GOS 1101030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_411
Annotathon code: GOS_1101030
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : phytram
Annotated on : 2010-01-24 18:07:20
  • Marty Francis

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_411 GOS_1101030 Genomic DNA
TATAAAGATTGCTGGTCACCACCTGTGGGAGCTGAGTATAAAATAAATAATTATTTAGTTACAGTCAAACTTGATTTAGAAAAGAATGGTAGAGTAAAGA
GTAGAGAAATTTTGGAAAGAAGTAGAATGGGAACAGATGGTAAATATAGAGTTTTTGCTGAAGCAGTTGATCGAGCAGTATTAATGTGTAACCCTATAAA
AAATCTTCCGCCCAAAACTTATGAAAATTGGAGTACTATGATACTAAGATTTAACCCTGAAGGAATGATGGTTGGTGAATGAAAAAAAACTTATTTTTAA
TATTTTTTATATATTTAATTATAAAACCAAATATTTGTTTTTCATTAGTAGAAATTGATATAACTAGGGGCAATCTTGATCCTATGCCAATTTCTGTATC
ACCATTTTTTTCTAATGAGGATACTAAAGATAAAATTAATAATGTTCTCAGCATTAATAATTTAGGTCTAGAAATATCAAAAGTTATTGAAAACAATTTA
GAAAAGACTGGACTGTTTGATGCAATTGACAAAGAAGCATTTTTACAAAAACCAGATATTGCACATTTAAAACCTAGATTTGAAGATTGGGCTCTCATAA
AGTCTAAAGTTTTAATAACTGGAAAAGTTACTTATAAAATTATAGATGACAAAGATTATATAAAAATAGAATTTAAGCTTTGGGATATATTGGGAGCTAA
GATGGTAGATGGTTTTTCGTTAACAACTGTTCCAAGTAATTGGAGAAGAGTAGGACATAAAATTTCAGATAAGGTATATGAAAGGCTCACTGGAGAAAGT
GGATATTTTGATACCAGAATAATTTACGTAGCAGAAGAAGGACCTAAAACTCAAAGAGTAAAAAAACTAGCTATAATGGACCAAGACGGATTCACATACT
AGTATTTAACTTTAGGAAATGAAATAGTGCTAACTCCAAAGATTAATCTCCACAACCAAATGGTAACTTATCT

Translation

[279 - 899/973]   direct strand
>GOS_1101030 Translation [279-899   direct strand]
MKKNLFLIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPR
FEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQRVKKLAIM
DQDGFTY

Annotator commentaries

La séquence GOS_1101030 constitue, au moins pour partie, un gène codant.Le cadre de lecture est sur le brin direct et dans la phase 3. L'ORF débute à 279 nucléotides de l'extrémité 5' du fragment d'ADN. L'ORF est interrompu en 3', probablement par un décalage de la phase de lecture, à 71 nucléotides de l'extrémité du fragment. Ce décalage pourrait être dû à une erreur de séquençage. Le produit de traduction de l'ORF est un polypeptide putatif de 207 acides aminés. Mais la comparaison entre la séquence traduite à partir de l'ORF et ses homologues laisse penser qu'il manque environ 240 acides aminés en C-ter. Le polypeptide complet est donc plus grand (450 aa environ) que celui codé par la séquence dont nous disposons.

Il s'agit vraisemblablement d'une protéine ancrée dans la membrane bactérienne (présence d'un peptide signal et d'une hélice alpha transmembranaire).


La séquence traduite de l'ORF contient un domaine caractéristique de la superfamille TolB_N (domaine terminal de la protéine TolB, protéine impliquée dans l'importation des colicines). Comme ses homologues, la protéine complète possède aussi vraisemblablement le domaine C-terminal de la protéine Tol_B. La protéine est localisée dans l'espace périplasmique.


La phylogénie montre que la séquence traduite GOS_1101030 émerge clairement au sein des alpha-protéobactéries. Il est donc raisonnable d'en induire que la séquence provient d'une alpha-protéobactérie.



ORF finding

PROTOCOLE:

SMS ORF Finder / sens direct/cadres 1,2 et3/ 60 AA minimum/initiation "any codon"/ code génétique universel

SMS ORF Finder / sens direct/cadres 1,2 et3/ 60 AA minimum/initiation "any codon"/ code génétique universel

Validation du codon d'initiation et du codon d'arrêt en analysant les alignements deux à deux du Blast et l'alignement multiple (ClustalW)avec les homologues (voir plus loin).


ANALYSE DES RÉSULTATS:


3 ORFs ont été détectés:


+++ sur le brin direct:


- 1 ORF de 94 codons dans le cadre de lecture 1, plus court que le suivant et, en conséquence, écarté pour la suite de l'étude (cf. rule book)


- 1 ORF de 208 codons dans le cadre de lecture 2. C'est le plus long eten conséquence, il est conservé pour la suite de l'étude;


+++ sur le brin indirect:


- 1 ORF de 127 codons dans le cadre de lecture 1, plus court que le précédent et, en conséquence, écarté pour la suite de l'étude.


L'ORF de 208 codons retenu pour l'analyse s'étend de la base 279 à la base 902 sur le brin direct..

Le dernier codon est un codon d'arrêt (TAG).


ATTENTION: voir plus loin

Le codon stop est probablement un artefact dû à un décalage de phase (erreur de séquençage?). Dans ce cas l'ORF serait incomplet et la masse moléculaire ne pourrait plus être déterminée.



le premier codon de l'ORF (position 279)pourrait être le codon d'initiation. Toutefois, comme il se trouve en bordure 5'

de la séquence, un autre codon ATG pourrait être localisé en amont, hors de la séquence, et se révéler être le véritable codon d'initiation. Pour lever l'ambiguité, la séquence traduite de l'ORF a été alignée avec ses séquences homologues (alignemens locaux Blast puis alignements multiples ClustalW).

Les alignements sont convaincants: le premier codon de l'ORF (codon 279)est bien le codon d'initiation.


L'ORF est donc complet en 5' et en 3'.

Le fragment de séquence semble contenir un gène codant (nombreux homologues).

Cet ORF pourrait coder un polypeptide dont la masse moléculaire serait de 23.86 kDa.


L'ORF inclus dans le fragment de séquence GOS_1101030 paraît vraisemblable puisqu'il vérifie les conditions requises

(pas de codon stop, plus de 60 codons,...). Cet ORF est donc retenu pour les analyses ultérieures.



RÉSULTATS BRUTS:


A) sur le brin direct:


ORF Finder results
Results for 973 residue sequence "GOS_1101030 Genomic DNA (Sargasso Sea: Sargasso Sea, Station 11)" starting "TATAAAGATT"

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 282.
TATAAAGATTGCTGGTCACCACCTGTGGGAGCTGAGTATAAAATAAATAATTATTTAGTT
ACAGTCAAACTTGATTTAGAAAAGAATGGTAGAGTAAAGAGTAGAGAAATTTTGGAAAGA
AGTAGAATGGGAACAGATGGTAAATATAGAGTTTTTGCTGAAGCAGTTGATCGAGCAGTA
TTAATGTGTAACCCTATAAAAAATCTTCCGCCCAAAACTTATGAAAATTGGAGTACTATG
ATACTAAGATTTAACCCTGAAGGAATGATGGTTGGTGAATGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
YKDCWSPPVGAEYKINNYLVTVKLDLEKNGRVKSREILERSRMGTDGKYRVFAEAVDRAV
LMCNPIKNLPPKTYENWSTMILRFNPEGMMVGE*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 279 to base 902.
ATGAAAAAAAACTTATTTTTAATATTTTTTATATATTTAATTATAAAACCAAATATTTGT
TTTTCATTAGTAGAAATTGATATAACTAGGGGCAATCTTGATCCTATGCCAATTTCTGTA
TCACCATTTTTTTCTAATGAGGATACTAAAGATAAAATTAATAATGTTCTCAGCATTAAT
AATTTAGGTCTAGAAATATCAAAAGTTATTGAAAACAATTTAGAAAAGACTGGACTGTTT
GATGCAATTGACAAAGAAGCATTTTTACAAAAACCAGATATTGCACATTTAAAACCTAGA
TTTGAAGATTGGGCTCTCATAAAGTCTAAAGTTTTAATAACTGGAAAAGTTACTTATAAA
ATTATAGATGACAAAGATTATATAAAAATAGAATTTAAGCTTTGGGATATATTGGGAGCT
AAGATGGTAGATGGTTTTTCGTTAACAACTGTTCCAAGTAATTGGAGAAGAGTAGGACAT
AAAATTTCAGATAAGGTATATGAAAGGCTCACTGGAGAAAGTGGATATTTTGATACCAGA
ATAATTTACGTAGCAGAAGAAGGACCTAAAACTCAAAGAGTAAAAAAACTAGCTATAATG
GACCAAGACGGATTCACATACTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MKKNLFLIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSIN
NLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYK
IIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTR
IIYVAEEGPKTQRVKKLAIMDQDGFTY*



B) sur le brin indirect:


ORF Finder results
Results for 973 residue sequence "GOS_1101030 Genomic DNA (Sargasso Sea: Sargasso Sea, Station 11)" starting "TATAAAGATT"

>ORF number 1 in reading frame 1 on the reverse strand extends from base 343 to base 723.
GTAACTTTTCCAGTTATTAAAACTTTAGACTTTATGAGAGCCCAATCTTCAAATCTAGGT
TTTAAATGTGCAATATCTGGTTTTTGTAAAAATGCTTCTTTGTCAATTGCATCAAACAGT
CCAGTCTTTTCTAAATTGTTTTCAATAACTTTTGATATTTCTAGACCTAAATTATTAATG
CTGAGAACATTATTAATTTTATCTTTAGTATCCTCATTAGAAAAAAATGGTGATACAGAA
ATTGGCATAGGATCAAGATTGCCCCTAGTTATATCAATTTCTACTAATGAAAAACAAATA
TTTGGTTTTATAATTAAATATATAAAAAATATTAAAAATAAGTTTTTTTTCATTCACCAA
CCATCATTCCTTCAGGGTTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
VTFPVIKTLDFMRAQSSNLGFKCAISGFCKNASLSIASNSPVFSKLFSITFDISRPKLLM
LRTLLILSLVSSLEKNGDTEIGIGSRLPLVISISTNEKQIFGFIIKYIKNIKNKFFFIHQ
PSFLQG*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:

Alignements de la séquence traduite GOS_1101030 et des 30 séquences homologues correspondant

- aux séquences du groupe d'étude (a-protéobactéries);

- aux séquences du groupe extérieur (b-protéobactéries + g-protéobactéries);

Utilisation de:

a) CLUSTAL 2.0.12 multiple sequence alignment

b) CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

c) Curation/Gblocks



ANALYSE DES RÉSULTATS:


Tous les alignements multiples :

- confirment la position 1 du codon d'initiation au début 5'de l'ORF;

- montrent que, de manière singulière, le codon d'arrêt de GOS 1101030, en déterminant l'extémité C-terminale de la protéine, fait de ce polypeptide le plus court de tous ses homologues.


ATTENTION:

Il est probable que le codon stop résulte d'un décalage "accidentel" de la phase de lecture. Ce décalage pourrait résulter d'une erreur de séquençage (il suffit d'évoquer 1 nucléotide manquant). Dans cette éventualité on peut penser que le polypeptide complet a une taille comparable à celle de ses homologues. Il manquerait donc environ 240 acides aminés en C-terminal.


- montrent que l'ORF s'intègre correctement dans la famille de ses homologues présumés mais ne correspond qu'au domaine N_ter de ses homologues. Les homologues, eux, possèdent le domaine C-ter des protéines TolB.

- montrent que le domaine TolB_N (7-187) est la région la plus conservée.


RÉSULTATS BRUTS:

CLUSTAL 2.0.12 multiple sequence alignment


Rickettsia            ---------------------------MKNIIYCILLLFS-----FNSYALETINIEHGK 28
Orientia              ---------------MINNLSVSMTKVLKIILTIIIILFNTLSILANTTTLSSIKITKGN 45
Anaplasma             -----------------------MRVFFFACVLPAVSAFLL--CCQGAVAALGVDITKGN 35
Wolbachia             -----------------------MKLFVQLVLF--ISLFIP--YST--KAVLYVDIKKSN 31
GOS_1101030           ------------------------MKKN----LFLIFFIYLIIKPNICFSLVEIDITRGN 32
Candidatus            ------------------------MKK------KLIFICLFLIIPIKAFALIEVDITRGN 30
alpha                 ------------------------MKK-------ILVTLFLILFTSKSFAVVTIDITRGN 29
Rhizobium             MWRENRARFPRSAQKDERLKGFMEMLRRNFFRLFTLVFAGVLFAAPAN-AVVEININKGN 59
Brucella              ----------------MKIGIINTKIRTVFSAFACMIAASLVCTMPAR-AVVEININKGV 43
Bartonella            ---------------------MMTITRHKVFAWFIVTCGLWLSSISSGYAQLKGTISSAD 39
Magnetospirillum      ---------------------MITMSRIRSLAAFAVFVILGVAAVLPAQAEVRIDITRGQ 39
Caulobacter           --------------MPGTVVKKETPMRLRALLLMVAALMSGAAFVTPAAAQIEVDINAGA 46
Maricaulis            ------------------------MTRIFVLFAALLALIG-WSAASDAQEPLRVDVTQGN 35
Octadecabacter        ----------------MMTN--FLTLFAAIMLAFVSITP--ASAQEP----LRLTLRDGV 36
Oceanicola            -----------------MTHRLFANLLAGLLVAFAAMWL--AGAAAAQGGPLRITVTDPN 41
Sulfitobacter         -------------------------MIVRILSLCLALIGGVASVAQAQDGPLRIEITEGV 35
Rhodobacterales       ----------------------MRNILAALLIGASALAG--AGAAAAQTGPLRIEIDQGV 36
Silicibacter          ----------------------MMRLLTSLLVGLTLLSA----PASAQTGPLRLELDQGI 34
Rhodobacter           --------------------MTLFRTLAPMGLALALLLP-AAVPAAAQQGPLRIQITEGV 39
Methylobacterium      ---------------MPGTAFTRRTLLPALTAALGVLALALPAATPARA-QLQLRIGSGA 44
Acetobacter           MVMSTRPLISDQEADVLAGALRRRSLLGASVAAGGIMAMPVGAFAAASAPEAEITVDQAR 60
Allochromatium        --------------MTRYSCLPRSLFVVVLILVGLGQAL--------AAPRLNIEITGGI 38
Haemophilus           -----------------MKLLKRLVSVFAIVLAVGSNAF--------AGDEVRIVIDEGV 35
Xylella               -----------------MTKFPRWLAILVGLLFPLSALT--------QQQGLTIDIVGGN 35
Xanthomonas           -----------------MKKPLRWLAALTALLLPLSALA--------QQQGLTIDIVGGS 35
Marinomonas           ------------------------------MLFVLSNLV--------RAQ-LVIEITSGA 21
Leptothrix            -----------------MTSRRQFSGLALGLLGGLNATA--------SRAQFRVEISGVG 35
Methylibium           -----------------MLRR---SLVALPLAAALPS----------ALAQFRVEISGVG 30
Comamonas             ---------------------------MLATLAATPALP--------ALAQFRVEVTGVG 25
Thiomonas             ----------------MQRRRFVLGSLSAPLVRGAASFVGLTALANSAQAQFKVDVSGIG 44
Methylophilales       -----------------MKQSFWKFFFLIWLVCISNA----------SHALEVIEILGGK 33
                                                                             :    

Rickettsia            ADPTPIAVNNFEADSASDN---------TVGHEIVKVISNDLKLCGLFHPISSASFIEEK 79
Orientia              CTQIPIAINFFSAKSNEEH---------DLSQNIVSIISNDLNISKIFAPISSDLFIETE 96
Anaplasma             VERVRISVAPMHSSTNLEK---------EVGKSCVRVVLHDLNSTGIFDASWKLPAGGFG 86
Wolbachia             IGNIDLVVSKCACKTEVEN---------ELSESITKVIETNLSNCGLFNVKRDAKV---- 78
GOS_1101030           LDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGLFDAIDKEAFLQKP 92
Candidatus            LNPLPLAVSPLSIDENSKKSFEKILDKENIGSEISIIVENNLRTSGLFNPLNKDAFLQAP 90
alpha                 LEPLPTAISNFYID--NPEKFSEKIKSLKLEENLPKVIKGNLMRSGLFYVLDNKSYIQQP 87
Rhizobium             VEPLPVAITDFLQG--------------ELGQKISDVVAADLKRSGLFAPIDKGAFIEKI 105
Brucella              IEPLPIAITDFLSAD-------------QLGSNITSVIAADLERSGLFAPIDKGAFIEKI 90
Bartonella            FNPIPIAITDFISND-------------SIGLKISAVVTADLERSGLFLPLNKENFLENI 86
Magnetospirillum      MKPLPIAIPDFAGASAQDN---------RMGADIARVVSADLERSGLFKPIDPKAFIQNA 90
Caulobacter           VKPMPIAIPAFSGAT--------------RGAEIAQVISGNLERSGLFQPLNVSGVADKL 92
Maricaulis            LDPMPIAVPDFVGASDEAL---------RRGADITRVVANDLASSGLFAPVDQDAFIEDI 86
Octadecabacter        IEALPFALPTFQSEVAGSE---------GMAADISRVITEDLNGTGLFRQIPASAFISTP 87
Oceanicola            VEPLPFAIPAFEAETAGAE---------GLASDISRLVAQDLVNTGLFREIPSTAFVSQL 92
Sulfitobacter         IEPLPFAVPSFQPESGDAG---------QMAVDLARVVSEDLVGSGLFREVPASAYISTV 86
Rhodobacterales       IEPLPYAVPDFVPETPAAA---------EYAAEIARVIASDLSGTGLFREVPASAHISKV 87
Silicibacter          IEPMPFAVPNFVPDTPAAA---------QYPTDISRVIAADLTGTGLFREIAPEAFISRV 85
Rhodobacter           IEPLPFAVPDFVAENAGAS---------ELARDMARVIASDLSGTGLFREIPASAHISRV 90
Methylobacterium      FQPMPIAVADFAGDA-------------SLGTLVASVITNNLRRSGYFTPLEKGRFPE-N 90
Acetobacter           TAPIPIIIPNFGG---------------GLGEKIAEVLTNDLNNTGLFKVMP-------G 98
Allochromatium        ESAQPIAIVPFGTSEG-LI----------PPVDMAAIIGADLARTGRFKPMPTRD-MLDM 86
Haemophilus           DGARPIAVVPFVGSA---------------PEDISKIVADDLRNSGKFNPIAVSQ-MPQH 79
Xylella               TAATPIAVLPMPYHDSAGA----------PATDVSGVVAADLNRSGQFRTLPLGQ-ITER 84
Xanthomonas           ASATPIAVIPMPYQGSGTA----------PQTDVSAVVGADLDRSGQFRTLPAAQ-IVEK 84
Marinomonas           DQLLPLAVVPFAYEGR-DG----------LPEDVAQIIENDLKRSGLFEAIPRTN-MLSL 69
Leptothrix            ATQVPIAVLRLRD---EDK----------APQPVSAIVRADLERSGLFRSVEPGN-VAHD 81
Methylibium           ATQLPIAVVKFRD---EEK----------APQPVGAIVRADLERSGVFRNLDTSG-VVLD 76
Comamonas             LTQLPIAIAPFKG---EGS----------APQKISAIIQADLERSGQFRGVDASG-VALD 71
Thiomonas             ATQIPVGIGAFRD---LNH----------CPQPIADIVRADLTRSGLFAVSNLGG-QTLT 90
Methylophilales       ASQIPVAVIPFKDNN-AQK----------SMQLMHEVITNDLNRSGLFSSIDISG-VSDY 81
                             :                            ::  :*     *            

Rickettsia            TGIGYKPLFAAWRQINASLLVNGAVKKLE---NGKLKISFILWDTLL----EKQLG-GEV 131
Orientia              QGVAHIPLFTAWSQINANILINGEITKID---STDFKVTFVIWDVFS----AKEIT-RKS 148
Anaplasma             TTPEGMPDSDAWTSVGRDVLVTGSIKEFS---QDRVKVRLFIWDVAS----GRQLS-GKS 138
Wolbachia             ---------ESWKS---DTVVTISLSEVS---NRNLELSFRLSDSFT----NRELL-TQS 118
GOS_1101030           DIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILG----AKMVD-GFS 147
Candidatus            DIANLKPRFEDWNLIKAQALITGKVAY--IDEK--LRVEFRLWDVLA----GKEMM-ALA 141
alpha                 KLSHLKPRFEDWRLIKAQIMVSGKLRI---DEKGRLRVEFRLWDVVS----AKEIE-GLA 139
Rhizobium             ANPDAAPRFEDWKVINAQALVTGRVTQ---EGDGRLKAEFRLWDTFA----GQQML-GQQ 157
Brucella              SNPDAAPRFEDWKVINAQALVTGRITK---QPDGRLKAEFRLWDTFG----GQQMI-GQQ 142
Bartonella            SNPNKQPHFASWQKIKAQGLVTGQVMR---EIDGRLRVDFRLWDVFG----QRQLK-GRR 138
Magnetospirillum      ASLQAGPRFPDWKAINAEALVSGKIES---GADGRVRVEFRLWDVFN----EAYMT-GWT 142
Caulobacter           SDVNIQPRFPDWQTTGAQALINGQVTV---GPDGGLRVDFRLWDVFS----QQQLL-GLQ 144
Maricaulis            ANIDLRPRFSDWRVINADALLVGSVTI---QEDGRLVVGFRLWDTRL----EEQLL-GLQ 138
Octadecabacter        ASFGSAIAFPDWRAINAQALVTGAVAVN----GNQVTVKFRLYDVFS----GGEMGEGLQ 139
Oceanicola            TSFAQPVAYTDWRTINAQALITGAVAVN----GGQVTVKFRLYDVFS----GQELGAGQQ 144
Sulfitobacter         SDFNAPIQYADWKAINAQALITGAVSVS----GNTLNVKFRLYDVFS----GAELGSGLQ 138
Rhodobacterales       TAFDGPVKFADWKAVNAQALITGAVSVT----GNGLTVRFRGYDVFA----EKELETALQ 139
Silicibacter          NSFEAPIQFADWKAINADALVTGAVNLS----GNTLTVRFRVWDVFS----GQELGNGLQ 137
Rhodobacter           TSFEAPVAYGDWKAINAQALITGSVSAS----GDRVVVKFRLYDVFS----DQPLGEGLQ 142
Methylobacterium      PSFDAAPNFEAWKGAGVQALVTGRVGR---DASGRLTVAFRLWDVAS----GQQIT-GQQ 142
Acetobacter           STTSGTPDFVTSKSMGAHAQVTGSVSG---GGS-SVRVEMRLWDVLS----HQQIQ-GTA 149
Allochromatium        PATREEVDFRDWSLLGMNNLVIGRVEPD---PTG-YRISFSLFDVF-----RGTELASSS 137
Haemophilus           PTSAAEVNPEAWSNIGIDAIVIGQVVPS---GNG-YSITYQLIDTVGASGTPGAVLMQNS 135
Xylella               PTHGSEIRFPTWQALKQDYIVVGRVLDA---RQGTYRVEYELFDVR-----NGKRMLGLA 136
Xanthomonas           PTRGTEVQFQTWRTLKQNYIVVGRVMDA---GEGAYRVEYELFDVA-----KGERMLGLA 136
Marinomonas           PSKKEDVHFRDWRLLKSDYVVIGDVKQI---DANNFEINFELINVLS----QKTVEKHTG 122
Leptothrix            --ETSRPVFSDWRSLGSDALVAGSVTRL---ADARFDVRYRLWDVV-----KGSELAAQA 131
Methylibium           --EGSQPAMSDWRGRSADALVGGSVTRL---ADGRFDVRYRLWDVV-----KGRDLGGQS 126
Comamonas             --ETSRPDVAQWRQKGADSLATGSITRL---ADGRWDVRFRLWDVV-----KGQDLGGQG 121
Thiomonas             --EQGPPNYAAWRSQNLEAVAGGSVAQV---TGGRWQVQFRLWDAV-----KQADLGGLA 140
Methylophilales       PIDEREVNFSNWAALQSQFIVVGKIDAIG-RSNSQMQVTWSLIDIY-----KEKTVLSVA 135
                                              :                  :                

Rickettsia            LELPENLWRRAAHKIADKIYEKITGDTGYFDSKIIYVAESG-PDLKKVKRIALMDYDGAN 190
Orientia              FTFPSQLWRSTAHKIADQIYKHVTGSKGNFNTKIVYVSESN-SSNRKIRRIAIMDQDGAN 207
Anaplasma             FNFAVGNWRRAAHSMSDSIYSRITGEGGYFNTRIAYVAETG---LPGSRRIAIMDQDGAN 195
Wolbachia             VVFLAKDWRKISHLVSDLIHDRLIGEKGHFNTKITYIAEEKDSNYKSVRKIAVMNQDGSN 178
GOS_1101030           LTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEE-GPKTQRVKKLAIMDQDGFT 206
Candidatus            FTTVPNNWRRVGHIISDKIYERLTGEKGYFDTRIIYVAEE-GPKTQRKKKLAIMDQDGAN 200
alpha                 LFATPSSWRRIAHIISDKIYQRLTGEEGYFDTRIIYVAES-GPKTQREKKLAIMDQDGAN 198
Rhizobium             FYTQPENWRRVAHIIADAIYERITGEKGYFDTRIVYVAES-GPKNARKRQLAIMDQDGFN 216
Brucella              FFTTPDNWRRVAHIIADAIYERLTGEKGYFDTRVVFVDES-GPAQKRVKRLAIMDQDGAN 201
Bartonella            FYTATERWRRVAHMIADEIYSEMTGESGYFDTRIVFIDET-GPQNARIKRLAMMDQDGAN 197
Magnetospirillum      LSASPQDWRRLSHKVADAIYKRVTGEDGYFDTQIVYIAES-GPKNDRKKRLSIMDQDGEN 201
Caulobacter           FSSTPDNWRRVAHKISDAVYERLTGEKGYFDTRVAFVAES-GPKLNRIKRLAIMDQDGAN 203
Maricaulis            YRTAPENWRRVAHRLADAVYERLTGETGYFNTRIVYVSEGRGIEGEPIRQLALMDQDGAN 198
Octadecabacter        FAGTTDGWRRMAHKVSDAVYSRITGEAGYFDSRVVYVAET-GPKDDRAKRLAIMDYDGAN 198
Oceanicola            LVGTTDGWRRMAHKVADQVYSRITGESGYFDSRVVFVSET-GPKNDRRKRLAIMDYDGAN 203
Sulfitobacter         FSGTVDGWRRMAHKVADAVYSRITGEGGYFDSRVVYVSET-GPKDDRAKRLAVMDYDGAN 197
Rhodobacterales       FTGTTDGWRRMAHKVADAIYSEITGESGYFDSRVVYVSES-GPKNDRRKRLAVMDYDGAN 198
Silicibacter          FSGPTDGWRRMAHKVADQVYSRITGEGGYFDSRVAFVSES-GPKDQRRKRLAIMDYDGAN 196
Rhodobacter           FAGSASGWRRMAHKVADVAYSRITGEGGYFDSRVVFVSES-GPKNARAKRLAVMDYDGAN 201
Methylobacterium      YGTDVANARRTGHLVSDAVYTKVTGLGPWFDSRVAFVDES-GPKENRRKRLMVMDQDGAN 201
Acetobacter           YTTSAANWRRIAHIVGDVIYERMLGEKGYFDTRIAFISRS-GPRGHQRTRLAVMDQDGAN 208
Allochromatium        LVSTQSGMRQTAHRIADEIHEKLTGQPGVAATRIAYITSTG-SGADLTVTLRVADADGYN 196
Haemophilus           YTVTNKWLRYGAHTVSDEVFEKLSGIRGAFRTRIAYVVQK--NGGSQPYEVRVADYDGYN 193
Xylella               MTARASAMRDVAHQMADAIYEKITGLRGAFFTRIAYVTASG-SHGAMRYALMVADSDGYN 195
Xanthomonas           MTARANAMRDVSHQMADAIYEKITGVRGAFWTRIAYVTASG-KGGAMRYALMVADSDGYN 195
Marinomonas           LAVKVSGLRDAAHYISDKIYRLLTGVRGAFSTRILYVTAEG-NRAEPTYRLQVADADGHR 181
Leptothrix            LSVAKDDLRLAAHRIADDVYQKLTGERGVFSTRIAYVSKA----ANR-YTLWVADADGEN 186
Methylibium           YAVPAGDLRLAAHRIADAIYEKLTGEKGVFSTRIAYVTKG----GGR-FTLWVTDADGEG 181
Comamonas             FAVTTGDLRLVAHRIADYIYEKLTGEKGIFSTRIAYVTKA----GAQ-YRLWIADADGEN 176
Thiomonas             LTVMPGDLRLAAHKISDYIYQKLTGQRGVFATRITYITKA----GQHNFSLNIADSDGAN 196
Methylophilales       IKGQPSQYRVIAHRIADTIYEKLTGSKGVFDTNIAFVKKL----GKEKYSLFIADYDGHN 191
                              *  .* :.*  .  : *      :.: ::             : : : **  

