonas aeruginosa]                   54.3    4e-06
ref|ZP_05785973.1|  3-deoxy-manno-octulosonate cytidylyltransf...  53.9    5e-06
ref|ZP_03438908.1|  hypothetical protein HP9810_1g92 [Helicoba...  53.9    6e-06
gb|ACX97443.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  53.5    7e-06
ref|ZP_01740488.1|  3-deoxy-manno-octulosonate cytidylyltransf...  53.5    7e-06
ref|ZP_01154890.1|  3-deoxy-manno-octulosonate cytidylyltransf...  53.1    1e-05
ref|ZP_01052746.1|  3-deoxy-D-manno-octulosonatecytidylyltrans...  52.8    1e-05 Gene info
ref|ZP_05122025.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  52.8    1e-05
ref|YP_390175.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  52.4    1e-05 Gene info
ref|ZP_03690259.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  52.4    2e-05
ref|ZP_01287684.1|  3-deoxy-manno-octulosonate cytidylyltransf...  52.0    2e-05
ref|ZP_05078290.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  52.0    2e-05
ref|YP_001534909.1|  3-deoxy-manno-octulosonate cytidylyltrans...  51.2    3e-05 Gene info
gb|AAL06487.1|AF411798_1  F14G24.28/F14G24.28 [Arabidopsis tha...  50.8    4e-05
ref|YP_508158.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  50.8    5e-05 Gene info
ref|ZP_01291953.1|  3-deoxy-manno-octulosonate cytidylyltransf...  50.4    5e-05
ref|ZP_03311703.1|  hypothetical protein DESPIG_01620 [Desulfo...  50.4    6e-05
ref|YP_001301261.1|  putative CMP-KDO synthetase [Bacteroides ...  50.1    7e-05 Gene info
ref|ZP_02152413.1|  3-deoxy-manno-octulosonate cytidylyltransf...  50.1    8e-05
ref|ZP_01750216.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  49.7    1e-04
ref|ZP_01036908.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.7    1e-04
ref|ZP_01471764.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.7    1e-04
ref|YP_001264447.1|  3-deoxy-manno-octulosonate cytidylyltrans...  49.7    1e-04 Gene info
ref|ZP_05100995.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  49.3    1e-04
ref|ZP_00954385.1|  3-deoxy-manno-octulosonate cytidylyltransf...  48.9    2e-04
ref|ZP_05348511.1|  3-deoxy-manno-octulosonate cytidylyltransf...  48.9    2e-04
ref|ZP_05314047.1|  3-deoxy-manno-octulosonate cytidylyltransf...  48.5    2e-04
ref|ZP_00948929.1|  3-deoxy-manno-octulosonate cytidylyltransf...  47.4    5e-04
ref|ZP_03782123.1|  hypothetical protein RUMHYD_01560 [Blautia...  47.4    5e-04
ref|ZP_01881222.1|  3-deoxy-manno-octulosonate cytidylyltransf...  47.4    5e-04
ref|YP_165311.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  46.6    8e-04 Gene info
ref|ZP_00207826.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  46.2    0.001
ref|ZP_04542736.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  46.2    0.001
ref|ZP_05052814.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  45.8    0.001
ref|ZP_05343105.1|  3-deoxy-manno-octulosonate cytidylyltransf...  45.4    0.002
ref|ZP_05063139.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  45.4    0.002
ref|YP_411130.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  45.1    0.002 Gene info
ref|ZP_01002225.1|  3-deoxy-manno-octulosonate cytidylyltransf...  45.1    0.003
emb|CBA31320.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  43.5    0.007
ref|YP_419496.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetas...  42.7    0.011 Gene info
emb|CAM76620.1|  Acylneuraminate cytidylyltransferase [Magneto...  42.0    0.021
ref|ZP_04798552.1|  possible 3-deoxy-manno-octulosonate cytidy...  41.6    0.027
ref|ZP_00959567.1|  3-deoxy-manno-octulosonate cytidylyltransf...  41.6    0.028
ref|ZP_05856843.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  40.0    0.089
ref|YP_001168944.1|  3-deoxy-manno-octulosonate cytidylyltrans...  39.7    0.100 Gene info
ref|ZP_05842316.1|  3-deoxy-manno-octulosonate cytidylyltransf...  39.7    0.12 
ref|YP_001091627.1|  CMP-2-keto-3-deoxyoctulosonic acid synthe...  38.9    0.18  Gene info
ref|ZP_03733994.1|  hypothetical protein CLOM621_04037 [Clostr...  38.1    0.34 
ref|ZP_00056579.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  37.4    0.50 
ref|ZP_02036000.1|  hypothetical protein BACCAP_01597 [Bactero...  37.4    0.60 
ref|YP_380472.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  36.6    0.88  Gene info
gb|AAO59305.1|  kinesin [Gibberella moniliformis]                  36.2    1.2  
ref|YP_354245.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  36.2    1.2   Gene info
ref|YP_002526917.1|  3-deoxy-manno-octulosonate cytidylyltrans...  35.8    1.7   Gene info
gb|ABE01208.1|  IP14842p [Drosophila melanogaster]                 35.8    1.8  
ref|YP_001794338.1|  porphobilinogen synthase [Thermoproteus n...  35.4    1.9   Gene info
ref|ZP_02080944.1|  hypothetical protein CLOLEP_02410 [Clostri...  35.4    1.9  
ref|ZP_00964436.1|  3-deoxy-manno-octulosonate cytidylyltransf...  35.4    2.1  
ref|YP_929569.1|  delta-aminolevulinic acid dehydratase [Pyrob...  35.4    2.1   Gene info
emb|CAQ17492.1|  probable 3-deoxy-manno-octulosonate cmp-kdo s...  35.0    2.5  
ref|YP_001787046.1|  sensory box sigma-54 dependent transcript...  34.7    3.1   Gene info
gb|ABF00987.1|  mushroom body defect protein [Drosophila melan...  34.7    3.1  
gb|AAF88146.1|AF174134_1  Mud protein [Drosophila melanogaster]    34.7    3.1  
ref|ZP_01056429.1|  methyl-accepting chemotaxis protein [Roseo...  34.7    3.1  
ref|NP_727770.1|  mushroom body defect, isoform A [Drosophila ...  34.7    3.2   Gene info
ref|NP_727769.2|  mushroom body defect, isoform B [Drosophila ...  34.7    3.3   UniGene infoGene info
ref|YP_001044695.1|  3-deoxy-manno-octulosonate cytidylyltrans...  34.7    3.4   Gene info
ref|ZP_02614963.1|  sensory box sigma-54 dependent transcripti...  34.7    3.8  
ref|YP_001390979.1|  sensory box sigma-54 dependent transcript...  34.7    3.9   Gene info
ref|YP_001781275.1|  sensory box sigma-54 dependent transcript...  34.7    4.0   Gene info
ref|NP_536743.2|  mushroom body defect, isoform C [Drosophila ...  34.3    4.2   Gene info
ref|YP_001254144.1|  signal-transduction and transcriptional-c...  34.3    4.4   Gene info
ref|NP_347702.1|  TPR repeat-containing protein [Clostridium a...  34.3    4.5   Gene info
ref|ZP_01223330.1|  N-acetylglucosamine-1-phosphate uridyltran...  33.9    5.2  
ref|ZP_05634301.1|  elongation factor P [Fusobacterium ulceran...  33.9    5.3  
ref|ZP_02619370.1|  sensory box sigma-54 dependent transcripti...  33.9    5.4  
ref|ZP_05114495.1|  Uncharacterized protein family UPF0007 [La...  33.9    5.5  
ref|YP_001010992.1|  UDP-N-acetylglucosamine pyrophosphorylase...  33.9    5.8   Gene info
gb|ACN58987.1|  GAF sensor hybrid histidine kinase [uncultured...  33.9    6.3  
ref|NP_564385.1|  NFD3 (NUCLEAR FUSION DEFECTIVE 3); structura...  33.9    6.4   UniGene infoGene info
ref|ZP_04859523.1|  protein Translation Elongation Factor P [F...  33.5    7.0  
gb|AAG50732.1|AC079041_25  30S ribosomal protein S11, putative...  33.5    7.0  
ref|XP_001849180.1|  conserved hypothetical protein [Culex qui...  33.5    7.6   UniGene infoGene info
ref|ZP_03242547.1|  3-deoxy-manno-octulosonate cytidylyltransf...  33.5    7.7  
ref|XP_001456021.1|  hypothetical protein [Paramecium tetraure...  33.5    8.2   Gene info
ref|ZP_03838324.1|  hypothetical protein CIT292_04416 [Citroba...  33.5    8.7  
ref|ZP_02996150.1|  hypothetical protein CLOSPO_03273 [Clostri...  33.1    10.0 
gb|AAF89163.2|AF209068_1  Mud protein [Drosophila melanogaster]    33.1    10.0 


Alignments 

>gb|ABZ06016.1|  putative cytidylyltransferase [uncultured marine microorganism 
HF4000_005D21]
 gb|ABZ10411.1|  putative cytidylyltransferase [uncultured marine bacterium HF4000_APKG3108]
Length=243

 Score =  169 bits (428),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 119/167 (71%), Gaps = 1/167 (0%)

