GOS 1102030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343582136
Annotathon code: GOS_1102030
Sample :
  • GPS :18°2'12n; 83°47'5w
  • Caribbean Sea: Rosario Bank - Honduras
  • Open Ocean (-1.7m, 27.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : ma-cha
Annotated on : 2010-01-12 17:30:06
  • Mateo Marie claire
  • Viant Charlotte

Synopsis

  • Taxonomy: Rhodobacterales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 204455
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rhodobacterales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;

Genomic Sequence

>JCVI_READ_1092343582136 GOS_1102030 Genomic DNA
TTATTTTGGACAGGTGTTCTCACAATTCTAATTAATCTAGTAATGGCAAGTGCATTTGCTTCTATTCTGATTTATGCAATAGATCTATTACCAAATAGAA
TTGGATTAATAGGAGGTTTATTTTATGGACTGAATTTTGGTCTAGGCGGAATTGCTGCAGGATTTTTAGGTGTTCTTACTGAAAAATATGGGATAGAAAA
CACATATTTAATTTGCTCCTTTATGCCATTTGCAGGATTAATGGTTTGGTTTCTTCCTCGTACGGATAATAAATTGAAATAAAAAAATCTTTTTAATCAT
TAATAAGTTTTAGAAGTATAATTTTCTGTTAATTTACTTTGTTTCTGCAAAAGCAACTGGAATTTATAACAATATCAGTTCTGGCTTTTGCTTGATTTAA
CAATAGTTCTACATGAGGTAATTCTACGGTATCTTTTCGGATAAACAAACACTCATGTAGACCATGTAAAGACCAAACATTTTTTGGATTTTGACAAGGG
CGTGGAAGTTTACCATCTAATCCTAAATCTGCTCTGAAAACAGTTTCAGCTTCGTCGAACTCTCCTGCAGCCATTAGTAAGGCTCCAAGTGCATGACGAG
TTGGTTGAGGCCAACACCAAGGTTCTTCATAAGCTAATCCATCATCAAGTTTAACAGCTTTTCTTAAATGTGATAATCCAATTTTAAGATTTCCAGCTTT
AAATTCTATTTCACCAATCATCATCTCCTGAGCTATAGCCAGTACATCTCTAGATTTATTATTAAATAACATTCGACTGTCTGGAACTAGTTCATAAGAT
TTTAAAAATTTGCTAGAAAAATTTTTGCTTCACTTATTCTATTTAAATTCGCTAA

Translation

[27 - 524/855]   indirect strand
>GOS_1102030 Translation [27-524   indirect strand]
SKNFSSKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRA
DLGLDGKLPRPCQNPKNVWSLHGLHECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFCRNKVN

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

L'étude de cette séquence GOS_1102030 nous a permis d'identifier 2 ORF et nous nous sommes appuyé sur la plus longue d'entre elles (501 nucléotides) pour analyser notre séquence.

Nous avons donc un ORF, identifié dans le cadre de lecture 3 du sens indirect, de 166 acides aminés qui est complet en 3', mais pas en 5' (comme le laisse supposer l'alignement multiple).

L'ORF étant incomplet nous n'avons pas pu calculer son poids moléculaire.


L'analyse de l'ORF par interproscan ne nous a pas permis d'identifier de domaine protéique.


En faisant un BLASTp contre NR nous avons pu identifier de nombreuses séquences similaires à la notre. Celle ayant la meilleur E-value (10e-52) correspond à un domaine protéique de chez Citreicella. Nous avons établie un seuil de E-value à 10^-4 donc toutes les séquences dont le score est supérieur à ce seuil ne sont pas considérées comme homologue à la notre. Parmi les séquences ayant les meilleurs E-value, beaucoup correspondent à un domaine protéique TPR qui permet une intéraction protéine-protéine.

Le BLASTp contre swissprot n'a montrer aucun homologue.


Au vue des résultats du BLAST nous avons établi un 1er groupe taxonomique: groupe d'étude les protéobactéries et comme groupe extérieur: les autres bactéries. Mais les arbres obtenus ont donné peut d'information et n'avaient pas la même organisation que l'arbre de référence (phylogénie inférée). Nous avons quand même pu identifier que notre séquence émergée parmi des alphasprotéobactéries. De plus, celles ci ont obtenue les meilleurs scores. Nous avons donc établi un nouveau rapport taxonomique avec comme groupe d'étude les alphaprotéobactéries et comme groupe extérieur les béta et les gammaprotéobactéries. Cette fois les arbres obtenus ont mit en évidence que notre séquence appartient surement aux alphaprotéobactéries et plus précisément aux Rhodobacteraceaes car elle en est entourée.

Pour confirmer cette hypothèse nous avons construit un troisième rapport taxonomique et l'arbre qui en découle rassemble sur une même branche notre séquence et toutes les Rhodobacteraceaes.


L'alignement multiple a mit en évidence que notre ORF a de nombreuses régions similaires avec les autres mais qu'elle commence plus tard car elle est beaucoup plus courte.

Comme nous n'avions pas pu identifier le codon START de notre ORF, nous pouvons alors supposer que les codons stop qui se trouvent immédiatement en aval du premier codon de notre ORF sont en réalité dû à une erreur de séquançage et donc que l'ORF est incomplet en 5'.


Aucun des homologues identifiés ne nous a permis d'obtenir des informations sur le processus biologique dans lequel interviendrait la protéine pour laquelle code notre séquence.


Nous avons identifié une séquence codante de 501 nucléotides (166 acides aminés) dans le cadre de lecture 3 du sens indirect qui est complète en 3' mais pas en 5', qui provient surement d'une bactérie de la famille des Rhodobacteraceaes et qui code pour une protéine qui interagi peut être avec une autre protéine par l'intermédiaire d'un domaine TPR.



ORF finding

PROTOCOLE:

a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'

b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


ANALYSE DES RÉSULTATS:



Nous avons obtenue deux ORF possibles, une dans le sens direct (de 282 nucléotides) et une dans le sens indirect (de 501 nucléotides) toutes deux faisant plus de 60 codons elles peuvent être considérée comme codantes. La seconde étant plus grande que la deuxième, c'est avec elle que nous allons continuer l'annotation de cette séquence.

C'est une séquence de 501 nucléotides(166 Acides aminées plus le codon STOP) obtenue dans le cadre de lecture 3 du sens indirect.

Cette ORF est complet en 3'car il y a un codon STOP.

En 5' juste avant le premier codon il y a un codon STOP donc on pourrait supposer que l'ORF est complet. Cependant dans l'alignement multiple les séquences homologues à la notre ne débutent pas au niveau de la première méthionine de la séquence protéique de notre ORF mais bien avant. On peut alors supposer que le codon STOP qui se trouve juste avant le début de notre ORF est en faite dû à une erreur de séquençage et donc que notre ORF est incomplet en 5'.


Nous avons donc une ORF de 166 acides aminés obtenue dans le cadre de lecture 3 du sens indirect qui est complet en 3' mais pas en 5'.

L'ORF étant incomplet, nous ne pouvons pas calculer son poids moléculaire.


>ORF number 1 in reading frame 3 on the reverse strand extends from base 27 to base 527.

AGCAAAAATTTTTCTAGCAAATTTTTAAAATCTTATGAACTAGTTCCAGACAGTCGAATG

TTATTTAATAATAAATCTAGAGATGTACTGGCTATAGCTCAGGAGATGATGATTGGTGAA

ATAGAATTTAAAGCTGGAAATCTTAAAATTGGATTATCACATTTAAGAAAAGCTGTTAAA

CTTGATGATGGATTAGCTTATGAAGAACCTTGGTGTTGGCCTCAACCAACTCGTCATGCA

CTTGGAGCCTTACTAATGGCTGCAGGAGAGTTCGACGAAGCTGAAACTGTTTTCAGAGCA

GATTTAGGATTAGATGGTAAACTTCCACGCCCTTGTCAAAATCCAAAAAATGTTTGGTCT

TTACATGGTCTACATGAGTGTTTGTTTATCCGAAAAGATACCGTAGAATTACCTCATGTA

GAACTATTGTTAAATCAAGCAAAAGCCAGAACTGATATTGTTATAAATTCCAGTTGCTTT

TGCAGAAACAAAGTAAATTAA



>Translation of ORF number 1 in reading frame 3 on the reverse strand.

SKNFSSKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVK

LDDGLAYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWS

LHGLHECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFCRNKVN*

RÉSULTATS BRUTS:

a)
>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 282.
TTATTTTGGACAGGTGTTCTCACAATTCTAATTAATCTAGTAATGGCAAGTGCATTTGCT
TCTATTCTGATTTATGCAATAGATCTATTACCAAATAGAATTGGATTAATAGGAGGTTTA
TTTTATGGACTGAATTTTGGTCTAGGCGGAATTGCTGCAGGATTTTTAGGTGTTCTTACT
GAAAAATATGGGATAGAAAACACATATTTAATTTGCTCCTTTATGCCATTTGCAGGATTA
ATGGTTTGGTTTCTTCCTCGTACGGATAATAAATTGAAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LFWTGVLTILINLVMASAFASILIYAIDLLPNRIGLIGGLFYGLNFGLGGIAAGFLGVLT
EKYGIENTYLICSFMPFAGLMVWFLPRTDNKLK*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

b)
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 27 to base 527.
AGCAAAAATTTTTCTAGCAAATTTTTAAAATCTTATGAACTAGTTCCAGACAGTCGAATG
TTATTTAATAATAAATCTAGAGATGTACTGGCTATAGCTCAGGAGATGATGATTGGTGAA
ATAGAATTTAAAGCTGGAAATCTTAAAATTGGATTATCACATTTAAGAAAAGCTGTTAAA
CTTGATGATGGATTAGCTTATGAAGAACCTTGGTGTTGGCCTCAACCAACTCGTCATGCA
CTTGGAGCCTTACTAATGGCTGCAGGAGAGTTCGACGAAGCTGAAACTGTTTTCAGAGCA
GATTTAGGATTAGATGGTAAACTTCCACGCCCTTGTCAAAATCCAAAAAATGTTTGGTCT
TTACATGGTCTACATGAGTGTTTGTTTATCCGAAAAGATACCGTAGAATTACCTCATGTA
GAACTATTGTTAAATCAAGCAAAAGCCAGAACTGATATTGTTATAAATTCCAGTTGCTTT
TGCAGAAACAAAGTAAATTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
SKNFSSKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVK
LDDGLAYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWS
LHGLHECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFCRNKVN*




Multiple Alignement

PROTOCOLE:

a)Résultats du BLAST format FASTA, analyse dans Phylogeny.fr, option "A la carte mode" avec les paramètres par défaut sauf step by step, puis CLUSTAL.(groupe d'étude:les alfa-protéobactéries. groupe extérieur:les béta et les gamma-protéobactéries)


ANALYSE DES RÉSULTATS:


On constate qu'il y a de nombreux domaines similaires entre les séquences choisies et notre ORF qui s'intègre correctement parmi les homologues, mais notre séquence est plus courte et elle commence bien plus tard que les autres séquences.

De ce fait on peut supposer qu'une erreur de séquençage a introduit un codon STOP ce qui aurait raccourci la séquence en 5'. Notre ORF est donc incomplet en 5'.


RÉSULTATS BRUTS:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Betaprot1       ----------------------------------------------------MTLGRKHA
Translatio      ------------------------------------------------------------
Alphapro2       ------------------------------------------------------------
Alphapro1       ------------------------------------------------------------
Alphapro7       ------------------------------------------------------------
Alphapro8       ------------------------------------------------------------
Alphapro3       ------------------------------------------------------------
Alphapro5       ------------------------------------------------------------
Alphapro4       ------------------------------------------------------------
Alphapro6       ------------------------------------------------------------
Alphapro12      ------------------------------------------------------------
Alphapro11      ------------------------------------------------------------
Alphapro13      ------------------------------------------------------------
Gammapro1       --------------------------------------------------MASRLQKPFW
Gammapro2       MKAVKQLFIALDAVSLHIKI------------------------------DLNNAFRFHF
Gammapro3       ----------------------------------------------MSRIKLIKRVRALF
Alphapro14      MARSPFLLAIG---------------------------------------ASAVAGAALF
Betaprot3       MLKRKLLITTLIGAGLIGTMAFDEYQAWR---------------------TADASALLTT
Betaprot2       --------------------------------------------------MKTRAFNSLV
Betaprot4       MLVHERWFSTVFPAMYKKLTWLYRFSANRRQVAIVIAQWQFIQGVYIMQFYAAVRFTLFI
Gammapro4       ----------------------------------------------------MALGALLA
Alphapro10      ----------------------------------------------MKTRYLLASASVFA
                                                                            

Betaprot1       VGM---------------------------------------------------------
Translatio      ------------------------------------------------------------
Alphapro2       ------------------------------------------------------------
Alphapro1       ------------------------------------------------------------
Alphapro7       ------------------------------------------------------------
Alphapro8       ------------------------------------------------------------
Alphapro3       ------------------------------------------------------------
Alphapro5       ------------------------------------------------------------
Alphapro4       ------------------------------------------------------------
Alphapro6       ------------------------------------------------------------
Alphapro12      ------------------------------------------------------------
Alphapro11      ------------------------------------------------------------
Alphapro13      ------------------------------------------------------------
Gammapro1       SGI-----------------ALGWG-----------------------------------
Gammapro2       GRVKFEATPSSKSLAFALFCTLTFIGCSSNTAEAPLARHASSAQNHSIANVNEPSE----
Gammapro3       ASF--------------LICAVAYVTNAEHPMN---------------------------
Alphapro14      ASV--------------PPQEAKPSQAELEILLDPRLVAQNQCGRGSRERAAFFKPSFQL
Betaprot3       IGV--------------PFCAPQRSGPQYKTFFRLAMAQAEGGREPARTEVGPFS-----
Betaprot2       VGL--------------LSAVVSVSCSTIQSDENAAGHHEKHEVSTVEHRSRELS-----
Betaprot4       LTL--------------ILASISESFAEAESSEDIRQKQLAAGESEREHQHHVAS-----
Gammapro4       LGM---------------------------------------------------------
Alphapro10      LGG--------------CQTIHDWFNPKTEESALATPVEAEAEEVDLATRAG--------
                                                                            

Betaprot1       ------------GSRNMGDY-LAQDARIERITVRDPEARTWFDRGLLWAYGFNFEAAVDC
Translatio      ------------------------------------------------------------
Alphapro2       -----------------MGY-FDLGTWSRKVTTDNPEAQLWFDRGLNWLYGFNHEEAIIC
Alphapro1       -----------------MER-YDLGRFGRSVTTSSETAQLWFDQGLTWLYGYNHEAAARC
Alphapro7       ----------------MSDY-YNLGTYSCAVTTRSPEAQLWFDRGLIWCFGYNHDEAVAC
Alphapro8       ----------------MSDY-YDLGDYSYAVSTQSPEAQTWFDRGVVWCFGYNHDEAIAC
Alphapro3       --------------MTMTDYGYDLGQYSCPVTTAAPEAQLWFDRGLIWTYGYNHAEAAAC
Alphapro5       ----------------MSDY-YDLGTHSCTITTTSPEAQLWFNRGLVWTYGYNHDEAVVC
Alphapro4       ----------------MRDY-YDLGDYTWPITTTAPEAQLWFDRGLIWTYAFNHAEAIQC
Alphapro6       -----------------MEYPYDLGSYSCPITTTSPLAQRWFDRGLIWTYGYNHQEAIAC
Alphapro12      -----------------MKYEFDLGPWTRSITTTSPEAQIWFDWGLNWTFAYNHEEAIAC
Alphapro11      -----------------MDR-FNLGSYRRPISTRSTETQRWFDIGLNWCYGFNHEEGIKC
Alphapro13      -----------------MDR-FNLGTYRRPISTRSTETQRWFDVGLNWCYGFNHEEGIKC
Gammapro1       --LAVAPGLVPAGDEGPILYYENLGDYSRAVTTDSESAQAWFDQGLRLAYGFARQAAADA
Gammapro2       --HALNIENNIFAGQIAPKL-SGMGEHGFYPSTGNEDAHVFFNQAIALTYGFNHLEAHRS
Gammapro3       --EGPKGGHNVFEGQIAPML-KGMGEHDFEISSKSRMAKIFFNQAIALTYGFNHLEAARS
Alphapro14      ALAASARAATNAADEKLPLW-PGLGDRTVRITTASEEAQIYFDQGFALLYGFNHWEAIRA
Betaprot3       --RAIPEAESIAGADANPLLMNNLGTLHYPITTSIPAAQQFFDQGLRLAYAFNHGEALRA
Betaprot2       --AL--ADQPLSGDQLASRL-QNLGTHSFPVSTQHEWAQLFINQGLSLAYGFNHAEAGRA
Betaprot4       --ES--EYKSGTDGQLAPRL-LNLGSHTFPVSTRNPLAQQYINQGLNLAYAFNHAEARRA
Gammapro4       ----ASVTFAQTGRSAVPLY-DNLGDHHYAITTASPLAQRYFDQGLRLYYAFNHQEAIRV
Alphapro10      ----------------APLF-DGMGDFHRPITTASPDAQKYFDQGMVLSFGFNHAESIRS
                                                                            