Rickettsia            NRYITDG-KSLVLTPRFSGSADKIFYVSYATKRRTLVYEKDLKTGKESIVGDFAG----- 244
Orientia              HNYITNG-KNHVITPVFSPKNNQILYVSYHNKIPT-VRIHDLNSGNNKILASFNG----- 260
Anaplasma             NVYITST-GEFVSTPRFSPDARSLVYMSYAKSSGS-IVLHDLETGYSTALGGVRG----- 248
Wolbachia             IKYLTNG-EKFVSTPRFSPNGKGIVYISYTNGKSY-IILKNLKDNTESIISAFEG----- 231
GOS_1101030           Y----------------------------------------------------------- 207
Candidatus            NKFLTLG-NELVLTPRFNPTSQMVTYLSYF-KNLPRVYLLDIETGTQEVVGDFP------ 252
alpha                 NKFLTLG-NELVLTPRFSPNGKMVTYMSYF-KNLPRVYLLNIETGIQEVVGDFP------ 250
Rhizobium             ARALTNS-NDIVLTPRFSPNRQEITYMSFE-NQQPRVYLLQLETGQREVVGNFP------ 268
Brucella              VSFISDG-RALSLTPRFSPNRQEVTYMSFE-GGSPKVYLLQLETGQRELVGNFP------ 253
Bartonella            LIYMSDG-SELVLTPRFSPKRQEMTYMAYEDNQVPHVYLQQIEMGQRELIGTFN------ 250
Magnetospirillum      HRFLTDG-SELVLTPRFSPSAREITYLSYF-KGVPRVYIFNLDTGRRESLGNFP------ 253
Caulobacter           PQYLTDG-SYIVMTPRFSSTSQELTYMALR-PTGSSIYLLNLETSRQETVGKFP------ 255
Maricaulis            PSFLTDR-SYMALLPNYSPSAQEITYVSFL-DGQATTYLYNLETGRQEALFASGGAGAAS 256
Octadecabacter        VQYLTDS-SAIVLAPRFSPSGDRILYTSYE-SGFPRINILDVATVVRQQMTTAAG----- 251
Oceanicola            VQYLTDS-GSIVLAPRFSPTGDRVIYTSWD-SGFPRINAIDVGTVSRQQIPVQAG----- 256
Sulfitobacter         VRYLTDS-SSIVLAPRFSPSGDRILYTSYE-SGFPRIYVLDIGSVQRRVLESAEG----- 250
Rhodobacterales       VQYLTNS-ASIVLAPRFSPAGDRVLYTSYE-SGFPQIHVLDVGQVQRKVLSSGDG----- 251
Silicibacter          VQYLTDS-AAIVLAPRFSPAGDRLLYTSYE-SGRPRIYLLDVGRVKKQELKTQDG----- 249
Rhodobacter           VQYLTDS-SSIVLAPRFSPTGDRILFTSYS-TGFPRIYLMDVGSLATRGLAEQPG----- 254
Methylobacterium      VRALTGGGDVSVVAPRYSPAGQDIAFMTQAPGQQPKVQMIDLETGKRQTVGNFAS----- 256
Acetobacter           ARMLTTG-KWLTLTPRFSPVKDQIAFMSYAN-NRPRVYLFDLTSGRQQILGEFEG----- 261
Allochromatium        PQTIVSS-AEPLMSPAWSPDGQRLAYVSFE-NKRAAIYIQELSSGRRELVASHPG----- 249
Haemophilus           QFIVNRS-AQPIMSPAWSPNGQRLAYVSFE-NKKSQLVVQDLNSGARKVVASFQG----- 246
Xylella               PQTIVRS-AEPLLSPDWSPDGKKLAYVSFE-KGGSSIYIQDIATGSRELVSSFRG----- 248
Xanthomonas           PQTIVRS-AEPLLSPNWSPDGKKLAYVSFE-RGNSSIYLQDIATGARELVSSFRG----- 248
Marinomonas           PQVIVES-KEPILSPSWSRNGRFITYVMFR-DRRPNIFVQELATGKRQKIAQYRG----- 234
Leptothrix            AQAAVGG-PEPIISPAWSPNGRELAYVSFE-ARKAVVYVQDVLTSKRRVIANYKG----- 239
Methylibium           GQSALAS-PEPIISPAWSPDGRELAYVSFE-SRKAVVYVQEVASGKRRTLASFRG----- 234
Comamonas             AQSALSS-PEPIISPAWAPNGTQLAYVSFE-SRKPVVYVHDVASGHRRLLANFRG----- 229
Thiomonas             PQFALRS-REPLLSPVWSPNGQELAYVSFE-TGKPVVFMQDVRSGARRAVANFKG----- 249
Methylophilales       PRAIVNS-RYSIISPRWSPNGKKIAYVSFE-KKKPVIYVQDIETGKRTLLANFRG----- 244
                                                                                  

Rickettsia            ------ISFAPRFAPDGRKAVMS-IAKNGSTHIYEIDLATKRLHKLTDGFGINTSPSYSP 297
Orientia              ------ITFSPRFSPDGNKILVSNSSTKNVTHIYEINLLTGKIKQLTKGQSINTSPSYSP 314
Anaplasma             ------VNSSPRFSPDGKHVLLS-ESAQGATNIYSIDLKSGKSTRLTNNKSINTSASYSP 301
Wolbachia             ------VISAPRFSPDGKSLFIS-HSLSGETNILSLDLSSKRTKKITKGSAISTSPSLSP 284
GOS_1101030           ------------------------------------------------------------
Candidatus            -----GMTFAPRFSPDGKKIIMSFAKD-GKSDIFTMDLENRIVERITNHPSIDTSPSYSP 306
alpha                 -----GMTFAPRFSPDGRKIIMSFARD-GNSDIYTMDIESRRVEQITSNPAIDTSPSFSP 304
Rhizobium             -----GMTFAPRFSPDGQRVIMSLQQE-GNANIYTMDLRSRTTTRLTNTNAIDTSPSYSP 322
Brucella              -----GMTIAPRFSPDGQKVVMSLLQDDGSANIYTMDLRNRTTTRLTSSQAIDTGASYSP 308
Bartonella            -----NMTIAPRFSSDGQKVIMSLLQNDGSANLYTMDLRTRTMTRLTTTSAIDTSASYSP 305
Magnetospirillum      -----GMTFAPRFSPDGNKVVFSMAEN-GNTEIYEMNLLTRQKRQLTMNPAIDTAPSYSP 307
Caulobacter           -----GMVFAPRFSPDGGKVAFSVEKN-GNSDIYVMDLRSRSTTRITTDPSIDTSPSFSP 309
Maricaulis            QVDPDGQSLSARFSPDGSELAVSIETR-SGHDIHLFDLQTRNLQRLTQHPADDVEPSFAP 315
Octadecabacter        -----EMAFSPRFSRDGRQVIYSLANG-GNTDIYRTDLATGQNTRLTNTPAIETSPSFSP 305
Oceanicola            -----EMAFSPRFSRDGRQVIYSLSEG-GNIDIWRTDITTGQHQRLTSAPSIETAPSLSP 310
Sulfitobacter         -----TMSFAPRFSPSGNTVVYSLTQG-GNTDIYTMDINTGQSTRLTNTPAIETAPSYSP 304
Rhodobacterales       -----TMSFAPRFAPDGRTIVYSQTQG-GNTDLFAMDIETGAKTRLTSAPSIETAPSFSP 305
Silicibacter          -----TMSFSPRFSPDGRSIVYSLTQG-GNTDLWKMDLASGQSVRLTNTPAIETAPSYAP 303
Rhodobacter           -----TMTFAPRFAPDGRTVAFSLEQG-GNTDIYTLDTGSGTRRQLTNSPSIETAPSYSP 308
Methylobacterium      ------MSASPRFSPDGRRLVMSVQQG-GNADIVTVDLASKAQTPVTQGLAIDTSPSYAP 309
Acetobacter           ------ISFAPRFSPDGRSVVLSVTRN-GGSDLYIVDLASGSRRQITSSGAIDTSPCFSP 314
Allochromatium        ------INGSPAFSPDGSRLAMTLSKD-GNPDIYSLNLLSRELTRLTDHYAIDTEPSWSP 302
Haemophilus           ------HNGAPAFSPDGSRLAFASSRD-GVLNIYVMGANGGTPTQLTSGAGNNTEPAWSP 299
Xylella               ------INAAPSFAPDGHRIALSLSRS-GNPEIYVMDLVSKQLIQLTNSFGIDTEPVWSS 301
Xanthomonas           ------INGAPSFSPDGRRLALALSRS-GNPEIYVMDLGSKQLTQLTNHFGIDTEPTWAP 301
Marinomonas           ------LNGAPAWSPDGKQLALVLSKD-GNPEIYVLDIATQKLQRITNHYSIDTEPSWEP 287
Leptothrix            ------SNSAPAWSPDGNQLVVTLTRD-GLSQLYTMSRTGGDLRRLTTSSGIDTEAAWSP 292
Methylibium           ------SNSAPAWSPDGRQLALTLSRD-GGSQLFVMGRDGEGVKRLTSSGAIDTEATWAP 287
Comamonas             ------SNSAPAWSPDGSRLAVTLSRD-GGSQLYLLSAQGGEPRRLMQSSGIDTEPCFSS 282
Thiomonas             ------SNSAPAFSPDGGTLAVVLTLT-GRSQIYLMPSKGGTPRQLMRSYSIDTEPTFSP 302
Methylophilales       ------NNSAPAWSPDSKKLAIVLTYS-ANSQIYTIDADGKNIKQLMRTRSINTEPAWSP 297
                                                                                  

Rickettsia            DGRRIVFNSDRNGVPQLYIMNSDGSNVQ--RISFGGGSYMAPSWSPRGDYIAFTKIIRGS 355
Orientia              DGSKIAFVSDRSGSTQIYIMNDQGGNIK--RLTSQPGAYTTPAWSPTNNYIAFTKIEAG- 371
Anaplasma             DKKSIVFNSDRSGRPQLYVMNADGTNQR--RISSGKGGYSAPVWSPRGDWIAFTKADGK- 358
Wolbachia             DQKYMVFSSDISGSQQLYIIDFTKKSKKPKRISFGNGRYATPVWSPKGDLIAFTKIQSG- 343
GOS_1101030           ------------------------------------------------------------
Candidatus            NGKFIAFNSDRSGYQQIYIMKNDGSDVK--RISFGNGIYGTPVWSPRGDLIAFTKLHNG- 363
alpha                 DGRFIVFNSDRSGFQQIYTMRSDGRGVK--RISRGKGLYGTPVWSPRGDLIAFTKIHKG- 361
Rhizobium             DGARIVFESDRGGKQQLYVMGADGSGQT--RISFGDGSYSTPVWSPRGDLIAFTKQSGG- 379
Brucella              DGSQIVFTSDRGGRPQLYVMGADGSNPR--RISMGDGSYSTPVWSPRGDLIAFTKQSQG- 365
Bartonella            DGKQIVFSSDRSGKPQIYKMNADGSDIQ--RISSNEGSYSTPIWSPRGDYIAFTKQLSG- 362
Magnetospirillum      DGQQIVFESDRGGGQQIYTMSADGSNPQ--RISFGDGRYGTPVWSPRGDLIAFTKQKGG- 364
Caulobacter           DGTKIVFNSDRGGQAQIYVMNTDGSGVR--RISFGGGRYTTPVWSPRGDFIAFTKQTGG- 366
Maricaulis            DGERIVFSSARGGGSQLYVMNRDGSDVQ--RITFGSGRYTTPVWSPRGDLIAFTKQVGG- 372
Octadecabacter        DGSQIVFESDRSGTQQLYVMSANGGEPQ--RISFENGRYGTPVWSPRGDLIAFTKQESG- 362
Oceanicola            DGQRIVFESDRSGSQQLYVMPVTGGEPQ--RISFGEGRYGSPVWSPRGDMIAFTKQHAG- 367
Sulfitobacter         DGSRIVFESDRSGSQQLYIMPATGGEAT--RISFGEGRYGTPVWSPRGDLVAFTKQNKG- 361
Rhodobacterales       DGSQIVFESDRSGSQQLYVMPAGGGEAR--RISFGEGRYGTPVWSPRGDMVAFTKQNKG- 362
Silicibacter          DGSRIVFESDRSGTPQLYVMPANGGEAT--RISFGQGRYGTPVWSPRGDLIAFTKQNKG- 360
Rhodobacter           DGSQIVFESDRSGGQQLYIMPAGGGEPR--RISNGAGRYGTPVWSPRGDLIAFTKQHQG- 365
Methylobacterium      DGSQIVFESDRGGSQQIYVMGADGSNPR--RLSFGEGSASQPAWSPRGDLIAFTRQRKG- 366
Acetobacter           DGSQIVFNSDRGGSPQIYIMPASGGGAR--RISYGQGTYGSPVWSPRGDLIAFTRIAGG- 371
Allochromatium        DGQSIIFTSDRGGSPQIYRMAATGGPAE--RISVEGDYNGRASYAPDGRSIVMVTR-VNG 359
Haemophilus           DGNSILFTSDRSGSPQVYRMDANGGSAT--VVGGR----GSAQISADGKTLVMING-NN- 351
Xylella               DGKFIYFTSDRGGRPQIYKVASVGGTAT--RVTFQGNYNATASVSYDDKKIVVAQG-SGN 358
Xanthomonas           DGGSIYFTSDRGGRPQIYQVAASGGSAN--RVTFQGNYNATASVSFDGKKIAVAQG-SGN 358
Marinomonas           DGKGIVFTSDRGGNPQIYRVDISSKAVE--RVTFEGDLNTRARMTPDGRYLVTVQK-NEG 344
Leptothrix            DGKSVYFVSDRGGGPQIYRVAAGGGNAE--RVTFAGNYNISPALSPDGRYMAYVSRLNGS 350
Methylibium           DGKSIYFVSDRGGSPQIYRVPAGGGNAE--RVSFSGSYNISPAISPDGRTMAYISR-DGG 344
Comamonas             DGRTIYFVSDRGGAPQVYKVSSSGGSAE--RVTFSGTYNISPAISPDGKWLAYVSR-VGG 339
Thiomonas             DGQSLYFVSDRDGGPQVYKVGLNGGSVQ--RITYSGGYNVSPAISPDGKTLAYISQ-QGN 359
Methylophilales       NGKEIYFSSDRAGSAQIYKVDVDTNEVV--RVTFEGNNNVSPSLSPDGKLLLFLNQ-DNG 354
                                                                                  

Rickettsia            EGKTFNIGVMKPYPQDDE-NSERVIASGYLVESPCWSPNGRVIMFAKGWP-SNGKSSGKN 413
Orientia              ---EFSIGVIK----LDG-SNKRIIATKYLVEGPSWAPDGKTIIFSRAYK-ATKSTSTKV 422
Anaplasma             ---NFHIGVMK----PDG-SGERLLAKGHMVDSPSWSPNGRVILFTQQDP-PSATHPFRS 409
Wolbachia             ---KFYIGVMK----PDG-KEERLLSEGHKIESPAWLPNGREIIFTNAES-PSN-----S 389
GOS_1101030           ------------------------------------------------------------
Candidatus            ---KFYIGVMR----TDG-TGERLLTENYYQEAPSWSPNGRVLIFYRETKTNAKGEGFSA 415
alpha                 ---KFYIGVMR----TDG-TGERLLTQNFYQEAPSWSPNGRVLIFYRETAGGKKGQGSSA 413
Rhizobium             ---KFSIGVMK----PDG-SGERILTTGFHNEGPTWAPNGRVLMFFRQNA----GAGG-P 426
Brucella              ---QFSIGVMK----TDG-SGERLLTSGFHNEGPTWAPNGRVLMFFRKAA----GAGG-P 412
Bartonella            ---QFSIGVMR----PDG-QGERILTTGFHNEGPTWAPNGRVLMFFRKNP----GMG--P 408
Magnetospirillum      ---QFFIGVMR----TDG-SGERLLAEGFLVEGPTWAPNGRVLSFFRESPSDERGRGQVV 416
Caulobacter           ---QFHIGVMR----PDG-GDERLLTTSYLDEGPTWAPNGRVLMFFR------EGGGGNP 412
Maricaulis            ---QFSLGVVR----ADGSGIERILFEGYFVDTPAWSPNGRVLLFTRGEQ---RANGTRY 422
Octadecabacter        ---RFHIGVMR----TDG-TEERLLTSSFLDEGPTWAPNGRVIMFARETQ----GSDGTT 410
Oceanicola            ---RFHIGVMR----TDG-SEERLLTASFLDEGPTWSPNGRVLMFSRETQ----GADGAP 415
Sulfitobacter         ---RFHIGVMR----LDG-SEERLLTASFLDEGPTWAPNGRVIMFARETQ----GAGGAS 409
Rhodobacterales       ---RFHIGVMR----TDG-SEERLLTASFLDEGPTWAPNGRVIMFTRESQ----GSSGRA 410
Silicibacter          ---RFHIGVMR----VDG-SEERLLTASFLDEGPTWSPNGRVIMFTRETQ----GASGRS 408
Rhodobacter           ---RFHIGVMR----TDG-SEERLLTASFLDEGPTWAPNGRVLMFTREGA----GAGGQP 413
Methylobacterium      ---GFAICVMK----PDG-SGERVLTEGFHNESPTFAPNGQYVMFFRDP-GGQGGG---- 413
Acetobacter           ---MFSLGVMA----PDG-TGERIMTQGFTVESPSFCPNGRVLAYCRQSRAGAGGAGFNS 423
Allochromatium        ---AFRIGQLD---LARG--VTRLLSRGDLDESPSFAPNGAMVIYATIHG------HRG- 404
Haemophilus           -----NVVKQD---LTTG--VSEVLSTSFLGESPSLSPNGIMIIYSSTQG------LGK- 394
Xylella               ---VYRIAMMD---QSSGSTVWNTLSTGSLDESPSFAPNASMVLYAAREG------GRG- 405
Xanthomonas           ---TYRIAMMD---RSLGSPSWSTLSPGSLDESPSFAPNASMVLYAAREG------GRG- 405
Marinomonas           ---NYHIALQD---MKNG--RVQILTETYLDESPSIAPNGSMVMYATTYK------GKG- 389
Leptothrix            ---AFRLTLME---LATG--TITTLTDTNDDESPGFAPNSRLIIYATRAG------GRD- 395
Methylibium           ---AFRVQVMD---LASG--TARAVSDTKDDESPSFAPNGRLIIYATRDG------GRD- 389
Comamonas             ---GFKLQVMD---LATG--TVNSVTDTTADESPSFAPNSRLIVYATIQG------GRE- 384
Thiomonas             ---SYQLWSIN---LATN--ATQLLDDGSDCGHPSFAPNGQIVLYSAGGR------GGE- 404
Methylophilales       ---SYRVAIQN---LLSN--QMLKLTNGPDDESPIFSPNGHMVLFTYKDY------GKVT 400
                                                                                  

Rickettsia            RIYAIDLTGHNEREIKTPG-DASDPEWSNLLN-- 444
Orientia              KLYSVDYTGYNEREIQTPE-NASDPNWSNEYE-- 453
Anaplasma             RLVTVDITGTNTQTLDVPT-NASNAHWSPVLRE- 441
Wolbachia             KLYLVDLVKKNQKMVFTPT-NASLPDWSYF---- 418
GOS_1101030           ----------------------------------
Candidatus            KLWSIDLTGYNERLVTTPT-DASDPSWSSLLSN- 447
alpha                 KLWAIDITGYNEVKIKTPT-DASDPSWSGLLSK- 445
Rhizobium             QLYSIDLTGYNEQQIQTQG-FASDPAWSPLME-- 457
Brucella              KLFTIDLTGRNERQIQTPN-FASDPAWSPLLE-- 443
Bartonella            KIYTIDITGRNERQLPTPN-DASDPAWSPLLNIQ 441
Magnetospirillum      RLYTIDLTGVNERVLLTPV-DGSDPAWSPLIP-- 447
Caulobacter           KLWTVDITGRILRPAAYNG-SGSDPAWSPLLD-- 443
Maricaulis            EIWSVDLAGFNLRRLATGG-MASDPAWSPLIE-- 453
Octadecabacter        GLYSVDITGRNLRRVTTPQ-GGSDPSWGVLQR-- 441
Oceanicola            AIYSVDVSGRNLRRVTTPA-FASDPSWGPLQP-- 446
Sulfitobacter         SLYSVDISGRNLKPVRTQE-GGSDPSWSPLQK-- 440
Rhodobacterales       LLYSVDITGRNLKPVKTPD-GASDPSWSPLQK-- 441
Silicibacter          SLYSVDISGRNLRPVRTPD-GGSDPSWGPLLK-- 439
Rhodobacter           ALYSVDISGRNLKKVPLSV-PASDPAWSPLLP-- 444
Methylobacterium      KLYMVDITGKVEQPVPTPS-FASDPTWSPLLSGK 446
Acetobacter           TIGMVDITGFNDRVLPTPE-AASDPAWSPLNG-- 454
Allochromatium        VLATASVEGGGSQRLTQDSGQVREPAWSPLKR-- 436
Haemophilus           VLQLVSADGRFKASLPGSDGQVKFPAWSPYLTK- 427
Xylella               VLYAVSADARVRQRLVSVDSDVREPAWGPYRSVH 439
Xanthomonas           VLYAVSSDARVRQRLVLADGDVREPAWGPYRTAH 439
Marinomonas           ILAVVSVDGLVKYRLPSAAGEVREPAWSPFFE-- 421
Leptothrix            VLMTTTLDGSIKARLGAPQADVREPTWGPFGR-- 427
Methylibium           VLMTTTTDGKIKARLVSTQADVREPVWGPYGR-- 421
Comamonas             ALMTTTLDGKIKARLAGPSGDIREPDWGPFQKH- 417
Thiomonas             VLKTVSIDGRVRSTLSQAGVQVREPSWGPWTPDR 438
Methylophilales       KIGTVSINGLKMTPIDVGSEAILESTWGPLYD-- 432
                                                        
----------------------------------------------------------------------------------------------------------------------

MUSCLE

MUSCLE (3.7) multiple sequence alignment


Wolbachia       -----------------------MKLFVQL------VLFISLFI---PYSTKAV-LYVDI
Anaplasma       ------------------------MRVFFFACVLP-AVSAFLLC---CQGAVAA-LGVDI
Orientia_t      --------------MINNLSVSMTKVLKIILTIII-ILFNTLSI---LANTTTL-SSIKI
Rickettsia      --------------------------MKNIIYCIL-LLF--------SFNSYAL-ETINI
Acetobacte      MVMSTRPLISDQEADVLAGALRRRSLLGASVAAGG-IMAMPVGA---FAAASAPEAEITV
Rhodobac        --------------------MTLFRTLAPMGLALA-LLLPAAVP---AAAQQGP-LRIQI
Silicibact      ----------------------MMRLLTSLLVGLT-LLSAP------ASAQTGP-LRLEL
Sulfitobac      ------------------------MIVRILSLCLA-LIGGVASV---AQAQDGP-LRIEI
Rhodobac_r      ----------------------MRNILAALLIGAS-ALAG-AGA---AAAQTGP-LRIEI
Octadecaba      ----------------------MMTNFLTLFAAIM-LAFVSIT----PASAQEP-LRLTL
Oceanicola      ---------------------MTHRLFANLLAGLL-VAFAAMWLAGAAAAQGGP-LRITV
Methylobac      ---------------MPGTAFTRRTLLPALTAALG-VLALALPA---ATPARAQ-LQLRI
Maricaulis      -------------------------MTRIFVLFAALLALIGWSA---ASDAQEP-LRVDV
GOS_110103      ---------------------MKKNLFLIFFIYLI-IK---------PNICFSL-VEIDI
Candidatus      ---------------------MKKKLIFICLFLII------------PIKAFAL-IEVDI
alpha_prot      ----------------------MKKILVTLFLILF------------TSKSFAV-VTIDI
Caulobacte      -------------MPGTVVKKETPMRLRALLLMVA-ALMSGAAF---VTPAAAQ-IEVDI
Magnetospi      --------------------MITMSRIRSLAAFAV-FVILGVAA---VLPAQAE-VRIDI
Bartonella      -----------------MMTITRHKVFAWFIVTCG-LWLSS------ISSGYAQ-LKGTI
Rhizobium       MWRENRARFPRSAQKDERLKGFMEMLRRNFFRLFT-LVFAGVLF---AAPANAV-VEINI
Brucella_s      -----------------MKIGIINTKIRTVFSAFACMIAASLVC---TMPARAV-VEINI
Methylophi      ---------------------MKQSFWKFFFLIWLVCI---------SNASHAL-EVIEI
Thiomonas       -------------------MQRRRFVLGSLSAPLVRGAASFVGLTALANSAQAQ-FKVDV
Comamonas       --------------------------MLATLAATP------------ALPALAQ-FRVEV
Leptothrix      --------------------MTSRRQFSGLALGLLGGLN--------ATASRAQ-FRVEI
Methylibiu      ---------------------MLRRSLVALPLAAA------------LPSALAQ-FRVEI
Haemophilu      -----------------------MKLLKRLVSVFAIVLAVG------SNAFAGDEVRIVI
Marinomona      ------------------------------MLFVL------------SNLVRAQ-LVIEI
Allochroma      --------------------MTRYSCLPRSLFVVV-LILVGLGQ----ALAAPR-LNIEI
Xylella_fa      -----------------------MTKFPRWLAILV-GLLFPLSA---LTQQQG--LTIDI
Xanthomona      -----------------------MKKPLRWLAALT-ALLLPLSA---LAQQQG--LTIDI
                                                                           :

Wolbachia       KKSNIGNIDLVVSKC---------ACKTEVENELSESITKVIETNLSNCGLFNV------
Anaplasma       TKGNVERVRISVAPM---------HSSTNLEKEVGKSCVRVVLHDLNSTGIFDASWKLPA
Orientia_t      TKGNCTQIPIAINFF---------SAKSNEEHDLSQNIVSIISNDLNISKIFAP---ISS
Rickettsia      EHGKADPTPIAVNNF---------EADSASDNTVGHEIVKVISNDLKLCGLFHP---ISS
Acetobacte      DQARTAPIPIIIPNF---------------GGGLGEKIAEVLTNDLNNTGLFKV---MPG
Rhodobac        TEGVIEPLPFAVPDF---------VAENAGASELARDMARVIASDLSGTGLFRE---IPA
Silicibact      DQGIIEPMPFAVPNF---------VPDTPAAAQYPTDISRVIAADLTGTGLFRE---IAP
Sulfitobac      TEGVIEPLPFAVPSF---------QPESGDAGQMAVDLARVVSEDLVGSGLFRE---VPA
Rhodobac_r      DQGVIEPLPYAVPDF---------VPETPAAAEYAAEIARVIASDLSGTGLFRE---VPA
Octadecaba      RDGVIEALPFALPTF---------QSEVAGSEGMAADISRVITEDLNGTGLFRQ---IPA
Oceanicola      TDPNVEPLPFAIPAF---------EAETAGAEGLASDISRLVAQDLVNTGLFRE---IPS
Methylobac      GSGAFQPMPIAVADF-------------AGDASLGTLVASVITNNLRRSGYFTP---LEK
Maricaulis      TQGNLDPMPIAVPDF---------VGASDEALRRGADITRVVANDLASSGLFAP---VDQ
GOS_110103      TRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGLFDA---IDK
Candidatus      TRGNLNPLPLAVSPLSIDENSKKSFEKILDKENIGSEISIIVENNLRTSGLFNP---LNK
alpha_prot      TRGNLEPLPTAISNFYIDNPEK--FSEKIKSLKLEENLPKVIKGNLMRSGLFYV---LDN
Caulobacte      NAGAVKPMPIAIPAF--------------SGATRGAEIAQVISGNLERSGLFQP---LNV
Magnetospi      TRGQMKPLPIAIPDF---------AGASAQDNRMGADIARVVSADLERSGLFKP---IDP
Bartonella      SSADFNPIPIAITDF-------------ISNDSIGLKISAVVTADLERSGLFLP---LNK
Rhizobium       NKGNVEPLPVAITDF--------------LQGELGQKISDVVAADLKRSGLFAP---IDK
Brucella_s      NKGVIEPLPIAITDF-------------LSADQLGSNITSVIAADLERSGLFAP---IDK
Methylophi      LGGKASQIPVAVIPF-----------KDNNAQKSMQLMHEVITNDLNRSGLFSS---IDI
Thiomonas       SGIGATQIPVGIGAF-------------RDLNHCPQPIADIVRADLTRSGLFAV------
Comamonas       TGVGLTQLPIAIAPF-------------KGEGSAPQKISAIIQADLERSGQFRG---VDA
Leptothrix      SGVGATQVPIAVLRL-------------RDEDKAPQPVSAIVRADLERSGLFRS---VEP
Methylibiu      SGVGATQLPIAVVKF-------------RDEEKAPQPVGAIVRADLERSGVFRN---LDT
Haemophilu      DEGVDGARPIAVVPF---------------VGSAPEDISKIVADDLRNSGKFNP---IAV
Marinomona      TSGADQLLPLAVVPF-----------AYEGRDGLPEDVAQIIENDLKRSGLFEA---IPR
Allochroma      TGGIESAQPIAIVPF-----------GTSEGLIPPVDMAAIIGADLARTGRFKP---MPT
Xylella_fa      VGGNTAATPIAVLPM----------PYHDSAGAPATDVSGVVAADLNRSGQFRT---LPL
Xanthomona      VGGSASATPIAVIPM----------PYQGSGTAPQTDVSAVVGADLDRSGQFRT---LPA
                           :                            ::  :*     *        