Query  1    GTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSNE  60
            G+DRVYE +   L  N  +I+NLQGDMPNI P +I+ L   M +  C+IGTLAS I + +
Sbjct  76   GSDRVYEAYLKQLKDNVNLIINLQGDMPNIKPNSISKLEKLMRQNDCDIGTLASFIKNAD  135

Query  61   ELENENVVKVLVKEKLKTGMYVKALDFVRL-KNIQKLQPYHHIGIYAFTNKALSRYVGLK  119
            E+ + NVVKVLV ++L+   +  A DF R+ KN++  + YHHIGIYAFT  AL++YV L 
Sbjct  136  EIIDANVVKVLVDQELENDSFSNAKDFFRIKKNLKNEKIYHHIGIYAFTIVALTKYVKLS  195

Query  120  RSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            RSK EI+R LEQ+RAMEN + + VG  +S+PL VDT+EDL+++ K M
Sbjct  196  RSKFEIKRHLEQMRAMENNLVVKVGLSDSTPLGVDTKEDLKKVTKEM  242


>ref|NP_949032.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
 sp|Q6N3J9.1|KDSB_RHOPA  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
 emb|CAE29135.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
Length=245

 GENE ID: 2691528 kdsB | 3-deoxy-manno-octulosonate cytidylyltransferase
[Rhodopseudomonas palustris CGA009] (10 or fewer PubMed links)

 Score =  131 bits (329),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 102/173 (58%), Gaps = 14/173 (8%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DR++E  +  L+ + KI  ++NLQGD P I PE I  +++ +     +I TLA++I +
Sbjct  78   GSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLEPLADPAVDIATLAAEIHT  136

Query  59   NEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALS  113
             EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   AL 
Sbjct  137  EEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRAALE  190

Query  114  RYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  191  RFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>ref|YP_676618.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
 sp|Q11AX2.1|KDSB_MESSB  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
 gb|ABG65453.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
Length=251

 GENE ID: 4182786 Meso_4086 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Mesorhizobium sp. BNC1]

 Score =  131 bits (329),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 100/174 (57%), Gaps = 6/174 (3%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E  +  +  A  +I++NLQGD+P I PE I  +V  +     +I TL  +IS  
Sbjct  75   GSDRIFEALQTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEISDE  134

Query  60   EELENENVVKVLVKEKLKTG---MYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  115
            EE  N NVVK+ V   +KT    + ++AL F R        P +HHIGIYA+  +AL R+
Sbjct  135  EEKANPNVVKI-VGVPVKTASDALRLRALYFTRATAPWGEGPLFHHIGIYAYRRRALERF  193

Query  116  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTN  169
            V L    LE+  +LEQLRA+E GM I    V S PL VDT  DLE  ++++   
Sbjct  194  VALPPGTLEMRERLEQLRALEAGMRIEAEIVRSVPLGVDTPADLERARQLLSAR  247


>ref|ZP_05068841.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidatus 
Pelagibacter sp. HTCC7211]
 gb|EDZ59840.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidatus 
Pelagibacter sp. HTCC7211]
Length=243

 Score =  130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 111/167 (66%), Gaps = 1/167 (0%)

Query  1    GTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSNE  60
            GTDR+YE FK     +  +I+NLQGD P I  + I +L   M     ++GTLA+ I ++ 
Sbjct  75   GTDRIYEAFKKLDIRDVDLIMNLQGDEPAINIDDIISLNKKMTVYPSQMGTLAANIKNDN  134

Query  61   ELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQPYHHIGIYAFTNKALSRYVGLKR  120
            +LENEN+VKV+ K+ LK   +  A +F+R  + +K   YHHIG+Y ++ + L ++V L++
Sbjct  135  DLENENIVKVITKKNLKDEDFSSAENFLR-NSSKKNNIYHHIGVYCYSAETLEKFVKLEQ  193

Query  121  SKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMK  167
            S+ EI+ +LEQLRA++N + I+V    SSP+ VDTEED   +KKIM+
Sbjct  194  SQNEIKNRLEQLRALDNNIEINVSLAKSSPIGVDTEEDYLALKKIME  240


>ref|YP_001993187.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris TIE-1]
 sp|B3QGN5.1|KDSB_RHOPT Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
 gb|ACF02712.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris TIE-1]
Length=245

 GENE ID: 6411900 Rpal_4216 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Rhodopseudomonas palustris TIE-1]

 Score =  130 bits (327),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 101/173 (58%), Gaps = 14/173 (8%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DR++E  +  L+ + KI  ++NLQGD P I PE I  ++  +     +I TLA++I +
Sbjct  78   GSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLGPLADPAVDIATLAAEIHT  136

Query  59   NEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALS  113
             EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   AL 
Sbjct  137  EEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRAALE  190

Query  114  RYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  191  RFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>ref|YP_485387.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
 gb|ABD06476.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
Length=259

 GENE ID: 3909755 RPB_1768 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Rhodopseudomonas palustris HaA2]

 Score =  129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E  +  +     + ++NLQGD P I PE I  ++  ++    +I TLA++I + 
Sbjct  92   GSDRIHEALQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEIHTE  151

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVKV V   + T   ++AL F R        P YHHIG+YA+   AL R+V L
Sbjct  152  EESTNPNVVKV-VGSHIGT-TRLRALYFTRATAPWGDGPRYHHIGLYAYRRAALERFVAL  209

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++++
Sbjct  210  PPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRVL  257


>sp|Q2IZ84.2|KDSB_RHOP2  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=245

 Score =  128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E  +  +     + ++NLQGD P I PE I  ++  ++    +I TLA++I + 
Sbjct  78   GSDRIHEALQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEIHTE  137

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVKV V   + T   ++AL F R        P YHHIG+YA+   AL R+V L
Sbjct  138  EESTNPNVVKV-VGSHIGT-TRLRALYFTRATAPWGDGPRYHHIGLYAYRRAALERFVAL  195

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++++
Sbjct  196  PPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRVL  243


>ref|YP_001242846.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizobium 
sp. BTAi1]
 sp|A5ERZ6.1|KDSB_BRASB Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
 gb|ABQ38940.1| Gene info CTP/CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. BTAi1]
Length=246

 GENE ID: 5152257 kdsB | 3-deoxy-manno-octulosonate cytidylyltransferase
[Bradyrhizobium sp. BTAi1] (10 or fewer PubMed links)

 Score =  127 bits (319),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 10/171 (5%)

Query  1    GTDRVYEV-FKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR+YE   K +     +I+VNLQGD P ILP+ I +++  ++    +I TLA++I + 
Sbjct  78   GSDRIYEASCKLDPAGEAEIVVNLQGDFPTILPQNIRDVLLPLSDPAVDIATLAAQIHTA  137

Query  60   EELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  115
            EE    +VVK +   + E+      ++AL F R        P YHHIG+YA+   AL R+
Sbjct  138  EEDAAPSVVKAVGSPIGER-----RLRALYFTRATAPHGDGPRYHHIGLYAYRRAALERF  192

Query  116  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            V L  S LE++ KLEQLRA+E GM I +G V++ P  VDT  DLE  ++++
Sbjct  193  VSLPPSPLELQEKLEQLRALEAGMRIDIGIVDTVPRGVDTPPDLETARRLL  243


>ref|YP_575727.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
 sp|Q1QR80.1|KDSB_NITHX Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
 gb|ABE61267.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
Length=258

 GENE ID: 4030262 Nham_0376 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Nitrobacter hamburgensis X14]

 Score =  126 bits (316),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 101/171 (59%), Gaps = 6/171 (3%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DRV+E   + L+ + +I  I+NLQGD P I P+ I +++  +     +I TLA++I S
Sbjct  78   GSDRVFEAL-DRLDPDGRIETIINLQGDFPTIRPDIIRDVLKPLADPAVDIATLAAEIHS  136

Query  59   NEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVG  117
            +EE  N NVVK +          ++AL F R        P YHHIG+YA+  KAL R+V 
Sbjct  137  DEEATNPNVVKAVGSPVAP--RRLRALYFTRATAPHGDGPRYHHIGLYAYRRKALQRFVE  194

Query  118  LKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKT  168
            L  S LE + +LEQLRA+E GM I +  V+  P  VDT  DLE  ++I+ +
Sbjct  195  LPPSPLERQERLEQLRALEGGMRIDIMIVDDVPRGVDTAADLETARRILAS  245


>ref|YP_001203152.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Bradyrhizobium 
sp. ORS278]
 emb|CAL74915.1| Gene info CTP:CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. ORS278]
Length=256

 GENE ID: 5116865 kdsB | 3-deoxy-manno-octulosonate cytidylyltransferase
[Bradyrhizobium sp. ORS278] (10 or fewer PubMed links)

 Score =  125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR+YE   K +       +VNLQGD P I P +I++++  ++    +I TLA++I + 
Sbjct  88   GSDRIYEALCKLDPAGEADFVVNLQGDFPTIDPRSISDVLPPLDDPAVDIATLAAQIHTE  147

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVK  V   L  G  ++AL F R        P YHHIG+YA+   AL R+V L
Sbjct  148  EESLNPNVVKA-VGSPLG-GRRMRALYFTRATAPHGDGPRYHHIGLYAYRRAALERFVRL  205

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE + KLEQLRA+E GM I V  V++ P  VDT  DLE  ++++
Sbjct  206  PPSPLEQQEKLEQLRALEAGMRIDVMVVDAVPRGVDTPADLETARRLL  253

(---------------------------------------------------------------------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------------------------)
b. Banque Swissprot

Translation of ORF number 1 in reading frame...
Results for: What's this?