Betaprot1       FQEAARIDPDCVLAYWGIAYASGCNYNKQWKVFHPRMIARCMKLARDAIRRAQACRAGAS
Translatio      ------------------------------------------------------------
Alphapro2       FEKALQFDVDCLMAHWGIAHCIGPNYNKLWEFFSPEEKVAALDRAHLSLKQAAAVADRAT
Alphapro1       FRQALEADPDCAMAQWGIAAASGPNYNLPWEAMEPEDKAAALATAHAALE-AIGPDAAMS
Alphapro7       FLKAIDLDPDLAMAYWGVSYASGCNYNKPWAAFDDADMERSLARAFDYARRALAKSSGAS
Alphapro8       FLKAIEHDPNLAIAYWGVSYASGCNYNKPWEAFDDADMQLSLERAFDYSRRALEKAEHAS
Alphapro3       FRRALEHDPDCAMAHWGLAYASGPNYNMPWERWDSATRAEALATSYDASQAALARVAGGT
Alphapro5       FQQAAEHDPDCAMAHWGVAYAAGPNYNLPWELRDEQGQAKALGIAFDATQKALSLLDKCT
Alphapro4       FYKALEHDPHCAMAHWGVSYASGPNYNMPWELYDEAGRQAALETAYDFCRKANACSKTCS
Alphapro6       FKQALTHDPTCAMAHWGLAYASGPNYNMPWELHDQEGRASALATAYEASQAAVAHLAGCT
Alphapro12      FRRALEHDPECAMAWWGIAYAGGPFYNRAWIRFSDAEIEAVLPTCHAAAEAAKACAATAT
Alphapro11      FEKALETDPGCAMVHWGIAYAAGPFYNLTWKEHGEAEANSATKRCFEHVELARTHAAGAG
Alphapro13      FEKALETDPDCPMVHWGIAYAAGPFYNLTWKEHGEAEANSATKRCFEHVQQAHANAAAAS
Gammapro1       FLQATRHDPDCALCHWGAAWVLGPYQN---NPGGVGERAEA-AAAAQAALRALSRAEAVA
Gammapro2       FKQVAALDPRSAIAFWGQALVLGPNIN------GAMEPSAV-QPAHEAITQALALIEYAS
Gammapro3       YKQVALLDENSAMAYWGQALVLGPNIN------GAMEPDSV-KPAADAIAKAKTLKAHAT
Alphapro14      FQEAQRIDPGCAMCYWGEAKARGPNIN------APMDAGEE-NPAVAAIKKAKAFAGKAS
Betaprot3       FRKARTLDPECAMCYWGEALVLGPNIN------APMDPAAA-APAFEAVNKAQGLSARAS
Betaprot2       FQEAAQLDPGLAMAYWGQALVLGPNVN------ALMDPADE-PRALELVKQAESLMVSAS
Betaprot4       FREAARLEPDLAIAYWGQALVLGPNIN------AMMEPNEE-PNALKIMQKAKALMINAS
Gammapro4       FEEAVRLDPDCAMCYWGIALAQGPNIN------APMDASAG-AAAHAATRKALER--KAS
Alphapro10      FRAAQKLDPDCAMCYWGEALATGPNINVTSNGKAVMSMADR-EAAYTAVQKAMALRHTAS
                                                                            

Betaprot1       ALEMALVRAIECRFQAEGAHDEALLRRWNDDYARAMRDVYLSCPDNLDVAALFADALINR
Translatio      ----------SKNFSSK-------------------------------------------
Alphapro2       PAEHAILMALAARFPTDPA--IEDYGPWHDAFADEMRKIHAAFPTDLDVTALFAEALMNR
Alphapro1       PVEAQLVDALRKRFPTEPV---EDIAPFLDAYAAAMRALRAAHPEDCDVAALCAEAMMSR
Alphapro7       EVEAALILALQRRYQSAIAPGDEAFCVWNDDYADAMREVYARYANDLNVATFFCEAVMNR
Alphapro8       ELEAALISALAKRYQSAEVPGLEGFCVWNDDFADAMREVYTQFPDDLTVVTFFCEAIMNR
Alphapro3       PVEQALIRALPARYPQREL--DADMHRWDHDFADAMRAAFAAHPGHLDLRAIYAESLLNL
Alphapro5       PVEQALIRALPARYPQREP--IEDMHAWDYDFADAMRTAFADQPDQLDLRTIYVEALMNL
Alphapro4       QPEKLLIEALKDRYPQRDL--SDNMADWDRAFAETMRQAYNSCPDQLDICSLFAESLLTL
Alphapro6       VPETLLINALQARYPQRDL--AQDMHAWDFDFADAMRAAFGRCDSHLDLRTIYVESLLNL
Alphapro12      PPERALIAAIPLRYQSPFERDRETLNRWHRNFTDAMRGAHRDHPDDLDITALFAEAAITC
Alphapro11      EVERRLIEALASRFQKPQRVSPQEFEQWDDAYAGAMRRVYQDFPDDHDVMALLVEALMMR
Alphapro13      EIERALIEALAARFQKPQKVSPQEFEQWDDAYAAAMRLVYQDFPDDHDVMALLVEALMMR
Gammapro1       PWEQALVEAMAQRYPDG-----SDQAAATAPYAEAMERAAVAHPDDPDVQTLYAEALMMF
Gammapro2       PKEAALIHALRQRYSLDES--LSDRNRLDANYADAMRALVMEYPDDANLRTLLAEALMVI
Gammapro3       VKERDLIDALAARYSNDQT--MADRAELDMAYAAAMRALANKYPKDAHIKALLAEALMVI
Alphapro14      AKERALIEALALRYVADGE---ETRAELDKRYAEAMEKIHKRYPGDQDIAVLYAEAQMDL
Betaprot3       AKERALIEALTARYAREPQ---ADRTALDAAYAAAMQRVAERYPDDDQITLTYAESLMDR
Betaprot2       PREQALIRALKKRYSGA-D---EDRKANDKAYADAMREVYRSFPDDADIAVLYVESMMDL
Betaprot4       PKEQALISALEKRYSGR-A---EHREANDKAYAQAMKEVLQRFPHDEDVAMLYVESMMDL
Gammapro4       PKEQALIRALAARYASPPP---DDRAALDEAYARAMREVVRQYPEDREAATLFAESLMDL
Alphapro10      PAEQALIEALATRYSADFE---ADREPQDIAWAQAMAAYVAAHPEDDDAAAIYAEAWMNT
                            .:                                              

Betaprot1       TPWKLWDMSSGKTADGADTDEAIAVLERALAQVDANGLAPHPGLLHVYIHTIEMSPTPEK
Translatio      ------------------------------------------------------------
Alphapro2       TPWKLWDLRARGPAEGASTVEAQAALERAFAYDP--AAWDHPGLLHMYIHLMEMSPTPEK
Alphapro1       TPWQLWNLATGKAARGADTVEARALLEQAFDTLP--GAWDHPGLLHFYIHLMEMSPHPEL
Alphapro7       TPWALWDLKTGRVGAGASTAEAVAASEKALA-LP--GGYQHPGLLHMYIHLMEMSPFPER
Alphapro8       TPWALWDLGTGAIAEGASTAEAVEVSERALK-RP--EAYRHPGLLHIYIHLMEMSPFPER
Alphapro3       TPWQMWDLATGQPAAGAATREAQEVLETALSEAP--GAMHHPGLLHLYVHLMEMSPTPEK
Alphapro5       TPWQMWDLKTGLPAEGAPTLEAQEALEAAMADDP--AAMSHPGLLHLYVHLMEMSPTPEK
Alphapro4       TPWQMWDLKTGEPAKGAATVEAQELLEQAMAQLP--GAMRHPGLLHFYIHLMEMSPTPEK
Alphapro6       TPWKMWDLKTGAPAQGAATLEAQDVLEAAMATTP--AAMSHPGLLHLYVHLMEMSPSPEK
Alphapro12      TPRQLFDLKTGQPNPLSLTGEVLPMLDRAIAACR-EKGMIHPGVLHMHIHALEMSPTPER
Alphapro11      TVRRLWNLKTGEPAANSDVLEALEVCERSIRLANEAGAAQHPAILHLHIHLLEMSTMPER
Alphapro13      TVRRLWNLKTGAPAPNSDVLEALEVCERSIRLADRAGVAQHPAIVHLHIHLLEMSTMPER
Gammapro1       RPWDLHDEEE-GPYPE--TQAAVQALEGVLADHP-----QHPGACHLYIHAVEAW-EPQR
Gammapro2       HSWDYWKNDG-QPKEW--TNEILAVLEDGLKFSP-----SHAGLNHYYIHAVEASKQPER
Gammapro3       HAWDYWHADG-KPKEW--TPEIITVLETGLARHP-----RHAGLIHYYIHATEASKTPQR
Alphapro14      SPWNYWERDHKTPRPH--IAGAIAAVERVLAANP-----NHAGAIHLQIHLMEASAMPER
Betaprot3       QPWDYWEAGGFRPKGR--TAEIVGLLEKVLRRTP-----DHPGAIHYYIHVTESSNNPAR
Betaprot2       RPWDYWMRDG-HPHEG--TDEIVAVTEDVLRRHP-----VHPGALHMYIHLMEPTNTPER
Betaprot4       RPWGYWMLDG-QPYEG--TAEIVALTEAVLRRNP-----EHPGALHMYIHLIEPTDTPER
Gammapro4       NPWQYWSHDG-QPRPN--TPELLTQLERVIAANP-----DHPGACHFFIHAVEAA-QPER
Alphapro10      MPWDYWSADG-APKPD--TVKVIETLETTIARAP-----DHPLALHLYIHAVEASDDPGR
                                                                            

Betaprot1       ALRAADALRDLAPDVGHLLHMASHIDILCGHYHDAIVANDRAIAANQRVLDRHPQWLEF-
Translatio      ------------------------------------------------------------
Alphapro2       ALRHGDRLVDLVPDSGHLGHMATHIDVLCGDYQNVIWRNVRAVAVDRKYFHHAGGE-NFY
Alphapro1       ALRHGDRLSTLAPDAGHLLHMATHIDVLCGDYQNVVARNSRAIEADRIWVAREGTE-DFY
Alphapro7       ALRVADALRGLVPDSGHLQHMSTHIDVLCGHYERVVTSNHEAILADRKYLAREGAI-NFY
Alphapro8       ALRAGDALRDLVPDSGHLRHMPTHIDVLCGHYERVVASNGDAVKADRKYLEREGAI-NFY
Alphapro3       ALKAADVLRTLVPDAGHLVHMPTHIDVLCGQYHDVVHWNRRATLADRKYLDREGAF-NIY
Alphapro5       ALKAGDILRTLVPDAGHLVHMPTHIDVLCGHYHNVTYWNAKASEVDLKYYEREGAF-NIY
Alphapro4       ALKAGDVLRRLVPDAGHLVHMPTHIDVLCGNYHDVVLWNEVAVTADLKYYEQEGAF-NIY
Alphapro6       ALKPADVLRRLVPDAGHLVHMPTHIDVLCGNYHDVVLWNEQAIKADLKYYAREGAY-NIY
Alphapro12      ALNSADTLRGWAPDAGHLEHMPAHIYVLCGAYAEAVEQSRRAVAADDRYLSFGGDD-NFY
Alphapro11      GLRSADRLGEMCPDAGHMNHMPGHIYVLCGDYEKAKIASEKAVRANDLYLAYADEP-TYY
Alphapro13      GMRSADLLGQMCPDAGHMNHMPGHIYVLCGEYEKAKLASEKAVRANDLYLAYANEP-TYY
Gammapro1       AEACADRLADAIPGVSHIQHMPSHIYMHVGRFGDAVHQNQQARIMDQAAARGAGVS--VY
Gammapro2       GLASAKILETAVPGAGHLVHMPSHIYIRTGRYQQGVLSNEHAILVDNNYITQCRQQ-GVY
Gammapro3       AEDYADTLRDLVPGAGHLVHMPSHIYMRVGRYQDGVIANEKAMQVDDDYITQCGAQ-GVY
Alphapro14      AEKGAGRLADLMPGAGHLVHMPGHIYFRVGRYLDSLETNVRAVAVDEAYLAKTEGS-PIY
Betaprot3       AVPYAQRLGRLMPGAGHVVHMPFHTFFRVGMYKEAIEANRQAVRADEIYIARSAPV-GIY
Betaprot2       AEHAADTLMTLMPGAGHMVHMSSHIFQRVGRYADSVKSNQLAIAADEHYMGQSHAP-GLY
Betaprot4       AEQAADKLLTLMPEAGHMIHMSSHIYQRVGRYADSIKSNQLAIAADESYIAQCQAH-GIY
Gammapro4       AVPCAERLAGLMPGAGHLVHMPGHIYVRVGRYEDAIEANEHAVHADETYIRDQNPTFGIY
Alphapro10      AEAAADRLIKLVPGSGHLVHMPAHIFWRVGRYDDAAAANILAAKVDEDYIAQCNAQ-GFY
                                                                            

Betaprot1       -RLYCVHDIHFKIYAAMMLGRFSAAWQGVHELEALITEA-LLRVEQPPMAYLLEGFLSVR
Translatio      ---------------------------------------------------FLKSYELVP
Alphapro2       -TIYRIHNLHFVIYGAMFLARPTTALAAAAALRETLPEQ-VVRF----MPEFFEAFIGMK
Alphapro1       -TVYRCHNYHFKIYGAMFLCQPAPALEAAAELVANLPEEPVLRQ----FADWLEAFVPMN
Alphapro7       -SLYRCHNYHFKVYGAMFLGQYAPAMEAANEMADTLPAD-LLQVSSPPMADWLEGFLSVK
Alphapro8       -SLYRCHNYHFKVYGAMFLGQYTPAIEAATEMVATLPED-LLTVQSPPMADWLEGFISVQ
Alphapro3       -TGYRIHNCHFAIYGALFLGQMQPALEANRDLWDSVPEE-MLRMESPPMADYFESYMAMG
Alphapro5       -TGYRQHNYHFAIYGALFLGQMEPALRANQGLWDTTPEE-LLRIESPPMADYFESYMSMG
Alphapro4       -TGYRQHDYHFVIYGALFLGQIEPALRANQGLWDTTPEA-MLRIESPPMADYFESFMSLH
Alphapro6       -TGYRQHDYHFVIYGALFLGQIEPALRANAGLWETTPEE-MLRIESPPMADYFESYMAMH
Alphapro12      -TTARCHDLHLYVYSAMLLGQYRTALHAADRIRAIATPE-LLATSAPFMASILDGYSGMR
Alphapro11      -LLGCCHDLHLMMFTCMFLGQYRPALWAADKVRSLVTRDVVAIQDRPKLTQTVEGYHAMK
Alphapro13      -LLGCCHDLHLMMFTCMLSGQYRPALWAADKVRSLVVRDVVAIQDRPKLTQTVEGYHAMK
Gammapro1       PT----HNTAMLAFAAWMDGQSGVALSAARDLARESPGD-AFHYD---------------
Gammapro2       PLAYVPHNRHFLWAMASMQGNSQKAIKAAEHMAAHIDTH-LMTQEGLG---TLQHYWVTP
Gammapro3       PVAYVPHNRHFLWAMATMQGSSAKAINAAEHMAQHIDTA-LMREPGLG---TLQHYWVTP
Alphapro14      RYGYYPHNVHFVLVSAQMAGDAKTALDYARKLDGLIPFE-AVTS--AA---IVQPVKVAP
Betaprot3       PQAYYPHNVHSLMVSAQMAGDGATAIESAAKLVRIVSDA-AAKN--IS---WVQPIMAAP
Betaprot2       PMAYYPHNIHFLWFAATASGQRALALESAQKAASKVDDA-LLRE--MP---FTAIFRVVP
Betaprot4       PMVYYPHNIHFLWFAATLDGQSKLAISAAQETASKIGDE-VLET--IP---LTAIFRVTP
Gammapro4       VAGYYPHNYDFLAFAASMIGRSGQALGATRKMAELVPQA-MLREPGMT---FLQHHQTRR
Alphapro10      PALYYPHNIHFLWAAASMSGQSAVALEAAQKVADNVR---MEQVEAFP---TVEFFRTIP
                                                                            

Betaprot1       VHVLIRFGKWREILEQPFPANAALYCNTTAMLHYARGIAYANLKLAGPAAQARRAFSIAQ
Translatio      ------------------------------------------------------------
Alphapro2       FHVLVRFGRWQEILDERLPTDPALYLNTMALLHYARAVALANLGRLDEARAERDAFATAQ
Alphapro1       MHVYIRFGMWDAILAEPLPEDAELYAMTTAVMRYARTVALANKGRSTEAGAEAAAFVQAR
Alphapro7       QHVYIRFGKWDEIVAQPQPEDPELFCVTNAMMHYAKAVAYAASNRVEPALAEAEKFERAF
Alphapro8       QHVYIRFGKWDEIVAQAQPENSELFCVTNAMMRYAKAVAYAASNRVPEAETEAKHFEEAF
Alphapro3       PHILIRFGRWDEAIALEPPADPDLYRTLTATVHYARAVAFAATGRVAEAEAEEQVFLAAA
Alphapro5       PHILIRFGRWAEAKALQLPDDPDLFRTLTATIHYARAIAHAATGDVAQAEAEEQLFLAAK
Alphapro4       PHILIRFGRWQEASELELPEDQDLYRTLTASTHYARAIGHAALGRVAEAEAEESLFLLAK
Alphapro6       PHILIRFGRWQDCIELELPEDQDLYCTLTATTHYARAIGYAATGQVAEAEAEEQRFLAAK
Alphapro12      SHVQVRFGKWRELTLEPPPSEPEISPFRAAMFHYAKGVAHAALGEIAAAEAAEAAFHAAR
Alphapro11      SHVQVRFGRWQEIIAEPAVDEPGLYVLTAAMQHYAKGVAHATLGQFAEAERERDRFHRHM
Alphapro13      SHVLVRFGRWQEIIDEPVTAEPGLYVLTAAMQHYAKGVAHATLRQFAEAERERERFHRHV
Gammapro1       -LLLARFGRWDQLADRDDR--P-EMPFQAGMWHFAQGLAALRSRGPEAASGDLQALRRIR
Gammapro2       WYAYIRFGKWEKIMNIPKP--ATKLLYPLAVWHYAQGSALSSNGHILQARTHLQYLKQQA
Gammapro3       LYAYSRFGKWDKIFATKKP--DLALKYPLGVWHYARGIAFVAANKLDRARLELSMVKTLA
Alphapro14      YYAYLEFGSADDIANMPEP--PDNLPFVKGIWRYVQGVAAVRAGDLAAARTEADAIAALR
Betaprot3       YFAHAQFSDAKTILGLPDP--GADFPYVQAMWHYARGVGLAGAGDASAAQAEVDAIVRLG
Betaprot2       YWALARFGQWQAILAEPAP--PAFNAFLKGSWHYVRGLAYVATKQSQRAERELQQLRRIV
Betaprot4       YWALARFGYWQEILAVPRP--PATNLFLTGSWHYVRGLAFVATEQLQQAEQEWEALRKIM
Gammapro4       LQMLVRFDRWDEILQTEAP--PPDLPHASALWHYARGRALAARGDVPGAEAELARLRATA
Alphapro10      LLAHVQFGKWEEILAIEAP--PTDRDYSKGIWHYARGAALARTGEADAAKAEEAALASLK
                                                                            