Wolbachia       ----------KRDAKVESWK---SDTVVTISLS---EVSNRNLELSFRLSDSFTNREL-L
Anaplasma       GGFGTTP---EGMPDSDAWTSVGRDVLVTGSIK---EFSQDRVKVRLFIWDVASGRQL-S
Orientia_t      DLFIETEQGVAHIPLFTAWSQINANILINGEIT---KIDSTDFKVTFVIWDVFSAKEI-T
Rickettsia      ASFIEEKTGIGYKPLFAAWRQINASLLVNGAVK---KLENGKLKISFILWDTLLEKQL-G
Acetobacte      STT-------SGTPDFVTSKSMGAHAQVTGSVS----GGGSSVRVEMRLWDVLSHQQI-Q
Rhodobac        SAHISRVTSFEAPVAYGDWKAINAQALITGSVS----ASGDRVVVKFRLYDVFSDQPLGE
Silicibact      EAFISRVNSFEAPIQFADWKAINADALVTGAVN----LSGNTLTVRFRVWDVFSGQELGN
Sulfitobac      SAYISTVSDFNAPIQYADWKAINAQALITGAVS----VSGNTLNVKFRLYDVFSGAELGS
Rhodobac_r      SAHISKVTAFDGPVKFADWKAVNAQALITGAVS----VTGNGLTVRFRGYDVFAEKELET
Octadecaba      SAFISTPASFGSAIAFPDWRAINAQALVTGAVA----VNGNQVTVKFRLYDVFSGGEMGE
Oceanicola      TAFVSQLTSFAQPVAYTDWRTINAQALITGAVA----VNGGQVTVKFRLYDVFSGQELGA
Methylobac      GRFPENPS-FDAAPNFEAWKGAGVQALVTGRVG---RDASGRLTVAFRLWDVASGQQI-T
Maricaulis      DAFIEDIANIDLRPRFSDWRVINADALLVGSVT---IQEDGRLVVGFRLWDTRLEEQL-L
GOS_110103      EAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILGAKMV-D
Candidatus      DAFLQAPDIANLKPRFEDWNLIKAQALITGKVA----YIDEKLRVEFRLWDVLAGKEM-M
alpha_prot      KSYIQQPKLSHLKPRFEDWRLIKAQIMVSGKLR---IDEKGRLRVEFRLWDVVSAKEI-E
Caulobacte      SGVADKLSDVNIQPRFPDWQTTGAQALINGQVT---VGPDGGLRVDFRLWDVFSQQQL-L
Magnetospi      KAFIQNAASLQAGPRFPDWKAINAEALVSGKIE---SGADGRVRVEFRLWDVFNEAYM-T
Bartonella      ENFLENISNPNKQPHFASWQKIKAQGLVTGQVM---REIDGRLRVDFRLWDVFGQRQL-K
Rhizobium       GAFIEKIANPDAAPRFEDWKVINAQALVTGRVT---QEGDGRLKAEFRLWDTFAGQQM-L
Brucella_s      GAFIEKISNPDAAPRFEDWKVINAQALVTGRIT---KQPDGRLKAEFRLWDTFGGQQM-I
Methylophi      SGVSDYPID-EREVNFSNWAALQSQFIVVGKID-AIGRSNSQMQVTWSLIDIYKEKTV-L
Thiomonas       SNLGGQTLTEQGPPNYAAWRSQNLEAVAGGSVA---QVTGGRWQVQFRLWDAVKQADL-G
Comamonas       SGVALDETS---RPDVAQWRQKGADSLATGSIT---RLADGRWDVRFRLWDVVKGQDL-G
Leptothrix      GNVAHDETS---RPVFSDWRSLGSDALVAGSVT---RLADARFDVRYRLWDVVKGSEL-A
Methylibiu      SGVVLDE---GSQPAMSDWRGRSADALVGGSVT---RLADGRFDVRYRLWDVVKGRDL-G
Haemophilu      SQMPQHPTS-AAEVNPEAWSNIGIDAIVIGQVV----PSGNGYSITYQLIDTVGASGT-P
Marinomona      TNMLSLPSK-KEDVHFRDWRLLKSDYVVIGDVK---QIDANNFEINFELINVLSQKTVEK
Allochroma      RDMLDMPAT-REEVDFRDWSLLGMNNLVIGRVE---PDPTG-YRISFSLFDVFRGTEL-A
Xylella_fa      GQITERPTH-GSEIRFPTWQALKQDYIVVGRVL---DARQGTYRVEYELFDVRNGKRM-L
Xanthomona      AQIVEKPTR-GTEVQFQTWRTLKQNYIVVGRVM---DAGEGAYRVEYELFDVAKGERM-L
                                               :                  :         

Wolbachia       TQSV----VFLAKDW-RKISHLVSDLIHDRLIGEKGHFNTKITYIAEEKDSNYKSVRKIA
Anaplasma       GKSF----NFAVGNW-RRAAHSMSDSIYSRITGEGGYFNTRIAYVAET-GLPGSR--RIA
Orientia_t      RKSF----TFPSQLW-RSTAHKIADQIYKHVTGSKGNFNTKIVYVSES-NSSNRKIRRIA
Rickettsia      GEVL----ELPENLW-RRAAHKIADKIYEKITGDTGYFDSKIIYVAES-GPDLKKVKRIA
Acetobacte      GTAY----TTSAANW-RRIAHIVGDVIYERMLGEKGYFDTRIAFISRS-GPRGHQRTRLA
Rhodobac        GLQF----AGSASGW-RRMAHKVADVAYSRITGEGGYFDSRVVFVSES-GPKNARAKRLA
Silicibact      GLQF----SGPTDGW-RRMAHKVADQVYSRITGEGGYFDSRVAFVSES-GPKDQRRKRLA
Sulfitobac      GLQF----SGTVDGW-RRMAHKVADAVYSRITGEGGYFDSRVVYVSET-GPKDDRAKRLA
Rhodobac_r      ALQF----TGTTDGW-RRMAHKVADAIYSEITGESGYFDSRVVYVSES-GPKNDRRKRLA
Octadecaba      GLQF----AGTTDGW-RRMAHKVSDAVYSRITGEAGYFDSRVVYVAET-GPKDDRAKRLA
Oceanicola      GQQL----VGTTDGW-RRMAHKVADQVYSRITGESGYFDSRVVFVSET-GPKNDRRKRLA
Methylobac      GQQY----GTDVANA-RRTGHLVSDAVYTKVTGLGPWFDSRVAFVDES-GPKENRRKRLM
Maricaulis      GLQY----RTAPENW-RRVAHRLADAVYERLTGETGYFNTRIVYVSEGRGIEGEPIRQLA
GOS_110103      GFSL----TTVPSNW-RRVGHKISDKVYERLTGESGYFDTRIIYVAEE-GPKTQRVKKLA
Candidatus      ALAF----TTVPNNW-RRVGHIISDKIYERLTGEKGYFDTRIIYVAEE-GPKTQRKKKLA
alpha_prot      GLAL----FATPSSW-RRIAHIISDKIYQRLTGEEGYFDTRIIYVAES-GPKTQREKKLA
Caulobacte      GLQF----SSTPDNW-RRVAHKISDAVYERLTGEKGYFDTRVAFVAES-GPKLNRIKRLA
Magnetospi      GWTL----SASPQDW-RRLSHKVADAIYKRVTGEDGYFDTQIVYIAES-GPKNDRKKRLS
Bartonella      GRRF----YTATERW-RRVAHMIADEIYSEMTGESGYFDTRIVFIDET-GPQNARIKRLA
Rhizobium       GQQF----YTQPENW-RRVAHIIADAIYERITGEKGYFDTRIVYVAES-GPKNARKRQLA
Brucella_s      GQQF----FTTPDNW-RRVAHIIADAIYERLTGEKGYFDTRVVFVDES-GPAQKRVKRLA
Methylophi      SVAI----KGQPSQY-RVIAHRIADTIYEKLTGSKGVFDTNIAFVKKL----GKEKYSLF
Thiomonas       GLAL----TVMPGDL-RLAAHKISDYIYQKLTGQRGVFATRITYITKA----GQHNFSLN
Comamonas       GQGF----AVTTGDL-RLVAHRIADYIYEKLTGEKGIFSTRIAYVTKA-GAQ----YRLW
Leptothrix      AQAL----SVAKDDL-RLAAHRIADDVYQKLTGERGVFSTRIAYVSKA-----ANRYTLW
Methylibiu      GQSY----AVPAGDL-RLAAHRIADAIYEKLTGEKGVFSTRIAYVTKGGG-----RFTLW
Haemophilu      GAVLMQNSYTVTNKWLRYGAHTVSDEVFEKLSGIRGAFRTRIAYVVQKNG--GSQPYEVR
Marinomona      HTGL----AVKVSGL-RDAAHYISDKIYRLLTGVRGAFSTRILYVTAE-GNRAEPTYRLQ
Allochroma      SSSL----VSTQSGM-RQTAHRIADEIHEKLTGQPGVAATRIAYITST-GSGADLTVTLR
Xylella_fa      GLAM----TARASAM-RDVAHQMADAIYEKITGLRGAFFTRIAYVTAS-GSHGAMRYALM
Xanthomona      GLAM----TARANAM-RDVSHQMADAIYEKITGVRGAFWTRIAYVTAS-GKGGAMRYALM
                                *  .* :.*  .  : *      :.: ::             : 

Wolbachia       VMNQDGSNIKYLTNGEKF-VSTPRFSPNGKGIVYISYTNGK-SYIILKNLKDNTESII--
Anaplasma       IMDQDGANNVYITSTGEF-VSTPRFSPDARSLVYMSYAKSS-GSIVLHDLETGYSTAL--
Orientia_t      IMDQDGANHNYITNGKNH-VITPVFSPKNNQILYVSYHNKI-PTVRIHDLNSGNNKIL--
Rickettsia      LMDYDGANNRYITDGKSL-VLTPRFSGSADKIFYVSYATKRRTLVYEKDLKTGKESIV--
Acetobacte      VMDQDGANARMLTTGKWL-TLTPRFSPVKDQIAFMSYANNR-PRVYLFDLTSGRQQIL--
Rhodobac        VMDYDGANVQYLTDSSSI-VLAPRFSPTGDRILFTSYSTGF-PRIYLMDVGSLATRGL--
Silicibact      IMDYDGANVQYLTDSAAI-VLAPRFSPAGDRLLYTSYESGR-PRIYLLDVGRVKKQEL--
Sulfitobac      VMDYDGANVRYLTDSSSI-VLAPRFSPSGDRILYTSYESGF-PRIYVLDIGSVQRRVL--
Rhodobac_r      VMDYDGANVQYLTNSASI-VLAPRFSPAGDRVLYTSYESGF-PQIHVLDVGQVQRKVL--
Octadecaba      IMDYDGANVQYLTDSSAI-VLAPRFSPSGDRILYTSYESGF-PRINILDVATVVRQQM--
Oceanicola      IMDYDGANVQYLTDSGSI-VLAPRFSPTGDRVIYTSWDSGF-PRINAIDVGTVSRQQI--
Methylobac      VMDQDGANVRALTGGGDVSVVAPRYSPAGQDIAFMTQAPGQQPKVQMIDLETGKRQTV--
Maricaulis      LMDQDGANPSFLTDRSYM-ALLPNYSPSAQEITYVSFLDGQ-ATTYLYNLETGRQEALFA
GOS_110103      IMDQDG-------------------------FTY--------------------------
Candidatus      IMDQDGANNKFLTLGNEL-VLTPRFNPTSQMVTYLSYFKNL-PRVYLLDIETGTQEVV--
alpha_prot      IMDQDGANNKFLTLGNEL-VLTPRFSPNGKMVTYMSYFKNL-PRVYLLNIETGIQEVV--
Caulobacte      IMDQDGANPQYLTDGSYI-VMTPRFSSTSQELTYMALRPTG-SSIYLLNLETSRQETV--
Magnetospi      IMDQDGENHRFLTDGSEL-VLTPRFSPSAREITYLSYFKGV-PRVYIFNLDTGRRESL--
Bartonella      MMDQDGANLIYMSDGSEL-VLTPRFSPKRQEMTYMAYEDNQVPHVYLQQIEMGQRELI--
Rhizobium       IMDQDGFNARALTNSNDI-VLTPRFSPNRQEITYMSFENQQ-PRVYLLQLETGQREVV--
Brucella_s      IMDQDGANVSFISDGRAL-SLTPRFSPNRQEVTYMSFEGGS-PKVYLLQLETGQRELV--
Methylophi      IADYDGHNPRAIVNSRYS-IISPRWSPNGKKIAYVSFEKKK-PVIYVQDIETGKRTLL--
Thiomonas       IADSDGANPQFALRSREP-LLSPVWSPNGQELAYVSFETGK-PVVFMQDVRSGARRAV--
Comamonas       IADADGENAQSALSSPEP-IISPAWAPNGTQLAYVSFESRK-PVVYVHDVASGHRRLL--
Leptothrix      VADADGENAQAAVGGPEP-IISPAWSPNGRELAYVSFEARK-AVVYVQDVLTSKRRVI--
Methylibiu      VTDADGEGGQSALASPEP-IISPAWSPDGRELAYVSFESRK-AVVYVQEVASGKRRTL--
Haemophilu      VADYDGYNQFIVNRSAQP-IMSPAWSPNGQRLAYVSFENKK-SQLVVQDLNSGARKVV--
Marinomona      VADADGHRPQVIVESKEP-ILSPSWSRNGRFITYVMFRDRR-PNIFVQELATGKRQKI--
Allochroma      VADADGYNPQTIVSSAEP-LMSPAWSPDGQRLAYVSFENKR-AAIYIQELSSGRRELV--
Xylella_fa      VADSDGYNPQTIVRSAEP-LLSPDWSPDGKKLAYVSFEKGG-SSIYIQDIATGSRELV--
Xanthomona      VADSDGYNPQTIVRSAEP-LLSPNWSPDGKKLAYVSFERGN-SSIYLQDIATGARELV--
                : : **                         . :                          

Wolbachia       ---------SAFEG-VISAPRFSPDGKSLFIS-HSLSGETNILSLDLSSKRTKKITKGSA
Anaplasma       ---------GGVRG-VNSSPRFSPDGKHVLLS-ESAQGATNIYSIDLKSGKSTRLTNNKS
Orientia_t      ---------ASFNG-ITFSPRFSPDGNKILVSNSSTKNVTHIYEINLLTGKIKQLTKGQS
Rickettsia      ---------GDFAG-ISFAPRFAPDGRKAVMS-IAKNGSTHIYEIDLATKRLHKLTDGFG
Acetobacte      ---------GEFEG-ISFAPRFSPDGRSVVLS-VTRNGGSDLYIVDLASGSRRQITSSGA
Rhodobac        ---------AEQPGTMTFAPRFAPDGRTVAFS-LEQGGNTDIYTLDTGSGTRRQLTNSPS
Silicibact      ---------KTQDGTMSFSPRFSPDGRSIVYS-LTQGGNTDLWKMDLASGQSVRLTNTPA
Sulfitobac      ---------ESAEGTMSFAPRFSPSGNTVVYS-LTQGGNTDIYTMDINTGQSTRLTNTPA
Rhodobac_r      ---------SSGDGTMSFAPRFAPDGRTIVYS-QTQGGNTDLFAMDIETGAKTRLTSAPS
Octadecaba      ---------TTAAGEMAFSPRFSRDGRQVIYS-LANGGNTDIYRTDLATGQNTRLTNTPA
Oceanicola      ---------PVQAGEMAFSPRFSRDGRQVIYS-LSEGGNIDIWRTDITTGQHQRLTSAPS
Methylobac      ---------GNFAS-MSASPRFSPDGRRLVMS-VQQGGNADIVTVDLASKAQTPVTQGLA
Maricaulis      SGGAGAASQVDPDG-QSLSARFSPDGSELAVS-IETRSGHDIHLFDLQTRNLQRLTQHPA
GOS_110103      ------------------------------------------------------------
Candidatus      ---------GDFPG-MTFAPRFSPDGKKIIMS-FAKDGKSDIFTMDLENRIVERITNHPS
alpha_prot      ---------GDFPG-MTFAPRFSPDGRKIIMS-FARDGNSDIYTMDIESRRVEQITSNPA
Caulobacte      ---------GKFPG-MVFAPRFSPDGGKVAFS-VEKNGNSDIYVMDLRSRSTTRITTDPS
Magnetospi      ---------GNFPG-MTFAPRFSPDGNKVVFS-MAENGNTEIYEMNLLTRQKRQLTMNPA
Bartonella      ---------GTFNN-MTIAPRFSSDGQKVIMSLLQNDGSANLYTMDLRTRTMTRLTTTSA
Rhizobium       ---------GNFPG-MTFAPRFSPDGQRVIMS-LQQEGNANIYTMDLRSRTTTRLTNTNA
Brucella_s      ---------GNFPG-MTIAPRFSPDGQKVVMSLLQDDGSANIYTMDLRNRTTTRLTSSQA
Methylophi      ---------ANFRG-NNSAPAWSPDSKKLAIV-LTYSANSQIYTIDADGKNIKQLMRTRS
Thiomonas       ---------ANFKG-SNSAPAFSPDGGTLAVV-LTLTGRSQIYLMPSKGGTPRQLMRSYS
Comamonas       ---------ANFRG-SNSAPAWSPDGSRLAVT-LSRDGGSQLYLLSAQGGEPRRLMQSSG
Leptothrix      ---------ANYKG-SNSAPAWSPDGNQLVVT-LTRDGLSQLYTMSRTGGDLRRLTTSSG
Methylibiu      ---------ASFRG-SNSAPAWSPDGRQLALT-LSRDGGSQLFVMGRDGEGVKRLTSSGA
Haemophilu      ---------ASFQG-HNGAPAFSPDGSRLAFA-SSRDGVLNIYVMGANGGTPTQLTSGAG
Marinomona      ---------AQYRG-LNGAPAWSPDGKQLALV-LSKDGNPEIYVLDIATQKLQRITNHYS
Allochroma      ---------ASHPG-INGSPAFSPDGSRLAMT-LSKDGNPDIYSLNLLSRELTRLTDHYA
Xylella_fa      ---------SSFRG-INAAPSFAPDGHRIALS-LSRSGNPEIYVMDLVSKQLIQLTNSFG
Xanthomona      ---------SSFRG-INGAPSFSPDGRRLALA-LSRSGNPEIYVMDLGSKQLTQLTNHFG
                                                                            

Wolbachia       ISTSPSLSPDQKYMVFSSDISGSQQLYIIDFTKKSKKPKRISFGNGRYATPVWSPKGDLI
Anaplasma       INTSASYSPDKKSIVFNSDRSGRPQLYVMN--ADGTNQRRISSGKGGYSAPVWSPRGDWI
Orientia_t      INTSPSYSPDGSKIAFVSDRSGSTQIYIMN--DQGGNIKRLTSQPGAYTTPAWSPTNNYI
Rickettsia      INTSPSYSPDGRRIVFNSDRNGVPQLYIMN--SDGSNVQRISFGGGSYMAPSWSPRGDYI
Acetobacte      IDTSPCFSPDGSQIVFNSDRGGSPQIYIMP--ASGGGARRISYGQGTYGSPVWSPRGDLI
Rhodobac        IETAPSYSPDGSQIVFESDRSGGQQLYIMP--AGGGEPRRISNGAGRYGTPVWSPRGDLI
Silicibact      IETAPSYAPDGSRIVFESDRSGTPQLYVMP--ANGGEATRISFGQGRYGTPVWSPRGDLI
Sulfitobac      IETAPSYSPDGSRIVFESDRSGSQQLYIMP--ATGGEATRISFGEGRYGTPVWSPRGDLV
Rhodobac_r      IETAPSFSPDGSQIVFESDRSGSQQLYVMP--AGGGEARRISFGEGRYGTPVWSPRGDMV
Octadecaba      IETSPSFSPDGSQIVFESDRSGTQQLYVMS--ANGGEPQRISFENGRYGTPVWSPRGDLI
Oceanicola      IETAPSLSPDGQRIVFESDRSGSQQLYVMP--VTGGEPQRISFGEGRYGSPVWSPRGDMI
Methylobac      IDTSPSYAPDGSQIVFESDRGGSQQIYVMG--ADGSNPRRLSFGEGSASQPAWSPRGDLI
Maricaulis      DDVEPSFAPDGERIVFSSARGGGSQLYVMN--RDGSDVQRITFGSGRYTTPVWSPRGDLI
GOS_110103      ------------------------------------------------------------
Candidatus      IDTSPSYSPNGKFIAFNSDRSGYQQIYIMK--NDGSDVKRISFGNGIYGTPVWSPRGDLI
alpha_prot      IDTSPSFSPDGRFIVFNSDRSGFQQIYTMR--SDGRGVKRISRGKGLYGTPVWSPRGDLI
Caulobacte      IDTSPSFSPDGTKIVFNSDRGGQAQIYVMN--TDGSGVRRISFGGGRYTTPVWSPRGDFI
Magnetospi      IDTAPSYSPDGQQIVFESDRGGGQQIYTMS--ADGSNPQRISFGDGRYGTPVWSPRGDLI
Bartonella      IDTSASYSPDGKQIVFSSDRSGKPQIYKMN--ADGSDIQRISSNEGSYSTPIWSPRGDYI
Rhizobium       IDTSPSYSPDGARIVFESDRGGKQQLYVMG--ADGSGQTRISFGDGSYSTPVWSPRGDLI
Brucella_s      IDTGASYSPDGSQIVFTSDRGGRPQLYVMG--ADGSNPRRISMGDGSYSTPVWSPRGDLI
Methylophi      INTEPAWSPNGKEIYFSSDRAGSAQIYKVD--VDTNEVVRVTFEGNNNVSPSLSPDGKLL
Thiomonas       IDTEPTFSPDGQSLYFVSDRDGGPQVYKVG--LNGGSVQRITYSGGYNVSPAISPDGKTL
Comamonas       IDTEPCFSSDGRTIYFVSDRGGAPQVYKVS--SSGGSAERVTFSGTYNISPAISPDGKWL
Leptothrix      IDTEAAWSPDGKSVYFVSDRGGGPQIYRVA--AGGGNAERVTFAGNYNISPALSPDGRYM
Methylibiu      IDTEATWAPDGKSIYFVSDRGGSPQIYRVP--AGGGNAERVSFSGSYNISPAISPDGRTM
Haemophilu      NNTEPAWSPDGNSILFTSDRSGSPQVYRMD--ANGGSATVV----GGRGSAQISADGKTL
Marinomona      IDTEPSWEPDGKGIVFTSDRGGNPQIYRVD--ISSKAVERVTFEGDLNTRARMTPDGRYL
Allochroma      IDTEPSWSPDGQSIIFTSDRGGSPQIYRMA--ATGGPAERISVEGDYNGRASYAPDGRSI
Xylella_fa      IDTEPVWSSDGKFIYFTSDRGGRPQIYKVA--SVGGTATRVTFQGNYNATASVSYDDKKI
Xanthomona      IDTEPTWAPDGGSIYFTSDRGGRPQIYQVA--ASGGSANRVTFQGNYNATASVSFDGKKI
                                                                            

Wolbachia       AFTKI----QSGKFYIGVMKP----DGKE-ERLLSEGHKIESPAWLPNGREIIFTNA---
Anaplasma       AFTKA----DGKNFHIGVMKP----DGSG-ERLLAKGHMVDSPSWSPNGRVILFTQQDPP
Orientia_t      AFTKI----EAGEFSIGVIKL----DGSN-KRIIATKYLVEGPSWAPDGKTIIFSRAYKA
Rickettsia      AFTKIIRGSEGKTFNIGVMKPYPQDDENS-ERVIASGYLVESPCWSPNGRVIMFAKGWP-
Acetobacte      AFTRI----AGGMFSLGVMAP----DGTG-ERIMTQGFTVESPSFCPNGRVLAYCRQSRA
Rhodobac        AFTKQ----HQGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWAPNGRVLMFTREGA-
Silicibact      AFTKQ----NKGRFHIGVMRV----DGSE-ERLLTASFLDEGPTWSPNGRVIMFTRETQ-
Sulfitobac      AFTKQ----NKGRFHIGVMRL----DGSE-ERLLTASFLDEGPTWAPNGRVIMFARETQ-
Rhodobac_r      AFTKQ----NKGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWAPNGRVIMFTRESQ-
Octadecaba      AFTKQ----ESGRFHIGVMRT----DGTE-ERLLTSSFLDEGPTWAPNGRVIMFARETQ-
Oceanicola      AFTKQ----HAGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWSPNGRVLMFSRETQ-
Methylobac      AFTRQ----RKGGFAICVMKP----DGSG-ERVLTEGFHNESPTFAPNGQYVMFFRDPG-
Maricaulis      AFTKQ----VGGQFSLGVVRA----DGSGIERILFEGYFVDTPAWSPNGRVLLFTRGEQ-
GOS_110103      ------------------------------------------------------------
Candidatus      AFTKL----HNGKFYIGVMRT----DGTG-ERLLTENYYQEAPSWSPNGRVLIFYRETKT
alpha_prot      AFTKI----HKGKFYIGVMRT----DGTG-ERLLTQNFYQEAPSWSPNGRVLIFYRETAG
Caulobacte      AFTKQ----TGGQFHIGVMRP----DGGD-ERLLTTSYLDEGPTWAPNGRVLMFFRE---
Magnetospi      AFTKQ----KGGQFFIGVMRT----DGSG-ERLLAEGFLVEGPTWAPNGRVLSFFRESPS
Bartonella      AFTKQ----LSGQFSIGVMRP----DGQG-ERILTTGFHNEGPTWAPNGRVLMFFRK---
Rhizobium       AFTKQ----SGGKFSIGVMKP----DGSG-ERILTTGFHNEGPTWAPNGRVLMFFRQNA-
Brucella_s      AFTKQ----SQGQFSIGVMKT----DGSG-ERLLTSGFHNEGPTWAPNGRVLMFFRKAA-
Methylophi      LFLNQ----DNGSYRVAIQNL----LSNQ-MLKLTNGPDDESPIFSPNGHMVLFTYK---
Thiomonas       AYISQ----QGNSYQLWSINL-----ATNATQLLDDGSDCGHPSFAPNGQIVLYSA----
Comamonas       AYVSR----VGGGFKLQVMDL-----ATGTVNSVTDTTADESPSFAPNSRLIVYAT----
Leptothrix      AYVSRL---NGSAFRLTLMEL-----ATGTITTLTDTNDDESPGFAPNSRLIIYAT----
Methylibiu      AYISR----DGGAFRVQVMDL-----ASGTARAVSDTKDDESPSFAPNGRLIIYAT----
Haemophilu      VM-------INGNNNVVKQDL-----TTGVSEVLSTSFLGESPSLSPNGIMIIYSS----
Marinomona      VTVQK----NEGNYHIALQDM---KNGRV--QILTETYLDESPSIAPNGSMVMYAT----
Allochroma      VMVTR----VNGAFRIGQLDL-----ARGVTRLLSRGDLDESPSFAPNGAMVIYAT----
Xylella_fa      VVAQG----SGNVYRIAMMDQ---SSGSTVWNTLSTGSLDESPSFAPNASMVLYAA----
Xanthomona      AVAQG----SGNTYRIAMMDR---SLGSPSWSTLSPGSLDESPSFAPNASMVLYAA----
                                                                            

Wolbachia       ---ESPSNSKLYLVDLVKKNQKMVFTP-TNASLPDWSYF----
Anaplasma       SA-THPFRSRLVTVDITGTNTQTLDVP-TNASNAHWSPVLRE-
Orientia_t      TK-STSTKVKLYSVDYTGYNEREIQTP-ENASDPNWSNEYE--
Rickettsia      SNGKSSGKNRIYAIDLTGHNEREIKTP-GDASDPEWSNLLN--
Acetobacte      GAGGAGFNSTIGMVDITGFNDRVLPTP-EAASDPAWSPLNG--
Rhodobac        ---GAGGQPALYSVDISGRNLKKVPLS-VPASDPAWSPLLP--
Silicibact      ---GASGRSSLYSVDISGRNLRPVRTP-DGGSDPSWGPLLK--
Sulfitobac      ---GAGGASSLYSVDISGRNLKPVRTQ-EGGSDPSWSPLQK--
Rhodobac_r      ---GSSGRALLYSVDITGRNLKPVKTP-DGASDPSWSPLQK--
Octadecaba      ---GSDGTTGLYSVDITGRNLRRVTTP-QGGSDPSWGVLQR--
Oceanicola      ---GADGAPAIYSVDVSGRNLRRVTTP-AFASDPSWGPLQP--
Methylobac      ---GQGG-GKLYMVDITGKVEQPVPTP-SFASDPTWSPLLSGK
Maricaulis      --RANGTRYEIWSVDLAGFNLRRLATG-GMASDPAWSPLIE--
GOS_110103      -------------------------------------------
Candidatus      NAKGEGFSAKLWSIDLTGYNERLVTTP-TDASDPSWSSLLSN-
alpha_prot      GKKGQGSSAKLWAIDITGYNEVKIKTP-TDASDPSWSGLLSK-
Caulobacte      ---GGGGNPKLWTVDITGRILRPAAYN-GSGSDPAWSPLLD--
Magnetospi      DERGRGQVVRLYTIDLTGVNERVLLTP-VDGSDPAWSPLIP--
Bartonella      ---NPGMGPKIYTIDITGRNERQLPTP-NDASDPAWSPLLNIQ
Rhizobium       ---GAGG-PQLYSIDLTGYNEQQIQTQ-GFASDPAWSPLME--
Brucella_s      ---GAGG-PKLFTIDLTGRNERQIQTP-NFASDPAWSPLLE--
Methylophi      ---DYGKVTKIGTVSINGLKMTPIDVGSEAILESTWGPLYD--
Thiomonas       ---GGRGGEVLKTVSIDGRVRSTLSQAGVQVREPSWGPWTPDR
Comamonas       ---IQGGREALMTTTLDGKIKARLAGPSGDIREPDWGPFQKH-
Leptothrix      ---RAGGRDVLMTTTLDGSIKARLGAPQADVREPTWGPFGR--
Methylibiu      ---RDGGRDVLMTTTTDGKIKARLVSTQADVREPVWGPYGR--
Haemophilu      ---TQGLGKVLQLVSADGRFKASLPGSDGQVKFPAWSPYLTK-
Marinomona      ---TYKGKGILAVVSVDGLVKYRLPSAAGEVREPAWSPFFE--
Allochroma      ---IHGHRGVLATASVEGGGSQRLTQDSGQVREPAWSPLKR--
Xylella_fa      ---REGGRGVLYAVSADARVRQRLVSVDSDVREPAWGPYRSVH
Xanthomona      ---REGGRGVLYAVSSDARVRQRLVLADGDVREPAWGPYRTAH
                                                           
-------------------------------------------------------------------------------------------------------------------