Your BLAST job specified more than one input sequence. This box lets you choose which input sequence to show BLAST results for.

Query ID
    lcl|55328
Description
    Translation of ORF number 1 in reading frame 3 on the reverse strand.
Molecule type
    amino acid
Query Length
    171

Database Name
    swissprot
Description
    Non-redundant SwissProt sequences See details
Program
    BLASTP 2.2.22+ Citation

                                                        Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q6N3J9.1|KDSB_RHOPA  RecName: Full=3-deoxy-manno-octulosona...   131    2e-30
sp|Q11AX2.1|KDSB_MESSB  RecName: Full=3-deoxy-manno-octulosona...   131    2e-30
sp|B3QGN5.1|KDSB_RHOPT  RecName: Full=3-deoxy-manno-octulosona...   130    3e-30 Gene info
sp|Q2IZ84.2|KDSB_RHOP2  RecName: Full=3-deoxy-manno-octulosona...   128    1e-29
sp|A5ERZ6.1|KDSB_BRASB  RecName: Full=3-deoxy-manno-octulosona...   127    3e-29 Gene info
sp|Q1QR80.1|KDSB_NITHX  RecName: Full=3-deoxy-manno-octulosona...   126    7e-29 Gene info
sp|A4YLY9.2|KDSB_BRASO  RecName: Full=3-deoxy-manno-octulosona...   125    1e-28
sp|Q133H9.1|KDSB_RHOPS  RecName: Full=3-deoxy-manno-octulosona...   125    1e-28 Gene info
sp|A7HPP1.1|KDSB_PARL1  RecName: Full=3-deoxy-manno-octulosona...   125    1e-28 Gene info
sp|A8IGU8.2|KDSB_AZOC5  RecName: Full=3-deoxy-manno-octulosona...   125    1e-28
sp|Q07K36.1|KDSB_RHOP5  RecName: Full=3-deoxy-manno-octulosona...   125    1e-28 Gene info
sp|Q210C0.1|KDSB_RHOPB  RecName: Full=3-deoxy-manno-octulosona...   124    2e-28 Gene info
sp|B6JJE4.1|KDSB_OLICO  RecName: Full=3-deoxy-manno-octulosona...   124    3e-28 Gene info
sp|Q2VZK3.1|KDSB_MAGMM  RecName: Full=3-deoxy-manno-octulosona...   121    2e-27 Gene info
sp|A7IIM9.1|KDSB_XANP2  RecName: Full=3-deoxy-manno-octulosona...   121    2e-27 Gene info
sp|A9IMZ3.1|KDSB_BART1  RecName: Full=3-deoxy-manno-octulosona...   120    3e-27 Gene info
sp|A5VMY8.2|KDSB_BRUO2  RecName: Full=3-deoxy-manno-octulosona...   120    5e-27
sp|B6IWU1.1|KDSB_RHOCS  RecName: Full=3-deoxy-manno-octulosona...   120    5e-27 Gene info
sp|Q57FX6.1|KDSB_BRUAB  RecName: Full=3-deoxy-manno-octulosona...   120    5e-27
sp|Q8G3B2.1|KDSB_BRUSU  RecName: Full=3-deoxy-manno-octulosona...   120    5e-27
sp|Q1MN23.1|KDSB_RHIL3  RecName: Full=3-deoxy-manno-octulosona...   119    8e-27 Gene info
sp|B3PXG0.1|KDSB_RHIE6  RecName: Full=3-deoxy-manno-octulosona...   119    1e-26 Gene info
sp|Q3SVY8.1|KDSB_NITWN  RecName: Full=3-deoxy-manno-octulosona...   118    1e-26 Gene info
sp|Q92SX6.1|KDSB_RHIME  RecName: Full=3-deoxy-manno-octulosona...   118    2e-26
sp|A6UF15.1|KDSB_SINMW  RecName: Full=3-deoxy-manno-octulosona...   117    4e-26 Gene info
sp|B1LVX5.1|KDSB_METRJ  RecName: Full=3-deoxy-manno-octulosona...   117    4e-26 Gene info
sp|Q89UJ4.1|KDSB_BRAJA  RecName: Full=3-deoxy-manno-octulosona...   116    7e-26
sp|Q2KDX9.1|KDSB_RHIEC  RecName: Full=3-deoxy-manno-octulosona...   115    8e-26 Gene info
sp|A9CKP8.1|KDSB_AGRT5  RecName: Full=3-deoxy-manno-octulosona...   115    9e-26 Gene info
sp|Q6G4U6.1|KDSB_BARHE  RecName: Full=3-deoxy-manno-octulosona...   115    1e-25
sp|Q98BN3.1|KDSB_RHILO  RecName: Full=3-deoxy-manno-octulosona...   115    1e-25
sp|B5ZWP0.1|KDSB_RHILW  RecName: Full=3-deoxy-manno-octulosona...   115    1e-25 Gene info
sp|B1ZJ23.1|KDSB_METPB  RecName: Full=3-deoxy-manno-octulosona...   114    2e-25 Gene info
sp|B9JGV0.1|KDSB_AGRRK  RecName: Full=3-deoxy-manno-octulosona...   114    3e-25
sp|A9VZK8.1|KDSB_METEP  RecName: Full=3-deoxy-manno-octulosona...   114    3e-25 Gene info
sp|B7L043.1|KDSB_METC4  RecName: Full=3-deoxy-manno-octulosona...   114    3e-25
sp|Q6G0M4.1|KDSB_BARQU  RecName: Full=3-deoxy-manno-octulosona...   114    3e-25
sp|A6WUU4.1|KDSB_OCHA4  RecName: Full=3-deoxy-manno-octulosona...   113    6e-25 Gene info
sp|A1UU32.1|KDSB_BARBK  RecName: Full=3-deoxy-manno-octulosona...   112    1e-24 Gene info
sp|B8ICG5.1|KDSB_METNO  RecName: Full=3-deoxy-manno-octulosona...   106    7e-23 Gene info
sp|B0UNK9.2|KDSB_METS4  RecName: Full=3-deoxy-manno-octulosona...   105    1e-22
sp|A7HIF1.1|KDSB_ANADF  RecName: Full=3-deoxy-manno-octulosona...   105    2e-22
sp|B5YGT5.1|KDSB_THEYD  RecName: Full=3-deoxy-manno-octulosona...   103    5e-22 Gene info
sp|Q2RPI7.2|KDSB_RHORT  RecName: Full=3-deoxy-manno-octulosona...   102    1e-21
sp|A8GRV7.1|KDSB_RICRS  RecName: Full=3-deoxy-manno-octulosona...   102    1e-21 Gene info
sp|B0BXB4.1|KDSB_RICRO  RecName: Full=3-deoxy-manno-octulosona...   101    2e-21 Gene info
sp|A8GN86.1|KDSB_RICAH  RecName: Full=3-deoxy-manno-octulosona...   100    3e-21 Gene info
sp|Q4QPI6.1|KDSB_HAEI8  RecName: Full=3-deoxy-manno-octulosona...   100    4e-21 Gene info
sp|P44490.2|KDSB_HAEIN  RecName: Full=3-deoxy-manno-octulosona...   100    4e-21
sp|B8JBN7.1|KDSB_ANAD2  RecName: Full=3-deoxy-manno-octulosona...   100    5e-21 Gene info
sp|Q4ULX8.1|KDSB_RICFE  RecName: Full=3-deoxy-manno-octulosona...   100    5e-21
sp|A8F1E9.1|KDSB_RICM5  RecName: Full=3-deoxy-manno-octulosona...   100    6e-21 Gene info
sp|B4UIT7.1|KDSB_ANASK  RecName: Full=3-deoxy-manno-octulosona...  99.8    6e-21
sp|Q1IU72.1|KDSB_ACIBL  RecName: Full=3-deoxy-manno-octulosona...  99.4    8e-21 Gene info
sp|Q2IH80.1|KDSB_ANADE  RecName: Full=3-deoxy-manno-octulosona...  99.4    8e-21
sp|A8EZ55.1|KDSB_RICCK  RecName: Full=3-deoxy-manno-octulosona...  99.4    9e-21 Gene info
sp|Q1RHU5.1|KDSB_RICBR  RecName: Full=3-deoxy-manno-octulosona...  99.0    1e-20 Gene info
sp|Q9ZDF0.1|KDSB_RICPR  RecName: Full=3-deoxy-manno-octulosona...  99.0    1e-20
sp|A5UB81.1|KDSB_HAEIE  RecName: Full=3-deoxy-manno-octulosona...  99.0    1e-20 Gene info
sp|B0UT79.1|KDSB_HAES2  RecName: Full=3-deoxy-manno-octulosona...  99.0    1e-20
sp|C3PN96.1|KDSB_RICAE  RecName: Full=3-deoxy-manno-octulosona...  98.6    2e-20
sp|B8F5J5.1|KDSB_HAEPS  RecName: Full=3-deoxy-manno-octulosona...  98.2    2e-20
sp|Q0I2X5.1|KDSB_HAES1  RecName: Full=3-deoxy-manno-octulosona...  98.2    2e-20 Gene info