Betaprot1       AALH--EHRYVTNNTCADLLKIAACVLDGEIAYHEDRFDEAFAHLRRAVELDDGLEYMEP
Translatio      ------DSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAYEEP
Alphapro2       RAVP--DDWMMFNNPCSAVLLVAEQMMLGELAYKSGQTEAGLEHLRAAVRLDDGMLYDEP
Alphapro1       DALP--ESRMLFNNTGRDILGVAEAMMLGELEYKRGNKEAGLAHLRRSVALDDALPYDEP
Alphapro7       ARVP--ESRMLFNNTCRDILSVAREMMLGEIAYRQADYDSAFAHLRRSVDLSDTLPYDEP
Alphapro8       ALVP--ESRMLFNNTCRDILTVAREMMLGEIEYRKANYDQAFAHLRNSVDLSDNLPYDEP
Alphapro3       ARVP--ESRLLHNNRVVDLLEIAKEMLRGEIEYRKGSYDLAYAHLRRSIELDDTLPYDEP
Alphapro5       TCVP--ETRRLHNNRVIDLLEIATEMLRGEIEYRKGNHEIAYAHLRRSVELDDTLPYDEP
Alphapro4       AKVP--ESRLMHNNKVVDLLEIASEMLRGEIEYRKGNFDIAYGHLRRSVALDDDLPYDEP
Alphapro6       ARVP--DSRLMHNNRVVDLLEIAREMLRGEIEYRKENYAQAYTHLRRSVSLDDNLPYDEP
Alphapro12      DGFS--TEAIFLSNTVRDTLGVGAAMMAGEIAYRRGDHDQAFDALRLAVERHDTLNYTEP
Alphapro11      ETIP--AERRFLSNPTRASLAVGAALLDGELAYHQGGHEVAYAHLRQAVELDDNLAYTEP
Alphapro13      ESIA--PERRFLSNPTRASLAVGAALLDGELAYHQGRHDEAYGHLRQAVELDDNLSYTEP
Gammapro1       DNTPEEATYQFFGHPKQDLLGIAEEILAAEVALAEGRDVDAEAALREAVRLEDGLPYSEP
Gammapro2       KNKKLKDITVWQINDAYSVINIAALVLEGEIETKAKNYSAAIDALTKASALEDSLNYNEP
Gammapro3       TDSDLKNITVWEINDAQSVLSIAALVLEGELEGKAKNYEASIALFEKAIALETSLNYNEP
Alphapro14      SD-EALAPLAAANVPAGNILLLSETVLRARIDQREGALDAARAKLEEALALQDGLIYSEP
Betaprot3       QQ-NGFADLVAGGVPAKDVLRLAEQVLRARIAQANRDPVRAVRHFEAAVALEDGLAYTEP
Betaprot2       KNRAALDNPLLSRNTAYDILRIGPEVLAGEIAAARGRYESAVAHLERAVRYEDALVYTEP
Betaprot4       KD-PSLDSPLLSKNTTKTVLSAAPEVLAGEIAAAHGKFDQAIAHLEKAVRLNDALVYTEP
Gammapro4       GS-PQTDALRLEFNTSGAILKIASQVLAGHIAAGKADFPGAIGHLREAARLEDGLVYGEP
Alphapro10      DT-VQIQFLVTNDYPASLLLNIADELLLGEIAQAEGNSAEAVARFEQAVALQDQLPYTEP
                                   :  .  :: . :         .   :  :      : * **

Betaprot1       WGWMMPTRHPLGALLLAQGHVEEAERVYRADLGLDSTIYRSLQHPGNVWSLQGYVSCLRR
Translatio      WCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHECLFI
Alphapro2       WGWMQPARHALGALLMDAGQYAEAEVVYRADLGLDQTLPRPCQHPRNVWSLHGLDECLRR
Alphapro1       WGWMQPTRHALGALLLDAGQYGEAEAVYRADLGLDDTLARACQHPGNVWSLHGLHECLVR
Alphapro7       WGWMQPTRHALAALLLEQGHVEESAAVYREDLGLDPALPRAVHHPDNVWSLQGYHECLRK
Alphapro8       WGWMQPTRHALAALLLEQGHVEDSARVYEQDLGLDPSLPRAVHHPDNVWSLQGYNECLKK
Alphapro3       WGWMQPTRHALGALLFEQGHVDEAETVYRADLGLGGQLSRAAVHPDNVWSLKGLHDCLKA
Alphapro5       WGWMQPTRHALGALLFEQGHTAEAEAVYREDLGLGGTLSRASIHPDNVWSLKGLHDCLKA
Alphapro4       WGWMQPTRHALGALLLEQGHVEEAEAVYREDLGLGGSLPRAAIHPDNVWSLKGLHDCLLA
Alphapro6       WGWMQPTRHALGALLLEQGHVAEAEAVYRADLGLDDTLSRASEHPDNVWSLKGLYDCLNA
Alphapro12      WAWMHPPRHALGALLAEQRRFEEAEAVYRADLGYDQTVPRPCQHPDNVWAMHGLLECVVR
Alphapro11      WAWMHPPRHALAALLLDQGHMQEAEQVYRDDLGLSGKVQRCAQHPDNVWALHGLVECLRR
Alphapro13      WAWMHPPRHALAALLLDQGHAEEAEQVYRDDLGLSGTVQRCAQHPNNVWALHGLVECLTR
Gammapro1       EPWPIPARHVLGAVLLEIGDAEEAESVYREAL---------SVHPDNGWALRGLQQSLAA
Gammapro2       SDWHAPVRQSLGAALLAAGESIKAQHVYQADL---------HVFPENGWSLYGLHQALLA
Gammapro3       SDWHYPARQSLGAVLLDAKQYSAAEQVYLADL---------AVFPKNGWSLYGLQQALLG
Alphapro14      PYWYYPVEQTLGAVLLEAGDADAAVARFRAAL---------VRHPNNAWSLYGLMKAQEA
Betaprot3       PYWYYPTRQSLGAALLLAGDLDNAENVLRSSL---------ARAPNNGWALFGLMRLYEQ
Betaprot2       AEWHYPPRLALGAILLKAGRPDEAETVYWEDL---------KRNRDNGWALFGLQQALIA
Betaprot4       AEFHLPPRLALGAVLLESGRPNEAEIVYWEDL---------RRNRNNGWALYGLAQALQA
Gammapro4       PEWTVPVRQDLGRVLLEAGRNEEAEQAFREDL---------RRFPENGWSLHGLARTLDA
Alphapro10      PFWYYPTRQSLGEALIDAERYAEAEAVYRRDL---------EDHPHNGWSMAGLIGALEA
                  :  *    *.  *        :       *              * *:: *       

Betaprot1       LGKHETADALQPALDVARARADVEIGVSCFCAAPSKRGCCH-----
Translatio      RKDTVELPHVELLLNQAKARTDIVINSSCFCRNKVN----------
Alphapro2       RDETVERRHIGLQLDQAMARAEVPIRSSCYCRSKKAAAYRRSRDDQ
Alphapro1       RGEKVEAAHIGRQLDKARARAEVPVRASCYCRRGAA----------
Alphapro7       LGRDAEAVLIGQRLTLAKGRVDVPVRSSCYCKQGSR----------
Alphapro8       LGRDAEAALVGQRLTLAKGRVDVPVRSSCYCKQGSF----------
Alphapro3       RAETVEIIQIRQRLDLALARADRAVGASCFCAQAAMRAAG------
Alphapro5       RGETVEIQQIKQRLDLALARADGAVGASCFCAQAAMRAAE------
Alphapro4       RGEEIEIHHIKQKLDQAQARSDGVF-ASCGCAQAAMEQQNACCS--
Alphapro6       RGETVEIQHIKQKLDLAQARSDGVF-ASCGCAQIAMK---------
Alphapro12      RGDEREAEILSQRLMLAQARTDFPVTSACCCRGKSPLAEGD-----
Alphapro11      RGESGELPALQARLATALAKADVAISSSCLCRTSVQRGCCH-----
Alphapro13      RGESDELQALQARLAVASAKADVPITSSCLCRTSVQADHCCCH---
Gammapro1       QGKAAEARQVAEAFEQAWQRADIWLPGSRF----------------
Gammapro2       QGLSTEASKVNKRFLKAWQHADFELSGSVVH---------------
Gammapro3       QGKKQKAKAIGKQFEQSWQWADIALNASRIL---------------
Alphapro14      AGDGAVSYTAELLRKAAFDPGAITLDRL------------------
Betaprot3       RGDAPGARVVRGMLDKAWIGDPRTLELSRL----------------
Betaprot2       QKKEAEAKVIEARFKKAWEHADITLTASRFGR--------------
Betaprot4       QNKIDEAAIITARFEQAWARADIKLQGSRFGR--------------
Gammapro4       QNRGEEADAVMERFRKVWAGADMQLAETAR----------------
Alphapro10      QGKTEEAGHLSHHFEKAWAKADVELSGSRL----------------
                                        .                     

Protein Domains

PROTOCOLE:

Analyse avec InterProScan.paramètres par défaut


ANALYSE DES RÉSULTATS:


Aucun domaine protéique n'a été trouvé.

RÉSULTATS BRUTS: 

InterProScan Results

SEQUENCE: GOS_1102030 CRC64: 0507B2C9D25B9362 LENGTH: 166 aa
No hits reported.


	
	
	
	

Phylogeny

PROTOCOLE:

a) Phylogeny.fr / méthode BioNJ / groupe d'étude: les protéobactéries, groupe extérieur: autres bactéries

b) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model /groupe d'étude: les protéobactéries, groupe extérieur: autres bactéries

c) Phylogeny.fr / méthode BioNJ /groupe d'étude:les alfa-protéobactéries, groupe extérieur:béta, gamma-protéobactéries

d) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model /groupe d'étude:les alfa-protéobactéries, groupe extérieur:béta, gamma-protéobactéries

e) Phylogeny.fr / méthode BioNJ / pas de bootstrap / default substitution model /groupe d'étude: les Rhodobacteraceaes groupe extérieur:autres alfa-protéobactéries


ANALYSE DES RÉSULTATS:


a) et b)

Les arbres obtenus avec le premier rapport taxonomique que nous avons déterminé sont très désordonnés: sur chaque branche se trouve des bactéries appartenant au groupe d'étude (protéobactéries) et au groupe extérieur(autres bactéries).On peut supposer qu'il y a eu des transferts horizontaux ce qui est renforcer par la présence du domaine protéique TPR dans plusieurs familles de bactéries (protéobactéries cyanobactéries, bactéries Gram+ ....). On parle de phylogénie inférée.

Nous constatons tout de même que la séquence que nous étudions est toujours entourée d'alphaprotéobactéries (branche A de l'arbre BioNJ et branche B de l'arbre PhyML)

Ces arbres ne permettant pas de définir de quel type de bactérie provient notre séquence nous avons donc établi un nouveau rapport taxonomique.


c) et d)

Les arbres obtenus ne ressemblent pas à l'arbre de référence car il n'y a pas de séparation distincte entre les alphas, les bêtas et les gammaprotéobactéries.

Mais l'ORF étudié émerge cette foi dans un groupe bien distinct d'alphaprotéobactérie (branche I pour BioNJ et branche II pour PhyML) et l'on remarque que ces alphaprotéobactéries font toutes partie du groupe des Rhodobacteraceaes,

on peut donc supposer que notre séquence est issue d'une bactérie du groupe des Rhodobacteraceaes.


e)

Cet arbre nous permet de renforcer l'hypothèse précédente car notre séquence se trouve dans la branche (branche 1) qui contient toutes les Rhodobacteraceaes.


RÉSULTATS BRUTS:

a)                                                                                                     ------0.2-----
  
     -----0.2----
 
   +-----------------------Alkalilimnicola ehrlichii MLHE-1                     [g-proteobacteria]
   |
   |                +-----------Pseudoalteromonas atlantica T6c                 [g-proteobacteria]
   |  +-------------+
   |  |             +------------Saccharophagus degradans 2-40                  [g-proteobacteria]
   |  |
   |  |+---------------------Sorangium cellulosum 'So ce 56'                    [d-proteobacteria]
 +-+ ++|
 | | |||          +---------------------marine gamma proteobacterium HTCC2143   [g-proteobacteria]
 | | |||    +-----+
 | | |++    |     |
 | | | | +--+     +-------------------------------------Aromatoleum aromaticum EbN1[b-proteobacteria]
 | | | | |  |
 | | | +-+  +-----------------------Myxococcus xanthus DK 1622                  [d-proteobacteria]
 | +-+   |
 |   |   |             +---------------Cyanothece sp. CCY0110                   [cyanobacteria] 
 |   |   +-------------+
 |   |                 +----------------Trichodesmium erythraeum IMS101         [cyanobacteria]
 |   |
 |   |         +---------Nitrosomonas europaea ATCC 19718                       [b-proteobacteria]
 |   |+--------+
 |   ||        +-------Nitrosospira multiformis ATCC 25196                      [b-proteobacteria]
 |   ++
 |    |    +---------Gloeobacter violaceus PCC 7421                             [cyanobacteria]
 |    |    |
 |    +----+  +------------------------Flavobacteriales bacterium ALC-1         [CFB group bacteria]
 |         +--+
 |            +----------Cyanothece sp. PCC 7425                                 [cyanobacteria]
 |
 |
 |         +-------------Blastopirellula marina DSM 3645                         [planctomycetes]
 |       +-+
 |       | +---------------------Verrucomicrobiae bacterium DG1235               [verrucomicrobia]
 |       |
 |       |             +-----Mycobacterium smegmatis str. MC2 155                [high GC Gram+] 
 |       |            ++
 |       |            |+-----Beutenbergia cavernae DSM 12333                      [high GC Gram+] 
 |       |            |
 |       |         +--+--------------Nakamurella multipartita DSM 44233           [high GC Gram+] 
 |       |         |  |
 +-------+         |  +--------Streptomyces ghanaensis ATCC 14672                 [high GC Gram+]
         |         |
         |      +--+ +--------------Saccharopolyspora erythraea NRRL 2338         [high GC Gram+] 
         |      |  |++
         |      |  ||+----------------Sagittula_stellata E-37                     [a-proteobacteria]
         |      |  ||
         |      |  ++    +-----------------Translation_of_ORF_number_1_in_reading_frame_3_on_the_reverse_st )
         |      |   | +--+                                                                                  )
         |      |   | |  |                                                                                  )
         +------+   +-+  +--------Citricella sp. SE45                             [a-proteobacteria]        )Branche A
                |     |                                                                                     )
                |     +----------Rhodobacteraceae bacterium KLH                   [a-proteobacteria]        )
                |
                |           +----Mesorhizobium loti MAFF303099                    [a-proteobacteria]
                | +---------+
                +-+         +--Mesorhizobium opportunistum WSM2075.               [a-proteobacteria]
                  |
                  +---------------Burkholderia pseudomallei 668                   [b-proteobacteria]
 


b)
PhyML

                      ----0.2---
 
                             +---------------Cyanothece sp. CCY0110                        [cyanobacteria] 
                +------------+
                |            +-------------Trichodesmium erythraeum IMS101                 [cyanobacteria]
              +-+
          +---+ +---------------------------------------Aromatoleum aromaticum EbN1        [b-proteobacteria]
          |   |
      +---+   +----------------------------Myxococcus xanthus DK 1622                      [d-proteobacteria]
      |   +---------------------------marine gamma proteobacterium HTCC2143                [g-proteobacteria]
      |
      |
   +--+        +----------Cyanothece sp. PCC 7425                                          [cyanobacteria]
   |  |     +--+
   |  |     |  |    +---------------------------Flavobacteriales bacterium ALC-1           [CFB group bacteria]
   |  |     |  +----+
   |  |     |       +-------Gloeobacter violaceus PCC 7421                                  [cyanobacteria]
   |  +-----+
   |        |            +---Nitrosomonas europaea ATCC 19718                               [b-proteobacteria]
   |        |  +---------+
 +-+        |  |         +------------Nitrosospira multiformis ATCC 25196                   [b-proteobacteria]
 | |        +--+
 | |           |                  +-----------Pseudoalteromonas atlantica T6c               [g-proteobacteria]
 | |           +------------------+
 | |                              +----------Saccharophagus degradans 2-40                  [g-proteobacteria]
 | |
 | |    +---------------------Sorangium cellulosum 'So ce 56'                               [d-proteobacteria]
 | +----+
 |      +-------------------------Alkalilimnicola ehrlichii MLHE-1                          [g-proteobacteria]
 |
 |
 |              +-----------Blastopirellula marina DSM 3645                                  [planctomycetes]

 
 |          |   +---------------------Verrucomicrobiae bacterium DG1235                      [verrucomicrobia]
 |          |
 |          |                          +----Mesorhizobium loti MAFF303099                    [a-proteobacteria]
 |          |               +----------+  
 |          |           +---+          +--Mesorhizobium opportunistum WSM2075                [a-proteobacteria] 
 |          |           |   |
 +----------+           |   +-------------Burkholderia pseudomallei 668                       [b-proteobacteria]
            |           |
            |           |     +----Mycobacterium smegmatis str. MC2 155                       [high GC Gram+] 
            |         +-+  +--+
            |         | |  |  +-----Beutenbergia cavernae DSM 12333                           [high GC Gram+] 
            |         | |+-+
            |         | || +-----Streptomyces ghanaensis ATCC 14672                           [high GC Gram+] 
            |         | ++
            +---------+  +--------------Nakamurella multipartita DSM 44233                    [high GC Gram+] 
                      |
                      |
                      |  +-----------Rhodobacteraceae bacterium KLH11                         [a-proteobacteria]
                      |  |
                      +--+      +------------------Translation_of_ORF_number_1_in_reading_frame_3_on_the_reverse_st )
                         |------+                                                                                   )Branche B
                         |      +--------Citreicella sp. SE45                                 [a-proteobacteria]    )
                         |
                         | +-------------Saccharopolyspora erythraea NRRL 2338                [high GC Gram+] 
                         +-
                           +-------------Sagittula stellata E-37                               [a-proteobacteria]