CURATION

Gblocks 0.91b Results


                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  -----------------------MKLFVQL------VLFISLFI---PYSTKAV-LYVDI
Anaplasma_centr  ------------------------MRVFFFACVLP-AVSAFLLC---CQGAVAA-LGVDI
Orientia_tsutsu  --------------MINNLSVSMTKVLKIILTIII-ILFNTLSI---LANTTTL-SSIKI
Rickettsia_bell  --------------------------MKNIIYCIL-LLF--------SFNSYAL-ETINI
Acetobacter_pas  MVMSTRPLISDQEADVLAGALRRRSLLGASVAAGG-IMAMPVGA---FAAASAPEAEITV
Rhodobac         --------------------MTLFRTLAPMGLALA-LLLPAAVP---AAAQQGP-LRIQI
Silicibacter_la  ----------------------MMRLLTSLLVGLT-LLSAP------ASAQTGP-LRLEL
Sulfitobacter_s  ------------------------MIVRILSLCLA-LIGGVASV---AQAQDGP-LRIEI
Rhodobacterales  ----------------------MRNILAALLIGAS-ALAG-AGA---AAAQTGP-LRIEI
Octadecabacter   ----------------------MMTNFLTLFAAIM-LAFVSIT----PASAQEP-LRLTL
Oceanicola_gran  ---------------------MTHRLFANLLAGLL-VAFAAMWLAGAAAAQGGP-LRITV
Methylobacteriu  ---------------MPGTAFTRRTLLPALTAALG-VLALALPA---ATPARAQ-LQLRI
Maricaulis_mari  -------------------------MTRIFVLFAALLALIGWSA---ASDAQEP-LRVDV
GOS_1101030_Tra  ---------------------MKKNLFLIFFIYLI-IK---------PNICFSL-VEIDI
Candidatus_Pela  ---------------------MKKKLIFICLFLII------------PIKAFAL-IEVDI
alpha_proteobac  ----------------------MKKILVTLFLILF------------TSKSFAV-VTIDI
Caulobacter_seg  -------------MPGTVVKKETPMRLRALLLMVA-ALMSGAAF---VTPAAAQ-IEVDI
Magnetospirillu  --------------------MITMSRIRSLAAFAV-FVILGVAA---VLPAQAE-VRIDI
Bartonella_grah  -----------------MMTITRHKVFAWFIVTCG-LWLSS------ISSGYAQ-LKGTI
Rhizobium_sp._[  MWRENRARFPRSAQKDERLKGFMEMLRRNFFRLFT-LVFAGVLF---AAPANAV-VEINI
Brucella_sp_[al  -----------------MKIGIINTKIRTVFSAFACMIAASLVC---TMPARAV-VEINI
Methylophilales  ---------------------MKQSFWKFFFLIWLVCI---------SNASHAL-EVIEI
Thiomonas_inter  -------------------MQRRRFVLGSLSAPLVRGAASFVGLTALANSAQAQ-FKVDV
Comamonas_testo  --------------------------MLATLAATP------------ALPALAQ-FRVEV
Leptothrix_chol  --------------------MTSRRQFSGLALGLLGGLN--------ATASRAQ-FRVEI
Methylibium_pet  ---------------------MLRRSLVALPLAAA------------LPSALAQ-FRVEI
Haemophilus_inf  -----------------------MKLLKRLVSVFAIVLAVG------SNAFAGDEVRIVI
Marinomonas_sp   ------------------------------MLFVL------------SNLVRAQ-LVIEI
Allochromatium   --------------------MTRYSCLPRSLFVVV-LILVGLGQ----ALAAPR-LNIEI
Xylella_fastidi  -----------------------MTKFPRWLAILV-GLLFPLSA---LTQQQG--LTIDI
Xanthomonas_axo  -----------------------MKKPLRWLAALT-ALLLPLSA---LAQQQG--LTIDI
                                                                            #


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  KKSNIGNIDLVVSKC---------ACKTEVENELSESITKVIETNLSNCGLFNV------
Anaplasma_centr  TKGNVERVRISVAPM---------HSSTNLEKEVGKSCVRVVLHDLNSTGIFDASWKLPA
Orientia_tsutsu  TKGNCTQIPIAINFF---------SAKSNEEHDLSQNIVSIISNDLNISKIFAP---ISS
Rickettsia_bell  EHGKADPTPIAVNNF---------EADSASDNTVGHEIVKVISNDLKLCGLFHP---ISS
Acetobacter_pas  DQARTAPIPIIIPNF---------------GGGLGEKIAEVLTNDLNNTGLFKV---MPG
Rhodobac         TEGVIEPLPFAVPDF---------VAENAGASELARDMARVIASDLSGTGLFRE---IPA
Silicibacter_la  DQGIIEPMPFAVPNF---------VPDTPAAAQYPTDISRVIAADLTGTGLFRE---IAP
Sulfitobacter_s  TEGVIEPLPFAVPSF---------QPESGDAGQMAVDLARVVSEDLVGSGLFRE---VPA
Rhodobacterales  DQGVIEPLPYAVPDF---------VPETPAAAEYAAEIARVIASDLSGTGLFRE---VPA
Octadecabacter   RDGVIEALPFALPTF---------QSEVAGSEGMAADISRVITEDLNGTGLFRQ---IPA
Oceanicola_gran  TDPNVEPLPFAIPAF---------EAETAGAEGLASDISRLVAQDLVNTGLFRE---IPS
Methylobacteriu  GSGAFQPMPIAVADF-------------AGDASLGTLVASVITNNLRRSGYFTP---LEK
Maricaulis_mari  TQGNLDPMPIAVPDF---------VGASDEALRRGADITRVVANDLASSGLFAP---VDQ
GOS_1101030_Tra  TRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGLFDA---IDK
Candidatus_Pela  TRGNLNPLPLAVSPLSIDENSKKSFEKILDKENIGSEISIIVENNLRTSGLFNP---LNK
alpha_proteobac  TRGNLEPLPTAISNFYIDNPEK--FSEKIKSLKLEENLPKVIKGNLMRSGLFYV---LDN
Caulobacter_seg  NAGAVKPMPIAIPAF--------------SGATRGAEIAQVISGNLERSGLFQP---LNV
Magnetospirillu  TRGQMKPLPIAIPDF---------AGASAQDNRMGADIARVVSADLERSGLFKP---IDP
Bartonella_grah  SSADFNPIPIAITDF-------------ISNDSIGLKISAVVTADLERSGLFLP---LNK
Rhizobium_sp._[  NKGNVEPLPVAITDF--------------LQGELGQKISDVVAADLKRSGLFAP---IDK
Brucella_sp_[al  NKGVIEPLPIAITDF-------------LSADQLGSNITSVIAADLERSGLFAP---IDK
Methylophilales  LGGKASQIPVAVIPF-----------KDNNAQKSMQLMHEVITNDLNRSGLFSS---IDI
Thiomonas_inter  SGIGATQIPVGIGAF-------------RDLNHCPQPIADIVRADLTRSGLFAV------
Comamonas_testo  TGVGLTQLPIAIAPF-------------KGEGSAPQKISAIIQADLERSGQFRG---VDA
Leptothrix_chol  SGVGATQVPIAVLRL-------------RDEDKAPQPVSAIVRADLERSGLFRS---VEP
Methylibium_pet  SGVGATQLPIAVVKF-------------RDEEKAPQPVGAIVRADLERSGVFRN---LDT
Haemophilus_inf  DEGVDGARPIAVVPF---------------VGSAPEDISKIVADDLRNSGKFNP---IAV
Marinomonas_sp   TSGADQLLPLAVVPF-----------AYEGRDGLPEDVAQIIENDLKRSGLFEA---IPR
Allochromatium   TGGIESAQPIAIVPF-----------GTSEGLIPPVDMAAIIGADLARTGRFKP---MPT
Xylella_fastidi  VGGNTAATPIAVLPM----------PYHDSAGAPATDVSGVVAADLNRSGQFRT---LPL
Xanthomonas_axo  VGGSASATPIAVIPM----------PYQGSGTAPQTDVSAVVGADLDRSGQFRT---LPA
                 ###########                             ############        


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  ----------KRDAKVESWK---SDTVVTISLS---EVSNRNLELSFRLSDSFTNREL-L
Anaplasma_centr  GGFGTTP---EGMPDSDAWTSVGRDVLVTGSIK---EFSQDRVKVRLFIWDVASGRQL-S
Orientia_tsutsu  DLFIETEQGVAHIPLFTAWSQINANILINGEIT---KIDSTDFKVTFVIWDVFSAKEI-T
Rickettsia_bell  ASFIEEKTGIGYKPLFAAWRQINASLLVNGAVK---KLENGKLKISFILWDTLLEKQL-G
Acetobacter_pas  STT-------SGTPDFVTSKSMGAHAQVTGSVS----GGGSSVRVEMRLWDVLSHQQI-Q
Rhodobac         SAHISRVTSFEAPVAYGDWKAINAQALITGSVS----ASGDRVVVKFRLYDVFSDQPLGE
Silicibacter_la  EAFISRVNSFEAPIQFADWKAINADALVTGAVN----LSGNTLTVRFRVWDVFSGQELGN
Sulfitobacter_s  SAYISTVSDFNAPIQYADWKAINAQALITGAVS----VSGNTLNVKFRLYDVFSGAELGS
Rhodobacterales  SAHISKVTAFDGPVKFADWKAVNAQALITGAVS----VTGNGLTVRFRGYDVFAEKELET
Octadecabacter   SAFISTPASFGSAIAFPDWRAINAQALVTGAVA----VNGNQVTVKFRLYDVFSGGEMGE
Oceanicola_gran  TAFVSQLTSFAQPVAYTDWRTINAQALITGAVA----VNGGQVTVKFRLYDVFSGQELGA
Methylobacteriu  GRFPENPS-FDAAPNFEAWKGAGVQALVTGRVG---RDASGRLTVAFRLWDVASGQQI-T
Maricaulis_mari  DAFIEDIANIDLRPRFSDWRVINADALLVGSVT---IQEDGRLVVGFRLWDTRLEEQL-L
GOS_1101030_Tra  EAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILGAKMV-D
Candidatus_Pela  DAFLQAPDIANLKPRFEDWNLIKAQALITGKVA----YIDEKLRVEFRLWDVLAGKEM-M
alpha_proteobac  KSYIQQPKLSHLKPRFEDWRLIKAQIMVSGKLR---IDEKGRLRVEFRLWDVVSAKEI-E
Caulobacter_seg  SGVADKLSDVNIQPRFPDWQTTGAQALINGQVT---VGPDGGLRVDFRLWDVFSQQQL-L
Magnetospirillu  KAFIQNAASLQAGPRFPDWKAINAEALVSGKIE---SGADGRVRVEFRLWDVFNEAYM-T
Bartonella_grah  ENFLENISNPNKQPHFASWQKIKAQGLVTGQVM---REIDGRLRVDFRLWDVFGQRQL-K
Rhizobium_sp._[  GAFIEKIANPDAAPRFEDWKVINAQALVTGRVT---QEGDGRLKAEFRLWDTFAGQQM-L
Brucella_sp_[al  GAFIEKISNPDAAPRFEDWKVINAQALVTGRIT---KQPDGRLKAEFRLWDTFGGQQM-I
Methylophilales  SGVSDYPID-EREVNFSNWAALQSQFIVVGKID-AIGRSNSQMQVTWSLIDIYKEKTV-L
Thiomonas_inter  SNLGGQTLTEQGPPNYAAWRSQNLEAVAGGSVA---QVTGGRWQVQFRLWDAVKQADL-G
Comamonas_testo  SGVALDETS---RPDVAQWRQKGADSLATGSIT---RLADGRWDVRFRLWDVVKGQDL-G
Leptothrix_chol  GNVAHDETS---RPVFSDWRSLGSDALVAGSVT---RLADARFDVRYRLWDVVKGSEL-A
Methylibium_pet  SGVVLDE---GSQPAMSDWRGRSADALVGGSVT---RLADGRFDVRYRLWDVVKGRDL-G
Haemophilus_inf  SQMPQHPTS-AAEVNPEAWSNIGIDAIVIGQVV----PSGNGYSITYQLIDTVGASGT-P
Marinomonas_sp   TNMLSLPSK-KEDVHFRDWRLLKSDYVVIGDVK---QIDANNFEINFELINVLSQKTVEK
Allochromatium   RDMLDMPAT-REEVDFRDWSLLGMNNLVIGRVE---PDPTG-YRISFSLFDVFRGTEL-A
Xylella_fastidi  GQITERPTH-GSEIRFPTWQALKQDYIVVGRVL---DARQGTYRVEYELFDVRNGKRM-L
Xanthomonas_axo  AQIVEKPTR-GTEVQFQTWRTLKQNYIVVGRVM---DAGEGAYRVEYELFDVAKGERM-L
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  TQSV----VFLAKDW-RKISHLVSDLIHDRLIGEKGHFNTKITYIAEEKDSNYKSVRKIA
Anaplasma_centr  GKSF----NFAVGNW-RRAAHSMSDSIYSRITGEGGYFNTRIAYVAET-GLPGSR--RIA
Orientia_tsutsu  RKSF----TFPSQLW-RSTAHKIADQIYKHVTGSKGNFNTKIVYVSES-NSSNRKIRRIA
Rickettsia_bell  GEVL----ELPENLW-RRAAHKIADKIYEKITGDTGYFDSKIIYVAES-GPDLKKVKRIA
Acetobacter_pas  GTAY----TTSAANW-RRIAHIVGDVIYERMLGEKGYFDTRIAFISRS-GPRGHQRTRLA
Rhodobac         GLQF----AGSASGW-RRMAHKVADVAYSRITGEGGYFDSRVVFVSES-GPKNARAKRLA
Silicibacter_la  GLQF----SGPTDGW-RRMAHKVADQVYSRITGEGGYFDSRVAFVSES-GPKDQRRKRLA
Sulfitobacter_s  GLQF----SGTVDGW-RRMAHKVADAVYSRITGEGGYFDSRVVYVSET-GPKDDRAKRLA
Rhodobacterales  ALQF----TGTTDGW-RRMAHKVADAIYSEITGESGYFDSRVVYVSES-GPKNDRRKRLA
Octadecabacter   GLQF----AGTTDGW-RRMAHKVSDAVYSRITGEAGYFDSRVVYVAET-GPKDDRAKRLA
Oceanicola_gran  GQQL----VGTTDGW-RRMAHKVADQVYSRITGESGYFDSRVVFVSET-GPKNDRRKRLA
Methylobacteriu  GQQY----GTDVANA-RRTGHLVSDAVYTKVTGLGPWFDSRVAFVDES-GPKENRRKRLM
Maricaulis_mari  GLQY----RTAPENW-RRVAHRLADAVYERLTGETGYFNTRIVYVSEGRGIEGEPIRQLA
GOS_1101030_Tra  GFSL----TTVPSNW-RRVGHKISDKVYERLTGESGYFDTRIIYVAEE-GPKTQRVKKLA
Candidatus_Pela  ALAF----TTVPNNW-RRVGHIISDKIYERLTGEKGYFDTRIIYVAEE-GPKTQRKKKLA
alpha_proteobac  GLAL----FATPSSW-RRIAHIISDKIYQRLTGEEGYFDTRIIYVAES-GPKTQREKKLA
Caulobacter_seg  GLQF----SSTPDNW-RRVAHKISDAVYERLTGEKGYFDTRVAFVAES-GPKLNRIKRLA
Magnetospirillu  GWTL----SASPQDW-RRLSHKVADAIYKRVTGEDGYFDTQIVYIAES-GPKNDRKKRLS
Bartonella_grah  GRRF----YTATERW-RRVAHMIADEIYSEMTGESGYFDTRIVFIDET-GPQNARIKRLA
Rhizobium_sp._[  GQQF----YTQPENW-RRVAHIIADAIYERITGEKGYFDTRIVYVAES-GPKNARKRQLA
Brucella_sp_[al  GQQF----FTTPDNW-RRVAHIIADAIYERLTGEKGYFDTRVVFVDES-GPAQKRVKRLA
Methylophilales  SVAI----KGQPSQY-RVIAHRIADTIYEKLTGSKGVFDTNIAFVKKL----GKEKYSLF
Thiomonas_inter  GLAL----TVMPGDL-RLAAHKISDYIYQKLTGQRGVFATRITYITKA----GQHNFSLN
Comamonas_testo  GQGF----AVTTGDL-RLVAHRIADYIYEKLTGEKGIFSTRIAYVTKA-GAQ----YRLW
Leptothrix_chol  AQAL----SVAKDDL-RLAAHRIADDVYQKLTGERGVFSTRIAYVSKA-----ANRYTLW
Methylibium_pet  GQSY----AVPAGDL-RLAAHRIADAIYEKLTGEKGVFSTRIAYVTKGGG-----RFTLW
Haemophilus_inf  GAVLMQNSYTVTNKWLRYGAHTVSDEVFEKLSGIRGAFRTRIAYVVQKNG--GSQPYEVR
Marinomonas_sp   HTGL----AVKVSGL-RDAAHYISDKIYRLLTGVRGAFSTRILYVTAE-GNRAEPTYRLQ
Allochromatium   SSSL----VSTQSGM-RQTAHRIADEIHEKLTGQPGVAATRIAYITST-GSGADLTVTLR
Xylella_fastidi  GLAM----TARASAM-RDVAHQMADAIYEKITGLRGAFFTRIAYVTAS-GSHGAMRYALM
Xanthomonas_axo  GLAM----TARANAM-RDVSHQMADAIYEKITGVRGAFWTRIAYVTAS-GKGGAMRYALM
                                 #############################               


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  VMNQDGSNIKYLTNGEKF-VSTPRFSPNGKGIVYISYTNGK-SYIILKNLKDNTESII--
Anaplasma_centr  IMDQDGANNVYITSTGEF-VSTPRFSPDARSLVYMSYAKSS-GSIVLHDLETGYSTAL--
Orientia_tsutsu  IMDQDGANHNYITNGKNH-VITPVFSPKNNQILYVSYHNKI-PTVRIHDLNSGNNKIL--
Rickettsia_bell  LMDYDGANNRYITDGKSL-VLTPRFSGSADKIFYVSYATKRRTLVYEKDLKTGKESIV--
Acetobacter_pas  VMDQDGANARMLTTGKWL-TLTPRFSPVKDQIAFMSYANNR-PRVYLFDLTSGRQQIL--
Rhodobac         VMDYDGANVQYLTDSSSI-VLAPRFSPTGDRILFTSYSTGF-PRIYLMDVGSLATRGL--
Silicibacter_la  IMDYDGANVQYLTDSAAI-VLAPRFSPAGDRLLYTSYESGR-PRIYLLDVGRVKKQEL--
Sulfitobacter_s  VMDYDGANVRYLTDSSSI-VLAPRFSPSGDRILYTSYESGF-PRIYVLDIGSVQRRVL--
Rhodobacterales  VMDYDGANVQYLTNSASI-VLAPRFSPAGDRVLYTSYESGF-PQIHVLDVGQVQRKVL--
Octadecabacter   IMDYDGANVQYLTDSSAI-VLAPRFSPSGDRILYTSYESGF-PRINILDVATVVRQQM--
Oceanicola_gran  IMDYDGANVQYLTDSGSI-VLAPRFSPTGDRVIYTSWDSGF-PRINAIDVGTVSRQQI--
Methylobacteriu  VMDQDGANVRALTGGGDVSVVAPRYSPAGQDIAFMTQAPGQQPKVQMIDLETGKRQTV--
Maricaulis_mari  LMDQDGANPSFLTDRSYM-ALLPNYSPSAQEITYVSFLDGQ-ATTYLYNLETGRQEALFA
GOS_1101030_Tra  IMDQDG-------------------------FTY--------------------------
Candidatus_Pela  IMDQDGANNKFLTLGNEL-VLTPRFNPTSQMVTYLSYFKNL-PRVYLLDIETGTQEVV--
alpha_proteobac  IMDQDGANNKFLTLGNEL-VLTPRFSPNGKMVTYMSYFKNL-PRVYLLNIETGIQEVV--
Caulobacter_seg  IMDQDGANPQYLTDGSYI-VMTPRFSSTSQELTYMALRPTG-SSIYLLNLETSRQETV--
Magnetospirillu  IMDQDGENHRFLTDGSEL-VLTPRFSPSAREITYLSYFKGV-PRVYIFNLDTGRRESL--
Bartonella_grah  MMDQDGANLIYMSDGSEL-VLTPRFSPKRQEMTYMAYEDNQVPHVYLQQIEMGQRELI--
Rhizobium_sp._[  IMDQDGFNARALTNSNDI-VLTPRFSPNRQEITYMSFENQQ-PRVYLLQLETGQREVV--
Brucella_sp_[al  IMDQDGANVSFISDGRAL-SLTPRFSPNRQEVTYMSFEGGS-PKVYLLQLETGQRELV--
Methylophilales  IADYDGHNPRAIVNSRYS-IISPRWSPNGKKIAYVSFEKKK-PVIYVQDIETGKRTLL--
Thiomonas_inter  IADSDGANPQFALRSREP-LLSPVWSPNGQELAYVSFETGK-PVVFMQDVRSGARRAV--
Comamonas_testo  IADADGENAQSALSSPEP-IISPAWAPNGTQLAYVSFESRK-PVVYVHDVASGHRRLL--
Leptothrix_chol  VADADGENAQAAVGGPEP-IISPAWSPNGRELAYVSFEARK-AVVYVQDVLTSKRRVI--
Methylibium_pet  VTDADGEGGQSALASPEP-IISPAWSPDGRELAYVSFESRK-AVVYVQEVASGKRRTL--
Haemophilus_inf  VADYDGYNQFIVNRSAQP-IMSPAWSPNGQRLAYVSFENKK-SQLVVQDLNSGARKVV--
Marinomonas_sp   VADADGHRPQVIVESKEP-ILSPSWSRNGRFITYVMFRDRR-PNIFVQELATGKRQKI--
Allochromatium   VADADGYNPQTIVSSAEP-LMSPAWSPDGQRLAYVSFENKR-AAIYIQELSSGRRELV--
Xylella_fastidi  VADSDGYNPQTIVRSAEP-LLSPDWSPDGKKLAYVSFEKGG-SSIYIQDIATGSRELV--
Xanthomonas_axo  VADSDGYNPQTIVRSAEP-LLSPNWSPDGKKLAYVSFERGN-SSIYLQDIATGARELV--
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  ---------SAFEG-VISAPRFSPDGKSLFIS-HSLSGETNILSLDLSSKRTKKITKGSA
Anaplasma_centr  ---------GGVRG-VNSSPRFSPDGKHVLLS-ESAQGATNIYSIDLKSGKSTRLTNNKS
Orientia_tsutsu  ---------ASFNG-ITFSPRFSPDGNKILVSNSSTKNVTHIYEINLLTGKIKQLTKGQS
Rickettsia_bell  ---------GDFAG-ISFAPRFAPDGRKAVMS-IAKNGSTHIYEIDLATKRLHKLTDGFG
Acetobacter_pas  ---------GEFEG-ISFAPRFSPDGRSVVLS-VTRNGGSDLYIVDLASGSRRQITSSGA
Rhodobac         ---------AEQPGTMTFAPRFAPDGRTVAFS-LEQGGNTDIYTLDTGSGTRRQLTNSPS
Silicibacter_la  ---------KTQDGTMSFSPRFSPDGRSIVYS-LTQGGNTDLWKMDLASGQSVRLTNTPA
Sulfitobacter_s  ---------ESAEGTMSFAPRFSPSGNTVVYS-LTQGGNTDIYTMDINTGQSTRLTNTPA
Rhodobacterales  ---------SSGDGTMSFAPRFAPDGRTIVYS-QTQGGNTDLFAMDIETGAKTRLTSAPS
Octadecabacter   ---------TTAAGEMAFSPRFSRDGRQVIYS-LANGGNTDIYRTDLATGQNTRLTNTPA
Oceanicola_gran  ---------PVQAGEMAFSPRFSRDGRQVIYS-LSEGGNIDIWRTDITTGQHQRLTSAPS
Methylobacteriu  ---------GNFAS-MSASPRFSPDGRRLVMS-VQQGGNADIVTVDLASKAQTPVTQGLA
Maricaulis_mari  SGGAGAASQVDPDG-QSLSARFSPDGSELAVS-IETRSGHDIHLFDLQTRNLQRLTQHPA
GOS_1101030_Tra  ------------------------------------------------------------
Candidatus_Pela  ---------GDFPG-MTFAPRFSPDGKKIIMS-FAKDGKSDIFTMDLENRIVERITNHPS
alpha_proteobac  ---------GDFPG-MTFAPRFSPDGRKIIMS-FARDGNSDIYTMDIESRRVEQITSNPA
Caulobacter_seg  ---------GKFPG-MVFAPRFSPDGGKVAFS-VEKNGNSDIYVMDLRSRSTTRITTDPS
Magnetospirillu  ---------GNFPG-MTFAPRFSPDGNKVVFS-MAENGNTEIYEMNLLTRQKRQLTMNPA
Bartonella_grah  ---------GTFNN-MTIAPRFSSDGQKVIMSLLQNDGSANLYTMDLRTRTMTRLTTTSA
Rhizobium_sp._[  ---------GNFPG-MTFAPRFSPDGQRVIMS-LQQEGNANIYTMDLRSRTTTRLTNTNA
Brucella_sp_[al  ---------GNFPG-MTIAPRFSPDGQKVVMSLLQDDGSANIYTMDLRNRTTTRLTSSQA
Methylophilales  ---------ANFRG-NNSAPAWSPDSKKLAIV-LTYSANSQIYTIDADGKNIKQLMRTRS
Thiomonas_inter  ---------ANFKG-SNSAPAFSPDGGTLAVV-LTLTGRSQIYLMPSKGGTPRQLMRSYS
Comamonas_testo  ---------ANFRG-SNSAPAWSPDGSRLAVT-LSRDGGSQLYLLSAQGGEPRRLMQSSG
Leptothrix_chol  ---------ANYKG-SNSAPAWSPDGNQLVVT-LTRDGLSQLYTMSRTGGDLRRLTTSSG
Methylibium_pet  ---------ASFRG-SNSAPAWSPDGRQLALT-LSRDGGSQLFVMGRDGEGVKRLTSSGA
Haemophilus_inf  ---------ASFQG-HNGAPAFSPDGSRLAFA-SSRDGVLNIYVMGANGGTPTQLTSGAG
Marinomonas_sp   ---------AQYRG-LNGAPAWSPDGKQLALV-LSKDGNPEIYVLDIATQKLQRITNHYS
Allochromatium   ---------ASHPG-INGSPAFSPDGSRLAMT-LSKDGNPDIYSLNLLSRELTRLTDHYA
Xylella_fastidi  ---------SSFRG-INAAPSFAPDGHRIALS-LSRSGNPEIYVMDLVSKQLIQLTNSFG
Xanthomonas_axo  ---------SSFRG-INGAPSFSPDGRRLALA-LSRSGNPEIYVMDLGSKQLTQLTNHFG
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  ISTSPSLSPDQKYMVFSSDISGSQQLYIIDFTKKSKKPKRISFGNGRYATPVWSPKGDLI
Anaplasma_centr  INTSASYSPDKKSIVFNSDRSGRPQLYVMN--ADGTNQRRISSGKGGYSAPVWSPRGDWI
Orientia_tsutsu  INTSPSYSPDGSKIAFVSDRSGSTQIYIMN--DQGGNIKRLTSQPGAYTTPAWSPTNNYI
Rickettsia_bell  INTSPSYSPDGRRIVFNSDRNGVPQLYIMN--SDGSNVQRISFGGGSYMAPSWSPRGDYI
Acetobacter_pas  IDTSPCFSPDGSQIVFNSDRGGSPQIYIMP--ASGGGARRISYGQGTYGSPVWSPRGDLI
Rhodobac         IETAPSYSPDGSQIVFESDRSGGQQLYIMP--AGGGEPRRISNGAGRYGTPVWSPRGDLI
Silicibacter_la  IETAPSYAPDGSRIVFESDRSGTPQLYVMP--ANGGEATRISFGQGRYGTPVWSPRGDLI
Sulfitobacter_s  IETAPSYSPDGSRIVFESDRSGSQQLYIMP--ATGGEATRISFGEGRYGTPVWSPRGDLV
Rhodobacterales  IETAPSFSPDGSQIVFESDRSGSQQLYVMP--AGGGEARRISFGEGRYGTPVWSPRGDMV
Octadecabacter   IETSPSFSPDGSQIVFESDRSGTQQLYVMS--ANGGEPQRISFENGRYGTPVWSPRGDLI
Oceanicola_gran  IETAPSLSPDGQRIVFESDRSGSQQLYVMP--VTGGEPQRISFGEGRYGSPVWSPRGDMI
Methylobacteriu  IDTSPSYAPDGSQIVFESDRGGSQQIYVMG--ADGSNPRRLSFGEGSASQPAWSPRGDLI
Maricaulis_mari  DDVEPSFAPDGERIVFSSARGGGSQLYVMN--RDGSDVQRITFGSGRYTTPVWSPRGDLI
GOS_1101030_Tra  ------------------------------------------------------------
Candidatus_Pela  IDTSPSYSPNGKFIAFNSDRSGYQQIYIMK--NDGSDVKRISFGNGIYGTPVWSPRGDLI
alpha_proteobac  IDTSPSFSPDGRFIVFNSDRSGFQQIYTMR--SDGRGVKRISRGKGLYGTPVWSPRGDLI
Caulobacter_seg  IDTSPSFSPDGTKIVFNSDRGGQAQIYVMN--TDGSGVRRISFGGGRYTTPVWSPRGDFI
Magnetospirillu  IDTAPSYSPDGQQIVFESDRGGGQQIYTMS--ADGSNPQRISFGDGRYGTPVWSPRGDLI
Bartonella_grah  IDTSASYSPDGKQIVFSSDRSGKPQIYKMN--ADGSDIQRISSNEGSYSTPIWSPRGDYI
Rhizobium_sp._[  IDTSPSYSPDGARIVFESDRGGKQQLYVMG--ADGSGQTRISFGDGSYSTPVWSPRGDLI
Brucella_sp_[al  IDTGASYSPDGSQIVFTSDRGGRPQLYVMG--ADGSNPRRISMGDGSYSTPVWSPRGDLI
Methylophilales  INTEPAWSPNGKEIYFSSDRAGSAQIYKVD--VDTNEVVRVTFEGNNNVSPSLSPDGKLL
Thiomonas_inter  IDTEPTFSPDGQSLYFVSDRDGGPQVYKVG--LNGGSVQRITYSGGYNVSPAISPDGKTL
Comamonas_testo  IDTEPCFSSDGRTIYFVSDRGGAPQVYKVS--SSGGSAERVTFSGTYNISPAISPDGKWL
Leptothrix_chol  IDTEAAWSPDGKSVYFVSDRGGGPQIYRVA--AGGGNAERVTFAGNYNISPALSPDGRYM
Methylibium_pet  IDTEATWAPDGKSIYFVSDRGGSPQIYRVP--AGGGNAERVSFSGSYNISPAISPDGRTM
Haemophilus_inf  NNTEPAWSPDGNSILFTSDRSGSPQVYRMD--ANGGSATVV----GGRGSAQISADGKTL
Marinomonas_sp   IDTEPSWEPDGKGIVFTSDRGGNPQIYRVD--ISSKAVERVTFEGDLNTRARMTPDGRYL
Allochromatium   IDTEPSWSPDGQSIIFTSDRGGSPQIYRMA--ATGGPAERISVEGDYNGRASYAPDGRSI
Xylella_fastidi  IDTEPVWSSDGKFIYFTSDRGGRPQIYKVA--SVGGTATRVTFQGNYNATASVSYDDKKI
Xanthomonas_axo  IDTEPTWAPDGGSIYFTSDRGGRPQIYQVA--ASGGSANRVTFQGNYNATASVSFDGKKI
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Wolbachia_endos  AFTKI----QSGKFYIGVMKP----DGKE-ERLLSEGHKIESPAWLPNGREIIFTNA---
Anaplasma_centr  AFTKA----DGKNFHIGVMKP----DGSG-ERLLAKGHMVDSPSWSPNGRVILFTQQDPP
Orientia_tsutsu  AFTKI----EAGEFSIGVIKL----DGSN-KRIIATKYLVEGPSWAPDGKTIIFSRAYKA
Rickettsia_bell  AFTKIIRGSEGKTFNIGVMKPYPQDDENS-ERVIASGYLVESPCWSPNGRVIMFAKGWP-
Acetobacter_pas  AFTRI----AGGMFSLGVMAP----DGTG-ERIMTQGFTVESPSFCPNGRVLAYCRQSRA
Rhodobac         AFTKQ----HQGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWAPNGRVLMFTREGA-
Silicibacter_la  AFTKQ----NKGRFHIGVMRV----DGSE-ERLLTASFLDEGPTWSPNGRVIMFTRETQ-
Sulfitobacter_s  AFTKQ----NKGRFHIGVMRL----DGSE-ERLLTASFLDEGPTWAPNGRVIMFARETQ-
Rhodobacterales  AFTKQ----NKGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWAPNGRVIMFTRESQ-
Octadecabacter   AFTKQ----ESGRFHIGVMRT----DGTE-ERLLTSSFLDEGPTWAPNGRVIMFARETQ-
Oceanicola_gran  AFTKQ----HAGRFHIGVMRT----DGSE-ERLLTASFLDEGPTWSPNGRVLMFSRETQ-
Methylobacteriu  AFTRQ----RKGGFAICVMKP----DGSG-ERVLTEGFHNESPTFAPNGQYVMFFRDPG-
Maricaulis_mari  AFTKQ----VGGQFSLGVVRA----DGSGIERILFEGYFVDTPAWSPNGRVLLFTRGEQ-
GOS_1101030_Tra  ------------------------------------------------------------
Candidatus_Pela  AFTKL----HNGKFYIGVMRT----DGTG-ERLLTENYYQEAPSWSPNGRVLIFYRETKT
alpha_proteobac  AFTKI----HKGKFYIGVMRT----DGTG-ERLLTQNFYQEAPSWSPNGRVLIFYRETAG
Caulobacter_seg  AFTKQ----TGGQFHIGVMRP----DGGD-ERLLTTSYLDEGPTWAPNGRVLMFFRE---
Magnetospirillu  AFTKQ----KGGQFFIGVMRT----DGSG-ERLLAEGFLVEGPTWAPNGRVLSFFRESPS
Bartonella_grah  AFTKQ----LSGQFSIGVMRP----DGQG-ERILTTGFHNEGPTWAPNGRVLMFFRK---
Rhizobium_sp._[  AFTKQ----SGGKFSIGVMKP----DGSG-ERILTTGFHNEGPTWAPNGRVLMFFRQNA-
Brucella_sp_[al  AFTKQ----SQGQFSIGVMKT----DGSG-ERLLTSGFHNEGPTWAPNGRVLMFFRKAA-
Methylophilales  LFLNQ----DNGSYRVAIQNL----LSNQ-MLKLTNGPDDESPIFSPNGHMVLFTYK---
Thiomonas_inter  AYISQ----QGNSYQLWSINL-----ATNATQLLDDGSDCGHPSFAPNGQIVLYSA----
Comamonas_testo  AYVSR----VGGGFKLQVMDL-----ATGTVNSVTDTTADESPSFAPNSRLIVYAT----
Leptothrix_chol  AYVSRL---NGSAFRLTLMEL-----ATGTITTLTDTNDDESPGFAPNSRLIIYAT----
Methylibium_pet  AYISR----DGGAFRVQVMDL-----ASGTARAVSDTKDDESPSFAPNGRLIIYAT----
Haemophilus_inf  VM-------INGNNNVVKQDL-----TTGVSEVLSTSFLGESPSLSPNGIMIIYSS----
Marinomonas_sp   VTVQK----NEGNYHIALQDM---KNGRV--QILTETYLDESPSIAPNGSMVMYAT----
Allochromatium   VMVTR----VNGAFRIGQLDL-----ARGVTRLLSRGDLDESPSFAPNGAMVIYAT----
Xylella_fastidi  VVAQG----SGNVYRIAMMDQ---SSGSTVWNTLSTGSLDESPSFAPNASMVLYAA----
Xanthomonas_axo  AVAQG----SGNTYRIAMMDR---SLGSPSWSTLSPGSLDESPSFAPNASMVLYAA----
                                                                             