sp|Q92I96.1|KDSB_RICCN  RecName: Full=3-deoxy-manno-octulosona...  97.8    3e-20
sp|B2KD62.1|KDSB_ELUMP  RecName: Full=3-deoxy-manno-octulosona...  97.1    4e-20
sp|A5UFM6.1|KDSB_HAEIG  RecName: Full=3-deoxy-manno-octulosona...  97.1    4e-20 Gene info
sp|A3MYF7.1|KDSB1_ACTP2  RecName: Full=3-deoxy-manno-octuloson...  97.1    5e-20 Gene info
sp|Q0VQP3.1|KDSB_ALCBS  RecName: Full=3-deoxy-manno-octulosona...  96.7    6e-20
sp|B0BRZ1.1|KDSB_ACTPJ  RecName: Full=3-deoxy-manno-octulosona...  96.3    8e-20
sp|C4K2D9.1|KDSB_RICPU  RecName: Full=3-deoxy-manno-octulosona...  96.3    8e-20
sp|C1F3B8.1|KDSB_ACIC5  RecName: Full=3-deoxy-manno-octulosona...  96.3    8e-20
sp|B1XTC6.1|KDSB_POLNS  RecName: Full=3-deoxy-manno-octulosona...  95.5    1e-19 Gene info
sp|Q7VNY6.1|KDSB_HAEDU  RecName: Full=3-deoxy-manno-octulosona...  95.1    2e-19
sp|Q7W7F9.1|KDSB_BORPA  RecName: Full=3-deoxy-manno-octulosona...  95.1    2e-19
sp|A1VA25.1|KDSB_DESVV  RecName: Full=3-deoxy-manno-octulosona...  94.7    2e-19 Gene info
sp|Q7VVB0.1|KDSB_BORPE  RecName: Full=3-deoxy-manno-octulosona...  94.7    2e-19
sp|Q47B45.1|KDSB_DECAR  RecName: Full=3-deoxy-manno-octulosona...  94.4    3e-19 Gene info
sp|Q7WKU7.1|KDSB_BORBR  RecName: Full=3-deoxy-manno-octulosona...  93.6    5e-19
sp|A3N2M5.1|KDSB2_ACTP2  RecName: Full=3-deoxy-manno-octuloson...  93.2    6e-19 Gene info
sp|C1A8V7.1|KDSB_GEMAT  RecName: Full=3-deoxy-manno-octulosona...  93.2    6e-19
sp|Q8XWE2.1|KDSB_RALSO  RecName: Full=3-deoxy-manno-octulosona...  92.8    7e-19
sp|A4SVI9.1|KDSB_POLSQ  RecName: Full=3-deoxy-manno-octulosona...  92.8    8e-19 Gene info
sp|Q726J3.1|KDSB_DESVH  RecName: Full=3-deoxy-manno-octulosona...  92.8    8e-19 Gene info
sp|Q7NSS6.1|KDSB_CHRVO  RecName: Full=3-deoxy-manno-octulosona...  92.4    1e-18
sp|A6L9D4.1|KDSB_PARD8  RecName: Full=3-deoxy-manno-octulosona...  92.4    1e-18
sp|Q2NUA2.1|KDSB_SODGM  RecName: Full=3-deoxy-manno-octulosona...  90.9    3e-18 Gene info
sp|Q2KZE5.1|KDSB_BORA1  RecName: Full=3-deoxy-manno-octulosona...  90.9    3e-18 Gene info
sp|Q1ICZ9.1|KDSB_PSEE4  RecName: Full=3-deoxy-manno-octulosona...  90.5    4e-18 Gene info
sp|A0KLX9.1|KDSB_AERHH  RecName: Full=3-deoxy-manno-octulosona...  90.1    6e-18 Gene info
sp|Q5QU39.1|KDSB_IDILO  RecName: Full=3-deoxy-manno-octulosona...  89.7    7e-18
sp|Q87R14.1|KDSB_VIBPA  RecName: Full=3-deoxy-manno-octulosona...  89.7    7e-18
sp|A8GCI3.1|KDSB_SERP5  RecName: Full=3-deoxy-manno-octulosona...  89.7    7e-18 Gene info
sp|Q7MJ10.1|KDSB_VIBVY  RecName: Full=3-deoxy-manno-octulosona...  89.7    8e-18 Gene info
sp|C4L8W0.1|KDSB_TOLAT  RecName: Full=3-deoxy-manno-octulosona...  89.4    8e-18
sp|Q7N6C2.1|KDSB_PHOLL  RecName: Full=3-deoxy-manno-octulosona...  89.4    9e-18
sp|Q11R71.1|KDSB_CYTH3  RecName: Full=3-deoxy-manno-octulosona...  89.4    9e-18 Gene info
sp|A7MV12.1|KDSB_VIBHB  RecName: Full=3-deoxy-manno-octulosona...  89.0    1e-17 Gene info
sp|Q1MPN4.1|KDSB_LAWIP  RecName: Full=3-deoxy-manno-octulosona...  89.0    1e-17 Gene info
sp|B3QTV9.1|KDSB_CHLT3  RecName: Full=3-deoxy-manno-octulosona...  89.0    1e-17 Gene info
sp|B4RYE4.1|KDSB_ALTMD  RecName: Full=3-deoxy-manno-octulosona...  88.6    2e-17
sp|Q9KQX2.1|KDSB_VIBCH  RecName: Full=3-deoxy-manno-octulosona...  88.6    2e-17
sp|C3JY27.1|KDSB_PSEFS  RecName: Full=3-deoxy-manno-octulosona...  88.6    2e-17
sp|Q01T78.1|KDSB_SOLUE  RecName: Full=3-deoxy-manno-octulosona...  88.6    2e-17 Gene info
sp|B3EAK6.1|KDSB_GEOLS  RecName: Full=3-deoxy-manno-octulosona...  88.2    2e-17
sp|Q7MTW6.1|KDSB_PORGI  RecName: Full=3-deoxy-manno-octulosona...  88.2    2e-17
sp|A9IQ35.2|KDSB_BORPD  RecName: Full=3-deoxy-manno-octulosona...  88.2    2e-17
sp|A4SL70.1|KDSB_AERS4  RecName: Full=3-deoxy-manno-octulosona...  87.8    2e-17 Gene info
sp|Q68WZ5.1|KDSB_RICTY  RecName: Full=3-deoxy-manno-octulosona...  87.8    2e-17
sp|B2UB84.1|KDSB_RALPJ  RecName: Full=3-deoxy-manno-octulosona...  87.8    3e-17 Gene info
sp|A4SD67.1|KDSB_PROVI  RecName: Full=3-deoxy-manno-octulosona...  87.8    3e-17 Gene info
sp|Q4ZVY8.1|KDSB_PSEU2  RecName: Full=3-deoxy-manno-octulosona...  87.4    4e-17 Gene info
sp|A1K5I4.1|KDSB_AZOSB  RecName: Full=3-deoxy-manno-octulosona...  87.4    4e-17 Gene info
sp|B0BZZ7.1|KDSB_ACAM1  RecName: Full=3-deoxy-manno-octulosona...  87.4    4e-17
sp|B2RLM4.1|KDSB_PORG3  RecName: Full=3-deoxy-manno-octulosona...  87.0    4e-17 Gene info
sp|Q4KFT3.1|KDSB_PSEF5  RecName: Full=3-deoxy-manno-octulosona...  87.0    4e-17
sp|Q8DAU9.1|KDSB_VIBVU  RecName: Full=3-deoxy-manno-octulosona...  87.0    4e-17
sp|Q48L52.1|KDSB_PSE14  RecName: Full=3-deoxy-manno-octulosona...  87.0    5e-17 Gene info
sp|A1U1F3.1|KDSB_MARAV  RecName: Full=3-deoxy-manno-octulosona...  86.7    5e-17 Gene info
sp|B3PFR9.1|KDSB_CELJU  RecName: Full=3-deoxy-manno-octulosona...  86.7    6e-17
sp|B2JDV2.1|KDSB_BURP8  RecName: Full=3-deoxy-manno-octulosona...  86.7    6e-17 Gene info
sp|A0LE62.1|KDSB_SYNFM  RecName: Full=3-deoxy-manno-octulosona...  86.3    7e-17 Gene info
sp|B2T6M3.1|KDSB1_BURPP  RecName: Full=3-deoxy-manno-octuloson...  86.3    7e-17 Gene info
sp|Q492T2.1|KDSB_BLOPB  RecName: Full=3-deoxy-manno-octulosona...  86.3    8e-17
sp|A6VQ31.1|KDSB_ACTSZ  RecName: Full=3-deoxy-manno-octulosona...  85.9    9e-17 Gene info
sp|Q87YF7.1|KDSB_PSESM  RecName: Full=3-deoxy-manno-octulosona...  85.9    9e-17
sp|Q8A9S0.1|KDSB_BACTN  RecName: Full=3-deoxy-manno-octulosona...  85.9    9e-17
sp|Q5WVD2.1|KDSB_LEGPL  RecName: Full=3-deoxy-manno-octulosona...  85.9    1e-16 Gene info
sp|Q5ZU88.1|KDSB_LEGPH  RecName: Full=3-deoxy-manno-octulosona...  85.9    1e-16 Gene info
sp|A7MEV1.1|KDSB_ENTS8  RecName: Full=3-deoxy-manno-octulosona...  85.5    1e-16 Gene info
sp|C5BAD7.1|KDSB_EDWI9  RecName: Full=3-deoxy-manno-octulosona...  85.5    1e-16
sp|A6T710.1|KDSB_KLEP7  RecName: Full=3-deoxy-manno-octulosona...  85.5    1e-16 Gene info
sp|A1JMK9.1|KDSB_YERE8  RecName: Full=3-deoxy-manno-octulosona...  85.5    1e-16 Gene info
sp|Q2SIN2.1|KDSB_HAHCH  RecName: Full=3-deoxy-manno-octulosona...  85.5    1e-16 Gene info