                                                                                                         ----0.2---
 

c)     BioNJ

                                                                                      -----0.2---
 
   +--------------------Alkalilimnicola ehrlichii MLHE-1                                 [g-proteobacteria]
   |
   |                 +-------------Pseudoalteromonas atlantica T6c                        [g-proteobacteria]
   |  +--------------+
   |  |              +--------------Saccharophagus degradans 2-40                         [g-proteobacteria]
 +-+  |
 | | ++          +-----------Nitrosomonas europaea ATCC 19718                             [b-proteobacteria]
 | | ||          |
 | | ||  +-------+
 | | |+--+       +--------Nitrosomonas sp. AL212                                          [b-proteobacteria]
 | | |   |
 | +-+   +------------------------Azotobacter vinelandii DJ                               [g-proteobacteria]
 |   |
 |   |                    +-----------------------------Parvibaculum lavamentivorans DS-1 [a-proteobacteria]
 |   |    +---------------+
 |   |    |               +----------------------Aromatoleum aromaticum EbN1              [b-proteobacteria]
 |   +----+
 |        +-----------------Hyphomonas neptunium ATCC 15444                               [a-proteobacteria]
 |
 |               +-----------------Burkholderia pseudomallei 668                          [b-proteobacteria]
 |               |
 |             +-+  +----------------alpha proteobacterium BAL199                         [a-proteobacteria]
 |             | |  |
 |             | +--+
 |             |    |         +---Mesorhizobium loti MAFF303099                           [a-proteobacteria]
 |             |    +---------+
 |             |              +---Mesorhizobium opportunistum WSM2075                     [a-proteobacteria]
 |             |
 |             |          +----Roseobacter sp. SK209-2-6                                  [a-proteobacteria]            )
 |             |         ++                                                                                  )
 +-------------+         |+----Roseobacter sp. MED193                                     [a-proteobacteria] )
               |    +----+                                                                                   )
               |    |    |+-----Ruegeria pomeroyi DSS-3                                   [a-proteobacteria] ) 
               |    |    ++                                                                                  )
               |  +-+     +---Rhodobacteraceae bacterium KLH11                            [a-proteobacteria] )
               |  | |                                                                                        )
               |  | |            +--Rhodobacter sphaeroides KD131                         [a-proteobacteria] )branche A
               |  | +------------+                                                                           )
               +--+              |                                                                           ) 
                  |              +------Sagittula stellata E-37                           [a-proteobacteria] )
                  |                                                                                          )
                  |     +------------------Translation_of_ORF_number_1_in_reading_frame_3_on_the_reverse_st  ) 
                  +-----+                                                                                    ) 
                        |   +-----------Roseovarius sp. 217                               [a-proteobacteria] )
                        +---+                                                                                ) 
                            +----Citreicella sp. SE45                                     [a-proteobacteria] )
            






d)  PhyML

                      -------0.5------
 
                           +----------------------------Parvibaculum lavamentivorans DS-1     [a-proteobacteria] 
               +-----------+
               |           +----------------Aromatoleum aromaticum EbN1                       [b-proteobacteria]
           +---+
           |   +-------------Hyphomonas neptunium ATCC 15444                                  [a-proteobacteria]
        +--+
        |  |          +----------Pseudoalteromonas atlantica T6c                              [g-proteobacteria]
        |  |          |
      +-+  +----------+
      | |             +-------Saccharophagus degradans 2-40                                   [g-proteobacteria]
      | |
      | |      +-------Nitrosomonas europaea ATCC 19718                                       [b-proteobacteria]
     ++ +------+
     ||        +-------Nitrosomonas sp. AL212                                                 [b-proteobacteria]
     ||
 |---|+------------------Azotobacter vinelandii DJ                                            [g-proteobacteria]
 |   |
 |   +----------------Alkalilimnicola ehrlichii MLHE-1                                        [g-proteobacteria]
 |
 |              +-----------Burkholderia pseudomallei 668                                     [b-proteobacteria] 
 |              |
 |           +--+  +---------------alpha proteobacterium BAL199                               [a-proteobacteria]
 |           |  +--+
 |           |     |     +---Mesorhizobium loti MAFF303099                                    [a-proteobacteria]
 |           |     +-----+
 |           |           +-Mesorhizobium opportunistum WSM2075                                [a-proteobacteria]
 |           |
 |           |               +--Citreicella sp. SE45                                          [a-proteobacteria] )
 +-----------+      +--------+                                                                                   )
             |      |        |   +------Roseovarius sp. 217                                   [a-proteobacteria] ) 
             |      |        +---+                                                                               )
             |    +-+            +--------------Translation_of_ORF_number_1_in_reading_frame_3_on_the_reverse_st )
             |    | |                                                                                            )
             |    | |       +-Rhodobacter sphaeroides KD131                                   [a-proteobacteria] )
             |    | +-------+                                                                                    )
             |    |         +----Sagittula stellata E-37                                      [a-proteobacteria] )  
             +----+                                                                                              )
                  |                                                                                              )Branche B
                  |    +----Roseobacter sp. SK209-2-6                                         [a-proteobacteria] )
                  |   ++                                                                                         ) 
                  |   |+---Roseobacter sp. MED193                                             [a-proteobacteria] )
                  +---+                                                                                          )
                      |+---Ruegeria pomeroyi DSS-3                                            [a-proteobacteria] )
                      ++                                                                                         )
                       +--Rhodobacteraceae bacterium KLH11                                    [a-proteobacteria] )
   

 
e)BioNJ

                                                      
                                                                          -----0.2---
 
     +----------------------Hyphomonas neptunium ATCC 15444                                   [a-proteobacteria]
 +---+
 |   +--------------------------------------------------Parvibaculum lavamentivorans DS-1     [a-proteobacteria]
 |
 |                          +-----------------alpha proteobacterium BAL199                    [a-proteobacteria]
 |                          |
 |                  +-------+
 |                  |       |            +---Mesorhizobium loti MAFF303099                    [a-proteobacteria]
 |                  |       +------------+
 |                  |                    +----Mesorhizobium opportunistum WSM2075             [a-proteobacteria]
 |                  |
 |                  |            +----Roseobacter sp. SK209-2-6                               [a-proteobacteria] ) 
 |                  |          +-+                                                                               )
 |                  |          | +---Roseobacter sp. MED193                                   [a-proteobacteria] )
 +------------------+     +----+                                                                                 )
                    |     |    |                                                                                 )
                    |     |    |+----Ruegeria pomeroyi DSS-3                                  [a-proteobacteria] )
                    |     |    ++                                                                                )
                    |  +--+     +----Rhodobacteraceae bacterium KLH11                         [a-proteobacteria] )
                    |  |  |                                                                                      )branche 1
                    |  |  |            +--Rhodobacter sphaeroides KD131                       [a-proteobacteria] )
                    |  |  +------------+                                                                         ) 
                    +--+               +-----Sagittula stellata E-37                          [a-proteobacteria] )
                       |                                                                                         )
                       |                                                                                         )
                       |    +------------------Translation_of_ORF_number_1_in_reading_frame_3_on_the_reverse_st  )
                       +----+                                                                                    )
                            |  +--------------Roseovarius sp. 217                             [a-proteobacteria] ) 
                            +--+                                                                                 )
                               +-----Citreicella sp. SE45                                     [a-proteobacteria] )
                   

Taxonomy report

PROTOCOLE:

1)BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions_500" taxonomie report

2)BLASTp contre swissprot, paramètres par défaut au NCBI sauf "Number of descriptions_500"taxonomie report


ANALYSE DES RÉSULTATS:


1)Le lignage obtenue avec les séquences homologues référencées par le BLAST contre NR a mis en évidence plusieurs familles de bactéries et même des champignons qui ont de bonne E-value et qui vont nous permettre de faire le rapport taxonomique.


2)Le lignage obtenue avec un BLAST contre SWISSPROT ne nous donne aucune information sur notre séquence car les séquences ne sont pas des homologues de notre ORF: leur E-value est trop élevée.


a)Dans un premier temps nous avons choisi les protéobactéries comme groupe d'étude car c'est celui qui a le plus de similarités avec notre ORF. Comme groupe extérieure nous avons choisi les "autres bactéries" car aucun autre sous-groupe de bactéries n'était assez bien représenté.

Dans les arbres obtenus avec se rapport taxonomique notre séquence émerge au milieu d'alphaprotéobactéries, mais les organismes qui composent les différentes branches étant assez hétérogène (phylogénie inférée), il est difficile d'interpréter les arbres et dans déduire des informations précises et fiables. Nous avons donc décidé d'établir un nouveau rapport taxonomique.


b) Nous avons donc affiné nos groupes en choisissant comme groupe d'étude les alphaprotéobactéries (car chez les arbres obtenus avec les groupes précédents notre séquence émerge dans un groupe d'alphaprotéobactéries qui sont aussi les organismes qui ont les meilleurs scores) et comme groupe extérieur les bétaprotéobactéries et les gammaprotéobactéries. Nous avons exclus les Deltaprotéobactéries car elle sont trop éloignées des alphas et des gammas phylogénétiquement parlant.

Notre séquence émerge au sein d'une branche contenant uniquement des alphaprotéobactéries. Là encore sur certaines branches le groupe d'étude et le groupe extérieur sont mélangés. Mais cette fois la branche où se trouve notre ORF contient un nombre important d'alphaprotéobactéries et elle se détache de façon bien distincte du reste de l'arbre ce qui nous permet de dire que notre ORF provient d'une alphaprotéobactérie. De plus toutes les alphaprotéobactéries de cette branche sont des Rhodobacteraceaes, ce qui nous laisse supposer que notre séquence provient également d'une Rhodobacteraceae.

Ce rapport taxonomique parait donc plus correcte que le précédent.


c)Pour renforcer cette hypothèse nous avons défini un nouveau rapport taxonomique avec pour groupe d'étude les Rhodobacteraceaes et comme groupe extérieur les autres alphaprotéobactéries.

L'ORF émerge sur la branche contenant tous les Rhodobacteraceaes du groupe d'étude ce qui semble confirmer qu'elle provient bien d'une bactérie de cette famille. Le groupe taxonomique le plus proche de notre ORF reste donc celui des Rhodobacteraceaes


a)

Groupe d'étude: Les protéobactéries


-ref|ZP_05781053.1| 1e-52 Citreicella sp. SE45 [a-proteobacteria] taxid 501479 [a-proteobacteria]

TPR domain protein [Citreicella sp. SE45]

-ref|ZP_05123175.1| 4e-42 Rhodobacteraceae bacterium KLH11 [a-proteobacteria] taxid 467661 [a-proteobacteria]

TPR domain protein [Rhodobacteraceae ba...

-ref|ZP_01746799.1| 2e-39 Sagittula stellata E-37 [a-proteobacteria] taxid 388399 [a-proteobacteria]

hypothetical protein SSE37_14293 [Sagit...

-ref|NP_108456.1| 4e-38 Mesorhizobium loti MAFF303099 [a-proteobacteria] taxid 266835 [a-proteobacteria]

hypothetical protein mll8338 [Mesorhizobi...

-ref|ZP_05812540.1| 2e-33 Mesorhizobium opportunistum WSM2075 [a-proteobacteria] taxid 536019 [a-proteobacteria]

Tetratricopeptide TPR_4 protein [Mesorh...

-ref|YP_001062462.1| 2e-30 Burkholderia pseudomallei 668 [b-proteobacteria] taxid 320373 [b-proteobacteria]

TPR repeat-containing protein [Burkhol...

-ref|NP_840897.1| 4e-18 Nitrosomonas europaea ATCC 19718 [b-proteobacteria] taxid 228410 [b-proteobacteria]

TPR repeat-containing protein [Nitrosomon...

-ref|YP_412564.1| 2e-16 Nitrosospira multiformis ATCC 25196 [b-proteobacteria] taxid 323848 [b-proteobacteria]

hypothetical protein Nmul_A1877 [Nitrosos...

-ref|YP_159004.1| 2e-11 Aromatoleum aromaticum EbN1 [b-proteobacteria] taxid 76114 [b-proteobacteria]

hypothetical protein ebA3511 [Aromatoleum...

-ref|YP_742156.1| 1e-17 Alkalilimnicola ehrlichii MLHE-1 [g-proteobacteria] taxid 187272 [g-proteobacteria]

TPR repeat-containing protein [Alkalilimn...

-ref|YP_661836.1| 2e-14 Pseudoalteromonas atlantica T6c [g-proteobacteria] taxid 342610 [g-proteobacteria]

hypothetical protein Patl_2264 [Pseudoalt...

- ref|ZP_01618270.1| 5e-11 marine gamma proteobacterium HTCC2143 [g-proteobacteria] taxid 247633 [g-proteobacteria]

hypothetical protein GP2143_06729 [mari... 70

- ref|YP_528338.1| 8e-14 Saccharophagus degradans 2-40 [g-proteobacteria] taxid 203122 [g-proteobacteria]

hypothetical protein Sde_2869 [Saccharoph...

-ref|YP_001613235.1| 3e-15 Sorangium cellulosum 'So ce 56' [d-proteobacteria] taxid 448385 [d-proteobacteria]

hypothetical protein sce2596 [Sorangiu...

-ref|YP_630480.1| 4e-10 Myxococcus xanthus DK 1622 [d-proteobacteria] taxid 246197 [d-proteobacteria]

TPR repeat-containing protein [Myxococcus...


Groupe extérieur:autre types de bactéries.


-ref|YP_887877.1| 2e-44 Mycobacterium smegmatis str. MC2 155 [high GC Gram+] taxid 246196 [high GC Gram+]

TPR domain-containing protein [Mycobacter...

-ref|ZP_04683979.1| 2e-43 Streptomyces ghanaensis ATCC 14672 [high GC Gram+] taxid 566461 [high GC Gram+]

hypothetical protein SghaA1_02278 [Stre...

-ref|YP_002880407.1| 1e-41 Beutenbergia cavernae DSM 12333 [high GC Gram+] taxid 471853 [high GC Gram+]

Tetratricopeptide TPR_2 repeat protein...

-ref|YP_003203603.1| 2e-37 Nakamurella multipartita DSM 44233 [high GC Gram+] taxid 479431 [high GC Gram+]

Tetratricopeptide TPR_2 repeat protein...

-ref|YP_001104973.1| 1e-31 Saccharopolyspora erythraea NRRL 2338 [high GC Gram+] taxid 405948 [high GC Gram+]

TPR domain-containing protein [Sacchar...

-ref|ZP_01088815.1| 7e-23 Blastopirellula marina DSM 3645 [planctomycetes] taxid 314230 [planctomycetes]

TPR repeat protein [Blastopirellula mar...

- ref|ZP_05057971.1| 2e-19 Verrucomicrobiae bacterium DG1235 [verrucomicrobia] taxid 382464 [verrucomicrobia]

tetratricopeptide repeat domain protein...

-ref|NP_925689.1| 4e-18 Gloeobacter violaceus PCC 7421 [cyanobacteria] taxid 251221 [cyanobacteria]

hypothetical protein gll2743 [Gloeobacter...

-ref|YP_002483402.1| 3e-16 Cyanothece sp. PCC 7425 [cyanobacteria] taxid 395961 [cyanobacteria]

TPR repeat-containing protein [Cyanoth...

-ref|ZP_02183353.1| 3e-13 Flavobacteriales bacterium ALC-1 [CFB group bacteria] taxid 391603 [CFB group bacteria]

hypothetical protein FBALC1_11742 [Flav...

-ref|ZP_01728474.1| 1e-12 Cyanothece sp. CCY0110 [cyanobacteria] taxid 391612 [cyanobacteria]

TPR repeat protein [Cyanothece sp. CCY0...

-ref|YP_720476.1| 1e-11 Trichodesmium erythraeum IMS101 [cyanobacteria] taxid 203124 [cyanobacteria]

tetratricopeptide region [Trichodesmium e...




b)groupe d'étude: Les alphaprotéobactérie


-Cref|ZP_05781053.1| 1e-52 1eitreicella sp. SE45 [a-proteobacteria] taxid 501479 [a-proteobacteria]

TPR domain protein [Citreicella sp. SE45]

-ref|ZP_01038341.1| 2e-52 Roseovarius sp. 217 [a-proteobacteria] taxid 314264 [a-proteobacteria]

hypothetical protein ROS217_02550 [Rose...