                        490       500       510       520
                 =========+=========+=========+=========+===
Wolbachia_endos  ---ESPSNSKLYLVDLVKKNQKMVFTP-TNASLPDWSYF----
Anaplasma_centr  SA-THPFRSRLVTVDITGTNTQTLDVP-TNASNAHWSPVLRE-
Orientia_tsutsu  TK-STSTKVKLYSVDYTGYNEREIQTP-ENASDPNWSNEYE--
Rickettsia_bell  SNGKSSGKNRIYAIDLTGHNEREIKTP-GDASDPEWSNLLN--
Acetobacter_pas  GAGGAGFNSTIGMVDITGFNDRVLPTP-EAASDPAWSPLNG--
Rhodobac         ---GAGGQPALYSVDISGRNLKKVPLS-VPASDPAWSPLLP--
Silicibacter_la  ---GASGRSSLYSVDISGRNLRPVRTP-DGGSDPSWGPLLK--
Sulfitobacter_s  ---GAGGASSLYSVDISGRNLKPVRTQ-EGGSDPSWSPLQK--
Rhodobacterales  ---GSSGRALLYSVDITGRNLKPVKTP-DGASDPSWSPLQK--
Octadecabacter   ---GSDGTTGLYSVDITGRNLRRVTTP-QGGSDPSWGVLQR--
Oceanicola_gran  ---GADGAPAIYSVDVSGRNLRRVTTP-AFASDPSWGPLQP--
Methylobacteriu  ---GQGG-GKLYMVDITGKVEQPVPTP-SFASDPTWSPLLSGK
Maricaulis_mari  --RANGTRYEIWSVDLAGFNLRRLATG-GMASDPAWSPLIE--
GOS_1101030_Tra  -------------------------------------------
Candidatus_Pela  NAKGEGFSAKLWSIDLTGYNERLVTTP-TDASDPSWSSLLSN-
alpha_proteobac  GKKGQGSSAKLWAIDITGYNEVKIKTP-TDASDPSWSGLLSK-
Caulobacter_seg  ---GGGGNPKLWTVDITGRILRPAAYN-GSGSDPAWSPLLD--
Magnetospirillu  DERGRGQVVRLYTIDLTGVNERVLLTP-VDGSDPAWSPLIP--
Bartonella_grah  ---NPGMGPKIYTIDITGRNERQLPTP-NDASDPAWSPLLNIQ
Rhizobium_sp._[  ---GAGG-PQLYSIDLTGYNEQQIQTQ-GFASDPAWSPLME--
Brucella_sp_[al  ---GAGG-PKLFTIDLTGRNERQIQTP-NFASDPAWSPLLE--
Methylophilales  ---DYGKVTKIGTVSINGLKMTPIDVGSEAILESTWGPLYD--
Thiomonas_inter  ---GGRGGEVLKTVSIDGRVRSTLSQAGVQVREPSWGPWTPDR
Comamonas_testo  ---IQGGREALMTTTLDGKIKARLAGPSGDIREPDWGPFQKH-
Leptothrix_chol  ---RAGGRDVLMTTTLDGSIKARLGAPQADVREPTWGPFGR--
Methylibium_pet  ---RDGGRDVLMTTTTDGKIKARLVSTQADVREPVWGPYGR--
Haemophilus_inf  ---TQGLGKVLQLVSADGRFKASLPGSDGQVKFPAWSPYLTK-
Marinomonas_sp   ---TYKGKGILAVVSVDGLVKYRLPSAAGEVREPAWSPFFE--
Allochromatium   ---IHGHRGVLATASVEGGGSQRLTQDSGQVREPAWSPLKR--
Xylella_fastidi  ---REGGRGVLYAVSADARVRQRLVSVDSDVREPAWGPYRSVH
Xanthomonas_axo  ---REGGRGVLYAVSSDARVRQRLVLADGDVREPAWGPYRTAH

Protein Domains

PROTOCOLE:

Utilisation de la séquence GOS_1101030 contre InterPro

Confrontation avec la fonction d'homologues éventuels trouvés dans SP

Rerérer les AA conservés dans les alignements multiples.


ANALYSE DES RÉSULTATS:


a) INTERPROT


La traduction de l'ORF présente:


- un domaine protéique (positions 1 à 20) correspondant à un peptide signal et indiquant que la protéine subit une translocation co-traductionnelle (protéine dite "de sécrétion").


- un domaine en hélice alpha probablement tansmembranire (positions 5 à 23).


- un domaine protéique conservé caractéristique de la superfamille TolB_N (domaine N terminal de la TolB, une protéine nécessaire à l'importation des colicines).

Le résultat de l'alignement avec le domaine est significatif: E-value_ 1.5e-27 à 7.6e-38 selon les sources. On peut donc considérer que cette région est bien un domaine caractéristique de la superfamille TolB_N.

Dans le segment protéique codé, il s'étend de la position 7 à 187.


Son identifiant INTERPRO est: IPR007195


Cette région conservée de la séquence GOS_1101030 ressemble au domaine N-terminal de la protéine TolB. TolB est une protéine périplasmique d'Escherichia coli qui fait partie du système de translocation des colicines A et E et impliqué dans la mort cellulaire.

Le domaine N-terminal de TolB, en hélice alpha, présente des similitudes structurales avec le domaine C-terminal des les RNA-ligases de transfert. Sa fonction est incertaine.


voir notamment la publication:

Abergel C, Bouveret E, Claverie JM, Brown K, Rigal A, Lazdunski C, Benedetti H.

Structure of the Escherichia coli TolB protein determined by MAD methods at 1.95 A resolution.

Structure 7 1291-300 1999

http://dx.doi.org/10.1016/S0969-2126(00)80062-3


b)il a été trouvé des protéines homologues dans SP (annotations manuelles)et dans nr: voir rubrique BLAST (Blastp vs SP et vs nr) mais les homologues sont des proréines (environ 2x) plus grandes et possèdent les 2 domaines fonctionnels des protéines TolB, c'est à dire non seulement le domaine N-ter comme GOS1101030, mais aussi le domaine C-terminal. Ce domaine C-ter absent chez GOS_1101030 est en feuillet bêta et présente des similitudes structurales avec des prolyl-oligopeptidases (et à un moindre degré avec certaines lactamases).


c)Il existe de nombreux acides aminés conservés dans la région de séquence 27-200 correspondant au domaine fonctionnel TolB_N (voir rubrique: alignements multiples).



RÉSULTATS BRUTS:

GOS_1101030 FACB321CDC8EA878 207	Gene3D	   G3DSA:3.40.50.10070 no description	 29	178	1.5e-27	T	03-Dec-2009	IPR007195	TolB, N-terminal	Biological Process: protein transport (GO:0015031), Cellular Component: periplasmic space (GO:0042597)
GOS_1101030 FACB321CDC8EA878 207	SignalPHMM  SignalP	     signal-peptide	 1	20	NA	?	03-Dec-2009	NULL	NULL
GOS_1101030 FACB321CDC8EA878 207	superfamily SSF52964	     TolB, N-terminal domain 29	175	3e-29	T	03-Dec-2009	IPR007195	TolB, N-terminal	Biological Process: protein transport (GO:0015031), Cellular Component: periplasmic space (GO:0042597)
GOS_1101030 FACB321CDC8EA878 207	TMHMM	   tmhmm	              transmembrane_regions	 5	23	NA	?	03-Dec-2009	NULL	NULL
GOS_1101030 FACB321CDC8EA878 207	HMMPfam	   PF04052	     TolB_N	          7	187	7.6e-38	T	03-Dec-2009	IPR007195	TolB, N-terminal	Biological Process: protein transport (GO:0015031), Cellular Component: periplasmic space (GO:0042597)

_
INTERPRO 

identifiant InterPro: IPR007195 TolB, N-terminal

TolB is a periplasmic protein from Escherichia coli that is part of the Tol-dependent translocation system 
involving group A and E colicins that is used to penetrate and kill cells [1, 2]. TolB has two domains, 
an alpha-helical N-terminal domain that shares structural similarity with the C-terminal domain of transfer
 RNA ligases, and a beta-propeller C-terminal domain (IPR011042) that shares structural similarity with numerous
 members of the prolyl oligopeptidase family and, to a lesser extent, to class B metallo-beta-lactamases [1].
 The function of the N-terminal domain is uncertain.

GOS_1101030 correspond à la partie N-ter seulement. Fonction incertaine.The α/β N-terminal domain shares a 
structural similarity with the C-terminal domain of transfer RNA ligases. We suggest that the (complete)TolB protein 
might be part of a multiprotein complex involved in the recycling of peptidoglycan or in its covalent linking 
with lipoproteins.

voir notamment: Abergel C, Bouveret E, Claverie JM, Brown K, Rigal A, Lazdunski C, Benedetti H. 
Structure of the Escherichia coli TolB protein determined by MAD methods at 1.95 A resolution. 
Structure 7 1291-300 1999 [PubMed: 10545334] 
http://dx.doi.org/10.1016/S0969-2126(00)80062-3 


_____________________________________________________________________________
Pfam (Sanger)
Family: TolB_N (PF04052)
TolB amino-terminal domain  
TolB is an essential periplasmic component of the tol-dependent translocation system. This function of this amino 
terminal domain is uncertain.


--------------------------------------------------------------------------------

Literature references

Carr S, Penfold CN, Bamford V, James R, Hemmings AM. , Structure Fold Des 2000;8:57-66.: The structure of TolB,
 an essential component of the tol-dependent translocation system, and its protein-protein interaction with the
 translocation domain of colicin E9. PUBMED:10673426 

_________________________________________________________________________________________________________

SSF 52964:
TolB is a periplasmic protein from Escherichia coli that is part of the Tol-dependent translocation system 
involving group A and E colicins that is used to penetrate and kill cells [10545334, 10673426]. TolB has two
 domains, an alpha-helical N-terminal domain that shares structural similarity with the C-terminal domain of 
transfer RNA ligases, and a beta-propeller C-terminal domain that shares structural similarity with numerous 
members of the prolyl oligopeptidase family and, to a lesser extent, to class B metallo-beta-lactamases [10545334].
 The function of the N-terminal domain is uncertain

Phylogeny

PROTOCOLE:


En utilisant les 30 homologues + tGOS_1101030 (Evalues<1e-10) comme indiqué dans le champ Multiple Alignement


a) Phylogeny.fr / methode BioNJ / bootstrap _ 0/ default substitution model /groupe unique des séquences sélectionnées/ programme TreeDyn / Tree Rendering ( avec 2 enracinements différents R1 et R2)


b)Phylogeny.fr / methode PhyML / bootstrap _ 100/ default substitution model /groupe unique des séquences sélectionnées / programme TreeDyn / Tree Rendering




ANALYSE DES RÉSULTATS:


L'arbre obtenu par la méthode PhyML (placé en dernier dans le champ des résultats bruts):


- distingue clairement le groupe d'étude (alpha-protéobactéries) et le groupe extérieur (bêta- et gamma-protéobactéries).


- montre que la séquence traduite GOS_1101030 émerge au sein des alpha-protéobactéries.


L'arbre est cohérent avec la phylogénie de référence.


Il est également cohérent avec l'arbre obtenu par l'autre méthode (BioNJ). Toutefois il est à remarquer que l'arbre obtenu par la méthode BioNJ fait émerger une séquence du groupe des alpha-protéobactéries (Orientia tsutsugamushi)dans le groupe extérieur. Des études ultérieures devraient essayer de déterminer si c'est l'indice d'un posible transfert horizontal.

RÉSULTATS BRUTS:


BioNJ

Enracimement R1 (voir également, après enracinement R1, enracinement R2 comme indiqué dans l'arbre)

                                                                                                      ------0.1-----
 
              +---------Rhizobium_sp._NGR234                                                 [a-protéobactérie}
       +------+
       |      +------------Brucella_sp._83/13                                                [a-protéobactérie}
       |
       |                               +-----------Rhodobacter sphaeroides                   [a-protéobactérie}
       |                             +-+
       |                             | +----------------Silicibacter_lacuscaerulensis_ITI    [a-protéobactérie}
       |                           +-+
      ++                           | +------------Rhodobacterales_bacterium_Y4I              [a-protéobactérie}
      ||                          ++
      ||                          ||  +--------Sulfitobacter_sp._EE-36                       [a-protéobactérie}
      ||                          ||  |
      ||+-------------------------++--+
      |||                         |   +------------------Octadecabacter_antarcticus_238      [a-protéobactérie}
      |||                         |
  +---+++                         +--------------------------Oceanicola_granulosus_HTCC2516  [a-protéobactérie}
  |   | |
  |   | |    +----------------------------Magnetospirillum_magneticum_AMB-1                   [a-protéobactérie}
  |   | +----+
  |   |      +-------------------------------Bartonella_grahamii_as4aup                       [a-protéobactérie} 
  |   |
  |   |             +---------------------------------------------------Methylobacterium_ext  [a-protéobactérie}
  |   +-------------+
 ++                 +-------------Caulobacter_segnis_ATCC_21756
 ||
 ||     +---------------------------------------------Anaplasma_centrale_                      [a-proteobactries]
 ||     |  
 ||+----+              +--------------------------------------------------------Wolbachia_pipientis [a-protéobactérie}
 |||    +--------------+
 |||                   +------------------------------------Acetobacter_pasteurianus_IFO_       [a-protéobactérie}
 |++
 | |
 | |+------------------------Maricaulis_maris_MCS10                                             [a-protéobactérie}
 | ||
 | ++               +-----------------GOS_1101030_Translation_279-899_direct_strand             GOS_1101030
 |  |            +--+
 |  +------------+  +------------------Candidatus_Pelagibacter_sp._HTCC7211                     [a-protéobactérie}
 |               |
 |               +------------------alpha_proteobacterium_HIMB114                               [a-protéobactérie}
 |
 |    +----------------------------------------Rickettsia_bellii_RML369-C                       [a-protéobactérie}
 |    |
 |    |               +----------------------------------------Orientia_tsutsugamushi_str._Bor  [a-protéobactérie}
 |    |         +-----+
 +----+         |     +----------------------------------Methylophilales_bacterium_HTCC2181     [b-protéobactérie}
      |         |
      |         |    +------------------------------------------------Marinomonas_sp._MED121    [g-protéobactérie}
      +---------+    |
                |    |                       +---------------Comamonas_testosteroni_KF-1        [b-protéobactérie}
                |    |                       |
                |    |                       |      +-------------------------Thiobacillus_inter[b-protéobactérie}
                |    |           +-----------+     ++
                +----+           |           |     |+-------Leptothrix_cholodnii_SP-6           [b-protéobactérie}
                     |           |           +-----+
                     |     +-----+                 |
                     |     |     |                 +------Methylibium_petroleiphilum_PM1         [b-protéobactérie}
                     |     |     |
                     +-----+     +--------------------------------------Allochromatium_vinosum_  [g-protéobactérie}
                           |
                           |        +-----------------------------------------------Haemophilus_ [g-protéobactérie}
                           +--------+
                                    |                   +-------Xylella_fastidiosa_M12           [g-protéobactérie}
                                    +-------------------+
                                                        +-------------Xanthomonas_axonopodis_    [g-protéobactérie}

                                                
 





Enracinement R2

                                                                                                        -----0.1---
 
       +-------------------------------------Marinomonas_sp._MED121                            [g-protéobactérie}
       |
       |                 +------------Comamonas_testosteroni_KF-1                              [b-protéobactérie}
       |                 |
       |        +--------+     +---------------------Thiobacillus_intermedius_K12              [b-protéobactérie}
   +---+        |        |    ++
   |   |        |        |    |+-------Leptothrix_cholodnii_SP-6                               [b-protéobactérie}
   |   |   +----+        +----+
   |   |   |    |             +-----Methylibium_petroleiphilum_PM1                             [b-protéobactérie}
   |   |   |    |
   |   |   |    +---------------------------------Allochromatium_vinosum_DSM_180               [g-protéobactérie}
   |   +---+
   |       |
   |       |      +------------------------------------------Haemophilus_influenzae_PittHH     [g-protéobactérie}
   |       +------+
   |              |               +-----Xylella_fastidiosa_M12                                 [g-protéobactérie}
   |              +---------------+
   |                              +----------Xanthomonas_axonopodis_pv._citri_str._306         [g-protéobactérie}
   |
   |                     +------Rhizobium_sp._NGR234                                           [a-protéobactérie}
   |                +----+
   |                |    +---------Brucella_sp._83/13                                          [a-protéobactérie}
   |                |
   |                |                       +---------Rhodobacter sphaeroides                  [a-protéobactérie} 
   |                |                      ++
   |                |                      |+------------Silicibacter_lacuscaerulensis_ITI-    [a-protéobactérie}
   |                |                    +-+
   |               ++                    | +---------Rhodobacterales_bacterium_Y4I             [a-protéobactérie} 
 +-+               ||                   ++
 | |               ||                   || +------Sulfitobacter_sp._EE-36                      [a-protéobactérie}
 | |               ||                   |+-+
 | |               ||-------------------+  |
 | |               ||                   |  +--------------Octadecabacter_antarcticus_238        [a-protéobactérie}
 | |               ||                   |
 | |           +---+|                   +--------------------Oceanicola_granulosus_HTCC2516     [a-protéobactérie}
 | |           |   ||
 | |           |   ||   +----------------------Magnetospirillum_magneticum_AMB-1                [a-protéobactérie}
 | |           |   |+---+
 | |           |   |    +------------------------Bartonella_grahamii_as4aup                     [a-protéobactérie}
 | |           |   |
 | |           |   |         +-------------------------------------------Methylobacterium_extor [a-protéobactérie}
 | |           |   +---------+
 | |       +---+             +----------Caulobacter_segnis_ATCC_21756
 | |       |   |
 | |       |   |    +-----------------------------------Anaplasma_centrale_                      [a-protéobactérie}
 | |       |   |    |
 | |       |   |+---+           +---------------------------------------------Wolbachia_pipient  [a-protéobactérie}
 | |       |   ||   +-----------+
 | |       |   ||               +--------------------------Acetobacter_pasteurianus_IFO_3283-01  [a-protéobactérie}
 | |       |   ++
 | +-------+    |+-------------------Maricaulis_maris_MCS10                                      [a-protéobactérie}
 |         |    ||
 |         |    ||            +------------GOS_1101030_Translation_279-899_direct_strand         [GOS_1101030 traduite}
 |         |    ++            |
 |         |     |         +--+
 |         |     +---------+  +-------------Candidatus_Pelagibacter_sp._HTCC7211                 [a-protéobactérie}
 |         |               |
 |         |               +--------------alpha_proteobacterium_HIMB114                          [a-protéobactérie}
 |         |
 |         +------------------------------Rickettsia_bellii_RML369-C                             [a-protéobactérie}
 |
 | +-------------------------------Orientia_tsutsugamushi_str._Boryong                           [a-protéobactérie}
 +-+
   +---------------------------Methylophilales_bacterium_HTCC2181                                [b-protéobactérie}




----------------------------------------------------------------------------------------------------------------------
PhyML

                                                                                                -----0.2----
 
                                 +-----Xylella_fastidiosa_M12                                [g-protéobactérie}
                    +------------+
                    |            +---Xanthomonas_axonopodis_pv._citri_str._306               [g-protéobactérie}
              +-----+
              |     |        +---------------------------------Haemophilus_influenzae_Pit    [g-protéobactérie}
              |     +--------+
          +---+              +---------------------Marinomonas_sp._MED121                    [g-protéobactérie}
          |   |
          |   +---------------------Allochromatium_vinosum_DSM_180                           [g-protéobactérie}
    +-----+
    |     |     +------Comamonas_testosteroni_KF-1                                           [b-protéobactérie} 
    |     |     |
    |     |     |
    |     +-----+         +----------------Thiobacillus_intermedius_K12                      [b-protéobactérie}
 +--+           |    +----+
 |  |           +----+    +-Leptothrix_cholodnii_SP-6                                        [b-protéobactérie}
 |  |                |
 |  |                +Methylibium_petroleiphilum_PM1                                         [b-protéobactérie}
 |  |
 |  +----------------Methylophilales_bacterium_HTCC2181                                      [b-protéobactérie}
 |
 |  +--------------------------Orientia_tsutsugamushi_str._Boryong                           [a-protéobactérie}
 |  |
 |  |                +---------alpha_proteobacterium_HIMB114                                 [a-protéobactérie}
 |  |                |
 |  |        +-------+ +-------Candidatus_Pelagibacter_sp._HTCC7211                          [a-protéobactérie}
 |  |        |       +-+
 |  |        |         +--------GOS_1101030_Translation_279-899_direct_strand                 [GOS_1101030 traduite]
 |  |        |
 |  |        |        +Brucella_sp._83/13                                                     [a-protéobactérie}
 |  |        |        |
 |  |        |    +---+
 |  |        |    |   |              +Caulobacter_segnis_ATCC_21756                           [a-protéobactérie}
 |  |        |    |   +--------------+
 |  |        |    |                  +---------------------------------Methylobacterium_ext   [a-protéobactérie}
 |  |        |    |
 |  |        |    |     +--------------------Bartonella_grahamii_as4aup                       [a-protéobactérie}
 |  |      +-+    |     |
 +--+      | |    |     |                 +------------Oceanicola_granulosus_HTCC2516         [a-protéobactérie}
    |      | |    |     |                 |
    |      | |  +-+     |                 |    +----------Octadecabacter_antarcticus_238      [a-protéobactérie}
    |      | |  | |     |     +-----------+    |
    |      | |  | | +---+     |           | +--+ +---Rhodobacter sphaeroides                  [a-protéobactérie}
    |      | |  | | |   |     |           | |  | |
    |      | |  | | |   |     |           | |  +-+ +----------Silicibacter_lacuscaerulensis   [a-protéobactérie}
    |      | |  | | |   |     |           +-+    +-+
    |      | |  | | |   |  +--+             |      +------Rhodobacterales_bacterium_Y4I       [a-protéobactérie}
    |      | |  | | |   |  |  |             |
    |      | |  | | |   |  |  |             +--Sulfitobacter_sp._EE-36                        [a-protéobactérie}
    |    +-+ +--+ +-+   +--+  |
    |    | |    |   |      |  +-------------------------Anaplasma_centrale__                  [a-protéobactérie}
    |    | |    |   |      |
    |    | |    |   |      +---------------Magnetospirillum_magneticum_AMB-1                  [a-protéobactérie}
    |    | |    |   |
    |    | |    |   |
    |    | |    |   +---Rhizobium_sp._NGR234                                                  [a-protéobactérie}  
    +----+ |    |
         | |    |               +---------------------Acetobacter_pasteurianus_IFO_3283-01    [a-protéobactérie}
         | |    +---------------+
         | |                    +--------------------------------------Wolbachia_pipientis    [a-protéobactérie}
         | |
         | +-------------Maricaulis_maris_MCS10                                               [a-protéobactérie}
         |
         +-------------------------Rickettsia_bellii_RML369-C                                 [a-protéobactérie}   

Taxonomy report

PROTOCOLE:


Toutes les séquences retenues et listées ci-dessous (45 au total) sont des homologues (E-values inférieures au seuil déterminé précédemment soit 1e-10) appartenant à des taxons identifiés (voir le champ: Lineage report).