sp|P57883.1|KDSB_PASMU  RecName: Full=3-deoxy-manno-octulosona...  85.1    1e-16
sp|A4XSR4.1|KDSB_PSEMY  RecName: Full=3-deoxy-manno-octulosona...  85.1    2e-16
sp|Q04VK9.1|KDSB_LEPBJ  RecName: Full=3-deoxy-manno-octulosona...  85.1    2e-16 Gene info
sp|A2SIQ3.1|KDSB_METPP  RecName: Full=3-deoxy-manno-octulosona...  85.1    2e-16 Gene info
sp|Q2T0K3.1|KDSB_BURTA  RecName: Full=3-deoxy-manno-octulosona...  84.7    2e-16 Gene info
sp|Q5X3Y7.1|KDSB_LEGPA  RecName: Full=3-deoxy-manno-octulosona...  84.7    3e-16 Gene info
sp|Q6D440.1|KDSB_ERWCT  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16
sp|A1WWF7.1|KDSB_HALHL  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16 Gene info
sp|A5ID77.1|KDSB_LEGPC  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16 Gene info
sp|A1S639.1|KDSB_SHEAM  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16 Gene info
sp|B6ES02.1|KDSB_ALISL  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16 Gene info
sp|B3R0X8.1|KDSB_CUPTR  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16 Gene info
sp|Q62HI2.1|KDSB_BURMA  RecName: Full=3-deoxy-manno-octulosona...  84.3    3e-16
sp|Q13UR9.2|KDSB_BURXL  RecName: Full=3-deoxy-manno-octulosona...  84.0    3e-16 Gene info
sp|B1J508.1|KDSB_PSEPW  RecName: Full=3-deoxy-manno-octulosona...  84.0    4e-16
sp|Q0KE19.1|KDSB_RALEH  RecName: Full=3-deoxy-manno-octulosona...  84.0    4e-16 Gene info
sp|Q02PE2.1|KDSB_PSEAB  RecName: Full=3-deoxy-manno-octulosona...  84.0    4e-16
sp|Q3K8J4.1|KDSB_PSEPF  RecName: Full=3-deoxy-manno-octulosona...  83.6    5e-16 Gene info
sp|B7V149.1|KDSB_PSEA8  RecName: Full=3-deoxy-manno-octulosona...  83.6    5e-16 Gene info
sp|B9MI81.1|KDSB_DIAST  RecName: Full=3-deoxy-manno-octulosona...  83.6    5e-16
sp|B5XY79.1|KDSB_KLEP3  RecName: Full=3-deoxy-manno-octulosona...  83.6    5e-16
sp|B1JXF7.1|KDSB_BURCC  RecName: Full=3-deoxy-manno-octulosona...  83.6    6e-16 Gene info
sp|Q65U18.1|KDSB_MANSM  RecName: Full=3-deoxy-manno-octulosona...  83.2    6e-16 Gene info
sp|Q83LN8.1|KDSB_SHIFL  RecName: Full=3-deoxy-manno-octulosona...  83.2    6e-16
sp|Q31YT2.1|KDSB_SHIBS  RecName: Full=3-deoxy-manno-octulosona...  83.2    6e-16 Gene info
sp|Q5E0E9.1|KDSB_VIBF1  RecName: Full=3-deoxy-manno-octulosona...  83.2    7e-16 Gene info
sp|B7LN80.1|KDSB_ESCF3  RecName: Full=3-deoxy-manno-octulosona...  83.2    7e-16 Gene info
sp|Q32E38.1|KDSB_SHIDS  RecName: Full=3-deoxy-manno-octulosona...  82.8    7e-16 Gene info
sp|A1APF8.1|KDSB_PELPD  RecName: Full=3-deoxy-manno-octulosona...  82.8    7e-16
sp|A7ZK07.1|KDSB_ECO24  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16 Gene info
sp|A1W894.1|KDSB_ACISJ  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16 Gene info
sp|A6T170.1|KDSB_JANMA  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|Q8ZGA4.1|KDSB_YERPE  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|C6DFA4.1|KDSB_PECCP  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|A4JH79.1|KDSB_BURVG  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16 Gene info
sp|Q8XDG6.3|KDSB_ECO57  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|P04951.2|KDSB_ECOLI  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|Q6LPK9.1|KDSB_PHOPR  RecName: Full=3-deoxy-manno-octulosona...  82.8    8e-16
sp|A9MHW5.1|KDSB_SALAR  RecName: Full=3-deoxy-manno-octulosona...  82.8    9e-16 Gene info
sp|Q9HZM5.1|KDSB_PSEAE  RecName: Full=3-deoxy-manno-octulosona...  82.8    9e-16
sp|B0B9T2.1|KDSB_CHLT2  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15
sp|A9M2V7.1|KDSB_NEIM0  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15 Gene info
sp|Q7VR47.1|KDSB_BLOFL  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15
sp|B0KF43.1|KDSB_PSEPG  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15 Gene info
sp|B7UN04.1|KDSB_ECO27  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15
sp|Q3J7B0.1|KDSB_NITOC  RecName: Full=3-deoxy-manno-octulosona...  82.4    1e-15 Gene info
sp|B1YVD9.1|KDSB1_BURA4  RecName: Full=3-deoxy-manno-octuloson...  82.0    1e-15 Gene info
sp|Q129C7.2|KDSB_POLSJ  RecName: Full=3-deoxy-manno-octulosona...  82.0    1e-15
sp|B5QZC2.1|KDSB_SALEP  RecName: Full=3-deoxy-manno-octulosona...  82.0    1e-15
sp|Q6F9X2.1|KDSB_ACIAD  RecName: Full=3-deoxy-manno-octulosona...  82.0    2e-15 Gene info
sp|B8CMP6.1|KDSB_SHEPW  RecName: Full=3-deoxy-manno-octulosona...  82.0    2e-15 Gene info
sp|Q7UI86.1|KDSB_RHOBA  RecName: Full=3-deoxy-manno-octulosona...  82.0    2e-15
sp|B2VC71.1|KDSB_ERWT9  RecName: Full=3-deoxy-manno-octulosona...  81.6    2e-15
sp|Q1DDB3.1|KDSB_MYXXD  RecName: Full=3-deoxy-manno-octulosona...  81.6    2e-15 Gene info
sp|Q39DJ4.1|KDSB1_BURS3  RecName: Full=3-deoxy-manno-octuloson...  81.6    2e-15 Gene info
sp|A9AGK2.1|KDSB_BURM1  RecName: Full=3-deoxy-manno-octulosona...  81.6    2e-15 Gene info
sp|Q475G0.1|KDSB_RALEJ  RecName: Full=3-deoxy-manno-octulosona...  81.6    2e-15 Gene info
sp|Q8ZQC0.3|KDSB_SALTY  RecName: Full=3-deoxy-manno-octulosona...  81.3    3e-15
sp|Q15UY4.1|KDSB_PSEA6  RecName: Full=3-deoxy-manno-octulosona...  81.3    3e-15 Gene info
sp|Q9PKL1.2|KDSB_CHLMU  RecName: Full=3-deoxy-manno-octulosona...  81.3    3e-15
sp|B5FQ61.1|KDSB_SALDC  RecName: Full=3-deoxy-manno-octulosona...  81.3    3e-15
sp|Q5PGF5.1|KDSB_SALPA  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15
sp|A6V3B9.1|KDSB_PSEA7  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15
sp|Q3A370.1|KDSB_PELCD  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15 Gene info
sp|Q59320.2|KDSB_CHLTR  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15
sp|Q8FJA9.3|KDSB_ECOL6  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15
sp|Q12MB0.1|KDSB_SHEDO  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15 Gene info
sp|B2FK23.1|KDSB_STRMK  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15 Gene info
sp|A8AIG3.1|KDSB_CITK8  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15 Gene info
sp|A1KST6.1|KDSB_NEIMF  RecName: Full=3-deoxy-manno-octulosona...  80.9    3e-15 Gene info