- ref|YP_167302.1| 2e-44 Ruegeria pomeroyi DSS-3 [a-proteobacteria] taxid 246200 [a-proteobacteria]

TPR domain-containing protein [Ruegeria p...

-ref|ZP_01753428.1| 5e-43 Roseobacter sp. SK209-2-6 [a-proteobacteria] taxid 388739 [a-proteobacteria]

TPR domain protein [Roseobacter sp. SK2...

-ref|ZP_05123175.1| 4e-42 Rhodobacteraceae bacterium KLH11 [a-proteobacteria] taxid 467661 [a-proteobacteria]

TPR domain protein [Rhodobacteraceae ba...

- ref|ZP_01056914.1| 5e-42 Roseobacter sp. MED193 [a-proteobacteria] taxid 314262 [a-proteobacteria]

TPR domain protein [Roseobacter sp. MED...

-ref|YP_002520811.1| 4e-41 Rhodobacter sphaeroides KD131 [a-proteobacteria] taxid 557760 [a-proteobacteria]

hypothetical protein RSKD131_3878 [Rho...

-ref|ZP_01746799.1| 2e-39 Sagittula stellata E-37 [a-proteobacteria] taxid 388399 [a-proteobacteria]

hypothetical protein SSE37_14293 [Sagit...

-ref|YP_760021.1| 1e-12 Hyphomonas neptunium ATCC 15444 [a-proteobacteria] taxid 228405 [a-proteobacteria]

hypothetical protein HNE_1303 [Hyphomonas...

-ref|NP_108456.1| 4e-38 Mesorhizobium loti MAFF303099 [a-proteobacteria] taxid 266835 [a-proteobacteria]

hypothetical protein mll8338 [Mesorhizobi...

-ref|ZP_02191333.1| 8e-34 alpha proteobacterium BAL199 [a-proteobacteria] taxid 331869 [a-proteobacteria]

flagellar motor switch protein G [alpha...

-ref|ZP_05812540.1| 2e-33 Mesorhizobium opportunistum WSM2075 [a-proteobacteria] taxid 536019 [a-proteobacteria]

Tetratricopeptide TPR_4 protein [Mesorh...

- ref|YP_001413578.1| 4e-09 Parvibaculum lavamentivorans DS-1 [a-proteobacteria] taxid 402881 [a-proteobacteria]

TPR repeat-containing protein [Parviba...


groupe extérieur: les bétaprotéobactéries et les gammaprotéobactéries


-ref|YP_001062462.1| 2e-30 Burkholderia pseudomallei 668 [b-proteobacteria] taxid 320373 [b-proteobacteria]

TPR repeat-containing protein [Burkhol...

-ref|NP_840897.1| 4e-18 Nitrosomonas europaea ATCC 19718 [b-proteobacteria] taxid 228410 [b-proteobacteria]

TPR repeat-containing protein [Nitrosomon...

- ref|YP_159004.1| 2e-11 Aromatoleum aromaticum EbN1 [b-proteobacteria] taxid 76114 [b-proteobacteria]

hypothetical protein ebA3511 [Aromatoleum...

- ref|ZP_05314739.1| 5e-16 Nitrosomonas sp. AL212 [b-proteobacteria] taxid 153948 [b-proteobacteria]

Tetratricopeptide domain protein [Nitro...

-ref|YP_742156.1| 1e-17 Alkalilimnicola ehrlichii MLHE-1 [g-proteobacteria] taxid 187272 [g-proteobacteria]

TPR repeat-containing protein [Alkalilimn...

- ref|YP_661836.1| 2e-14 Pseudoalteromonas atlantica T6c [g-proteobacteria] taxid 342610 [g-proteobacteria]

hypothetical protein Patl_2264 [Pseudoalt...

- ref|YP_528338.1| 8e-14 Saccharophagus degradans 2-40 [g-proteobacteria] taxid 203122 [g-proteobacteria]

hypothetical protein Sde_2869 [Saccharoph...

-ref|YP_002799263.1| 5e-13 Azotobacter vinelandii DJ [g-proteobacteria] taxid 322710 [g-proteobacteria]

Tetratricopeptide repeat (TPR) protein...




c)groupe d'étude: Les Rhodobacteraceaes


- ref|ZP_05781053.1| 1e-52 Citreicella sp. SE45 [a-proteobacteria] taxid 501479 [a-proteobacteria]

TPR domain protein [Citreicella sp. SE45]

-ref|ZP_01038341.1| 2e-52 Roseovarius sp. 217 [a-proteobacteria] taxid 314264 [a-proteobacteria]

hypothetical protein ROS217_02550 [Rose...

-ref|YP_167302.1| 2e-44 Ruegeria pomeroyi DSS-3 [a-proteobacteria] taxid 246200 [a-proteobacteria]

TPR domain-containing protein [Ruegeria p...

-ref|ZP_01753428.1| 5e-43 Roseobacter sp. SK209-2-6 [a-proteobacteria] taxid 388739 [a-proteobacteria]

TPR domain protein [Roseobacter sp. SK2...

-ref|ZP_05123175.1| 4e-42 Rhodobacteraceae bacterium KLH11 [a-proteobacteria] taxid 467661 [a-proteobacteria]

TPR domain protein [Rhodobacteraceae ba...

-ref|ZP_01056914.1| 5e-42 Roseobacter sp. MED193 [a-proteobacteria] taxid 314262 [a-proteobacteria]

TPR domain protein [Roseobacter sp. MED...

-ref|YP_002520811.1| 4e-41 Rhodobacter sphaeroides KD131 [a-proteobacteria] taxid 557760 [a-proteobacteria]

hypothetical protein RSKD131_3878 [Rho...

-ref|ZP_01746799.1| 2e-39 Sagittula stellata E-37 [a-proteobacteria] taxid 388399 [a-proteobacteria]

hypothetical protein SSE37_14293 [Sagit...


Groupe extérieur: Les autres alphaprotéobactéries


-ref|YP_760021.1| 1e-12 Hyphomonas neptunium ATCC 15444 [a-proteobacteria] taxid 228405 [a-proteobacteria]

hypothetical protein HNE_1303 [Hyphomonas...

-ref|NP_108456.1| 4e-38 Mesorhizobium loti MAFF303099 [a-proteobacteria] taxid 266835 [a-proteobacteria]

hypothetical protein mll8338 [Mesorhizobi...

-ref|ZP_02191333.1| 8e-34 alpha proteobacterium BAL199 [a-proteobacteria] taxid 331869 [a-proteobacteria]

flagellar motor switch protein G [alpha...

-ref|ZP_05812540.1| 2e-33 Mesorhizobium opportunistum WSM2075 [a-proteobacteria] taxid 536019 [a-proteobacteria]

Tetratricopeptide TPR_4 protein [Mesorh...

- ref|YP_001413578.1| 4e-09 Parvibaculum lavamentivorans DS-1 [a-proteobacteria] taxid 402881 [a-proteobacteria]

TPR repeat-containing protein [Parviba...