ANALYSE DES RÉSULTATS:


+++ groupe d'étude:alpha-protéobactéries


N° d'accession hits E value Nom de code groupe taxonomique


ref|ZP_05069250.1| 256 8e-67 Candidatus pelagibacter [alpha-protéobactéries]

ref|ZP_06055283.1| 218 2e-55 alpha proteobacterium [alpha-protéobactéries]

ref|YP_002827280.1| 180 9e-44 Rhizobium sp. [alpha-protéobactéries]

ref|ZP_05181511.1| 176 2e-42 Brucella sp. [alpha-protéobactéries]

ref|YP_422574.1| 172 2e-41 Magnetospirillum magneticum [alpha-protéobactéries]

ref|ZP_06123097.1| 166 1e-39 Caulobacter segnis [alpha-protéobactéries]

ref|YP_757646.1| 156 1e-36 Maricaulis maris [alpha-protéobactéries]

ref|YP_002972622.1| 150 1e-34 Bartonella grahamii [alpha-protéobactéries]

ref|YP_537438.1| 138 3e-31 Rickettsia bellii [alpha-protéobactéries]

ref|ZP_05067624.1| 136 1e-30 Octadecabacter antarcticus [alpha-protéobactéries]

ref|ZP_05785079.1| 129 1e-28 Silicibacter lacuscaerulensis [alpha-protéobactéries]

ref|ZP_00956375.1| 127 9e-28 Sulfitobacter sp. [alpha-protéobactéries]

ref|YP_353744.1| 124 8e-27 Rhodobacter sphaeroides [alpha-protéobactéries]

ref|ZP_01155457.1| 124 8e-27 Oceanicola granulosus [alpha-protéobactéries]

ref|YP_003071219.1| 119 2e-25 Methylobacterium extorquens [alpha-protéobactéries]

ref|YP_001248099.1| 117 8e-25 Orientia tsutsugamushi [alpha-protéobactéries]

ref|YP_003328842.1| 114 4e-24 Anaplasma centrale [alpha-protéobactéries]

ref|ZP_05077692.1| 112 3e-23 Rhodobacterales bacterium [alpha-protéobactéries]

ref|YP_003189096.1| 101 6e-20 Acetobacter pasteurianus [alpha-protéobactéries]

ref|ZP_03334884.1| 80.9 8e-14 Wolbachia endosymbiont [alpha-protéobactéries]


+++groupe extérieur: bêta- et gamma-protéobactéries.


ref|ZP_01074850.1| 95.5 3e-18 Marinomonas sp. [gammaa-protéobactéries]

ref|ZP_01551691.1| 92.0 3e-17 Methylophilales bacterium [beta-protéobactéries]

ref|ZP_04774897.1| 85.9 2e-15 Allochromatium vinosum [gammaa-protéobactéries]

ref|ZP_03544167.1| 84.7 6e-15 Comamonas testosteroni [beta-protéobactéries]

ref|YP_001775657.1| 81.3 6e-14 Xylella fastidiosa [gammaa-protéobactéries]

ref|YP_001790976.1| 80.1 1e-13 Leptothrix cholodnii [beta-protéobactéries]

ref|NP_643450.1| 77.4 9e-13 Xanthomonas axonopodis [gammaa-protéobactéries]

ref|YP_001020543.1| 72.8 2e-11 Methylibium petroleiphilum [beta-protéobactéries]

ref|ZP_01792019.1| 72.0 4e-11 Haemophilus influenzae [gammaa-protéobactéries]

ref|ZP_05498260.1| 71.2 6e-11 Thiomonas intermedia [beta-protéobactéries]











RÉSULTATS BRUTS:

Blastp contre nr

Lineage Report

root
. cellular organisms
. . Proteobacteria          [proteobacteria]
. . . Alphaproteobacteria     [a-proteobacteria]
. . . . Rickettsiales           [a-proteobacteria]
. . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter sp. HTCC7211 -----------------------------  256  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Candidat
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 ..........................  252  2 hits [a-proteobacteria]  translocation protein TolB [Candidatus Pelagibacter ubique 
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 ..........................  252  2 hits [a-proteobacteria]  translocation protein TolB [Candidatus Pelagibacter ubique 
. . . . . . . Candidatus Pelagibacter ubique ...................................  252  1 hit  [a-proteobacteria]  translocation protein TolB [Candidatus Pelagibacter ubique 
. . . . . . alpha proteobacterium HIMB114 --------------------------------------  218  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [alpha pr
. . . . . Rickettsia bellii RML369-C -------------------------------------------  138  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia bellii RML369-C] >gi
. . . . . Rickettsia bellii OSU 85-389 .........................................  138  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia bellii RML369-C] >gi
. . . . . Rickettsia rickettsii str. 'Sheila Smith' ............................  127  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia rickettsii str. 'She
. . . . . Rickettsia rickettsii str. Iowa ......................................  127  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia rickettsii str. Iowa
. . . . . Rickettsia endosymbiont of Ixodes scapularis .........................  127  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ricketts
. . . . . Rickettsia peacockii str. Rustic .....................................  127  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia peacockii str. Rusti
. . . . . Rickettsia massiliae MTU5 ............................................  127  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia massiliae MTU5] >gi|
. . . . . Rickettsia sibirica 246 ..............................................  127  2 hits [a-proteobacteria]  tolB protein precursor [Rickettsia sibirica 246] >gi|282620
. . . . . Rickettsia conorii str. Malish 7 .....................................  126  2 hits [a-proteobacteria]  translocation protein TolB [Rickettsia conorii str. Malish 
. . . . . Rickettsia conorii ...................................................  126  1 hit  [a-proteobacteria]  translocation protein TolB [Rickettsia conorii str. Malish 
. . . . . Rickettsia africae ESF-5 .............................................  126  3 hits [a-proteobacteria]  TolB protein precursor [Rickettsia africae ESF-5] >gi|25953
. . . . . Rickettsia felis URRWXCal2 ...........................................  125  2 hits [a-proteobacteria]  translocation protein TolB [Rickettsia felis URRWXCal2] >gi
. . . . . Rickettsia felis .....................................................  125  1 hit  [a-proteobacteria]  translocation protein TolB [Rickettsia felis URRWXCal2] >gi
. . . . . Rickettsia canadensis str. McKiel ....................................  124  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia canadensis str. McKi
. . . . . Rickettsia prowazekii str. Madrid E ..................................  122  1 hit  [a-proteobacteria]  translocation protein TolB [Rickettsia prowazekii str. Madr
. . . . . Rickettsia prowazekii ................................................  122  2 hits [a-proteobacteria]  translocation protein TolB [Rickettsia prowazekii str. Madr
. . . . . Rickettsia typhi str. Wilmington .....................................  121  2 hits [a-proteobacteria]  translocation protein TolB [Rickettsia typhi str. Wilmingto
. . . . . Rickettsia typhi .....................................................  121  1 hit  [a-proteobacteria]  translocation protein TolB [Rickettsia typhi str. Wilmingto
. . . . . Rickettsia akari str. Hartford .......................................  120  3 hits [a-proteobacteria]  translocation protein TolB [Rickettsia akari str. Hartford]
. . . . . Orientia tsutsugamushi str. Boryong ..................................  117  3 hits [a-proteobacteria]  protein precursor [Orientia tsutsugamushi str. Boryong] >gi
. . . . . Anaplasma centrale str. Israel .......................................  114  2 hits [a-proteobacteria]  translocation protein [Anaplasma centrale str. Israel] >gi|
. . . . . Orientia tsutsugamushi str. Ikeda ....................................  114  3 hits [a-proteobacteria]  TolB protein precursor [Orientia tsutsugamushi str. Ikeda] 
. . . . . Anaplasma marginale str. St. Maries ..................................  113  3 hits [a-proteobacteria]  translocation protein TolB [Anaplasma marginale str. St. Ma
. . . . . Anaplasma marginale str. Mississippi .................................  113  1 hit  [a-proteobacteria]  translocation protein TolB [Anaplasma marginale str. St. Ma
. . . . . Anaplasma marginale str. Virginia ....................................  113  1 hit  [a-proteobacteria]  translocation protein TolB [Anaplasma marginale str. St. Ma
. . . . . Anaplasma marginale str. Florida .....................................  112  2 hits [a-proteobacteria]  TOLB protein precursor (tolB) [Anaplasma marginale str. Flo
. . . . . Anaplasma marginale str. Puerto Rico .................................  112  1 hit  [a-proteobacteria]  TOLB protein precursor (tolB) [Anaplasma marginale str. Flo
. . . . . Anaplasma phagocytophilum HZ .........................................   85  2 hits [a-proteobacteria]  translocation protein TolB [Anaplasma phagocytophilum HZ] >
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB .................   80  2 hits [a-proteobacteria]  Protein tolB precursor [Wolbachia endosymbiont of Culex qui
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel .................   80  3 hits [a-proteobacteria]  Protein tolB precursor [Wolbachia endosymbiont of Culex qui
. . . . . Wolbachia endosymbiont of Drosophila ananassae .......................   77  4 hits [a-proteobacteria]  tolB protein, putative [Wolbachia endosymbiont of Drosophil
. . . . . Wolbachia endosymbiont of Drosophila melanogaster ....................   75  3 hits [a-proteobacteria]  translocation protein TolB [Wolbachia endosymbiont of Droso
. . . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 ....   75  1 hit  [a-proteobacteria]  hypothetical protein Wendoof_01000957 [Wolbachia endosymbio
. . . . . Wolbachia sp. wRi ....................................................   75  3 hits [a-proteobacteria]  tolB protein, putative [Wolbachia endosymbiont of Drosophil
. . . . . Wolbachia endosymbiont of Muscidifurax uniraptor .....................   75  2 hits [a-proteobacteria]  translocation protein TolB precursor [Wolbachia endosymbion
. . . . Parvibaculum lavamentivorans DS-1 --------------------------------------  181  3 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Rhizobium sp. NGR234 ...................................................  180  2 hits [a-proteobacteria]  TolB protein precursor [Rhizobium sp. NGR234] >gi|227342309
. . . . Labrenzia aggregata IAM 12614 ..........................................  178  2 hits [a-proteobacteria]  translocation protein TolB precursor [Stappia aggregata IAM
. . . . Agrobacterium tumefaciens str. C58 .....................................  178  3 hits [a-proteobacteria]  translocation protein TolB [Agrobacterium tumefaciens str. 
. . . . Labrenzia alexandrii DFL-11 ............................................  176  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Labrenzi
. . . . Brucella sp. 83/13 .....................................................  176  3 hits [a-proteobacteria]  translocation protein TolB [Brucella sp. 83/13] >gi|2659847
. . . . Ochrobactrum anthropi ATCC 49188 .......................................  176  3 hits [a-proteobacteria]  translocation protein TolB [Ochrobactrum anthropi ATCC 4918
. . . . Ochrobactrum intermedium LMG 3301 ......................................  175  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ochrobac
. . . . Phenylobacterium zucineum HLK1 .........................................  175  2 hits [a-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . . Sinorhizobium meliloti 1021 ............................................  175  2 hits [a-proteobacteria]  translocation protein TolB [Sinorhizobium meliloti 1021] >g
. . . . Sinorhizobium meliloti .................................................  175  1 hit  [a-proteobacteria]  translocation protein TolB [Sinorhizobium meliloti 1021] >g
. . . . Brucella abortus bv. 1 str. 9-941 ......................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella melitensis biovar Abortus 2308 ................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus S19 ...................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella ceti str. Cudo ................................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella melitensis ATCC 23457 .........................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus str. 2308 A ...........................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus bv. 6 str. 870 ........................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus bv. 3 str. Tulya ......................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus bv. 2 str. 86/8/59 ....................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella suis bv. 5 str. 513 ...........................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus bv. 4 str. 292 ........................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella neotomae 5K33 .................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella melitensis bv. 3 str. Ether ...................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella ceti M490/95/1 ................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella ceti B1/94 ....................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus bv. 9 str. C68 ........................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella melitensis bv. 2 str. 63/9 ....................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella microti CCM 4915 ..............................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella sp. F5/99 .....................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus NCTC 8038 .............................................  174  2 hits [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella abortus .......................................................  174  1 hit  [a-proteobacteria]  translocation protein TolB [Brucella abortus bv. 1 str. 9-9
. . . . Brucella ceti M644/93/1 ................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella ceti M644/93/1] >gi|25
. . . . Brucella ceti M13/05/1 .................................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella ceti M644/93/1] >gi|25
. . . . Agrobacterium radiobacter K84 ..........................................  174  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Agrobact
. . . . Oceanicaulis alexandrii HTCC2633 .......................................  174  2 hits [a-proteobacteria]  translocation protein TolB precursor [Oceanicaulis alexandr
. . . . Brucella ovis ATCC 25840 ...............................................  174  3 hits [a-proteobacteria]  translocation protein TolB [Brucella ovis ATCC 25840] >gi|1
. . . . Sinorhizobium medicae WSM419 ...........................................  173  3 hits [a-proteobacteria]  translocation protein TolB [Sinorhizobium medicae WSM419] >
. . . . Brucella suis ATCC 23445 ...............................................  173  3 hits [a-proteobacteria]  translocation protein TolB [Brucella suis ATCC 23445] >gi|1
. . . . Brucella suis 1330 .....................................................  173  2 hits [a-proteobacteria]  translocation protein TolB [Brucella suis 1330] >gi|3269970
. . . . Brucella suis ..........................................................  173  1 hit  [a-proteobacteria]  translocation protein TolB [Brucella suis 1330] >gi|3269970
. . . . Brucella suis bv. 3 str. 686 ...........................................  173  3 hits [a-proteobacteria]  translocation protein TolB [Brucella suis bv. 3 str. 686] >
. . . . Brucella pinnipedialis M163/99/10 ......................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Brucella pinnipedialis M163/99/
. . . . Brucella pinnipedialis B2/94 ...........................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Brucella pinnipedialis M163/99/
. . . . Brucella pinnipedialis M292/94/1 .......................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Brucella pinnipedialis M163/99/
. . . . Magnetospirillum magnetotacticum MS-1 ..................................  172  1 hit  [a-proteobacteria]  COG0823: Periplasmic component of the Tol biopolymer transp
. . . . Brucella canis ATCC 23365 ..............................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Brucella canis ATCC 23365] >gi|
. . . . Brucella suis bv. 4 str. 40 ............................................  172  2 hits [a-proteobacteria]  translocation protein TolB [Brucella canis ATCC 23365] >gi|
. . . . Brucella melitensis bv. 1 str. 16M .....................................  172  4 hits [a-proteobacteria]  translocation protein TolB [Brucella melitensis 16M] >gi|25
. . . . Brucella melitensis bv. 1 str. Rev.1 ...................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Brucella melitensis 16M] >gi|25
. . . . Brucella melitensis ....................................................  172  2 hits [a-proteobacteria]  translocation protein TolB [Brucella melitensis 16M] >gi|25
. . . . Magnetospirillum magneticum AMB-1 ......................................  172  3 hits [a-proteobacteria]  translocation protein TolB [Magnetospirillum magneticum AMB
. . . . Aurantimonas manganoxydans SI85-9A1 ....................................  171  2 hits [a-proteobacteria]  tolB protein, periplasmic component, biopolymer transport s
. . . . Hoeflea phototrophica DFL-43 ...........................................  171  2 hits [a-proteobacteria]  translocation protein TolB precursor [Hoeflea phototrophica
. . . . Pseudovibrio sp. JE062 .................................................  171  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Pseudovi
. . . . Rhizobium etli Brasil 5 ................................................  169  1 hit  [a-proteobacteria]  translocation protein TolB [Rhizobium etli Brasil 5]
. . . . Rhizobium etli CFN 42 ..................................................  169  3 hits [a-proteobacteria]  translocation protein TolB [Rhizobium etli CFN 42] >gi|1193
. . . . Rhizobium etli CIAT 652 ................................................  169  3 hits [a-proteobacteria]  protein transporter, uptake component protein [Rhizobium et
. . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...........................  168  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Rhizobiu
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  168  3 hits [a-proteobacteria]  translocation protein TolB [Rhizobium leguminosarum bv. tri
. . . . Rhizobium leguminosarum bv. viciae 3841 ................................  166  3 hits [a-proteobacteria]  translocation protein TolB [Rhizobium leguminosarum bv. vic
. . . . Chelativorans sp. BNC1 .................................................  166  3 hits [a-proteobacteria]  translocation protein TolB [Mesorhizobium sp. BNC1] >gi|118
. . . . Caulobacter segnis ATCC 21756 ..........................................  166  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Caulobac
. . . . Rhizobium etli IE4771 ..................................................  164  1 hit  [a-proteobacteria]  translocation protein TolB [Rhizobium etli IE4771]
. . . . Agrobacterium vitis S4 .................................................  163  3 hits [a-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . . Rhodospirillum centenum SW .............................................  163  2 hits [a-proteobacteria]  protein TolB precursor [Rhodospirillum centenum SW] >gi|209
. . . . Caulobacter crescentus NA1000 ..........................................  162  2 hits [a-proteobacteria]  TolB protein [Caulobacter crescentus NA1000] >gi|220965446|
. . . . Caulobacter crescentus CB15 ............................................  162  2 hits [a-proteobacteria]  translocation protein TolB [Caulobacter crescentus CB15] >g
. . . . Caulobacter vibrioides .................................................  162  1 hit  [a-proteobacteria]  translocation protein TolB [Caulobacter crescentus CB15] >g
. . . . Nitrobacter sp. Nb-311A ................................................  161  2 hits [a-proteobacteria]  TolB [Nitrobacter sp. Nb-311A] >gi|85698827|gb|EAQ36696.1| 
. . . . Caulobacter sp. K31 ....................................................  161  2 hits [a-proteobacteria]  translocation protein TolB [Caulobacter sp. K31] >gi|167350
. . . . Rhodopseudomonas palustris CGA009 ......................................  161  2 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris CGA0
. . . . Rhodopseudomonas palustris TIE-1 .......................................  161  2 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris CGA0
. . . . Rhodopseudomonas palustris .............................................  161  1 hit  [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris CGA0
. . . . Rhodopseudomonas palustris BisB18 ......................................  160  3 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris BisB
. . . . Rhodopseudomonas palustris BisB5 .......................................  160  2 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris BisB
. . . . Fulvimarina pelagi HTCC2506 ............................................  160  2 hits [a-proteobacteria]  translocation protein TolB precursor [Fulvimarina pelagi HT
. . . . Oligotropha carboxidovorans OM5 ........................................  159  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Oligotro
. . . . Rhodospirillum rubrum ATCC 11170 .......................................  159  3 hits [a-proteobacteria]  translocation protein TolB [Rhodospirillum rubrum ATCC 1117
. . . . Azorhizobium caulinodans ORS 571 .......................................  159  2 hits [a-proteobacteria]  twin-arginine translocation pathway signal precursor [Azorh
. . . . Rhizobium etli CIAT 894 ................................................  159  1 hit  [a-proteobacteria]  translocation protein TolB [Rhizobium etli CIAT 894]
. . . . Rhodopseudomonas palustris HaA2 ........................................  159  3 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris HaA2
. . . . Magnetospirillum gryphiswaldense MSR-1 .................................  158  1 hit  [a-proteobacteria]  TOLB PROTEIN PRECURSOR [Magnetospirillum gryphiswaldense MS
. . . . Nitrobacter winogradskyi Nb-255 ........................................  157  3 hits [a-proteobacteria]  translocation protein TolB [Nitrobacter winogradskyi Nb-255
. . . . Rhodopseudomonas palustris BisA53 ......................................  157  2 hits [a-proteobacteria]  translocation protein TolB [Rhodopseudomonas palustris BisA
. . . . Maricaulis maris MCS10 .................................................  156  2 hits [a-proteobacteria]  TolB domain-containing protein [Maricaulis maris MCS10] >gi
. . . . alpha proteobacterium BAL199 ...........................................  155  2 hits [a-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . . . Mesorhizobium loti MAFF303099 ..........................................  154  2 hits [a-proteobacteria]  translocation protein TolB [Mesorhizobium loti MAFF303099] 
. . . . Mesorhizobium loti .....................................................  154  1 hit  [a-proteobacteria]  translocation protein TolB [Mesorhizobium loti MAFF303099] 
. . . . Nitrobacter hamburgensis X14 ...........................................  154  3 hits [a-proteobacteria]  translocation protein TolB [Nitrobacter hamburgensis X14] >
. . . . Bartonella henselae str. Houston-1 .....................................  154  2 hits [a-proteobacteria]  translocation protein TolB [Bartonella henselae str. Housto
. . . . Bartonella henselae ....................................................  154  1 hit  [a-proteobacteria]  translocation protein TolB [Bartonella henselae str. Housto
. . . . Mesorhizobium opportunistum WSM2075 ....................................  154  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Mesorhiz
. . . . Asticcacaulis excentricus CB 48 ........................................  152  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Asticcac
. . . . Bartonella quintana str. Toulouse ......................................  151  2 hits [a-proteobacteria]  translocation protein TolB [Bartonella quintana str. Toulou
. . . . Bartonella quintana ....................................................  151  1 hit  [a-proteobacteria]  translocation protein TolB [Bartonella quintana str. Toulou
. . . . Bradyrhizobium japonicum USDA 110 ......................................  151  2 hits [a-proteobacteria]  translocation protein TolB [Bradyrhizobium japonicum USDA 1
. . . . Bradyrhizobium japonicum ...............................................  150  1 hit  [a-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . . Hyphomonas neptunium ATCC 15444 ........................................  150  2 hits [a-proteobacteria]  tolB protein [Hyphomonas neptunium ATCC 15444] >gi|11473877
. . . . Bartonella grahamii as4aup .............................................  150  2 hits [a-proteobacteria]  translocation protein TolB [Bartonella grahamii as4aup] >gi
. . . . Bartonella bacilliformis KC583 .........................................  149  2 hits [a-proteobacteria]  translocation protein TolB [Bartonella bacilliformis KC583]
. . . . Xanthobacter autotrophicus Py2 .........................................  149  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Hyphomicrobium denitrificans ATCC 51888 ................................  148  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Hyphomic
. . . . Parvularcula bermudensis HTCC2503 ......................................  147  2 hits [a-proteobacteria]  translocation protein TolB precursor [Parvularcula bermuden
. . . . Bartonella tribocorum CIP 105476 .......................................  146  2 hits [a-proteobacteria]  translocation protein TolB [Bartonella tribocorum CIP 10547
. . . . Bradyrhizobium sp. BTAi1 ...............................................  140  2 hits [a-proteobacteria]  translocation protein TolB [Bradyrhizobium sp. BTAi1] >gi|1
. . . . Granulibacter bethesdensis CGDNIH1 .....................................  139  2 hits [a-proteobacteria]  translocation protein TolB [Granulibacter bethesdensis CGDN
. . . . Sagittula stellata E-37 ................................................  139  2 hits [a-proteobacteria]  translocation protein TolB precursor [Sagittula stellata E-
. . . . Roseobacter sp. AzwK-3b ................................................  138  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseobacter sp. AzwK-
. . . . Citreicella sp. SE45 ...................................................  137  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Citreice
. . . . Roseovarius sp. HTCC2601 ...............................................  137  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseovarius sp. HTCC2
. . . . Dinoroseobacter shibae DFL 12 ..........................................  137  3 hits [a-proteobacteria]  translocation protein TolB [Dinoroseobacter shibae DFL 12] 
. . . . Roseobacter denitrificans OCh 114 ......................................  137  3 hits [a-proteobacteria]  translocation protein TolB [Roseobacter denitrificans OCh 1
. . . . Octadecabacter antarcticus 238 .........................................  136  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Octadeca
. . . . Roseobacter litoralis Och 149 ..........................................  135  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseobacter litoralis
. . . . Roseovarius sp. 217 ....................................................  135  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseovarius sp. 217] 
. . . . Thalassiobium sp. R2A62 ................................................  135  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Thalassi
. . . . Hirschia baltica ATCC 49814 ............................................  134  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Hirschia
. . . . Octadecabacter antarcticus 307 .........................................  134  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Octadeca
. . . . Roseovarius nubinhibens ISM ............................................  132  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseovarius nubinhibe
. . . . Roseovarius sp. TM1035 .................................................  131  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseovarius sp. TM103
. . . . Rhizobium etli Kim 5 ...................................................  130  1 hit  [a-proteobacteria]  translocation protein TolB [Rhizobium etli Kim 5]
. . . . Loktanella vestfoldensis SKA53 .........................................  130  2 hits [a-proteobacteria]  translocation protein TolB precursor [Loktanella vestfolden
. . . . Silicibacter lacuscaerulensis ITI-1157 .................................  129  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Siliciba
. . . . Oceanicola batsensis HTCC2597 ..........................................  129  2 hits [a-proteobacteria]  translocation protein TolB precursor [Oceanicola batsensis 
. . . . Rhodobacterales bacterium HTCC2255 .....................................  128  2 hits [a-proteobacteria]  translocation protein TolB precursor [alpha proteobacterium
. . . . Acidiphilium cryptum JF-5 ..............................................  127  2 hits [a-proteobacteria]  TolB domain-containing protein [Acidiphilium cryptum JF-5] 
. . . . Silicibacter sp. TrichCH4B .............................................  127  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Siliciba
. . . . Roseobacter sp. GAI101 .................................................  127  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Roseobac
. . . . Sulfitobacter sp. EE-36 ................................................  127  2 hits [a-proteobacteria]  translocation protein TolB precursor [Sulfitobacter sp. EE-
. . . . Sulfitobacter sp. NAS-14.1 .............................................  127  2 hits [a-proteobacteria]  translocation protein TolB precursor [Sulfitobacter sp. EE-
. . . . Rhodobacterales bacterium HTCC2150 .....................................  125  2 hits [a-proteobacteria]  translocation protein TolB precursor [Rhodobacterales bacte
. . . . Rhodobacterales bacterium HTCC2654 .....................................  125  2 hits [a-proteobacteria]  translocation protein TolB precursor [Rhodobacterales bacte
. . . . Jannaschia sp. CCS1 ....................................................  125  3 hits [a-proteobacteria]  translocation protein TolB [Jannaschia sp. CCS1] >gi|119371
. . . . Methylobacterium sp. 4-46 ..............................................  124  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Methylobacterium radiotolerans JCM 2831 ................................  124  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Roseobacter sp. SK209-2-6 ..............................................  124  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseobacter sp. SK209
. . . . Rhodobacteraceae bacterium KLH11 .......................................  124  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Rhodobac
. . . . Rhodobacter sp. SW2 ....................................................  124  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Rhodobac
. . . . Rhodobacter sphaeroides 2.4.1 ..........................................  124  3 hits [a-proteobacteria]  translocation protein TolB [Rhodobacter sphaeroides 2.4.1] 
. . . . Rhodobacter sphaeroides ATCC 17029 .....................................  124  3 hits [a-proteobacteria]  translocation protein TolB [Rhodobacter sphaeroides 2.4.1] 
. . . . Oceanicola granulosus HTCC2516 .........................................  124  2 hits [a-proteobacteria]  translocation protein TolB precursor [Oceanicola granulosus
. . . . Rhodobacter sphaeroides KD131 ..........................................  124  2 hits [a-proteobacteria]  Protein tolB precursor [Rhodobacter sphaeroides KD131] >gi|
. . . . Brevundimonas subvibrioides ATCC 15264 .................................  123  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Brevundi
. . . . Candidatus Liberibacter asiaticus str. psy62 ...........................  123  2 hits [a-proteobacteria]  translocation protein TolB [Candidatus Liberibacter asiatic
. . . . Ruegeria sp. TM1040 ....................................................  123  3 hits [a-proteobacteria]  translocation protein TolB [Silicibacter sp. TM1040] >gi|11
. . . . Methylobacterium nodulans ORS 2060 .....................................  123  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Methylob
. . . . Roseobacter sp. MED193 .................................................  123  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseobacter sp. MED19
. . . . Rhodobacterales bacterium HTCC2083 .....................................  122  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Rhodobac
. . . . Brevundimonas sp. BAL3 .................................................  121  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Brevundi
. . . . Rhodobacter sphaeroides ATCC 17025 .....................................  120  3 hits [a-proteobacteria]  translocation protein TolB [Rhodobacter sphaeroides ATCC 17
. . . . Sphingomonas wittichii RW1 .............................................  120  3 hits [a-proteobacteria]  translocation protein TolB [Sphingomonas wittichii RW1] >gi
. . . . Methylobacterium populi BJ001 ..........................................  120  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Methylob
. . . . Ruegeria pomeroyi DSS-3 ................................................  120  2 hits [a-proteobacteria]  translocation protein TolB [Ruegeria pomeroyi DSS-3] >gi|67
. . . . Ruegeria pomeroyi ......................................................  120  1 hit  [a-proteobacteria]  translocation protein TolB [Ruegeria pomeroyi DSS-3] >gi|67
. . . . Methylobacterium extorquens PA1 ........................................  119  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Methylobacterium chloromethanicum CM4 ..................................  119  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Methylobacterium extorquens AM1 ........................................  119  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Methylobacterium extorquens DM4 ........................................  119  2 hits [a-proteobacteria]  protein tolB precursor [Methylobacterium extorquens DM4] >g
. . . . Zymomonas mobilis subsp. mobilis ZM4 ...................................  119  2 hits [a-proteobacteria]  translocation protein TolB [Zymomonas mobilis subsp. mobili
. . . . Zymomonas mobilis subsp. mobilis ATCC 10988 ............................  119  2 hits [a-proteobacteria]  translocation protein TolB [Zymomonas mobilis subsp. mobili
. . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ...........................  119  2 hits [a-proteobacteria]  translocation protein TolB [Zymomonas mobilis subsp. mobili
. . . . Zymomonas mobilis ......................................................  119  1 hit  [a-proteobacteria]  translocation protein TolB [Zymomonas mobilis subsp. mobili
. . . . Ruegeria sp. R11 .......................................................  119  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ruegeria
. . . . Erythrobacter sp. SD-21 ................................................  118  2 hits [a-proteobacteria]  translocation protein TolB precursor [Erythrobacter sp. SD-
. . . . Rhizobium etli 8C-3 ....................................................  118  1 hit  [a-proteobacteria]  translocation protein TolB [Rhizobium etli 8C-3]
. . . . Phaeobacter gallaeciensis BS107 ........................................  117  2 hits [a-proteobacteria]  TolB-like protein [Phaeobacter gallaeciensis BS107] >gi|161
. . . . Phaeobacter gallaeciensis 2.10 .........................................  117  2 hits [a-proteobacteria]  translocation protein TolB precursor [Phaeobacter gallaecie
. . . . Oceanibulbus indolifex HEL-45 ..........................................  117  2 hits [a-proteobacteria]  translocation protein TolB precursor [Oceanibulbus indolife
. . . . Roseobacter sp. CCS2 ...................................................  117  2 hits [a-proteobacteria]  translocation protein TolB precursor [Roseobacter sp. CCS2]
. . . . Bradyrhizobium sp. ORS278 ..............................................  117  2 hits [a-proteobacteria]  protein tolB precursor [Bradyrhizobium sp. ORS278] >gi|1461
. . . . Paracoccus denitrificans PD1222 ........................................  115  2 hits [a-proteobacteria]  translocation protein TolB [Paracoccus denitrificans PD1222
. . . . Novosphingobium aromaticivorans DSM 12444 ..............................  112  6 hits [a-proteobacteria]  translocation protein TolB [Novosphingobium aromaticivorans
. . . . Rhodobacterales bacterium Y4I ..........................................  112  2 hits [a-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Rhodobac
. . . . Erythrobacter litoralis HTCC2594 .......................................  110  2 hits [a-proteobacteria]  translocation protein TolB [Erythrobacter litoralis HTCC259
. . . . Beijerinckia indica subsp. indica ATCC 9039 ............................  108  2 hits [a-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . . Gluconobacter oxydans 621H .............................................  108  2 hits [a-proteobacteria]  translocation protein TolB [Gluconobacter oxydans 621H] >gi
. . . . Gluconobacter oxydans ..................................................  108  1 hit  [a-proteobacteria]  translocation protein TolB [Gluconobacter oxydans 621H] >gi
. . . . Erythrobacter sp. NAP1 .................................................  104  2 hits [a-proteobacteria]  translocation protein TolB precursor [Erythrobacter sp. NAP
. . . . Sphingomonas sp. SKA58 .................................................  102  2 hits [a-proteobacteria]  TolB-like protein [Sphingomonas sp. SKA58] >gi|94424360|gb|
. . . . Sphingopyxis alaskensis RB2256 .........................................  102  2 hits [a-proteobacteria]  translocation protein TolB [Sphingopyxis alaskensis RB2256]
. . . . Sphingopyxis alaskensis ................................................  102  1 hit  [a-proteobacteria]  translocation protein TolB [Sphingopyxis alaskensis RB2256]
. . . . Acetobacter pasteurianus IFO 3283-01 ...................................  101  2 hits [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-03 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-07 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-22 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-26 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-32 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-01-42C ...............................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Acetobacter pasteurianus IFO 3283-12 ...................................  101  1 hit  [a-proteobacteria]  secretion system type I outer membrane protein TolB [Acetob
. . . . Gluconacetobacter diazotrophicus PAl 5 .................................  100  4 hits [a-proteobacteria]  translocation protein TolB [Gluconacetobacter diazotrophicu
. . . Magnetococcus sp. MC-1 ---------------------------------------------------  103  2 hits [proteobacteria]    TolB domain-containing protein [Magnetococcus sp. MC-1] >gi
. . . Marinomonas sp. MED121 ...................................................   95  2 hits [g-proteobacteria]  tolB protein [Marinomonas sp. MED121] >gi|86165343|gb|EAQ66
. . . Marinomonas sp. MWYL1 ....................................................   95  3 hits [g-proteobacteria]  translocation protein TolB [Marinomonas sp. MWYL1] >gi|1890
. . . Saccharophagus degradans 2-40 ............................................   92  3 hits [g-proteobacteria]  translocation protein TolB [Saccharophagus degradans 2-40] 
. . . Methylobacillus flagellatus KT ...........................................   92  3 hits [b-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . Methylophilales bacterium HTCC2181 .......................................   92  2 hits [b-proteobacteria]  translocation protein TolB precursor [Methylophilales bacte
. . . Methylotenera mobilis JLW8 ...............................................   91  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Methylot
. . . Methylophaga thiooxidans DMS010 ..........................................   91  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Methylop
. . . Methylovorus sp. SIP3-4 ..................................................   88  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Methylov
. . . Acidovorax delafieldii 2AN ...............................................   87  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Acidovor
. . . Bermanella marisrubri ....................................................   87  2 hits [g-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . . Acidovorax sp. JS42 ......................................................   86  2 hits [b-proteobacteria]  TolB domain-containing protein [Acidovorax sp. JS42] >gi|12
. . . Allochromatium vinosum DSM 180 ...........................................   85  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Allochro
. . . gamma proteobacterium NOR51-B ............................................   85  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [gamma pr
. . . Diaphorobacter sp. TPSY ..................................................   85  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Diaphoro
. . . Nitrosomonas sp. AL212 ...................................................   85  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Nitrosom
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................   85  3 hits [g-proteobacteria]  TolB domain-containing protein [Alkalilimnicola ehrlichii M
. . . Nitrosomonas europaea ATCC 19718 .........................................   85  2 hits [b-proteobacteria]  translocation protein TolB [Nitrosomonas europaea ATCC 1971
. . . Nitrosomonas europaea ....................................................   85  1 hit  [b-proteobacteria]  translocation protein TolB [Nitrosomonas europaea ATCC 1971
. . . Comamonas testosteroni KF-1 ..............................................   84  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Comamona
. . . Hahella chejuensis KCTC 2396 .............................................   84  3 hits [g-proteobacteria]  translocation protein TolB [Hahella chejuensis KCTC 2396] >
. . . Polaromonas naphthalenivorans CJ2 ........................................   83  3 hits [b-proteobacteria]  TolB domain-containing protein [Polaromonas naphthalenivora
. . . Nitrosococcus oceani ATCC 19707 ..........................................   83  3 hits [g-proteobacteria]  hypothetical protein Noc_0145 [Nitrosococcus oceani ATCC 19
. . . Nitrosococcus oceani AFC27 ...............................................   83  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Nitrosoc
. . . Xylella fastidiosa .......................................................   83  1 hit  [g-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . Xylella fastidiosa 9a5c ..................................................   83  2 hits [g-proteobacteria]  translocation protein TolB [Xylella fastidiosa 9a5c] >gi|91
. . . Aromatoleum aromaticum EbN1 ..............................................   83  3 hits [b-proteobacteria]  translocation protein TolB [Aromatoleum aromaticum EbN1] >g
. . . gamma proteobacterium NOR5-3 .............................................   83  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [gamma pr
. . . marine gamma proteobacterium HTCC2080 ....................................   83  2 hits [g-proteobacteria]  translocation protein TolB precursor [marine gamma proteoba
. . . Chromohalobacter salexigens DSM 3043 .....................................   82  3 hits [g-proteobacteria]  translocation protein TolB [Chromohalobacter salexigens DSM
. . . Verminephrobacter eiseniae EF01-2 ........................................   82  2 hits [b-proteobacteria]  TolB domain-containing protein [Verminephrobacter eiseniae 
. . . Nitrosospira multiformis ATCC 25196 ......................................   82  3 hits [b-proteobacteria]  translocation protein TolB [Nitrosospira multiformis ATCC 2
. . . Xanthomonas oryzae pv. oryzae PXO99A .....................................   82  3 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas oryzae pv. oryzae P
. . . Rhodoferax ferrireducens T118 ............................................   82  3 hits [b-proteobacteria]  TolB-like [Rhodoferax ferrireducens T118] >gi|119371056|sp|
. . . Xylella fastidiosa Dixon .................................................   81  2 hits [g-proteobacteria]  TolB, N-terminal [Xylella fastidiosa Dixon] >gi|71900395|re
. . . Xylella fastidiosa subsp. sandyi Ann-1 ...................................   81  4 hits [g-proteobacteria]  TolB, N-terminal [Xylella fastidiosa Dixon] >gi|71900395|re
. . . Xylella fastidiosa M23 ...................................................   81  2 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Curvibacter putative symbiont of Hydra magnipapillata ....................   81  1 hit  [b-proteobacteria]  Protein tolB [Curvibacter putative symbiont of Hydra magnip
. . . Xylella fastidiosa M12 ...................................................   81  3 hits [g-proteobacteria]  TolB protein precursor [Xylella fastidiosa M12] >gi|2267059
. . . Comamonas testosteroni CNB-2 .............................................   81  2 hits [b-proteobacteria]  protein tolB [Comamonas testosteroni CNB-2] >gi|262208265|g
. . . Xylella fastidiosa Temecula1 .............................................   81  3 hits [g-proteobacteria]  translocation protein TolB [Xylella fastidiosa Temecula1] >
. . . gamma proteobacterium HTCC2207 ...........................................   80  2 hits [g-proteobacteria]  translocation protein TolB precursor [marine gamma proteoba
. . . Nitrosomonas eutropha C91 ................................................   80  2 hits [b-proteobacteria]  translocation protein TolB [Nitrosomonas eutropha C91] >gi|
. . . Sideroxydans lithotrophicus ES-1 .........................................   80  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Sideroxy
. . . gamma proteobacterium HTCC5015 ...........................................   80  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [gamma pr
. . . Delftia acidovorans SPH-1 ................................................   80  2 hits [b-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................   80  3 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas oryzae pv. oryzae M
. . . Methylococcus capsulatus str. Bath .......................................   80  2 hits [g-proteobacteria]  translocation protein TolB [Methylococcus capsulatus str. B
. . . Methylococcus capsulatus .................................................   80  1 hit  [g-proteobacteria]  translocation protein TolB [Methylococcus capsulatus str. B
. . . Variovorax paradoxus S110 ................................................   80  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Variovor
. . . Polaromonas sp. JS666 ....................................................   80  3 hits [b-proteobacteria]  TolB-like [Polaromonas sp. JS666] >gi|118574592|sp|Q12C28.1
. . . Xanthomonas oryzae pv. oryzae ............................................   80  1 hit  [g-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas oryzae pv. oryzae KACC10331 ..................................   80  2 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas oryzae pv. oryzae K
. . . Leptothrix cholodnii SP-6 ................................................   80  2 hits [b-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Thauera sp. MZ1T .........................................................   79  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Thauera 
. . . Marinobacter aquaeolei VT8 ...............................................   78  2 hits [g-proteobacteria]  translocation protein TolB [Marinobacter aquaeolei VT8] >gi
. . . Stenotrophomonas maltophilia R551-3 ......................................   78  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Stenotro
. . . Congregibacter litoralis KT71 ............................................   78  2 hits [g-proteobacteria]  TolB protein precursor [Congregibacter litoralis KT71] >gi|
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................   78  2 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas campestris pv. camp
. . . Xanthomonas campestris pv. campestris str. 8004 ..........................   78  3 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas campestris pv. camp
. . . Xanthomonas campestris pv. campestris str. B100 ..........................   78  2 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas campestris pv. camp
. . . Xanthomonas campestris pv. campestris ....................................   78  2 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas campestris pv. camp
. . . Stenotrophomonas maltophilia K279a .......................................   78  2 hits [g-proteobacteria]  putative tolB protein precursor [Stenotrophomonas maltophil
. . . Chromobacterium violaceum ATCC 12472 .....................................   77  2 hits [b-proteobacteria]  translocation protein TolB [Chromobacterium violaceum ATCC 
. . . Chromobacterium violaceum ................................................   77  1 hit  [b-proteobacteria]  translocation protein TolB [Chromobacterium violaceum ATCC 
. . . Neptuniibacter caesariensis ..............................................   77  2 hits [g-proteobacteria]  TolB, N-terminal:TolB, N-terminal [Oceanospirillum sp. MED9
. . . Acidovorax citrulli AAC00-1 ..............................................   77  2 hits [b-proteobacteria]  TolB domain-containing protein [Acidovorax avenae subsp. ci
. . . marine gamma proteobacterium HTCC2143 ....................................   77  2 hits [g-proteobacteria]  translocation protein TolB precursor [marine gamma proteoba
. . . Xanthomonas axonopodis pv. citri str. 306 ................................   77  2 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas axonopodis pv. citr
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................   77  3 hits [g-proteobacteria]  translocation protein TolB [Xanthomonas axonopodis pv. citr
. . . Xanthomonas axonopodis pv. citri .........................................   77  1 hit  [g-proteobacteria]  translocation protein TolB [Xanthomonas axonopodis pv. citr
. . . Halothiobacillus neapolitanus c2 .........................................   77  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Halothio
. . . Xanthomonas oryzae pv. oryzicola BLS256 ..................................   77  1 hit  [g-proteobacteria]  translocation protein TolB [Xanthomonas oryzae pv. oryzicol
. . . Stenotrophomonas sp. SKA14 ...............................................   76  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Stenotro
. . . Limnobacter sp. MED105 ...................................................   76  2 hits [b-proteobacteria]  translocation protein TolB precursor [Limnobacter sp. MED10
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................   76  3 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Azoarcus sp. BH72 ........................................................   75  3 hits [b-proteobacteria]  translocation protein TolB [Azoarcus sp. BH72] >gi|16622997
. . . Gallionella ferruginea ES-2 ..............................................   75  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Gallione
. . . Thioalkalivibrio sp. HL-EbGR7 ............................................   75  3 hits [g-proteobacteria]  hypothetical protein Tgr7_2229 [Thioalkalivibrio sp. HL-EbG
. . . Teredinibacter turnerae T7901 ............................................   75  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Teredini
. . . Thioalkalivibrio sp. K90mix ..............................................   75  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Thioalka
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................   75  3 hits [g-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . Haemophilus influenzae ...................................................   74  2 hits [g-proteobacteria]  TolB [Haemophilus influenzae]
. . . Haemophilus influenzae PittAA ............................................   74  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . marine gamma proteobacterium HTCC2148 ....................................   74  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [marine g
. . . Thiobacillus denitrificans ATCC 25259 ....................................   73  3 hits [b-proteobacteria]  translocation protein TolB [Thiobacillus denitrificans ATCC
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............   73  3 hits [g-proteobacteria]  TolB domain-containing protein [Candidatus Ruthia magnifica
. . . Photobacterium profundum 3TCK ............................................   73  2 hits [g-proteobacteria]  translocation protein TolB precursor [Photobacterium profun
. . . Photobacterium profundum SS9 .............................................   73  2 hits [g-proteobacteria]  translocation protein TolB [Photobacterium profundum SS9] >
. . . Photobacterium profundum .................................................   73  1 hit  [g-proteobacteria]  translocation protein TolB [Photobacterium profundum SS9] >
. . . Desulfuromonas acetoxidans DSM 684 .......................................   73  2 hits [d-proteobacteria]  TolB-like [Desulfuromonas acetoxidans DSM 684] >gi|95133928
. . . Haemophilus influenzae 22.4-21 ...........................................   73  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Pelobacter carbinolicus DSM 2380 .........................................   73  3 hits [d-proteobacteria]  TolB protein [Pelobacter carbinolicus DSM 2380] >gi|1193710
. . . Methylibium petroleiphilum PM1 ...........................................   72  2 hits [b-proteobacteria]  TolB protein precursor, periplasmic component of the Tol bi
. . . Marinobacter algicola DG893 ..............................................   72  2 hits [g-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . . Vibrio furnissii CIP 102972 ..............................................   72  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio furnissii CIP 102972] >gi|26
. . . Aliivibrio salmonicida LFI1238 ...........................................   72  3 hits [g-proteobacteria]  translocation protein TolB [Aliivibrio salmonicida LFI1238]
. . . Haemophilus influenzae PittHH ............................................   72  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................   71  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Candidat
. . . Haemophilus influenzae 86-028NP ..........................................   71  3 hits [g-proteobacteria]  translocation protein TolB [Haemophilus influenzae 86-028NP
. . . Haemophilus influenzae NT127 .............................................   71  2 hits [g-proteobacteria]  tol-Pal system beta propeller repeat protein TolB [Haemophi
. . . Haemophilus influenzae Rd KW20 ...........................................   71  2 hits [g-proteobacteria]  translocation protein TolB [Haemophilus influenzae Rd KW20]
. . . Haemophilus influenzae RdAW ..............................................   71  2 hits [g-proteobacteria]  translocation protein TolB [Haemophilus influenzae Rd KW20]
. . . Haemophilus influenzae R2866 .............................................   71  1 hit  [g-proteobacteria]  COG0823: Periplasmic component of the Tol biopolymer transp
. . . Haemophilus influenzae R2846 .............................................   71  1 hit  [g-proteobacteria]  COG0823: Periplasmic component of the Tol biopolymer transp
. . . Haemophilus influenzae PittEE ............................................   71  3 hits [g-proteobacteria]  COG0823: Periplasmic component of the Tol biopolymer transp
. . . Thiomonas intermedia K12 .................................................   71  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Thiomona
. . . Vibrio alginolyticus 40B .................................................   71  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio alginolyticus 
. . . Vibrio parahaemolyticus RIMD 2210633 .....................................   71  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus AQ3810 ...........................................   71  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus K5030 ............................................   71  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus AN-5034 ..........................................   71  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus Peru-466 .........................................   71  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus AQ4037 ...........................................   71  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio parahaemolyticus ..................................................   71  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio parahaemolyticus RIMD 22
. . . Vibrio metschnikovii CIP 69.14 ...........................................   71  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio metschnikovii CIP 69.14] >gi
. . . Vibrio mimicus VM223 .....................................................   70  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio mimicus VM223] >gi|262171199
. . . Vibrio mimicus MB-451 ....................................................   70  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio mimicus VM223] >gi|262171199
. . . Vibrionales bacterium SWAT-3 .............................................   70  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrionales bacterium
. . . Glaciecola sp. HTCC2999 ..................................................   70  1 hit  [g-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . . Haemophilus influenzae 7P49H1 ............................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Haemophilus influenzae 7P49H1] 
. . . Haemophilus influenzae R3021 .............................................   70  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Haemophilus influenzae PittGG ............................................   70  3 hits [g-proteobacteria]  translocation protein TolB [Haemophilus influenzae PittGG] 
. . . Actinobacillus succinogenes 130Z .........................................   70  3 hits [g-proteobacteria]  translocation protein TolB [Actinobacillus succinogenes 130
. . . Citrobacter sp. 30_2 .....................................................   70  2 hits [enterobacteria]    translocation protein TolB [Citrobacter sp. 30_2] >gi|22690
. . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae V52 ......................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae O395 .....................................................   70  5 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae 1587 .....................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae MZO-3 ....................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae 623-39 ...................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae M66-2 ....................................................   70  3 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae BX 330286 ................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae B33 ......................................................   70  4 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae TMA 21 ...................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae RC9 ......................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae bv. albensis VL426 .......................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae 12129(1) .................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae MJ-1236 ..................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae MO10 .....................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholera CIRS 101 ..................................................   70  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Vibrio cholerae ..........................................................   70  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio cholerae O1 biovar El To
. . . Candidatus Vesicomyosocius okutanii HA ...................................   70  3 hits [g-proteobacteria]  biopolymer transport protein TolB [Candidatus Vesicomyosoci
. . . Vibrio cholerae 2740-80 ..................................................   70  2 hits [g-proteobacteria]  tolB protein [Vibrio cholerae 2740-80] >gi|121546465|gb|EAX
. . . Pasteurella dagmatis ATCC 43325 ..........................................   70  2 hits [g-proteobacteria]  tol-Pal system beta propeller repeat protein TolB [Pasteure
. . . Proteus penneri ATCC 35198 ...............................................   70  2 hits [enterobacteria]    hypothetical protein PROPEN_04851 [Proteus penneri ATCC 351
. . . Burkholderia pseudomallei 1655 ...........................................   70  2 hits [b-proteobacteria]  putative TolB protein [Burkholderia pseudomallei 1655] >gi|
. . . Vibrio cholerae NCTC 8457 ................................................   70  2 hits [g-proteobacteria]  tolB protein [Vibrio cholerae NCTC 8457] >gi|126508988|gb|E
. . . Citrobacter youngae ATCC 29220 ...........................................   70  2 hits [enterobacteria]    hypothetical protein CIT292_01743 [Citrobacter youngae ATCC
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   69  2 hits [enterobacteria]    translocation protein TolB precursor [Salmonella enterica s
. . . Haemophilus influenzae PittII ............................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Citrobacter koseri ATCC BAA-895 ..........................................   69  2 hits [enterobacteria]    translocation protein TolB [Citrobacter koseri ATCC BAA-895
. . . Cronobacter sakazakii ATCC BAA-894 .......................................   69  2 hits [enterobacteria]    translocation protein TolB [Enterobacter sakazakii ATCC BAA
. . . Lutiella nitroferrum 2002 ................................................   69  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Lutiella
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   69  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   69  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ariz
. . . Klebsiella pneumoniae NTUH-K2044 .........................................   69  2 hits [enterobacteria]    translocation protein TolB precursor [Klebsiella pneumoniae
. . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................   69  2 hits [enterobacteria]    translocation protein TolB precursor [Klebsiella pneumoniae
. . . Burkholderia oklahomensis EO147 ..........................................   69  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia oklahomensis EO147
. . . Burkholderia oklahomensis C6786 ..........................................   69  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia oklahomensis EO147
. . . Haemophilus influenzae 3655 ..............................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Haemophilus influenzae 6P18H1 ............................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Ralstonia pickettii 12D ..................................................   69  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ralstoni
. . . Haemophilus influenzae 22.1-21 ...........................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Haemophilus influenza
. . . Vibrio mimicus VM573 .....................................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio mimicus VM573]
. . . Vibrio mimicus VM603 .....................................................   69  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio mimicus VM573]
. . . Vibrio fischeri MJ11 .....................................................   68  3 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Vibrio f
. . . Burkholderia mallei NCTC 10229 ...........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei NCTC 10229]
. . . Burkholderia mallei JHU ..................................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei NCTC 10229]
. . . Legionella drancourtii LLAP12 ............................................   68  2 hits [g-proteobacteria]  TolB colicin import protein [Legionella drancourtii LLAP12]
. . . Burkholderia mallei ATCC 23344 ...........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei ATCC 23344]
. . . Burkholderia mallei PRL-20 ...............................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei ATCC 23344]
. . . Burkholderia mallei NCTC 10247 ...........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei ATCC 23344]
. . . Burkholderia mallei ......................................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia mallei ATCC 23344]
. . . Vibrio sp. Ex25 ..........................................................   68  4 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Vibrio s
. . . Burkholderia pseudomallei Pakistan 9 .....................................   68  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia pseudomallei K96243 .........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei DM98 ...........................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 14 .............................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 91 .............................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 9 ..............................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei B7210 ..........................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 7894 ...........................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei NCTC 13177 .....................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 112 ............................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei BCC215 .........................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei S13 ............................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei ................................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Burkholderia pseudomallei 1710b ..........................................   68  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei K9624
. . . Oxalobacter formigenes HOxBLS ............................................   68  2 hits [b-proteobacteria]  TolB protein [Oxalobacter formigenes HOxBLS] >gi|229378016|
. . . Burkholderia pseudomallei 668 ............................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 1106a ..........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 305 ............................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 576 ............................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei MSHR346 ........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei Pasteur 52237 ..................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 1710a ..........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 406e ...........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 668] 
. . . Burkholderia pseudomallei 1106b ..........................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia pseudomallei 1710b
. . . Escherichia albertii TW07627 .............................................   68  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Escheric
. . . Burkholderia mallei SAVP1 ................................................   68  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia mallei SAVP1] >gi|
. . . Vibrio sp. RC586 .........................................................   68  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio sp. RC586] >gi|262349214|gb|
. . . Burkholderia mallei GB8 horse 4 ..........................................   68  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia mallei ATCC 10399 ...........................................   68  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia mallei FMH ..................................................   68  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia mallei 2002721280 ...........................................   68  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Vibrio sp. MED222 ........................................................   68  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio sp. MED222] >g
. . . Vibrio splendidus LGP32 ..................................................   68  3 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio sp. MED222] >g
. . . Cronobacter turicensis ...................................................   68  1 hit  [enterobacteria]    Protein tolB [Cronobacter turicensis] >gi|260216316|emb|CBA
. . . Cronobacter turicensis z3032 .............................................   68  1 hit  [enterobacteria]    Protein tolB [Cronobacter turicensis] >gi|260216316|emb|CBA
. . . Vibrio fischeri ES114 ....................................................   68  3 hits [g-proteobacteria]  translocation protein TolB [Vibrio fischeri ES114] >gi|6746
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............   68  2 hits [b-proteobacteria]  translocation protein TolB [Polynucleobacter necessarius su
. . . Alcanivorax sp. DG881 ....................................................   68  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Alcanivo
. . . Vibrio sp. RC341 .........................................................   68  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio sp. RC341] >gi|260839250|gb|
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   68  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica ......................................................   68  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Burkholderia thailandensis MSMB43 ........................................   68  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia thailandensis MSMB
. . . Syntrophobacter fumaroxidans MPOB ........................................   68  2 hits [d-proteobacteria]  TolB domain-containing protein [Syntrophobacter fumaroxidan
. . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........   68  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........   68  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............   68  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........   68  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Rickettsiella grylli .....................................................   68  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ricketts
. . . Nitrococcus mobilis Nb-231 ...............................................   68  2 hits [g-proteobacteria]  TolB [Nitrococcus mobilis Nb-231] >gi|88792182|gb|EAR23292.
. . . Burkholderia cenocepacia MC0-3 ...........................................   68  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia cenocepacia MC0-3]
. . . Providencia stuartii ATCC 25827 ..........................................   68  2 hits [enterobacteria]    hypothetical protein PROSTU_01566 [Providencia stuartii ATC
. . . Marinobacter sp. ELB17 ...................................................   68  2 hits [g-proteobacteria]  translocation protein TolB precursor [Marinobacter sp. ELB1
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........   67  2 hits [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...   67  2 hits [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   67  3 hits [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   67  3 hits [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   67  3 hits [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................   67  1 hit  [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................   67  1 hit  [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   67  1 hit  [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......   67  1 hit  [enterobacteria]    translocation protein TolB [Salmonella typhimurium LT2] >gi
. . . Burkholderia thailandensis Bt4 ...........................................   67  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia thailandensis Bt4]
. . . Burkholderia thailandensis E264 ..........................................   67  4 hits [b-proteobacteria]  translocation protein TolB [Burkholderia thailandensis Bt4]
. . . Burkholderia thailandensis TXDOH .........................................   67  1 hit  [b-proteobacteria]  translocation protein TolB [Burkholderia thailandensis TXDO
. . . Burkholderia cenocepacia AU 1054 .........................................   67  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia cenocepacia AU 105
. . . Ralstonia solanacearum UW551 .............................................   67  2 hits [b-proteobacteria]  TolB protein [Ralstonia solanacearum UW551] >gi|83727137|gb
. . . Burkholderia cenocepacia HI2424 ..........................................   67  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia cenocepacia HI2424
. . . Burkholderia cenocepacia PC184 ...........................................   67  2 hits [b-proteobacteria]  translocation protein TolB [Burkholderia cenocepacia HI2424
. . . Herminiimonas arsenicoxydans .............................................   67  2 hits [b-proteobacteria]  TolB periplasmic protein precursor [Herminiimonas arsenicox
. . . Ralstonia solanacearum MolK2 .............................................   67  2 hits [b-proteobacteria]  protein tolb precursor [Ralstonia solanacearum MolK2] >gi|2
. . . Ralstonia solanacearum IPO1609 ...........................................   67  2 hits [b-proteobacteria]  protein tolb precursor [Ralstonia solanacearum MolK2] >gi|2
. . . Vibrio splendidus 12B01 ..................................................   67  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio splendidus 12B
. . . Shewanella loihica PV-4 ..................................................   67  3 hits [g-proteobacteria]  TolB domain-containing protein [Shewanella loihica PV-4] >g
. . . Endoriftia persephone 'Hot96_1+Hot96_2' ..................................   67  1 hit  [g-proteobacteria]  TolB [Endoriftia persephone 'Hot96_1+Hot96_2']
. . . Grimontia hollisae CIP 101886 ............................................   67  2 hits [g-proteobacteria]  TolB protein precursor [Grimontia hollisae CIP 101886] >gi|
. . . beta proteobacterium KB13 ................................................   67  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [beta pro
. . . Klebsiella pneumoniae 342 ................................................   67  3 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Klebsiel
. . . Klebsiella variicola At-22 ...............................................   67  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Klebsiel
. . . Burkholderia glumae BGR1 .................................................   67  2 hits [b-proteobacteria]  Putative TolB protein [Burkholderia glumae BGR1] >gi|237875
. . . Vibrio alginolyticus 12G01 ...............................................   67  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio alginolyticus 
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   67  2 hits [enterobacteria]    tol-Pal system beta propeller repeat protein TolB [Salmonel
. . . Acinetobacter lwoffii SH145 ..............................................   66  2 hits [g-proteobacteria]  tol-Pal system beta propeller repeat protein TolB [Acinetob
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............   66  1 hit  [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............   66  2 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Salmonella enterica subsp. enterica serovar Typhi ........................   66  3 hits [enterobacteria]    translocation protein TolB [Salmonella enterica subsp. ente
. . . Vibrio vulnificus CMCP6 ..................................................   66  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio vulnificus CMCP6] >gi|32
. . . Vibrio vulnificus ........................................................   66  1 hit  [g-proteobacteria]  translocation protein TolB [Vibrio vulnificus CMCP6] >gi|32
. . . Pantoea sp. At-9b ........................................................   66  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Pantoea 
. . . Enterobacter sp. 638 .....................................................   66  3 hits [enterobacteria]    translocation protein TolB [Enterobacter sp. 638] >gi|16698
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............   66  3 hits [g-proteobacteria]  TolB colicin import protein [Legionella pneumophila subsp. 
. . . Vibrio vulnificus YJ016 ..................................................   66  3 hits [g-proteobacteria]  translocation protein TolB [Vibrio vulnificus YJ016] >gi|67
. . . Bordetella bronchiseptica RB50 ...........................................   66  2 hits [b-proteobacteria]  translocation protein TolB [Bordetella bronchiseptica RB50]
. . . Bordetella bronchiseptica ................................................   66  1 hit  [b-proteobacteria]  translocation protein TolB [Bordetella bronchiseptica RB50]
. . . Vibrio shilonii AK1 ......................................................   66  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio shilonii AK1] 
. . . Proteus mirabilis ATCC 29906 .............................................   66  2 hits [enterobacteria]    TolB protein [Proteus mirabilis ATCC 29906] >gi|227163167|g
. . . Bordetella pertussis Tohama I ............................................   66  2 hits [b-proteobacteria]  translocation protein TolB [Bordetella pertussis Tohama I] 
. . . Bordetella pertussis .....................................................   66  1 hit  [b-proteobacteria]  translocation protein TolB [Bordetella pertussis Tohama I] 
. . . Janthinobacterium sp. Marseille ..........................................   66  2 hits [b-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . Yersinia bercovieri ATCC 43970 ...........................................   66  2 hits [enterobacteria]    hypothetical protein yberc0001_38250 [Yersinia bercovieri A
. . . Cellvibrio japonicus Ueda107 .............................................   66  2 hits [g-proteobacteria]  tolB protein [Cellvibrio japonicus Ueda107] >gi|190688617|g
. . . Proteus mirabilis HI4320 .................................................   66  2 hits [enterobacteria]    TolB protein [Proteus mirabilis HI4320] >gi|194681968|emb|C
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................   66  3 hits [enterobacteria]    translocation protein TolB [Yersinia enterocolitica subsp. 
. . . Burkholderia cenocepacia J2315 ...........................................   65  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia cenocepacia J2315]
. . . Vibrio harveyi 1DA3 ......................................................   65  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio harveyi 1DA3] 
. . . Legionella longbeachae D-4968 ............................................   65  1 hit  [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Legionel
. . . Providencia alcalifaciens DSM 30120 ......................................   65  2 hits [enterobacteria]    hypothetical protein PROVALCAL_03527 [Providencia alcalifac
. . . Alcanivorax borkumensis SK2 ..............................................   65  3 hits [g-proteobacteria]  tolB protein [Alcanivorax borkumensis SK2] >gi|110646730|em
. . . Burkholderia ubonensis Bu ................................................   65  1 hit  [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Vibrio harveyi HY01 ......................................................   65  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Vibrio h
. . . Thiomicrospira crunogena XCL-2 ...........................................   65  3 hits [g-proteobacteria]  TolB-like [Thiomicrospira crunogena XCL-2] >gi|119371064|sp
. . . Yersinia pestis KIM 10 ...................................................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Microtus str. 91001 ...............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pseudotuberculosis IP 32953 .....................................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis Antiqua ..................................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis Nepal516 .................................................   65  5 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis Pestoides F ..............................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis CA88-4125 ................................................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pseudotuberculosis IP 31758 .....................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis Angola ...................................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Orientalis str. IP275 .............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pseudotuberculosis YPIII ........................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pseudotuberculosis PB1/+ ........................................   65  3 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis CO92 .....................................................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Orientalis str. PEXU2 .............................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis biovar Orientalis str. India 195 .........................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis Pestoides A ..............................................   65  2 hits [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis ..........................................................   65  1 hit  [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pseudotuberculosis ..............................................   65  1 hit  [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis D106004 ..................................................   65  1 hit  [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Yersinia pestis D182038 ..................................................   65  1 hit  [enterobacteria]    translocation protein TolB [Yersinia pestis KIM] >gi|454408
. . . Dickeya dadantii 3937 ....................................................   65  1 hit  [enterobacteria]    RecName: Full=Protein tolB; Flags: Precursor >gi|16116637|e
. . . Erwinia chrysanthemi .....................................................   65  1 hit  [enterobacteria]    RecName: Full=Protein tolB; Flags: Precursor >gi|16116637|e
. . . Escherichia coli CFT073 ..................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli UTI89 ...................................................   65  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli APEC O1 .................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli SMS-3-5 .................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli SE11 ....................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli 83972 ...................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia sp. 3_2_53FAA ................................................   65  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli O157:H7 str. FRIK2000 ...................................   65  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli O157:H7 str. FRIK966 ....................................   65  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Escherichia coli .........................................................   65 15 hits [enterobacteria]    translocation protein TolB [Escherichia coli CFT073] >gi|91
. . . Yersinia pestis FV-1 .....................................................   65  1 hit  [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Yersinia
. . . Vibrio parahaemolyticus 16 ...............................................   65  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Vibrio p
. . . Burkholderia sp. 383 .....................................................   65  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia sp. 383] >gi|11937
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................   65  2 hits [g-proteobacteria]  translocation protein TolB [Pasteurella multocida subsp. mu
. . . Pasteurella multocida ....................................................   65  1 hit  [g-proteobacteria]  translocation protein TolB [Pasteurella multocida subsp. mu
. . . Mannheimia succiniciproducens MBEL55E ....................................   65  3 hits [g-proteobacteria]  translocation protein TolB [Mannheimia succiniciproducens M
. . . Yersinia frederiksenii ATCC 33641 ........................................   65  2 hits [enterobacteria]    hypothetical protein yfred0001_12280 [Yersinia frederikseni
. . . Photobacterium angustum S14 ..............................................   65  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio angustum S14] 
. . . Vibrio coralliilyticus ATCC BAA-450 ......................................   65  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio coralliilyticus ATCC BAA-450
. . . Shewanella sediminis HAW-EB3 .............................................   65  3 hits [g-proteobacteria]  TolB domain-containing protein [Shewanella sediminis HAW-EB
. . . Bordetella parapertussis 12822 ...........................................   65  1 hit  [b-proteobacteria]  translocation protein TolB [Bordetella parapertussis 12822]
. . . Bordetella parapertussis .................................................   65  2 hits [b-proteobacteria]  translocation protein TolB [Bordetella parapertussis 12822]
. . . Pseudomonas aeruginosa PA7 ...............................................   65  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas aeruginosa PA7] >gi
. . . Pseudomonas aeruginosa PAO1 ..............................................   65  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa ...................................................   65  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa PACS2 .............................................   65  1 hit  [g-proteobacteria]  hypothetical protein PaerPA_01001453 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa UCBPP-PA14 ........................................   65  2 hits [g-proteobacteria]  hypothetical protein PaerPA_01001453 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa LESB58 ............................................   65  2 hits [g-proteobacteria]  hypothetical protein PaerPA_01001453 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa C3719 .............................................   65  2 hits [g-proteobacteria]  hypothetical protein PaerPA_01001453 [Pseudomonas aeruginos
. . . Pseudomonas aeruginosa 2192 ..............................................   65  2 hits [g-proteobacteria]  hypothetical protein PaerPA_01001453 [Pseudomonas aeruginos
. . . Legionella pneumophila str. Lens .........................................   64  3 hits [g-proteobacteria]  TolB protein [Legionella pneumophila str. Lens] >gi|6746192
. . . Dickeya dadantii Ech586 ..................................................   64  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Dickeya 
. . . Photobacterium sp. SKA34 .................................................   64  2 hits [g-proteobacteria]  translocation protein TolB precursor [Photobacterium sp. SK
. . . Dechloromonas aromatica RCB ..............................................   64  3 hits [b-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella benthica KT99 .................................................   64  2 hits [g-proteobacteria]  tolB protein [Shewanella benthica KT99] >gi|161328971|gb|ED
. . . Yersinia aldovae ATCC 35236 ..............................................   64  2 hits [enterobacteria]    hypothetical protein yaldo0001_8380 [Yersinia aldovae ATCC 
. . . Bordetella petrii DSM 12804 ..............................................   64  1 hit  [b-proteobacteria]  translocation protein TolB [Bordetella petrii DSM 12804] >g
. . . Bordetella petrii ........................................................   64  1 hit  [b-proteobacteria]  translocation protein TolB [Bordetella petrii DSM 12804] >g
. . . Haemophilus somnus 2336 ..................................................   64  3 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Burkholderia ambifaria AMMD ..............................................   64  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia ambifaria AMMD] >g
. . . Burkholderia ambifaria IOP40-10 ..........................................   64  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia ambifaria MC40-6 ............................................   64  3 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia multivorans ATCC 17616 ......................................   64  5 hits [b-proteobacteria]  translocation protein TolB [Burkholderia multivorans ATCC 1
. . . Legionella pneumophila str. Paris ........................................   64  3 hits [g-proteobacteria]  TolB protein [Legionella pneumophila str. Paris] >gi|674619
. . . Legionella pneumophila str. Corby ........................................   64  3 hits [g-proteobacteria]  TolB colicin import protein [Legionella pneumophila str. Co
. . . Halorhodospira halophila SL1 .............................................   64  2 hits [g-proteobacteria]  TolB domain-containing protein [Halorhodospira halophila SL
. . . Enhydrobacter aerosaccus SK60 ............................................   63  2 hits [g-proteobacteria]  putative TolB periplasmic receptor [Enhydrobacter aerosaccu
. . . Psychromonas sp. CNPT3 ...................................................   63  2 hits [g-proteobacteria]  TolB protein [Psychromonas sp. CNPT3] >gi|90310349|gb|EAS38
. . . Shigella boydii Sb227 ....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Shigella boydii Sb227] >gi|1193
. . . Providencia rustigianii DSM 4541 .........................................   63  1 hit  [enterobacteria]    periplasmic protein involved in the tonb-independent uptake
. . . Shigella boydii CDC 3083-94 ..............................................   63  3 hits [enterobacteria]    tol-Pal system beta propeller repeat protein TolB [Shigella
. . . Shigella flexneri 2a str. 301 ............................................   63  2 hits [enterobacteria]    translocation protein TolB [Shigella flexneri 2a str. 301] 
. . . Shigella flexneri ........................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Shigella flexneri 2a str. 301] 
. . . Photobacterium damselae subsp. damselae CIP 102761 .......................   63  2 hits [g-proteobacteria]  TolB protein precursor [Photobacterium damselae subsp. dams
. . . Escherichia coli O157:H7 str. EC4024 .....................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 str. E
. . . Dickeya zeae Ech1591 .....................................................   63  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Dickeya 
. . . Shewanella amazonensis SB2B ..............................................   63  3 hits [g-proteobacteria]  tolB protein [Shewanella amazonensis SB2B] >gi|166988080|sp
. . . Serratia proteamaculans 568 ..............................................   63  3 hits [enterobacteria]    translocation protein TolB [Serratia proteamaculans 568] >g
. . . Shigella flexneri 5 str. 8401 ............................................   63  3 hits [enterobacteria]    translocation protein TolB [Shigella flexneri 5 str. 8401] 
. . . Reinekea blandensis MED297 ...............................................   63  2 hits [g-proteobacteria]  TolB [Reinekea sp. MED297] >gi|88777031|gb|EAR08238.1| TolB
. . . Escherichia coli IAI1 ....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli IAI1] >gi|2267
. . . Escherichia coli O157:H7 EDL933 ..........................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. Sakai ......................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli str. K-12 substr. MG1655 ................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Shigella flexneri 2a str. 2457T ..........................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Shigella sonnei Ss046 ....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli str. K-12 substr. W3110 .................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli 536 .....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli E24377A .................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC4076 .....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC869 ......................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli ATCC 8739 ...............................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli str. K-12 substr. DH10B .................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli 53638 ...................................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC4486 .....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC4206 .....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC4045 .....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. EC4115 .....................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O127:H6 str. E2348/69 ...................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. TW14588 ....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli S88 .....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli ED1a ....................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli 55989 ...................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli IAI39 ...................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli UMN026 ..................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli BW2952 ..................................................   63  3 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli BL21(DE3) ...............................................   63  4 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli B str. REL606 ...........................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 str. TW14359 ....................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Shigella sp. D9 ..........................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia sp. 4_1_40B ..................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O103:H2 str. 12009 ......................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O26:H11 str. 11368 ......................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O111:H- str. 11128 ......................................   63  2 hits [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli K-12 ....................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O6 ......................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli O157:H7 .................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Escherichia coli DH1 .....................................................   63  1 hit  [enterobacteria]    translocation protein TolB [Escherichia coli O157:H7 EDL933
. . . Ralstonia pickettii 12J ..................................................   63  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Ralstoni
. . . Haemophilus somnus 129PT .................................................   63  3 hits [g-proteobacteria]  translocation protein TolB [Haemophilus somnus 129PT] >gi|1
. . . Photorhabdus asymbiotica .................................................   63  2 hits [enterobacteria]    periplasmic protein involved in the tonb-independent uptake
. . . Pseudomonas fluorescens SBW25 ............................................   63  3 hits [g-proteobacteria]  TolB colicin import protein [Pseudomonas fluorescens SBW25]
. . . Oxalobacter formigenes OXCC13 ............................................   63  2 hits [b-proteobacteria]  TolB [Oxalobacter formigenes OXCC13] >gi|229380161|gb|EEO30
. . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................   63  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Polynucl
. . . Aggregatibacter actinomycetemcomitans D11S-1 .............................   63  2 hits [g-proteobacteria]  hypothetical protein D11S_1837 [Aggregatibacter actinomycet
. . . Vibrio sp. AND4 ..........................................................   63  2 hits [g-proteobacteria]  translocation protein TolB precursor [Vibrio sp. AND4] >gi|
. . . Tolumonas auensis DSM 9187 ...............................................   63  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Tolumona
. . . Burkholderia dolosa AUO158 ...............................................   63  2 hits [b-proteobacteria]  TolB [Burkholderia dolosa AUO158] >gi|124895755|gb|EAY69635
. . . Dickeya dadantii Ech703 ..................................................   63  2 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB [Dickeya 
. . . Shewanella frigidimarina NCIMB 400 .......................................   63  3 hits [g-proteobacteria]  TolB domain-containing protein [Shewanella frigidimarina NC
. . . Burkholderia vietnamiensis G4 ............................................   63  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia vietnamiensis G4] 
. . . Pseudoalteromonas atlantica T6c ..........................................   63  3 hits [g-proteobacteria]  TolB-like [Pseudoalteromonas atlantica T6c] >gi|123360547|s
. . . Pseudomonas putida KT2440 ................................................   63  3 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas putida KT2440] >gi|
. . . Pseudomonas putida .......................................................   63  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas putida KT2440] >gi|
. . . Vibrio orientalis CIP 102891 .............................................   62  2 hits [g-proteobacteria]  TolB protein precursor [Vibrio orientalis CIP 102891] >gi|2
. . . Pseudomonas putida F1 ....................................................   62  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas putida F1] >gi|1485
. . . Pseudomonas putida GB-1 ..................................................   62  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas putida GB-1] >gi|16
. . . Burkholderia multivorans CGD2M ...........................................   62  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia multivorans CGD2 ............................................   62  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Burkholderia multivorans CGD1 ............................................   62  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Aggregatibacter aphrophilus NJ8700 .......................................   62  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Aggregat
. . . Bordetella avium 197N ....................................................   62  3 hits [b-proteobacteria]  TolB protein [Bordetella avium 197N] >gi|119371036|sp|Q2KV9
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   62  2 hits [enterobacteria]    translocation protein TolB [Klebsiella pneumoniae subsp. pn
. . . Pseudomonas fluorescens Pf0-1 ............................................   62  3 hits [g-proteobacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella woodyi ATCC 51908 .............................................   62  3 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Mariprofundus ferrooxydans PV-1 ..........................................   62  2 hits [proteobacteria]    translocation protein TolB precursor [Mariprofundus ferroox
. . . Acinetobacter radioresistens SK82 ........................................   62  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Acinetob
. . . Acinetobacter radioresistens SH164 .......................................   62  2 hits [g-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Acinetob
. . . Haemophilus parasuis 29755 ...............................................   62  2 hits [g-proteobacteria]  Dna-J like membrane chaperone protein [Haemophilus parasuis
. . . Psychromonas ingrahamii 37 ...............................................   62  2 hits [g-proteobacteria]  TolB domain-containing protein [Psychromonas ingrahamii 37]
. . . Ralstonia solanacearum GMI1000 ...........................................   62  2 hits [b-proteobacteria]  translocation protein TolB [Ralstonia solanacearum GMI1000]
. . . Ralstonia solanacearum ...................................................   62  1 hit  [b-proteobacteria]  translocation protein TolB [Ralstonia solanacearum GMI1000]
. . . Providencia rettgeri DSM 1131 ............................................   61  1 hit  [enterobacteria]    translocation protein TolB [Providencia rettgeri DSM 1131]
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................   61  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. tomato
. . . Pseudomonas syringae pv. tomato ..........................................   61  1 hit  [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. tomato
. . . Pseudoalteromonas tunicata D2 ............................................   61  2 hits [g-proteobacteria]  outer membrane protein [Pseudoalteromonas tunicata D2] >gi|
. . . Burkholderia graminis C4D1M ..............................................   61  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Anaeromyxobacter sp. Fw109-5 .............................................   61  2 hits [d-proteobacteria]  TolB domain-containing protein [Anaeromyxobacter sp. Fw109-
. . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................   61  1 hit  [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. tabaci
. . . Yersinia kristensenii ATCC 33638 .........................................   61  2 hits [enterobacteria]    hypothetical protein ykris0001_32600 [Yersinia kristensenii
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................   61  3 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. phaseo
. . . Shewanella halifaxensis HAW-EB4 ..........................................   61  3 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Burkholderia phymatum STM815 .............................................   61  3 hits [b-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Burkholderia xenovorans LB400 ............................................   60  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia xenovorans LB400] 
. . . Azotobacter vinelandii DJ ................................................   60  2 hits [g-proteobacteria]  Beta propeller TolB [Azotobacter vinelandii DJ] >gi|2267206
. . . Shigella dysenteriae Sd197 ...............................................   60  3 hits [enterobacteria]    translocation protein TolB [Shigella dysenteriae Sd197] >gi
. . . Alteromonas macleodii 'Deep ecotype' .....................................   60  3 hits [g-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . . Shewanella pealeana ATCC 700345 ..........................................   60  3 hits [g-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Pseudomonas putida W619 ..................................................   60  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas putida W619] >gi|16
. . . Pseudomonas syringae pv. syringae B728a ..................................   60  3 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. syring
. . . Vibrio harveyi ATCC BAA-1116 .............................................   60  2 hits [g-proteobacteria]  translocation protein TolB [Vibrio harveyi ATCC BAA-1116] >
. . . Cupriavidus taiwanensis ..................................................   60  2 hits [b-proteobacteria]  translocation protein TolB [Cupriavidus taiwanensis] >gi|19
. . . Pseudomonas syringae pv. tomato T1 .......................................   60  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. tomato
. . . Pseudomonas entomophila L48 ..............................................   59  3 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas entomophila L48] >g
. . . Shewanella sp. W3-18-1 ...................................................   59  3 hits [g-proteobacteria]  TolB domain-containing protein [Shewanella sp. W3-18-1] >gi
. . . Shewanella putrefaciens CN-32 ............................................   59  3 hits [g-proteobacteria]  TolB domain-containing protein [Shewanella sp. W3-18-1] >gi
. . . Edwardsiella tarda EIB202 ................................................   59  2 hits [enterobacteria]    translocation protein [Edwardsiella tarda EIB202] >gi|26798
. . . Ralstonia metallidurans CH34 .............................................   59  3 hits [b-proteobacteria]  translocation protein TolB [Ralstonia metallidurans CH34] >
. . . uncultured delta proteobacterium .........................................   59  1 hit  [d-proteobacteria]  tolB protein [uncultured delta proteobacterium]
. . . Burkholderia phytofirmans PsJN ...........................................   59  3 hits [b-proteobacteria]  translocation protein TolB [Burkholderia phytofirmans PsJN]
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................   59  3 hits [enterobacteria]    tol protein B [Candidatus Hamiltonella defensa 5AT (Acyrtho
. . . Pseudomonas syringae pv. oryzae str. 1_6 .................................   59  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas syringae pv. oryzae
. . . Burkholderia sp. H160 ....................................................   59  2 hits [b-proteobacteria]  Tol-Pal system beta propeller repeat protein TolB [Burkhold
. . . Pseudomonas mendocina ymp ................................................   59  2 hits [g-proteobacteria]  translocation protein TolB [Pseudomonas mendocina ymp] >gi|
. . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........   58  3 hits [enterobacteria]    hypothetical protein WGLp412 [Wigglesworthia glossinidia en
. . . Idiomarina loihiensis L2TR ...............................................   58  2 hits [g-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . Idiomarina loihiensis ....................................................   58  1 hit  [g-proteobacteria]  periplasmic component of the Tol biopolymer transport syste
. . . Edwardsiella ictaluri 93-146 .............................................   58  3 hits [enterobacteria]    Tol-Pal system beta propeller repeat protein TolB, putative
. . . Desulfococcus oleovorans Hxd3 ............................................   58  3 hits [d-proteobacteria]  beta-propeller repeat-containing to-pal system protein TolB
. . . Acinetobacter johnsonii SH046 ............................................   58  2 hits [g-proteobacteria]  tol-Pal system beta propeller repeat protein TolB [Acinetob
. . . Bdellovibrio bacteriovorus HD100 .........................................   58  2 hits [d-proteobacteria]  adventurous gliding motility protein W [Bdellovibrio bacter
. . . Bdellovibrio bacteriovorus ...............................................   58  1 hit  [d-proteobacteria]  adventurous gliding motility protein W [Bdellovibrio bacter
. . . Haemophilus parasuis SH0165 ..............................................   58  2 hits [g-proteobacteria]  dna-J like membrane chaperone, translocation protein TolB/c
. . . Alteromonas macleodii ATCC 27126 .........................................   58  1 hit  [g-proteobacteria]  Periplasmic component of the Tol biopolymer transport syste
. . Populus trichocarpa (black cottonwood) -------------------------------------   80  2 hits [eudicots]          predicted protein [Populus trichocarpa] >gi|222873073|gb|EE
. uncultured organism ----------------------------------------------------------  167  1 hit  [unclassified]      periplasmic component of the Tol biopolymer transport syste