sp|B1Y6I6.1|KDSB_LEPCP  RecName: Full=3-deoxy-manno-octulosona...  80.9    4e-15 Gene info
sp|Q21TN7.1|KDSB_RHOFD  RecName: Full=3-deoxy-manno-octulosona...  80.9    4e-15
sp|Q8Z800.3|KDSB_SALTI  RecName: Full=3-deoxy-manno-octulosona...  80.9    4e-15
sp|A1TQ97.1|KDSB_ACIAC  RecName: Full=3-deoxy-manno-octulosona...  80.9    4e-15 Gene info
sp|Q1BU67.1|KDSB_BURCA  RecName: Full=3-deoxy-manno-octulosona...  80.5    4e-15 Gene info
sp|Q60B47.1|KDSB_METCA  RecName: Full=3-deoxy-manno-octulosona...  80.5    4e-15
sp|B4E9G0.1|KDSB_BURCJ  RecName: Full=3-deoxy-manno-octulosona...  80.5    4e-15 Gene info
sp|A5CVZ7.1|KDSB_VESOH  RecName: Full=3-deoxy-manno-octulosona...  80.5    5e-15
sp|Q0BCH2.1|KDSB1_BURCM  RecName: Full=3-deoxy-manno-octuloson...  80.5    5e-15 Gene info
sp|A1WSH5.1|KDSB_VEREI  RecName: Full=3-deoxy-manno-octulosona...  80.5    5e-15 Gene info
sp|Q9K0D6.1|KDSB_NEIMB  RecName: Full=3-deoxy-manno-octulosona...  80.1    5e-15
sp|A4Y7B5.1|KDSB_SHEPC  RecName: Full=3-deoxy-manno-octulosona...  80.1    5e-15 Gene info
sp|A1RJ74.1|KDSB_SHESW  RecName: Full=3-deoxy-manno-octulosona...  80.1    6e-15 Gene info
sp|Q483B3.1|KDSB_COLP3  RecName: Full=3-deoxy-manno-octulosona...  80.1    6e-15 Gene info
sp|B4ET34.1|KDSB_PROMH  RecName: Full=3-deoxy-manno-octulosona...  80.1    6e-15 Gene info
sp|Q88LM7.1|KDSB_PSEPK  RecName: Full=3-deoxy-manno-octulosona...  80.1    6e-15 Gene info
sp|A1IQS6.1|KDSB_NEIMA  RecName: Full=3-deoxy-manno-octulosona...  79.7    7e-15
sp|Q21J11.1|KDSB_SACD2  RecName: Full=3-deoxy-manno-octulosona...  79.7    8e-15 Gene info
sp|Q74BY2.2|KDSB_GEOSL  RecName: Full=3-deoxy-manno-octulosona...  79.3    8e-15
sp|B2HZD0.1|KDSB_ACIBC  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15 Gene info
sp|B1KDR7.1|KDSB_SHEWM  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15 Gene info
sp|Q3IGX8.1|KDSB_PSEHT  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15
sp|B7H3M4.1|KDSB_ACIB3  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15 Gene info
sp|B7J514.1|KDSB_ACIF2  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15 Gene info
sp|Q5N120.1|KDSB_SYNP6  RecName: Full=3-deoxy-manno-octulosona...  79.3    9e-15 Gene info
sp|A5EW69.1|KDSB_DICNV  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-14 Gene info
sp|C6E0M8.1|KDSB_GEOSM  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-14
sp|Q1GZI3.1|KDSB_METFK  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-14 Gene info
sp|A8FW10.1|KDSB_SHESH  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-14 Gene info
sp|Q0HJ42.1|KDSB_SHESM  RecName: Full=3-deoxy-manno-octulosona...  79.3    1e-14 Gene info
sp|A6VUC8.1|KDSB_MARMS  RecName: Full=3-deoxy-manno-octulosona...  79.0    1e-14 Gene info
sp|A1AXA1.1|KDSB_RUTMC  RecName: Full=3-deoxy-manno-octulosona...  79.0    1e-14
sp|Q0BL48.1|KDSB_FRATO  RecName: Full=3-deoxy-manno-octulosona...  79.0    1e-14 Gene info
sp|A3D555.1|KDSB_SHEB5  RecName: Full=3-deoxy-manno-octulosona...  79.0    1e-14 Gene info
sp|A9L3N6.1|KDSB_SHEB9  RecName: Full=3-deoxy-manno-octulosona...  78.6    1e-14 Gene info
sp|B5E8N2.1|KDSB_GEOBB  RecName: Full=3-deoxy-manno-octulosona...  78.6    2e-14
sp|B8GR40.1|KDSB_THISH  RecName: Full=3-deoxy-manno-octulosona...  78.6    2e-14
sp|A6WNW2.1|KDSB_SHEB8  RecName: Full=3-deoxy-manno-octulosona...  78.6    2e-14 Gene info
sp|A3M4Z0.2|KDSB_ACIBT  RecName: Full=3-deoxy-manno-octulosona...  78.6    2e-14 Gene info
sp|Q39W63.1|KDSB_GEOMG  RecName: Full=3-deoxy-manno-octulosona...  78.6    2e-14 Gene info
sp|B0TVJ0.1|KDSB_SHEHH  RecName: Full=3-deoxy-manno-octulosona...  78.2    2e-14 Gene info
sp|B0SA58.1|KDSB_LEPBA  RecName: Full=3-deoxy-manno-octulosona...  78.2    2e-14 Gene info
sp|Q5P107.1|KDSB_AZOSE  RecName: Full=3-deoxy-manno-octulosona...  78.2    2e-14 Gene info
sp|A0Q5R0.1|KDSB_FRATN  RecName: Full=3-deoxy-manno-octulosona...  78.2    2e-14 Gene info
sp|Q8EEA9.1|KDSB_SHEON  RecName: Full=3-deoxy-manno-octulosona...  77.8    2e-14
sp|A4W8T7.1|KDSB_ENT38  RecName: Full=3-deoxy-manno-octulosona...  77.8    3e-14 Gene info
sp|A6L5J0.1|KDSB_BACV8  RecName: Full=3-deoxy-manno-octulosona...  77.8    3e-14 Gene info
sp|Q72UN2.1|KDSB_LEPIC  RecName: Full=3-deoxy-manno-octulosona...  77.8    3e-14
sp|B4SES6.1|KDSB_PELPB  RecName: Full=3-deoxy-manno-octulosona...  77.8    3e-14 Gene info
sp|Q9Z8U9.1|KDSB_CHLPN  RecName: Full=3-deoxy-manno-octulosona...  77.8    3e-14
sp|A8ZWH0.1|KDSB_DESOH  RecName: Full=3-deoxy-manno-octulosona...  77.4    3e-14 Gene info
sp|Q5NEX8.1|KDSB_FRATT  RecName: Full=3-deoxy-manno-octulosona...  77.4    3e-14
sp|Q2A2J8.1|KDSB_FRATH  RecName: Full=3-deoxy-manno-octulosona...  77.4    4e-14
sp|Q14GD1.1|KDSB_FRAT1  RecName: Full=3-deoxy-manno-octulosona...  77.4    4e-14 Gene info
sp|P42216.3|KPSU5_ECOLX  RecName: Full=3-deoxy-manno-octuloson...  77.4    4e-14
sp|A1VNK3.1|KDSB_POLNA  RecName: Full=3-deoxy-manno-octulosona...  77.4    4e-14 Gene info
sp|A3QE24.1|KDSB_SHELP  RecName: Full=3-deoxy-manno-octulosona...  77.4    4e-14 Gene info
sp|Q5F9Y9.1|KDSB_NEIG1  RecName: Full=3-deoxy-manno-octulosona...  77.0    4e-14 Gene info
sp|C5BL28.1|KDSB_TERTT  RecName: Full=3-deoxy-manno-octulosona...  76.6    5e-14
sp|A9BWI2.1|KDSB_DELAS  RecName: Full=3-deoxy-manno-octulosona...  76.6    6e-14 Gene info
sp|B3EG58.1|KDSB_CHLL2  RecName: Full=3-deoxy-manno-octulosona...  76.3    7e-14 Gene info
sp|Q30V56.1|KDSB_DESDG  RecName: Full=3-deoxy-manno-octulosona...  75.9    9e-14
sp|B2SG51.1|KDSB_FRATM  RecName: Full=3-deoxy-manno-octulosona...  75.9    1e-13 Gene info
sp|B4SQQ0.1|KDSB_STRM5  RecName: Full=3-deoxy-manno-octulosona...  75.9    1e-13 Gene info
sp|Q2LY80.1|KDSB_SYNAS  RecName: Full=3-deoxy-manno-octulosona...  75.9    1e-13
sp|A4G7X9.1|KDSB_HERAR  RecName: Full=3-deoxy-manno-octulosona...  75.9    1e-13
sp|B8FKL0.1|KDSB_DESAA  RecName: Full=3-deoxy-manno-octulosona...  75.5    1e-13 Gene info
sp|C5CKW0.1|KDSB_VARPS  RecName: Full=3-deoxy-manno-octulosona...  75.5    1e-13
sp|A5G5T4.1|KDSB_GEOUR  RecName: Full=3-deoxy-manno-octulosona...  75.5    2e-13 Gene info