RÉSULTATS BRUTS:
cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Alphaproteobacteria [a-proteobacteria]
. . . . Rhodobacterales     [a-proteobacteria]
. . . . . Rhodobacteraceae    [a-proteobacteria]
. . . . . . Citreicella sp. SE45 ---------------------  208  4 hits [a-proteobacteria]       TPR domain protein [Citreicella sp. SE45] >gi|260421566|gb|
. . . . . . Roseovarius sp. 217 ......................  207  2 hits [a-proteobacteria]       hypothetical protein ROS217_02550 [Roseovarius sp. 217] >gi
. . . . . . Ruegeria pomeroyi DSS-3 ..................  181  2 hits [a-proteobacteria]       TPR domain-containing protein [Ruegeria pomeroyi DSS-3] >gi
. . . . . . Roseobacter sp. SK209-2-6 ................  177  2 hits [a-proteobacteria]       TPR domain protein [Roseobacter sp. SK209-2-6] >gi|12672109
. . . . . . Rhodobacteraceae bacterium KLH11 .........  173  2 hits [a-proteobacteria]       TPR domain protein [Rhodobacteraceae bacterium KLH11] >gi|2
. . . . . . Roseobacter sp. MED193 ...................  173  2 hits [a-proteobacteria]       TPR domain protein [Roseobacter sp. MED193] >gi|85824865|gb
. . . . . . Rhodobacter sphaeroides KD131 ............  170  2 hits [a-proteobacteria]       hypothetical protein RSKD131_3878 [Rhodobacter sphaeroides 
. . . . . . Sagittula stellata E-37 ..................  164  2 hits [a-proteobacteria]       hypothetical protein SSE37_14293 [Sagittula stellata E-37] 
. . . . . . Ruegeria sp. TM1040 ......................   34  2 hits [a-proteobacteria]       tetratricopeptide TPR_2 [Silicibacter sp. TM1040] >gi|99038
. . . . . . Oceanicola granulosus HTCC2516 ...........   34  2 hits [a-proteobacteria]       TPR domain protein [Oceanicola granulosus HTCC2516] >gi|890
. . . . . Rhodobacterales bacterium Y4I --------------  182  2 hits [a-proteobacteria]       TPR domain protein [Rhodobacterales bacterium Y4I] >gi|2066
. . . . . Hyphomonas neptunium ATCC 15444 ............   75  2 hits [a-proteobacteria]       hypothetical protein HNE_1303 [Hyphomonas neptunium ATCC 15
. . . . . Hirschia baltica ATCC 49814 ................   68  2 hits [a-proteobacteria]       TPR repeat-containing protein [Hirschia baltica ATCC 49814]
. . . . Mesorhizobium loti MAFF303099 ----------------  160  2 hits [a-proteobacteria]       hypothetical protein mll8338 [Mesorhizobium loti MAFF303099
. . . . alpha proteobacterium BAL199 .................  146  2 hits [a-proteobacteria]       flagellar motor switch protein G [alpha proteobacterium BAL
. . . . Mesorhizobium opportunistum WSM2075 ..........  145  4 hits [a-proteobacteria]       Tetratricopeptide TPR_4 protein [Mesorhizobium opportunistu
. . . . Parvibaculum lavamentivorans DS-1 ............   64  2 hits [a-proteobacteria]       TPR repeat-containing protein [Parvibaculum lavamentivorans
. . . . Sphingomonas wittichii RW1 ...................   56  2 hits [a-proteobacteria]       TPR repeat-containing protein [Sphingomonas wittichii RW1] 
. . . . Sinorhizobium meliloti 1021 ..................   55  2 hits [a-proteobacteria]       hypothetical protein SM_b20495 [Sinorhizobium meliloti 1021
. . . . Methylobacterium sp. 4-46 ....................   55  4 hits [a-proteobacteria]       TPR repeat-containing protein [Methylobacterium sp. 4-46] >
. . . . Methylobacterium nodulans ORS 2060 ...........   51  2 hits [a-proteobacteria]       Tetratricopeptide TPR_2 repeat protein [Methylobacterium no
. . . . Chelativorans sp. BNC1 .......................   41  2 hits [a-proteobacteria]       tetratricopeptide TPR_2 [Mesorhizobium sp. BNC1] >gi|110283
. . . . Nitrobacter winogradskyi Nb-255 ..............   35  2 hits [a-proteobacteria]       TPR repeat-containing protein [Nitrobacter winogradskyi Nb-
. . . Burkholderia pseudomallei 406e -----------------  135  2 hits [b-proteobacteria]       tetratricopeptide repeat protein [Burkholderia pseudomallei
. . . Burkholderia pseudomallei 668 ..................  135  2 hits [b-proteobacteria]       TPR repeat-containing protein [Burkholderia pseudomallei 66
. . . Burkholderia pseudomallei 576 ..................  135  2 hits [b-proteobacteria]       tetratricopeptide repeat protein [Burkholderia pseudomallei
. . . Burkholderia pseudomallei 1710a ................  135  2 hits [b-proteobacteria]       tetratricopeptide repeat protein [Burkholderia pseudomallei
. . . Burkholderia pseudomallei 305 ..................  135  2 hits [b-proteobacteria]       tetratricopeptide repeat protein [Burkholderia pseudomallei
. . . Burkholderia pseudomallei 1655 .................  135  2 hits [b-proteobacteria]       tetratricopeptide repeat protein [Burkholderia pseudomallei
. . . Burkholderia pseudomallei K96243 ...............  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 1106a ................  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei DM98 .................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 14 ...................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 91 ...................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 9 ....................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei B7210 ................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 7894 .................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei NCTC 13177 ...........  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 112 ..................  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei BCC215 ...............  135  1 hit  [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei Pakistan 9 ...........  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei MSHR346 ..............  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 1106b ................  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei Pasteur 52237 ........  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei S13 ..................  135  2 hits [b-proteobacteria]       hypothetical protein BPSS0997 [Burkholderia pseudomallei K9
. . . Burkholderia pseudomallei 1710b ................  135  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia pseudomallei 17
. . . Burkholderia mallei GB8 horse 4 ................  129  2 hits [b-proteobacteria]       TPR domain protein [Burkholderia mallei GB8 horse 4] >gi|25
. . . Burkholderia mallei ATCC 10399 .................  129  2 hits [b-proteobacteria]       TPR domain protein [Burkholderia mallei GB8 horse 4] >gi|25
. . . Burkholderia mallei ATCC 23344 .................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei SAVP1 ......................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei NCTC 10229 .................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei NCTC 10247 .................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei PRL-20 .....................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei FMH ........................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Burkholderia mallei 2002721280 .................  129  2 hits [b-proteobacteria]       TPR domain-containing protein [Burkholderia mallei ATCC 233
. . . Nitrosomonas europaea ATCC 19718 ...............   93  2 hits [b-proteobacteria]       TPR repeat-containing protein [Nitrosomonas europaea ATCC 1
. . . Nitrosomonas eutropha C91 ......................   93  2 hits [b-proteobacteria]       TPR repeat-containing protein [Nitrosomonas eutropha C91] >
. . . Alkalilimnicola ehrlichii MLHE-1 ...............   92  2 hits [g-proteobacteria]       TPR repeat-containing protein [Alkalilimnicola ehrlichii ML
. . . Nitrosospira multiformis ATCC 25196 ............   88  4 hits [b-proteobacteria]       hypothetical protein Nmul_A1877 [Nitrosospira multiformis A
. . . Nitrosomonas sp. AL212 .........................   87  2 hits [b-proteobacteria]       Tetratricopeptide domain protein [Nitrosomonas sp. AL212] >
. . . Sorangium cellulosum 'So ce 56' ................   84  2 hits [d-proteobacteria]       hypothetical protein sce2596 [Sorangium cellulosum 'So ce 5
. . . Pseudoalteromonas atlantica T6c ................   81  2 hits [g-proteobacteria]       hypothetical protein Patl_2264 [Pseudoalteromonas atlantica
. . . Saccharophagus degradans 2-40 ..................   79  2 hits [g-proteobacteria]       hypothetical protein Sde_2869 [Saccharophagus degradans 2-4
. . . Azotobacter vinelandii DJ ......................   77  2 hits [g-proteobacteria]       Tetratricopeptide repeat (TPR) protein [Azotobacter vinelan
. . . Haliangium ochraceum DSM 14365 .................   75  4 hits [d-proteobacteria]       Tetratricopeptide repeat protein [Haliangium ochraceum DSM 
. . . Nitrosococcus oceani ATCC 19707 ................   73  2 hits [g-proteobacteria]       TPR repeat-containing protein [Nitrosococcus oceani ATCC 19
. . . Nitrosococcus oceani AFC27 .....................   73  2 hits [g-proteobacteria]       TPR repeat-containing protein [Nitrosococcus oceani ATCC 19
. . . Aromatoleum aromaticum EbN1 ....................   72  2 hits [b-proteobacteria]       hypothetical protein ebA3511 [Aromatoleum aromaticum EbN1] 
. . . marine gamma proteobacterium HTCC2143 ..........   70  2 hits [g-proteobacteria]       hypothetical protein GP2143_06729 [marine gamma proteobacte
. . . Thiobacillus denitrificans ATCC 25259 ..........   68  2 hits [b-proteobacteria]       TPR repeat-containing protein [Thiobacillus denitrificans A
. . . Myxococcus xanthus DK 1622 .....................   67  4 hits [d-proteobacteria]       TPR repeat-containing protein [Myxococcus xanthus DK 1622] 
. . . marine gamma proteobacterium HTCC2080 ..........   61  2 hits [g-proteobacteria]       hypothetical protein MGP2080_09758 [marine gamma proteobact
. . . Azoarcus sp. BH72 ..............................   60  2 hits [b-proteobacteria]       hypothetical protein azo2598 [Azoarcus sp. BH72] >gi|119671
. . . Burkholderia oklahomensis C6786 ................   47  1 hit  [b-proteobacteria]       hypothetical protein BoklC_26153 [Burkholderia oklahomensis
. . . Burkholderia oklahomensis EO147 ................   47  1 hit  [b-proteobacteria]       hypothetical protein BoklE_27004 [Burkholderia oklahomensis
. . . Burkholderia thailandensis MSMB43 ..............   45  1 hit  [b-proteobacteria]       conserved hypothetical secreted protein [Burkholderia thail
. . . Anaeromyxobacter dehalogenans 2CP-1 ............   34  2 hits [d-proteobacteria]       Spermine synthase [Anaeromyxobacter dehalogenans 2CP-1] >gi
. . . Magnetococcus sp. MC-1 .........................   34  2 hits [proteobacteria]         TPR repeat-containing protein [Magnetococcus sp. MC-1] >gi|
. . . Anaeromyxobacter dehalogenans 2CP-C ............   33  2 hits [d-proteobacteria]       hypothetical protein Adeh_1209 [Anaeromyxobacter dehalogena
. . . Delftia tsuruhatensis ..........................   33  1 hit  [b-proteobacteria]       electron transfer protein [Delftia tsuruhatensis]
. . . Pseudomonas putida .............................   33  1 hit  [g-proteobacteria]       electron transfer protein [Pseudomonas putida] >gi|25529312
. . . Anaeromyxobacter sp. K .........................   33  2 hits [d-proteobacteria]       Spermine synthase [Anaeromyxobacter sp. K] >gi|196172913|gb
. . . Anaeromyxobacter sp. Fw109-5 ...................   33  2 hits [d-proteobacteria]       TPR repeat-containing protein [Anaeromyxobacter sp. Fw109-5
. . Mycobacterium smegmatis str. MC2 155 -------------  181  2 hits [high GC Gram+]          TPR domain-containing protein [Mycobacterium smegmatis str.
. . Mycobacterium gilvum PYR-GCK .....................  181  2 hits [high GC Gram+]          TPR repeat-containing protein [Mycobacterium gilvum PYR-GCK
. . Mycobacterium vanbaalenii PYR-1 ..................  179  2 hits [high GC Gram+]          TPR repeat-containing protein [Mycobacterium vanbaalenii PY
. . Streptomyces ghanaensis ATCC 14672 ...............  177  2 hits [high GC Gram+]          hypothetical protein SghaA1_02278 [Streptomyces ghanaensis 
. . Streptomyces viridochromogenes DSM 40736 .........  175  1 hit  [high GC Gram+]          hypothetical protein SvirD4_38279 [Streptomyces viridochrom
. . Mycobacterium sp. MCS ............................  172  2 hits [high GC Gram+]          tetratricopeptide TPR_2 [Mycobacterium sp. MCS] >gi|1198688
. . Mycobacterium sp. KMS ............................  172  2 hits [high GC Gram+]          tetratricopeptide TPR_2 [Mycobacterium sp. MCS] >gi|1198688
. . Mycobacterium sp. JLS ............................  172  2 hits [high GC Gram+]          tetratricopeptide TPR_2 [Mycobacterium sp. MCS] >gi|1198688
. . Beutenbergia cavernae DSM 12333 ..................  172  2 hits [high GC Gram+]          Tetratricopeptide TPR_2 repeat protein [Beutenbergia cavern
. . Streptomyces sviceus ATCC 29083 ..................  171  2 hits [high GC Gram+]          conserved hypothetical protein [Streptomyces sviceus ATCC 2
. . Streptomyces avermitilis MA-4680 .................  171  2 hits [high GC Gram+]          hypothetical protein SAV_806 [Streptomyces avermitilis MA-4
. . Streptomyces coelicolor A3(2) ....................  169  2 hits [high GC Gram+]          hypothetical protein SCO0642 [Streptomyces coelicolor A3(2)
. . Streptomyces ambofaciens ATCC 23877 ..............  165  1 hit  [high GC Gram+]          conserved hypothetical protein [Streptomyces ambofaciens AT
. . Mycobacterium kansasii ATCC 12478 ................  163  1 hit  [high GC Gram+]          hypothetical protein MkanA1_10527 [Mycobacterium kansasii A
. . Nakamurella multipartita DSM 44233 ...............  158  2 hits [high GC Gram+]          Tetratricopeptide TPR_2 repeat protein [Nakamurella multipa
. . Mycobacterium marinum M ..........................  158  2 hits [high GC Gram+]          hypothetical protein MMAR_2051 [Mycobacterium marinum M] >g
. . Mycobacterium ulcerans Agy99 .....................  157  2 hits [high GC Gram+]          hypothetical protein MUL_3298 [Mycobacterium ulcerans Agy99
. . Saccharopolyspora erythraea NRRL 2338 ............  139  2 hits [high GC Gram+]          TPR domain-containing protein [Saccharopolyspora erythraea 
. . Blastopirellula marina DSM 3645 ..................  110  2 hits [planctomycetes]         TPR repeat protein [Blastopirellula marina DSM 3645] >gi|87
. . Verrucomicrobiae bacterium DG1235 ................   98  2 hits [verrucomicrobia]        tetratricopeptide repeat domain protein [Verrucomicrobiae b
. . Gloeobacter violaceus PCC 7421 ...................   93  4 hits [cyanobacteria]          hypothetical protein gll2743 [Gloeobacter violaceus PCC 742
. . Cyanothece sp. PCC 7425 ..........................   87  4 hits [cyanobacteria]          TPR repeat-containing protein [Cyanothece sp. PCC 7425] >gi
. . Flavobacteriales bacterium HTCC2170 ..............   83  2 hits [CFB group bacteria]     hypothetical protein FB2170_15783 [Flavobacteriales bacteri
. . Robiginitalea biformata HTCC2501 .................   80  2 hits [CFB group bacteria]     hypothetical protein RB2501_12562 [Robiginitalea biformata 
. . Dyadobacter fermentans DSM 18053 .................   79  4 hits [CFB group bacteria]     hypothetical protein Dfer_0989 [Dyadobacter fermentans DSM 
. . Cyanothece sp. PCC 7424 ..........................   79  2 hits [cyanobacteria]          Tetratricopeptide domain protein [Cyanothece sp. PCC 7424] 
. . Flavobacteriales bacterium ALC-1 .................   77  2 hits [CFB group bacteria]     hypothetical protein FBALC1_11742 [Flavobacteriales bacteri
. . Cyanothece sp. CCY0110 ...........................   75  2 hits [cyanobacteria]          TPR repeat protein [Cyanothece sp. CCY0110] >gi|126621302|g
. . Trichodesmium erythraeum IMS101 ..................   72  6 hits [cyanobacteria]          tetratricopeptide region [Trichodesmium erythraeum IMS101] 
. . Cyanothece sp. PCC 8801 ..........................   69  2 hits [cyanobacteria]          Tetratricopeptide TPR_2 repeat protein [Cyanothece sp. PCC 
. . Cyanothece sp. PCC 7822 ..........................   69  2 hits [cyanobacteria]          Tetratricopeptide TPR_2 repeat protein [Cyanothece sp. PCC 
. . Cyanothece sp. PCC 8802 ..........................   69  2 hits [cyanobacteria]          Tetratricopeptide TPR_2 repeat protein [Cyanothece sp. PCC 
. . Spirosoma linguale DSM 74 ........................   68  2 hits [CFB group bacteria]     hypothetical protein SlinDRAFT_69500 [Spirosoma linguale DS
. . Candidatus Solibacter usitatus Ellin6076 .........   66  2 hits [bacteria]               TPR repeat-containing protein [Solibacter usitatus Ellin607
. . Nostoc punctiforme PCC 73102 .....................   64  2 hits [cyanobacteria]          TPR repeat-containing protein [Nostoc punctiforme PCC 73102
. . Gemmatimonas aurantiaca T-27 .....................   63  2 hits [bacteria]               hypothetical protein GAU_3388 [Gemmatimonas aurantiaca T-27
. . uncultured marine bacterium 561 ..................   60  1 hit  [bacteria]               TPR domain protein [uncultured marine bacterium 561]
. . Candidatus Koribacter versatilis Ellin345 ........   56  2 hits [bacteria]               TPR repeat-containing protein [Candidatus Koribacter versat
. . uncultured marine bacterium Ant4D5 ...............   52  1 hit  [bacteria]               conserved hypothetical protein [uncultured marine bacterium
. . Chlorobium phaeovibrioides DSM 265 ...............   37  2 hits [green sulfur bacteria]  TPR repeat-containing protein [Prosthecochloris vibrioformi
. . Symbiobacterium thermophilum IAM 14863 ...........   37  2 hits [firmicutes]             hypothetical protein STH3324 [Symbiobacterium thermophilum 
. . Chlorobium luteolum DSM 273 ......................   36  2 hits [green sulfur bacteria]  TPR repeat-containing protein [Chlorobium luteolum DSM 273]
. . Mycobacterium avium 104 ..........................   36  2 hits [high GC Gram+]          hypothetical protein MAV_0683 [Mycobacterium avium 104] >gi
. . Mycobacterium avium subsp. paratuberculosis K-10 .   36  2 hits [high GC Gram+]          hypothetical protein MAP0588 [Mycobacterium avium subsp. pa
. . Mycobacterium avium subsp. avium ATCC 25291 ......   35  1 hit  [high GC Gram+]          hypothetical protein MaviaA2_03040 [Mycobacterium avium sub
. . Stackebrandtia nassauensis DSM 44728 .............   35  2 hits [high GC Gram+]          DNA-binding transcriptional activator of the SARP family [S
. . Opitutus terrae PB90-1 ...........................   35  2 hits [verrucomicrobia]        TPR repeat-containing protein [Opitutus terrae PB90-1] >gi|
. . Thermobaculum terrenum ATCC BAA-798 ..............   33  2 hits [bacteria]               Tetratricopeptide TPR_2 repeat protein [Thermobaculum terre
. . Acaryochloris marina MBIC11017 ...................   33  2 hits [cyanobacteria]          TPR domain-containing protein [Acaryochloris marina MBIC110
. . uncultured bacterium .............................   33  1 hit  [bacteria]               electron transfer protein [Pseudomonas putida] >gi|25529312
. . Brachyspira murdochii DSM 12563 ..................   33  2 hits [spirochetes]            tetratricopeptide repeat protein [Brachyspira murdochii DSM
. . Verrucomicrobium spinosum DSM 4136 ...............   33  1 hit  [verrucomicrobia]        hypothetical protein VspiD_23075 [Verrucomicrobium spinosum
. . Chthoniobacter flavus Ellin428 ...................   33  2 hits [verrucomicrobia]        Tetratricopeptide TPR_2 repeat protein [Chthoniobacter flav
. Aspergillus fumigatus Af293 ------------------------  178  8 hits [ascomycetes]            TPR domain protein [Aspergillus fumigatus Af293] >gi|668535
. Aspergillus fumigatus A1163 ........................  178  4 hits [ascomycetes]            TPR domain protein [Aspergillus fumigatus Af293] >gi|668535
. Aspergillus niger CBS 513.88 .......................  176  6 hits [ascomycetes]            hypothetical protein An03g02690 [Aspergillus niger] >gi|134
. Aspergillus niger ..................................  176  6 hits [ascomycetes]            hypothetical protein An03g02690 [Aspergillus niger] >gi|134
. Neosartorya fischeri NRRL 181 ......................  176  4 hits [ascomycetes]            TPR domain protein [Neosartorya fischeri NRRL 181] >gi|1194
. Uncinocarpus reesii 1704 ...........................  171  2 hits [ascomycetes]            hypothetical protein UREG_05475 [Uncinocarpus reesii 1704] 
. Aspergillus oryzae RIB40 ...........................  171  8 hits [ascomycetes]            hypothetical protein [Aspergillus oryzae RIB40] >gi|8377035
. Aspergillus oryzae .................................  171  8 hits [ascomycetes]            hypothetical protein [Aspergillus oryzae RIB40] >gi|8377035
. Neurospora crassa OR74A ............................  171  2 hits [ascomycetes]            hypothetical protein NCU08076 [Neurospora crassa OR74A] >gi
. Coccidioides posadasii C735 delta SOWgp ............  169  1 hit  [ascomycetes]            tetratricopeptide repeat domain containing protein [Coccidi
. Aspergillus clavatus NRRL 1 ........................  168  2 hits [ascomycetes]            TPR domain protein [Aspergillus clavatus NRRL 1] >gi|119403
. Podospora anserina .................................  166  1 hit  [ascomycetes]            unnamed protein product [Podospora anserina]
. Coccidioides immitis RS ............................  159  1 hit  [ascomycetes]            hypothetical protein CIMG_01773 [Coccidioides immitis RS]
. Microsporum canis CBS 113480 .......................  158  1 hit  [ascomycetes]            TPR domain-containing protein [Microsporum canis CBS 113480]
. Aspergillus flavus NRRL3357 ........................  157 16 hits [ascomycetes]            TPR domain protein [Aspergillus flavus NRRL3357] >gi|220701
. Penicillium chrysogenum Wisconsin 54-1255 ..........  154 12 hits [ascomycetes]            Pc16g14210 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. Nectria haematococca mpVI 77-13-4 ..................  154  3 hits [ascomycetes]            hypothetical protein NECHADRAFT_100831 [Nectria haematococc
. Gibberella zeae PH-1 ...............................  148  1 hit  [ascomycetes]            hypothetical protein FG04205.1 [Gibberella zeae PH-1]
. Penicillium marneffei ATCC 18224 ...................  148  2 hits [ascomycetes]            TPR domain protein [Penicillium marneffei ATCC 18224] >gi|2
. Aspergillus nidulans FGSC A4 .......................  147  9 hits [ascomycetes]            hypothetical protein AN2878.2 [Aspergillus nidulans FGSC A4
. Aspergillus terreus NIH2624 ........................  144  6 hits [ascomycetes]            hypothetical protein ATEG_02415 [Aspergillus terreus NIH262
. Botryotinia fuckeliana B05.10 ......................  144  2 hits [ascomycetes]            hypothetical protein BC1G_15499 [Botryotinia fuckeliana B05
. Chaetomium globosum CBS 148.51 .....................  140  4 hits [ascomycetes]            hypothetical protein CHGG_03720 [Chaetomium globosum CBS 14
. Phaeosphaeria nodorum SN15 .........................  139  2 hits [ascomycetes]            hypothetical protein SNOG_08702 [Phaeosphaeria nodorum SN15
. Talaromyces stipitatus ATCC 10500 ..................  135  2 hits [ascomycetes]            TPR domain protein [Talaromyces stipitatus ATCC 10500] >gi|
. Cryptococcus neoformans var. neoformans B-3501A ....  130  2 hits [basidiomycetes]         hypothetical protein CNBK0030 [Cryptococcus neoformans var.
. Cryptococcus neoformans var. neoformans JEC21 ......  130  2 hits [basidiomycetes]         hypothetical protein [Cryptococcus neoformans var. neoforma
. Verticillium albo-atrum VaMs.102 ...................  110  2 hits [ascomycetes]            tetratricopeptide TPR_2 repeat protein [Verticillium albo-a
. Thalassiosira pseudonana CCMP1335 ..................   98  2 hits [diatoms]                predicted protein [Thalassiosira pseudonana CCMP1335] >gi|2
. Pyrenophora tritici-repentis Pt-1C-BFP .............   96  2 hits [ascomycetes]            TPR domain containing protein [Pyrenophora tritici-repentis
. Phaeodactylum tricornutum CCAP 1055/1 ..............   73  4 hits [diatoms]                predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. Micromonas sp. RCC299 ..............................   43  2 hits [green algae]            predicted protein [Micromonas sp. RCC299] >gi|226522102|gb|
. Monosiga brevicollis MX1 ...........................   41  2 hits [choanoflagellates]      hypothetical protein [Monosiga brevicollis MX1] >gi|1637751
. Chlamydomonas reinhardtii ..........................   39  2 hits [green algae]            hypothetical protein CHLREDRAFT_168283 [Chlamydomonas reinh
. Halomicrobium mukohataei DSM 12286 .................   35  2 hits [euryarchaeotes]         DNA polymerase II, large subunit DP2 [Halomicrobium mukohat
. Trichoplax adhaerens ...............................   35  2 hits [placozoans]             hypothetical protein TRIADDRAFT_61437 [Trichoplax adhaerens
. Perkinsus marinus ATCC 50983 .......................   33  1 hit  [eukaryotes]             Tetratricopeptide repeat protein, putative [Perkinsus marin
. Lobaria scrobiculata ...............................   33  1 hit  [ascomycetes]            RNA polymerase II second largest subunit [Lobaria scrobicul
. Parmeliella appalachensis ..........................   33  1 hit  [ascomycetes]            RNA polymerase II second largest subunit [Parmeliella appal
. Drosophila virilis .................................   33  2 hits [flies]                  GJ16659 [Drosophila virilis] >gi|194146628|gb|EDW62347.1| G
. Lobaria quercizans .................................   33  1 hit  [ascomycetes]            DNA-dependent RNA polymerase II second largest subunit [Lob
. Lobariella pallida .................................   33  2 hits [ascomycetes]            RNA polymerase II second largest subunit [Lobariella pallid
. Pseudocyphellaria anomala ..........................   33  1 hit  [ascomycetes]            RNA polymerase II second largest subunit [Pseudocyphellaria
. Diploschistes muscorum .............................   33  1 hit  [ascomycetes]            DNA-dependent RNA polymerase II second largest subunit [Dip




Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Wolinella succinogenes -----------   31 1 hit  [e-proteobacteria]    RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName
. . Porphyromonas gingivalis .........   29 1 hit  [CFB group bacteria]  RecName: Full=UPF0313 protein PG_0934
. Arabidopsis thaliana (thale-cress) -   31 1 hit  [eudicots]            RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-a
. Homo sapiens (man) .................   29 1 hit  [primates]            RecName: Full=CCR4-NOT transcription complex subunit 1; Alt
. Mus musculus (mouse) ...............   29 1 hit  [rodents]             RecName: Full=CCR4-NOT transcription complex subunit 1; Alt

BLAST

PROTOCOLE:

a)BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions_500"

b)BLASTp contre swissprot, paramètres par défaut au NCBI sauf "Number of descriptions_500"


ANALYSE DES RÉSULTATS:


a)Nous avons obtenue de nombreuses séquences similaires à la notre avec des bons scores de e-value nous pouvons donc dire qu'elle est codante. Le meilleur score que nous ayons obtenue est de 10e-52 et correspond à un domaine protéique de chez Citreicella.