sp|Q0A8Q5.1|KDSB_ALHEH  RecName: Full=3-deoxy-manno-octulosona...  75.5    2e-13 Gene info
sp|Q8PKS3.1|KDSB_XANAC  RecName: Full=3-deoxy-manno-octulosona...  75.1    2e-13
sp|B0U330.1|KDSB_XYLFM  RecName: Full=3-deoxy-manno-octulosona...  74.7    2e-13 Gene info
sp|Q6MD00.1|KDSB_PARUW  RecName: Full=3-deoxy-manno-octulosona...  74.7    2e-13 Gene info
sp|Q87BW1.1|KDSB_XYLFT  RecName: Full=3-deoxy-manno-octulosona...  74.7    2e-13
sp|B2I6C4.1|KDSB_XYLF2  RecName: Full=3-deoxy-manno-octulosona...  74.7    2e-13 Gene info
sp|B3EMY6.1|KDSB_CHLPB  RecName: Full=3-deoxy-manno-octulosona...  74.7    2e-13 Gene info
sp|A5WF97.1|KDSB_PSYWF  RecName: Full=3-deoxy-manno-octulosona...  74.3    3e-13 Gene info
sp|Q7M829.1|KDSB_WOLSU  RecName: Full=3-deoxy-manno-octulosona...  74.3    3e-13
sp|Q1QBV8.1|KDSB_PSYCK  RecName: Full=3-deoxy-manno-octulosona...  74.3    3e-13 Gene info
sp|B9M9Q4.1|KDSB_GEOSF  RecName: Full=3-deoxy-manno-octulosona...  73.9    4e-13
sp|A1BI64.1|KDSB_CHLPD  RecName: Full=3-deoxy-manno-octulosona...  73.9    4e-13 Gene info
sp|Q5H0H2.1|KDSB_XANOR  RecName: Full=3-deoxy-manno-octulosona...  73.6    5e-13
sp|Q3SIR7.1|KDSB_THIDA  RecName: Full=3-deoxy-manno-octulosona...  73.6    5e-13 Gene info
sp|Q254V8.1|KDSB_CHLFF  RecName: Full=3-deoxy-manno-octulosona...  73.2    7e-13 Gene info
sp|Q9PB46.1|KDSB_XYLFA  RecName: Full=3-deoxy-manno-octulosona...  73.2    7e-13
sp|B0RSI0.1|KDSB_XANCB  RecName: Full=3-deoxy-manno-octulosona...  72.8    8e-13 Gene info
sp|Q4UV63.1|KDSB_XANC8  RecName: Full=3-deoxy-manno-octulosona...  72.8    9e-13
sp|Q1QX66.1|KDSB_CHRSD  RecName: Full=3-deoxy-manno-octulosona...  72.4    1e-12 Gene info
sp|Q3BTC6.2|KDSB_XANC5  RecName: Full=3-deoxy-manno-octulosona...  72.4    1e-12 Gene info
sp|Q5L5S2.1|KDSB_CHLAB  RecName: Full=3-deoxy-manno-octulosona...  72.4    1e-12
sp|A6GYA2.1|KDSB_FLAPJ  RecName: Full=3-deoxy-manno-octulosona...  72.4    1e-12 Gene info
sp|Q0AST1.1|KDSB_MARMM  RecName: Full=3-deoxy-manno-octulosona...  72.0    1e-12 Gene info
sp|B2TAY9.1|KDSB2_BURPP  RecName: Full=3-deoxy-manno-octuloson...  72.0    2e-12 Gene info
sp|B0U168.1|KDSB_FRAP2  RecName: Full=3-deoxy-manno-octulosona...  71.6    2e-12 Gene info
sp|Q8RFA8.1|KDSB_FUSNN  RecName: Full=3-deoxy-manno-octulosona...  71.6    2e-12
sp|Q0B295.1|KDSB2_BURCM  RecName: Full=3-deoxy-manno-octuloson...  71.6    2e-12 Gene info
sp|Q3B604.1|KDSB_PELLD  RecName: Full=3-deoxy-manno-octulosona...  71.6    2e-12 Gene info
sp|Q822T3.1|KDSB_CHLCV  RecName: Full=3-deoxy-manno-octulosona...  71.6    2e-12
sp|Q3ATT2.1|KDSB_CHLCH  RecName: Full=3-deoxy-manno-octulosona...  71.2    3e-12 Gene info
sp|Q083F6.1|KDSB_SHEFN  RecName: Full=3-deoxy-manno-octulosona...  71.2    3e-12 Gene info
sp|A1STD0.1|KDSB_PSYIN  RecName: Full=3-deoxy-manno-octulosona...  70.9    4e-12
sp|Q1CUS2.1|KDSB_HELPH  RecName: Full=3-deoxy-manno-octulosona...  70.5    4e-12 Gene info
sp|Q83E52.3|KDSB_COXBU  RecName: Full=3-deoxy-manno-octulosona...  70.5    4e-12
sp|Q6MPP1.1|KDSB_BDEBA  RecName: Full=3-deoxy-manno-octulosona...  70.1    5e-12
sp|A9NBW9.1|KDSB_COXBR  RecName: Full=3-deoxy-manno-octulosona...  70.1    6e-12
sp|B4S4I2.1|KDSB_PROA2  RecName: Full=3-deoxy-manno-octulosona...  69.7    7e-12
sp|Q4FS44.1|KDSB_PSYA2  RecName: Full=3-deoxy-manno-octulosona...  69.7    8e-12 Gene info
sp|B6J8F8.2|KDSB_COXB1  RecName: Full=3-deoxy-manno-octulosona...  69.7    8e-12
sp|B3QL08.1|KDSB_CHLP8  RecName: Full=3-deoxy-manno-octulosona...  69.3    9e-12 Gene info
sp|Q8KBF7.1|KDSB_CHLTE  RecName: Full=3-deoxy-manno-octulosona...  69.3    1e-11
sp|B1Z3N9.1|KDSB2_BURA4  RecName: Full=3-deoxy-manno-octuloson...  68.9    1e-11 Gene info
sp|O66914.1|KDSB_AQUAE  RecName: Full=3-deoxy-manno-octulosona...  68.6    2e-11
sp|O25016.1|KDSB_HELPY  RecName: Full=3-deoxy-manno-octulosona...  67.4    4e-11
sp|A0M2E8.1|KDSB_GRAFK  RecName: Full=3-deoxy-manno-octulosona...  67.4    4e-11 Gene info
sp|Q9ZMK4.1|KDSB_HELPJ  RecName: Full=3-deoxy-manno-octulosona...  67.4    4e-11 Gene info
sp|B5Z9Z7.1|KDSB_HELPG  RecName: Full=3-deoxy-manno-octulosona...  67.0    4e-11
sp|Q17YX7.1|KDSB_HELAH  RecName: Full=3-deoxy-manno-octulosona...  67.0    5e-11 Gene info
sp|A6Q3P4.1|KDSB_NITSB  RecName: Full=3-deoxy-manno-octulosona...  66.2    9e-11
sp|A8H420.1|KDSB_SHEPA  RecName: Full=3-deoxy-manno-octulosona...  65.5    1e-10 Gene info
sp|B6JKG1.1|KDSB_HELP2  RecName: Full=3-deoxy-manno-octulosona...  65.5    1e-10
sp|B8DIL4.1|KDSB_DESVM  RecName: Full=3-deoxy-manno-octulosona...  65.1    2e-10 Gene info
sp|Q31H18.1|KDSB1_THICR  RecName: Full=3-deoxy-manno-octuloson...  62.8    8e-10 Gene info
sp|Q31DP4.1|KDSB2_THICR  RecName: Full=3-deoxy-manno-octuloson...  60.8    4e-09 Gene info
sp|A5FBA3.1|KDSB_FLAJ1  RecName: Full=3-deoxy-manno-octulosona...  59.7    9e-09 Gene info
sp|Q8D2V1.2|KDSB_WIGBR  RecName: Full=3-deoxy-manno-octulosona...  58.2    2e-08 Gene info
sp|Q39M82.1|KDSB2_BURS3  RecName: Full=3-deoxy-manno-octuloson...  57.0    5e-08 Gene info
sp|B2US61.1|KDSB_HELPS  RecName: Full=3-deoxy-manno-octulosona...  56.6    6e-08
sp|A2BVS4.1|GLMU_PROM5  RecName: Full=Bifunctional protein glm...  33.9    0.43  Gene info
sp|Q8XHJ3.1|GLMU_CLOPE  RecName: Full=Bifunctional protein glm...  32.0    1.5  
sp|Q0TMG3.1|GLMU_CLOP1  RecName: Full=Bifunctional protein glm...  32.0    1.6   Gene info
sp|O04195.2|Y2992_ARATH  RecName: Full=Uncharacterized protein...  31.6    2.0   Gene info
sp|Q97E92.1|GLMU_CLOAB  RecName: Full=Bifunctional protein glm...  30.4    4.5  
sp|Q5KFE0.1|ATM_CRYNE  RecName: Full=Serine/threonine-protein ...  30.0    5.7  
sp|Q8P8W4.1|MSBA_XANCP  RecName: Full=Lipid A export ATP-bindi...  30.0    5.9  
sp|Q87KB0.1|GLMU_VIBPA  RecName: Full=Bifunctional protein glm...  29.6    7.7  
sp|Q6D2F0.1|ARNC_ERWCT  RecName: Full=Undecaprenyl-phosphate 4...  29.6    8.7  
sp|P25455.3|PIP1_DROME  RecName: Full=1-phosphatidylinositol-4...  29.6    9.1  
sp|A6LTL5.1|THIG_CLOB8  RecName: Full=Thiazole biosynthesis pr...  29.3    9.7   Gene info


Alignments 

>sp|Q6N3J9.1|KDSB_RHOPA  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=245

 Score =  131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 102/173 (58%), Gaps = 14/173 (8%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DR++E  +  L+ + KI  ++NLQGD P I PE I  +++ +     +I TLA++I +
Sbjct  78   GSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLEPLADPAVDIATLAAEIHT  136

Query  59   NEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALS  113
             EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   AL 
Sbjct  137  EEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRAALE  190

Query  114  RYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  191  RFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>sp|Q11AX2.1|KDSB_MESSB  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=251

 Score =  131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 100/174 (57%), Gaps = 6/174 (3%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E  +  +  A  +I++NLQGD+P I PE I  +V  +     +I TL  +IS  
Sbjct  75   GSDRIFEALQTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEISDE  134

Query  60   EELENENVVKVLVKEKLKTG---MYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  115
            EE  N NVVK+ V   +KT    + ++AL F R        P +HHIGIYA+  +AL R+
Sbjct  135  EEKANPNVVKI-VGVPVKTASDALRLRALYFTRATAPWGEGPLFHHIGIYAYRRRALERF  193

Query  116  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTN  169
            V L    LE+  +LEQLRA+E GM I    V S PL VDT  DLE  ++++   
Sbjct  194  VALPPGTLEMRERLEQLRALEAGMRIEAEIVRSVPLGVDTPADLERARQLLSAR  247


>sp|B3QGN5.1|KDSB_RHOPT Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=245

 GENE ID: 6411900 Rpal_4216 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Rhodopseudomonas palustris TIE-1]

 Score =  130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 101/173 (58%), Gaps = 14/173 (8%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DR++E  +  L+ + KI  ++NLQGD P I PE I  ++  +     +I TLA++I +
Sbjct  78   GSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLGPLADPAVDIATLAAEIHT  136

Query  59   NEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALS  113
             EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   AL 
Sbjct  137  EEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRAALE  190

Query  114  RYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  191  RFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>sp|Q2IZ84.2|KDSB_RHOP2  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=245

 Score =  128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E  +  +     + ++NLQGD P I PE I  ++  ++    +I TLA++I + 
Sbjct  78   GSDRIHEALQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEIHTE  137

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVKV V   + T   ++AL F R        P YHHIG+YA+   AL R+V L
Sbjct  138  EESTNPNVVKV-VGSHIGT-TRLRALYFTRATAPWGDGPRYHHIGLYAYRRAALERFVAL  195

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++++
Sbjct  196  PPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRVL  243


>sp|A5ERZ6.1|KDSB_BRASB Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=246

 GENE ID: 5152257 kdsB | 3-deoxy-manno-octulosonate cytidylyltransferase
[Bradyrhizobium sp. BTAi1] (10 or fewer PubMed links)

 Score =  127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 10/171 (5%)

Query  1    GTDRVYEV-FKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR+YE   K +     +I+VNLQGD P ILP+ I +++  ++    +I TLA++I + 
Sbjct  78   GSDRIYEASCKLDPAGEAEIVVNLQGDFPTILPQNIRDVLLPLSDPAVDIATLAAQIHTA  137

Query  60   EELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  115
            EE    +VVK +   + E+      ++AL F R        P YHHIG+YA+   AL R+
Sbjct  138  EEDAAPSVVKAVGSPIGER-----RLRALYFTRATAPHGDGPRYHHIGLYAYRRAALERF  192

Query  116  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            V L  S LE++ KLEQLRA+E GM I +G V++ P  VDT  DLE  ++++
Sbjct  193  VSLPPSPLELQEKLEQLRALEAGMRIDIGIVDTVPRGVDTPPDLETARRLL  243


>sp|Q1QR80.1|KDSB_NITHX Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=258

 GENE ID: 4030262 Nham_0376 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Nitrobacter hamburgensis X14]

 Score =  126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 101/171 (59%), Gaps = 6/171 (3%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DRV+E   + L+ + +I  I+NLQGD P I P+ I +++  +     +I TLA++I S
Sbjct  78   GSDRVFEAL-DRLDPDGRIETIINLQGDFPTIRPDIIRDVLKPLADPAVDIATLAAEIHS  136

Query  59   NEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVG  117
            +EE  N NVVK +          ++AL F R        P YHHIG+YA+  KAL R+V 
Sbjct  137  DEEATNPNVVKAVGSPVAP--RRLRALYFTRATAPHGDGPRYHHIGLYAYRRKALQRFVE  194

Query  118  LKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKT  168
            L  S LE + +LEQLRA+E GM I +  V+  P  VDT  DLE  ++I+ +
Sbjct  195  LPPSPLERQERLEQLRALEGGMRIDIMIVDDVPRGVDTAADLETARRILAS  245


>sp|A4YLY9.2|KDSB_BRASO  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=246

 Score =  125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR+YE   K +       +VNLQGD P I P +I++++  ++    +I TLA++I + 
Sbjct  78   GSDRIYEALCKLDPAGEADFVVNLQGDFPTIDPRSISDVLPPLDDPAVDIATLAAQIHTE  137

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVK  V   L  G  ++AL F R        P YHHIG+YA+   AL R+V L
Sbjct  138  EESLNPNVVKA-VGSPLG-GRRMRALYFTRATAPHGDGPRYHHIGLYAYRRAALERFVRL  195

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE + KLEQLRA+E GM I V  V++ P  VDT  DLE  ++++
Sbjct  196  PPSPLEQQEKLEQLRALEAGMRIDVMVVDAVPRGVDTPADLETARRLL  243


>sp|Q133H9.1|KDSB_RHOPS Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=245

 GENE ID: 4024051 RPD_3537 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Rhodopseudomonas palustris BisB5]

 Score =  125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 100/169 (59%), Gaps = 6/169 (3%)

Query  1    GTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS  58
            G+DR++E  +  L+   +I  ++NLQGD P I PE I  ++  +     +I TLA++I +
Sbjct  78   GSDRIHEALQT-LDPERRIETVINLQGDFPTIRPEQIGAVLAPLADPAVDIATLAAEIHT  136

Query  59   NEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVG  117
             EE  N NVVKV V   ++  + ++AL F R        P YHHIG+YA+   AL R+V 
Sbjct  137  EEESTNPNVVKV-VGSPIRDNL-LRALYFTRATAPYGDGPRYHHIGLYAYRRAALERFVS  194

Query  118  LKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
            L  S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++ +
Sbjct  195  LPPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRAL  243


>sp|A7HPP1.1|KDSB_PARL1 Gene info RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=258

 GENE ID: 5455077 Plav_0251 | 3-deoxy-manno-octulosonate cytidylyltransferase
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score =  125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 4/168 (2%)

Query  1    GTDRVYE-VFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DRV++ V + +   +  +I+N+QGD+P + P  I    + + +   +I TLA+ I+  
Sbjct  88   GSDRVWQAVCEVDPEGHHTVILNVQGDLPTLDPALIRTAYEALVRPGADISTLAATITVE  147

Query  60   EELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRYVGL  118
            EE  N NVVK +       G   +AL F R        P YHHIG+Y +  +AL+R+V L
Sbjct  148  EERTNPNVVKAVAS--FGEGRLARALYFTRATAPWGEGPLYHHIGLYGYRREALARFVAL  205

Query  119  KRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  166
              S LE+  KLEQLRA+E GM+I V  V++ PL VDT  DLE+ +  +
Sbjct  206  PPSPLEVREKLEQLRALEAGMAIEVALVDTVPLGVDTPADLEKARAAL  253


>sp|A8IGU8.2|KDSB_AZOC5  RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-KDO synthetase; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthetase; Short=CKS
Length=250

 Score =  125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 101/175 (57%), Gaps = 10/175 (5%)

Query  1    GTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSN  59
            G+DR++E     + +   +++VN+QGD+P I PETI   +  + +G  +I TL + I+  
Sbjct  80   GSDRIFEALGVLDPDGAVQVVVNVQGDLPTIAPETIRAALVPLEEGPADIATLTAVITEE  139

Query  60   EELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  115
             E  + NVVKV+   + E       ++AL F R        P YHHIG+YA+   AL R+
Sbjct  140  GERTDPNVVKVVGTPIGEN-----RLRALYFTRATAPTGEGPLYHHIGLYAYRRAALERF  194

Query  116  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND  170
            V L  S LE   +LEQLRA+E GM I V  V++ PL VDT E LE  + ++ +ND
Sbjct  195  VSLPPSPLEKRERLEQLRALEAGMRIDVAVVDAVPLGVDTPEHLERARALLASND  249