Nous avons établi un seuil à 10e-4 car c'est à partir de ce score que les e-values augmentent rapidement (elles passent de 5e-04 à 0.002). Toutes les séquences ayant une e-value supérieure à 10e-4 ne sont pas considérées comme homologue à notre ORF.

La plus grande partie des séquences ayant les meilleurs E-values codent pour un domaine protéique TPR (qui n'a pas été mit en évidence par la recherche de domaine protéique) qui est un domaine d'interaction protéine-protéine que l'on retrouve chez de nombreuses bactéries.

On remarque que dans les 10 meilleurs scores on retrouve deux séquences provenant de champignon qui possèdent aussi ce domaine TPR, on pourrait alors envisager que la protéine pour laquelle code notre séquence se retrouve chez certain champignon en plus de se retrouver chez les bactéries ceci pouvant s'expliquer par un transfert horizontal de la séquence codante pour le domaine TPR.


c)Aucune des séquences obtenues avec un BLAST contre swissprot n'est assez similaire à la notre pour que l'on puisse en déduire sa fonction.

RÉSULTATS BRUTS:

a)Blaste P contre NR

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05781053.1|  TPR domain protein [Citreicella sp. SE45] ...   208    1e-52
ref|ZP_01038341.1|  hypothetical protein ROS217_02550 [Roseova...   207    2e-52
ref|ZP_05077928.1|  TPR domain protein [Rhodobacterales bacter...   182    9e-45
ref|YP_887877.1|  TPR domain-containing protein [Mycobacterium...   181    2e-44 
ref|YP_001134595.1|  TPR repeat-containing protein [Mycobacter...   181    2e-44 
ref|YP_167302.1|  TPR domain-containing protein [Ruegeria pome...   181    2e-44 
ref|YP_953865.1|  TPR repeat-containing protein [Mycobacterium...   179    1e-43 
ref|XP_755884.1|  TPR domain protein [Aspergillus fumigatus Af...   178    2e-43 
ref|ZP_04683979.1|  hypothetical protein SghaA1_02278 [Strepto...   177    2e-43
ref|ZP_01753428.1|  TPR domain protein [Roseobacter sp. SK209-...   177    5e-43
ref|XP_001390166.1|  hypothetical protein An03g02690 [Aspergil...   176    5e-43 
ref|XP_001261011.1|  TPR domain protein [Neosartorya fischeri ...   176    5e-43 
ref|ZP_05536298.1|  hypothetical protein SvirD4_38279 [Strepto...   175    1e-42
ref|ZP_05123175.1|  TPR domain protein [Rhodobacteraceae bacte...   173    4e-42
ref|ZP_01056914.1|  TPR domain protein [Roseobacter sp. MED193...   173    5e-42
ref|YP_639932.1|  tetratricopeptide TPR_2 [Mycobacterium sp. M...   172    9e-42 
ref|YP_002880407.1|  Tetratricopeptide TPR_2 repeat protein [B...   172    1e-41 
ref|XP_002584786.1|  hypothetical protein UREG_05475 [Uncinoca...   171    2e-41 
ref|XP_001727323.1|  hypothetical protein [Aspergillus oryzae ...   171    2e-41 
ref|ZP_05021282.1|  conserved hypothetical protein [Streptomyc...   171    2e-41
ref|NP_821981.1|  hypothetical protein SAV_806 [Streptomyces a...   171    2e-41 
ref|XP_965207.1|  hypothetical protein NCU08076 [Neurospora cr...   171    3e-41 
ref|YP_002520811.1|  hypothetical protein RSKD131_3878 [Rhodob...   170    4e-41 
gb|EER23347.1|  tetratricopeptide repeat domain containing pro...   169    7e-41
ref|NP_624951.1|  hypothetical protein SCO0642 [Streptomyces c...   169    7e-41 
ref|XP_001275832.1|  TPR domain protein [Aspergillus clavatus ...   168    1e-40 
emb|CAP65626.1|  unnamed protein product [Podospora anserina]       166    9e-40
gb|EDP53634.1|  TPR domain protein [Aspergillus fumigatus A1163]    166    1e-39
emb|CAJ88390.1|  conserved hypothetical protein [Streptomyces ...   165    1e-39
ref|XP_748346.1|  TPR domain protein [Aspergillus fumigatus Af...   165    1e-39 
ref|ZP_01746799.1|  hypothetical protein SSE37_14293 [Sagittul...   164    2e-39
ref|ZP_04748398.1|  hypothetical protein MkanA1_10527 [Mycobac...   163    5e-39
ref|NP_108456.1|  hypothetical protein mll8338 [Mesorhizobium ...   160    4e-38 
ref|XP_001248002.1|  hypothetical protein CIMG_01773 [Coccidio...   159    1e-37 
ref|YP_003203603.1|  Tetratricopeptide TPR_2 repeat protein [N...   158    2e-37
gb|EEQ30762.1|  TPR domain-containing protein [Microsporum can...   158    2e-37
ref|YP_001850356.1|  hypothetical protein MMAR_2051 [Mycobacte...   158    2e-37 
ref|YP_906961.1|  hypothetical protein MUL_3298 [Mycobacterium...   157    3e-37 
ref|XP_001258631.1|  tetratricopeptide repeat domain protein [...   157    3e-37 
ref|XP_002372995.1|  TPR domain protein [Aspergillus flavus NR...   157    3e-37 
ref|XP_002561719.1|  Pc16g14210 [Penicillium chrysogenum Wisco...   154    2e-36 
gb|EEU39364.1|  hypothetical protein NECHADRAFT_100831 [Nectri...   154    2e-36
ref|XP_002567739.1|  Pc21g06970 [Penicillium chrysogenum Wisco...   154    4e-36 
ref|XP_001817844.1|  hypothetical protein [Aspergillus oryzae ...   153    5e-36 
ref|XP_001395684.1|  hypothetical protein An12g06200 [Aspergil...   153    7e-36 
ref|XP_001399577.1|  hypothetical protein An02g04400 [Aspergil...   149    8e-35 
ref|XP_384381.1|  hypothetical protein FG04205.1 [Gibberella z...   148    2e-34 
ref|XP_002148598.1|  TPR domain protein [Penicillium marneffei...   148    2e-34 
ref|XP_660482.1|  hypothetical protein AN2878.2 [Aspergillus n...   147    3e-34 
ref|XP_661591.1|  hypothetical protein AN3987.2 [Aspergillus n...   147    4e-34 
ref|ZP_02191333.1|  flagellar motor switch protein G [alpha pr...   146    8e-34
gb|EEU42605.1|  hypothetical protein NECHADRAFT_84033 [Nectria...   145    9e-34
ref|XP_660261.1|  hypothetical protein AN2657.2 [Aspergillus n...   145    1e-33 
ref|ZP_05812540.1|  Tetratricopeptide TPR_4 protein [Mesorhizo...   145    2e-33
ref|XP_002375572.1|  hypothetical protein AFLA_015520 [Aspergi...   144    2e-33 
ref|XP_001211593.1|  hypothetical protein ATEG_02415 [Aspergil...   144    3e-33 
ref|XP_001545830.1|  hypothetical protein BC1G_15499 [Botryoti...   144    4e-33 
gb|EEU48937.1|  hypothetical protein NECHADRAFT_31448 [Nectria...   141    2e-32
ref|XP_001222934.1|  hypothetical protein CHGG_03720 [Chaetomi...   140    3e-32 
ref|XP_002561124.1|  Pc16g08020 [Penicillium chrysogenum Wisco...   139    7e-32 
ref|XP_001799012.1|  hypothetical protein SNOG_08702 [Phaeosph...   139    7e-32 
ref|XP_001817842.1|  hypothetical protein [Aspergillus oryzae ...   139    9e-32 
ref|XP_002372992.1|  TPR domain protein [Aspergillus flavus NR...   139    1e-31 
ref|YP_001104973.1|  TPR domain-containing protein [Saccharopo...   139    1e-31 
gb|EDP50881.1|  TPR domain protein [Aspergillus fumigatus A1163]    137    2e-31
ref|XP_748302.1|  TPR domain protein [Aspergillus fumigatus Af...   137    3e-31 
ref|XP_001826908.1|  hypothetical protein [Aspergillus oryzae ...   137    3e-31 
ref|ZP_04967826.1|  tetratricopeptide repeat protein [Burkhold...   135    2e-30
ref|YP_001062462.1|  TPR repeat-containing protein [Burkholder...   135    2e-30 
ref|ZP_03450381.1|  tetratricopeptide repeat protein [Burkhold...   135    2e-30
ref|ZP_01765802.1|  tetratricopeptide repeat protein [Burkhold...   135    2e-30
ref|YP_111003.1|  hypothetical protein BPSS0997 [Burkholderia ...   135    2e-30 
ref|YP_337758.1|  TPR domain-containing protein [Burkholderia ...   135    2e-30 
ref|XP_002485632.1|  TPR domain protein [Talaromyces stipitatu...   135    2e-30 
ref|XP_001394406.1|  hypothetical protein An11g04110 [Aspergil...   133    6e-30 
ref|XP_001393621.1|  hypothetical protein An09g03050 [Aspergil...   133    8e-30 
ref|XP_001390457.1|  hypothetical protein An03g05780 [Aspergil...   132    1e-29 
gb|EDP50885.1|  conserved hypothetical protein [Aspergillus fu...   132    1e-29
ref|XP_001824528.1|  hypothetical protein [Aspergillus oryzae ...   132    2e-29 
ref|XP_748299.1|  conserved hypothetical protein [Aspergillus ...   132    2e-29 
ref|XP_002384110.1|  conserved hypothetical protein [Aspergill...   131    2e-29 
ref|XP_772927.1|  hypothetical protein CNBK0030 [Cryptococcus ...   130    4e-29 
ref|XP_567729.1|  hypothetical protein [Cryptococcus neoforman...   130    5e-29 
ref|ZP_04610445.1|  TPR domain protein [Burkholderia mallei GB...   129    1e-28
ref|YP_105857.1|  TPR domain-containing protein [Burkholderia ...   129    1e-28 
ref|XP_002566315.1|  Pc22g24270 [Penicillium chrysogenum Wisco...   127    3e-28 
ref|XP_002563593.1|  Pc20g11040 [Penicillium chrysogenum Wisco...   126    7e-28 
ref|XP_002564786.1|  Pc22g07700 [Penicillium chrysogenum Wisco...   126    8e-28 
ref|XP_002378002.1|  conserved hypothetical protein [Aspergill...   125    1e-27 
ref|XP_001826313.1|  hypothetical protein [Aspergillus oryzae ...   125    1e-27 
ref|XP_001211717.1|  conserved hypothetical protein [Aspergill...   124    2e-27 
ref|XP_002383470.1|  conserved hypothetical protein [Aspergill...   122    2e-26 
ref|XP_002380130.1|  conserved hypothetical protein [Aspergill...   121    2e-26 
ref|XP_001818712.1|  hypothetical protein [Aspergillus oryzae ...   121    2e-26 
ref|XP_001816620.1|  hypothetical protein [Aspergillus oryzae ...   115    2e-24 
ref|XP_001226002.1|  hypothetical protein CHGG_10735 [Chaetomi...   112    1e-23 
gb|EEY14653.1|  tetratricopeptide TPR_2 repeat protein [Vertic...   110    4e-23
ref|ZP_01088815.1|  TPR repeat protein [Blastopirellula marina...   110    7e-23
ref|ZP_05057971.1|  tetratricopeptide repeat domain protein [V...  98.6    2e-19
ref|XP_002286353.1|  predicted protein [Thalassiosira pseudona...  98.2    2e-19 
ref|XP_001939303.1|  TPR domain containing protein [Pyrenophor...  96.7    7e-19 
ref|NP_840897.1|  TPR repeat-containing protein [Nitrosomonas ...  94.0    4e-18 
ref|NP_925689.1|  hypothetical protein gll2743 [Gloeobacter vi...  94.0    4e-18 
ref|YP_746938.1|  TPR repeat-containing protein [Nitrosomonas ...  93.2    7e-18 
ref|YP_742156.1|  TPR repeat-containing protein [Alkalilimnico...  92.4    1e-17 
ref|YP_412564.1|  hypothetical protein Nmul_A1877 [Nitrosospir...  89.0    2e-16 
ref|XP_001210254.1|  conserved hypothetical protein [Aspergill...  87.8    3e-16 
ref|YP_002483402.1|  TPR repeat-containing protein [Cyanothece...  87.8    3e-16 
ref|ZP_05314739.1|  Tetratricopeptide domain protein [Nitrosom...  87.0    5e-16
ref|YP_412656.1|  hypothetical protein Nmul_A1969 [Nitrosospir...  86.7    7e-16 
ref|YP_001613235.1|  hypothetical protein sce2596 [Sorangium c...  84.7    3e-15 
gb|EEY21428.1|  TPR domain-containing protein [Verticillium al...  84.3    4e-15
ref|ZP_01106451.1|  hypothetical protein FB2170_15783 [Flavoba...  84.0    5e-15
ref|YP_661836.1|  hypothetical protein Patl_2264 [Pseudoaltero...  81.6    2e-14 
ref|YP_003195507.1|  hypothetical protein RB2501_12562 [Robigi...  80.1    7e-14 
ref|YP_528338.1|  hypothetical protein Sde_2869 [Saccharophagu...  79.7    8e-14 
ref|YP_003085403.1|  hypothetical protein Dfer_0989 [Dyadobact...  79.7    9e-14 
ref|YP_002377624.1|  Tetratricopeptide domain protein [Cyanoth...  79.7    1e-13 
ref|YP_002483567.1|  TPR repeat-containing protein [Cyanothece...  79.7    1e-13 
ref|ZP_02183353.1|  hypothetical protein FBALC1_11742 [Flavoba...  77.8    3e-13
ref|YP_002799263.1|  Tetratricopeptide repeat (TPR) protein [A...  77.4    5e-13 
ref|ZP_01728474.1|  TPR repeat protein [Cyanothece sp. CCY0110...  75.9    1e-12
ref|YP_003268853.1|  Tetratricopeptide repeat protein [Haliang...  75.5    1e-12 
ref|YP_760021.1|  hypothetical protein HNE_1303 [Hyphomonas ne...  75.5    1e-12 
ref|XP_002182730.1|  predicted protein [Phaeodactylum tricornu...  73.6    6e-12 
ref|YP_343848.1|  TPR repeat-containing protein [Nitrosococcus...  73.2    8e-12 
ref|YP_720476.1|  tetratricopeptide region [Trichodesmium eryt...  72.8    1e-11 
ref|YP_159004.1|  hypothetical protein ebA3511 [Aromatoleum ar...  72.0    2e-11 
ref|ZP_01618270.1|  hypothetical protein GP2143_06729 [marine ...  70.9    5e-11
ref|YP_002372832.1|  Tetratricopeptide TPR_2 repeat protein [C...  69.7    1e-10 
ref|ZP_03157275.1|  Tetratricopeptide TPR_2 repeat protein [Cy...  69.3    1e-10
ref|YP_003139091.1|  Tetratricopeptide TPR_2 repeat protein [C...  69.3    1e-10 
ref|ZP_04493848.1|  hypothetical protein SlinDRAFT_69500 [Spir...  68.6    2e-10
ref|YP_315129.1|  TPR repeat-containing protein [Thiobacillus ...  68.2    2e-10 
ref|YP_003060602.1|  TPR repeat-containing protein [Hirschia b...  68.2    2e-10 
ref|YP_630480.1|  TPR repeat-containing protein [Myxococcus xa...  67.8    4e-10 
ref|YP_821305.1|  TPR repeat-containing protein [Solibacter us...  66.6    8e-10 
ref|YP_003085989.1|  Tetratricopeptide domain protein [Dyadoba...  66.6    8e-10 
ref|NP_925307.1|  hypothetical protein gll2361 [Gloeobacter vi...  65.9    1e-09 
ref|YP_001864635.1|  TPR repeat-containing protein [Nostoc pun...  64.3    4e-09 
ref|YP_001413578.1|  TPR repeat-containing protein [Parvibacul...  64.3    4e-09 
ref|YP_002762900.1|  hypothetical protein GAU_3388 [Gemmatimon...  63.5    6e-09 
ref|ZP_01626107.1|  hypothetical protein MGP2080_09758 [marine...  61.2    4e-08
ref|YP_934102.1|  hypothetical protein azo2598 [Azoarcus sp. B...  60.5    5e-08 
gb|AAR37954.1|  TPR domain protein [uncultured marine bacteriu...  60.5    6e-08
ref|ZP_05783358.1|  TPR domain protein [Citreicella sp. SE45] ...  59.3    1e-07
ref|YP_001261987.1|  TPR repeat-containing protein [Sphingomon...  56.6    9e-07 
ref|YP_589847.1|  TPR repeat-containing protein [Candidatus Ko...  56.2    1e-06 
ref|NP_437017.1|  hypothetical protein SM_b20495 [Sinorhizobiu...  55.5    2e-06 
ref|YP_001767970.1|  TPR repeat-containing protein [Methylobac...  55.5    2e-06 
gb|ABC25420.1|  conserved hypothetical protein [uncultured mar...  52.8    1e-05
ref|YP_002498517.1|  Tetratricopeptide TPR_2 repeat protein [M...  52.0    2e-05 
ref|ZP_02366220.1|  hypothetical protein BoklC_26153 [Burkhold...  47.4    5e-04
ref|ZP_02359151.1|  hypothetical protein BoklE_27004 [Burkhold...  47.4    5e-04
ref|ZP_02469080.1|  conserved hypothetical secreted protein [B...  45.4    0.002
ref|YP_001771081.1|  TPR repeat-containing protein [Methylobac...  44.7    0.003 
ref|XP_002506829.1|  predicted protein [Micromonas sp. RCC299]...  43.9    0.005 
ref|ZP_05811868.1|  conserved hypothetical secreted protein [M...  43.5    0.007
ref|YP_673177.1|  tetratricopeptide TPR_2 [Mesorhizobium sp. B...  42.0    0.023 
ref|XP_001746360.1|  hypothetical protein [Monosiga brevicolli...  41.2    0.037 
ref|XP_001698435.1|  hypothetical protein CHLREDRAFT_168283 [C...  39.7    0.091 
ref|YP_001130611.1|  TPR repeat-containing protein [Prosthecoc...  37.4    0.52  
ref|YP_077149.1|  hypothetical protein STH3324 [Symbiobacteriu...  37.4    0.55  
ref|YP_374659.1|  TPR repeat-containing protein [Chlorobium lu...  37.0    0.60  
ref|YP_879962.1|  hypothetical protein MAV_0683 [Mycobacterium...  37.0    0.68  
ref|NP_959522.1|  hypothetical protein MAP0588 [Mycobacterium ...  36.6    0.94  
ref|ZP_05215155.1|  hypothetical protein MaviaA2_03040 [Mycoba...  35.8    1.3  
ref|ZP_04481540.1|  DNA-binding transcriptional activator of t...  35.8    1.3  
ref|YP_001820037.1|  TPR repeat-containing protein [Opitutus t...  35.4    1.7   
ref|XP_002182835.1|  predicted protein [Phaeodactylum tricornu...  35.4    2.0   
ref|YP_003176601.1|  DNA polymerase II, large subunit DP2 [Hal...  35.0    2.3   
ref|XP_002117457.1|  hypothetical protein TRIADDRAFT_61437 [Tr...  35.0    2.3   
ref|YP_319606.1|  TPR repeat-containing protein [Nitrobacter w...  35.0    2.8   
ref|YP_002493159.1|  Spermine synthase [Anaeromyxobacter dehal...  34.7    3.7   
ref|ZP_04686178.1|  hypothetical protein SghaA1_13446 [Strepto...  34.3    3.9  
ref|YP_864226.1|  TPR repeat-containing protein [Magnetococcus...  34.3    4.2   
ref|YP_614346.1|  tetratricopeptide TPR_2 [Silicibacter sp. TM...  34.3    4.3   
ref|YP_003265715.1|  Tetratricopeptide TPR_4 [Haliangium ochra...  34.3    4.3   
ref|YP_722823.1|  tetratricopeptide TPR_2 [Trichodesmium eryth...  34.3    4.8   
ref|ZP_01155441.1|  TPR domain protein [Oceanicola granulosus ...  34.3    4.9  
gb|EER18335.1|  Tetratricopeptide repeat protein, putative [Pe...  33.9    5.3  
gb|ABI49100.1|  RNA polymerase II second largest subunit [Loba...  33.9    5.5  
gb|ABM81516.1|  RNA polymerase II second largest subunit [Parm...  33.9    5.7  
ref|YP_464420.1|  hypothetical protein Adeh_1209 [Anaeromyxoba...  33.9    5.8   
ref|XP_002056861.1|  GJ16659 [Drosophila virilis] >gb|EDW62347...  33.9    5.8   
ref|YP_630180.1|  TPR repeat-containing MJ0042 family protein ...  33.9    5.9   
ref|YP_720410.1|  TPR repeat-containing protein [Trichodesmium...  33.5    7.0   
ref|YP_003321827.1|  Tetratricopeptide TPR_2 repeat protein [T...  33.5    7.2  
ref|YP_001520579.1|  TPR domain-containing protein [Acaryochlo...  33.5    7.3   
gb|AAX47243.1|  electron transfer protein [Delftia tsuruhatensis]  33.5    7.8  
dbj|BAA12809.1|  electron transfer protein [Pseudomonas putida...  33.5    8.0  
ref|ZP_04046904.1|  tetratricopeptide repeat protein [Brachysp...  33.5    8.2  
ref|YP_002135015.1|  Spermine synthase [Anaeromyxobacter sp. K...  33.5    8.3   
gb|AAU86978.1|  DNA-dependent RNA polymerase II second largest...  33.1    8.6  
ref|ZP_02929582.1|  hypothetical protein VspiD_23075 [Verrucom...  33.1    8.9  
gb|ABI49103.1|  RNA polymerase II second largest subunit [Loba...  33.1    9.2  
ref|YP_001377874.1|  TPR repeat-containing protein [Anaeromyxo...  33.1    9.6   
gb|ABI49101.1|  RNA polymerase II second largest subunit [Pseu...  33.1    9.6  
ref|ZP_03131314.1|  Tetratricopeptide TPR_2 repeat protein [Ch...  33.1    9.7  
gb|AAS67512.1|  DNA-dependent RNA polymerase II second largest...  33.1    9.8  
gb|ABI49104.1|  RNA polymerase II second largest subunit [Loba...  33.1    9.9  


Alignement 2 à 2 entre l'ORF et les séquences ayant les dix meilleurs E-values:

>ref|ZP_05781053.1|  TPR domain protein [Citreicella sp. SE45]
 gb|EEX14817.1|  TPR domain protein [Citreicella sp. SE45]
Length=544
 Score =  208 bits (530),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 89/158 (56%), Positives = 123/158 (77%), Gaps = 0/158 (0%)
Query  5    SSKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDG  64
            ++ F+++ + +P+SRMLFNN  RD+L +A+ MM+GE+E+K GN + GL+HLR++V LDD 
Sbjct  383  AAAFVQARDALPESRMLFNNTGRDILGVAEAMMLGELEYKRGNKEAGLAHLRRSVALDDA  442
Query  65   LAYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGL  124
            L Y+EPW W QPTRHALGALL+ AG++ EAE V+RADLGLD  L R CQ+P NVWSLHGL
Sbjct  443  LPYDEPWGWMQPTRHALGALLLDAGQYGEAEAVYRADLGLDDTLARACQHPGNVWSLHGL  502
Query  125  HECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFCR  162
            HECL  R + VE  H+   L++A+AR ++ + +SC+CR
Sbjct  503  HECLVRRGEKVEAAHIGRQLDKARARAEVPVRASCYCR  540

>ref|ZP_01038341.1|  hypothetical protein ROS217_02550 [Roseovarius sp. 217]
 gb|EAQ23095.1|  hypothetical protein ROS217_02550 [Roseovarius sp. 217]
Length=555
 Score =  207 bits (528),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            F  +   VPD  M+FNN    VL +A++MM+GE+ +K+G  + GL HLR AV+LDDG+ Y
Sbjct  387  FATAQRAVPDDWMMFNNPCSAVLLVAEQMMLGELAYKSGQTEAGLEHLRAAVRLDDGMLY  446
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QP RHALGALLM AG++ EAE V+RADLGLD  LPRPCQ+P+NVWSLHGL EC
Sbjct  447  DEPWGWMQPARHALGALLMDAGQYAEAEVVYRADLGLDQTLPRPCQHPRNVWSLHGLDEC  506
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFCRNK  164
            L  R +TVE  H+ L L+QA AR ++ I SSC+CR+K
Sbjct  507  LRRRDETVERRHIGLQLDQAMARAEVPIRSSCYCRSK  543

>ref|ZP_05077928.1|  TPR domain protein [Rhodobacterales bacterium Y4I]
 gb|EDZ45907.1|  TPR domain protein [Rhodobacterales bacterium Y4I]
Length=557
 Score =  182 bits (463),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 82/155 (52%), Positives = 110/155 (70%), Gaps = 0/155 (0%)
Query  7    KFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLA  66
            +FL +   VPD+R+L NN+  D+L IA EM+ GEIE++  N +   +HLR++ +LDD L 
Sbjct  391  QFLAAKARVPDTRLLHNNRVVDLLEIAAEMLRGEIEYRKQNYEAAFTHLRRSAELDDSLP  450
Query  67   YEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHE  126
            Y+EPW W QPTRHALGALL   G+  EAE V+RADLGLDG LPR   +P N+WSL GLH+
Sbjct  451  YDEPWGWMQPTRHALGALLFEQGQTAEAEAVYRADLGLDGSLPRASVHPDNIWSLKGLHD  510
Query  127  CLFIRKDTVELPHVELLLNQAKARTDIVINSSCFC  161
            CL  R ++VE+ H++  L+ A AR D  + +SCFC
Sbjct  511  CLKARGESVEIKHIKQKLDLALARADRAVGASCFC  545

>ref|YP_887877.1|  TPR domain-containing protein [Mycobacterium smegmatis str. MC2 
155]
 gb|ABK73790.1|  TPR domain protein [Mycobacterium smegmatis str. MC2 155]
Length=533
 GENE ID: 4536519 MSMEG_3574 | TPR domain-containing protein
[Mycobacterium smegmatis str. MC2 155]
 Score =  181 bits (460),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 84/158 (53%), Positives = 107/158 (67%), Gaps = 0/158 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            F+K+Y+ +P++R LFNN SRD+LAIA  M+ GEI ++ G+  +   HLR+A+ LDD L Y
Sbjct  369  FIKAYDRIPETRYLFNNTSRDILAIAGAMLDGEIAYRRGDHDVAFEHLRRAIALDDNLPY  428
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QPTRHA GALL+  G  +EA  V+ ADLGLD  L R CQ+P NVWSLHG HEC
Sbjct  429  DEPWGWMQPTRHAYGALLLEQGRVEEAAQVYAADLGLDPTLSRACQHPNNVWSLHGYHEC  488
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFCRNKV  165
            L       E   +   L  A ARTD+ IN+SC CR +V
Sbjct  489  LRRLGRDAEAAIIGKQLELALARTDVPINASCACRLEV  526

>ref|YP_001134595.1|  TPR repeat-containing protein [Mycobacterium gilvum PYR-GCK]
 gb|ABP45807.1|  TPR repeat-containing protein [Mycobacterium gilvum PYR-GCK]
Length=565
 GENE ID: 4974651 Mflv_3331 | TPR repeat-containing protein
[Mycobacterium gilvum PYR-GCK]
 Score =  181 bits (460),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 83/155 (53%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            F  +Y+ +P+SR LFNN SRD+LA+A  M+ GEI+++AG+     +HLR+AV+LDD + Y
Sbjct  404  FAAAYDRIPESRYLFNNTSRDILAVAATMLDGEIDYRAGDHDAAFAHLRRAVELDDAMPY  463
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QPTRHALGALL+  G  +EA  V+ ADLGLD  L RPCQ+P NVWSLHG HEC
Sbjct  464  DEPWGWMQPTRHALGALLLEQGRVEEAAQVYAADLGLDPTLSRPCQHPGNVWSLHGYHEC  523
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFCR  162
            L       E   +   L  A AR D+ I +SC CR
Sbjct  524  LTRLGRDAEAVIIGKQLELAAARADVPIEASCACR  558

>ref|YP_167302.1|  TPR domain-containing protein [Ruegeria pomeroyi DSS-3]
 gb|AAV95343.1|  TPR domain protein [Ruegeria pomeroyi DSS-3]
Length=557
 GENE ID: 3193603 SPO2072 | TPR domain-containing protein
[Silicibacter pomeroyi DSS-3] (10 or fewer PubMed links)
 Score =  181 bits (460),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 83/154 (53%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            FL +   VP+SR+L NN+  D+L IA+EM+ GEIE++ G+  +  +HLR++++LDD L Y
Sbjct  395  FLAAAARVPESRLLHNNRVVDLLEIAKEMLRGEIEYRKGSYDLAYAHLRRSIELDDTLPY  454
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QPTRHALGALL   G  DEAETV+RADLGL G+L R   +P NVWSL GLH+C
Sbjct  455  DEPWGWMQPTRHALGALLFEQGHVDEAETVYRADLGLGGQLSRAAVHPDNVWSLKGLHDC  514
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFC  161
            L  R +TVE+  +   L+ A AR D  + +SCFC
Sbjct  515  LKARAETVEIIQIRQRLDLALARADRAVGASCFC  548

>ref|YP_953865.1|  TPR repeat-containing protein [Mycobacterium vanbaalenii PYR-1]
 gb|ABM13859.1|  Tetratricopeptide TPR_2 repeat protein [Mycobacterium vanbaalenii 
PYR-1]
Length=559
 GENE ID: 4643278 Mvan_3057 | TPR repeat-containing protein
[Mycobacterium vanbaalenii PYR-1]
 Score =  179 bits (453),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 84/155 (54%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            F  +Y+ +PDSR LFNN SRD+LA+A  M+ GEI+++AG      +HLR+AV+LDD L Y
Sbjct  398  FAAAYDRIPDSRYLFNNTSRDILAVAAAMLDGEIDYRAGRFDDAFAHLRRAVELDDTLPY  457
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QPTRHALGALL+  G  +EA  V+ ADLGLD  L R CQ+P NVWSLHG HEC
Sbjct  458  DEPWGWMQPTRHALGALLLEQGRVEEAAQVYAADLGLDPTLSRSCQHPGNVWSLHGYHEC  517
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFCR  162
            L       E   +   L  A AR D+ I +SC CR
Sbjct  518  LTRLGRGPEALIIGKQLELAAARADVPIEASCACR  552

>ref|XP_755884.1|  TPR domain protein [Aspergillus fumigatus Af293]
 gb|EAL93846.1|  TPR domain protein [Aspergillus fumigatus Af293]
 gb|EDP55053.1|  TPR domain protein [Aspergillus fumigatus A1163]
Length=562
 GENE ID: 3512886 AFUA_2G15490 | TPR domain protein
[Aspergillus fumigatus Af293] (10 or fewer PubMed links)
 Score =  178 bits (451),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
Query  6    SKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGL  65
            ++F K+++ VP SR LFNN  RD+LAIA+ M+ GEIE++ GN+     HLR+++ LDDGL
Sbjct  401  TEFHKAFDRVPPSRTLFNNTCRDILAIAEAMLDGEIEYRRGNIDAAFKHLRQSIALDDGL  460
Query  66   AYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLH  125
             Y+EPW W QPTRHA GALL+  G+ ++A  V+ ADLG+D  LPR  Q+P NVWSLHG H
Sbjct  461  PYDEPWGWMQPTRHAYGALLLEQGQVEKAAEVYGADLGMDDTLPRALQHPNNVWSLHGYH  520
Query  126  ECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFCR  162
            ECL       E   ++  L  A A  D+ I SSCFCR
Sbjct  521  ECLTRLGRLAEARIIQQQLKLAAATADVPIRSSCFCR  557

>ref|ZP_04683979.1|  hypothetical protein SghaA1_02278 [Streptomyces ghanaensis ATCC 
14672]
Length=560
 Score =  177 bits (450),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 83/155 (53%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
Query  8    FLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGLAY  67
            F  +   VP +RMLFNN  RD+LA+A  M+ GE+ ++ G+     + L +AV LDD L Y
Sbjct  391  FRAAVSRVPGTRMLFNNTCRDILAVAAAMLDGELAYRKGDHDTAFAALERAVALDDNLPY  450
Query  68   EEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLHEC  127
            +EPW W QPTRHA GALL+  G  +EAE V+RADLGLD  LPRP Q+P NVW+LHG HEC
Sbjct  451  DEPWGWMQPTRHAYGALLLEQGRVEEAEAVYRADLGLDATLPRPLQHPGNVWALHGFHEC  510
Query  128  LFIRKDTVELPHVELLLNQAKARTDIVINSSCFCR  162
            L     T E   V   L QA A  D+ I SSCFCR
Sbjct  511  LLRTGRTGEAAIVAQQLKQAAALADVPIESSCFCR  545

>ref|ZP_01753428.1|  TPR domain protein [Roseobacter sp. SK209-2-6]
 gb|EBA17795.1|  TPR domain protein [Roseobacter sp. SK209-2-6]
Length=557
 Score =  177 bits (448),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 110/156 (70%), Gaps = 1/156 (0%)
Query  6    SKFLKSYELVPDSRMLFNNKSRDVLAIAQEMMIGEIEFKAGNLKIGLSHLRKAVKLDDGL  65
            S FL +   VP+SR++ NNK  D+L IA EM+ GEIE++ GN  I   HLR++V LDD L
Sbjct  390  SLFLLAKAKVPESRLMHNNKVVDLLEIASEMLRGEIEYRKGNFDIAYGHLRRSVALDDDL  449
Query  66   AYEEPWCWPQPTRHALGALLMAAGEFDEAETVFRADLGLDGKLPRPCQNPKNVWSLHGLH  125
             Y+EPW W QPTRHALGALL+  G  +EAE V+R DLGL G LPR   +P NVWSL GLH
Sbjct  450  PYDEPWGWMQPTRHALGALLLEQGHVEEAEAVYREDLGLGGSLPRAAIHPDNVWSLKGLH  509
Query  126  ECLFIRKDTVELPHVELLLNQAKARTDIVINSSCFC  161
            +CL  R + +E+ H++  L+QA+AR+D V  +SC C
Sbjct  510  DCLLARGEEIEIHHIKQKLDQAQARSDGVF-ASCGC  544




b)
                                                                Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q7M8K2.1|GUAA_WOLSU  RecName: Full=GMP synthase [glutamine-...  31.6    2.0  
sp|Q9M8Y0.1|SEC_ARATH  RecName: Full=Probable UDP-N-acetylgluc...  31.2    2.4   Gene info
sp|A5YKK6.2|CNOT1_HUMAN  RecName: Full=CCR4-NOT transcription ...  29.6    7.5   Gene info
sp|Q6ZQ08.2|CNOT1_MOUSE  RecName: Full=CCR4-NOT transcription ...  29.6    7.6   Gene info
sp|Q7MVU9.1|Y934_PORGI  RecName: Full=UPF0313 protein PG_0934      29.6    7.9