----------------------------------------------------------------------------------------------------------------------

Blastp contre SP

Lineage Report

cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Alphaproteobacteria [a-proteobacteria]
. . . . Rickettsiales       [a-proteobacteria]
. . . . . Candidatus Pelagibacter ubique -------------------------------------  252 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia bellii RML369-C .........................................  138 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166229987|
. . . . . Rickettsia bellii OSU 85-389 .......................................  138 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166229987|
. . . . . Rickettsia rickettsii str. 'Sheila Smith' ..........................  127 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia rickettsii str. Iowa ....................................  127 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia peacockii str. Rustic ...................................  127 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia massiliae MTU5 ..........................................  127 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia conorii .................................................  126 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia africae ESF-5 ...........................................  126 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia felis ...................................................  125 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia canadensis str. McKiel ..................................  124 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia prowazekii ..............................................  122 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia typhi ...................................................  121 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Rickettsia akari str. Hartford .....................................  120 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Orientia tsutsugamushi str. Boryong ................................  117 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Orientia tsutsugamushi str. Ikeda ..................................  114 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Anaplasma marginale str. St. Maries ................................  113 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ...............   80 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Wolbachia endosymbiont of Drosophila melanogaster ..................   75 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . . Wolbachia sp. wRi ..................................................   75 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Parvibaculum lavamentivorans DS-1 ------------------------------------  181 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Agrobacterium tumefaciens str. C58 ...................................  178 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Ochrobactrum anthropi ATCC 49188 .....................................  176 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Sinorhizobium meliloti ...............................................  175 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Brucella abortus .....................................................  174 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371037|
. . . . Brucella melitensis biovar Abortus 2308 ..............................  174 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371037|
. . . . Brucella abortus S19 .................................................  174 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371037|
. . . . Brucella melitensis ATCC 23457 .......................................  174 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371037|
. . . . Brucella ovis ATCC 25840 .............................................  174 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Sinorhizobium medicae WSM419 .........................................  173 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Brucella suis ATCC 23445 .............................................  173 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Brucella suis ........................................................  173 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Brucella canis ATCC 23365 ............................................  172 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Brucella melitensis ..................................................  172 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Magnetospirillum magneticum AMB-1 ....................................  172 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhizobium etli CFN 42 ................................................  169 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhizobium etli CIAT 652 ..............................................  169 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 .........................  168 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhizobium leguminosarum bv. viciae 3841 ..............................  166 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Chelativorans sp. BNC1 ...............................................  166 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Agrobacterium vitis S4 ...............................................  163 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Caulobacter vibrioides ...............................................  162 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodopseudomonas palustris ...........................................  161 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodopseudomonas palustris BisB18 ....................................  160 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodospirillum rubrum ATCC 11170 .....................................  159 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodopseudomonas palustris HaA2 ......................................  159 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Nitrobacter winogradskyi Nb-255 ......................................  157 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Mesorhizobium loti ...................................................  154 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Nitrobacter hamburgensis X14 .........................................  154 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Bartonella henselae ..................................................  154 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Bartonella quintana ..................................................  151 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Bradyrhizobium japonicum .............................................  150 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Dinoroseobacter shibae DFL 12 ........................................  137 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Roseobacter denitrificans OCh 114 ....................................  137 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Jannaschia sp. CCS1 ..................................................  125 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodobacter sphaeroides 2.4.1 ........................................  124 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166229984|
. . . . Rhodobacter sphaeroides ATCC 17029 ...................................  124 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166229984|
. . . . Ruegeria sp. TM1040 ..................................................  123 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Rhodobacter sphaeroides ATCC 17025 ...................................  120 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Sphingomonas wittichii RW1 ...........................................  120 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Ruegeria pomeroyi ....................................................  120 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Zymomonas mobilis ....................................................  119 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Novosphingobium aromaticivorans DSM 12444 ............................  112 2 hits [a-proteobacteria]       RecName: Full=Protein tolB 1; Flags: Precursor
. . . . Gluconobacter oxydans ................................................  108 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . . Sphingopyxis alaskensis ..............................................  102 1 hit  [a-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Marinomonas sp. MWYL1 --------------------------------------------------   95 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Saccharophagus degradans 2-40 ..........................................   92 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Methylobacillus flagellatus KT .........................................   92 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Alkalilimnicola ehrlichii MLHE-1 .......................................   85 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Nitrosomonas europaea ..................................................   85 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Hahella chejuensis KCTC 2396 ...........................................   84 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Polaromonas naphthalenivorans CJ2 ......................................   83 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Nitrosococcus oceani ATCC 19707 ........................................   83 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xylella fastidiosa .....................................................   83 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Aromatoleum aromaticum EbN1 ............................................   83 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Chromohalobacter salexigens DSM 3043 ...................................   82 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Nitrosospira multiformis ATCC 25196 ....................................   82 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas oryzae pv. oryzae PXO99A ...................................   82 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Rhodoferax ferrireducens T118 ..........................................   82 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xylella fastidiosa M12 .................................................   81 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xylella fastidiosa Temecula1 ...........................................   81 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 ..............................   80 2 hits [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Methylococcus capsulatus ...............................................   80 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Polaromonas sp. JS666 ..................................................   80 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas oryzae pv. oryzae ..........................................   80 2 hits [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas campestris pv. campestris ..................................   78 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|81306551|s
. . . Xanthomonas campestris pv. campestris str. 8004 ........................   78 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|81306551|s
. . . Xanthomonas campestris pv. campestris str. B100 ........................   78 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|81306551|s
. . . Chromobacterium violaceum ..............................................   77 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Xanthomonas axonopodis pv. citri .......................................   77 2 hits [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371066|
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 ......................   77 2 hits [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|119371066|
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .......................   76 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Azoarcus sp. BH72 ......................................................   75 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Thioalkalivibrio sp. HL-EbGR7 ..........................................   75 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Aeromonas salmonicida subsp. salmonicida A449 ..........................   75 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Thiobacillus denitrificans ATCC 25259 ..................................   73 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ............   73 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Photobacterium profundum ...............................................   73 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pelobacter carbinolicus DSM 2380 .......................................   73 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Aliivibrio salmonicida LFI1238 .........................................   72 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus influenzae 86-028NP ........................................   71 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus influenzae .................................................   71 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus influenzae PittEE ..........................................   71 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio parahaemolyticus ................................................   71 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus influenzae PittGG ..........................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Actinobacillus succinogenes 130Z .......................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio cholerae ........................................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|172047657|
. . . Vibrio cholerae O395 ...................................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|172047657|
. . . Vibrio cholerae M66-2 ..................................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|172047657|
. . . Candidatus Vesicomyosocius okutanii HA .................................   70 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio fischeri MJ11 ...................................................   68 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia mallei ....................................................   68 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia pseudomallei ..............................................   68 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|118574573|
. . . Burkholderia pseudomallei 1710b ........................................   68 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|118574573|
. . . Vibrio splendidus LGP32 ................................................   68 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio fischeri ES114 ..................................................   68 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Salmonella enterica ....................................................   68 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia cenocepacia MC0-3 .........................................   68 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Salmonella enterica subsp. enterica serovar Typhimurium ................   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461910|s
. . . Salmonella enterica subsp. enterica serovar Paratyphi A ................   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461910|s
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 ...   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461910|s
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .....   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461910|s
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 .   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461910|s
. . . Burkholderia thailandensis E264 ........................................   67 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia cenocepacia AU 1054 .......................................   67 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia cenocepacia HI2424 ........................................   67 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella loihica PV-4 ................................................   67 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Klebsiella pneumoniae 342 ..............................................   67 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Salmonella enterica subsp. enterica serovar Typhi ......................   66 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio vulnificus ......................................................   66 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Enterobacter sp. 638 ...................................................   66 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ..........   66 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Vibrio vulnificus YJ016 ................................................   66 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Bordetella bronchiseptica ..............................................   66 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Bordetella pertussis ...................................................   66 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .....................   66 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia cenocepacia J2315 .........................................   65 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Alcanivorax borkumensis SK2 ............................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Thiomicrospira crunogena XCL-2 .........................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Yersinia pestis ........................................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pseudotuberculosis ............................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pestis Antiqua ................................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pestis Nepal516 ...............................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pestis Pestoides F ............................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pseudotuberculosis IP 31758 ...................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pseudotuberculosis PB1/+ ......................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pestis Angola .................................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Yersinia pseudotuberculosis YPIII ......................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67461941|s
. . . Dickeya dadantii 3937 ..................................................   65 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia sp. 383 ...................................................   65 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pasteurella multocida ..................................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Mannheimia succiniciproducens MBEL55E ..................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella sediminis HAW-EB3 ...........................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Bordetella parapertussis ...............................................   65 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas aeruginosa .................................................   65 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Legionella pneumophila str. Lens .......................................   64 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Dechloromonas aromatica RCB ............................................   64 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus somnus 2336 ................................................   64 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia ambifaria AMMD ............................................   64 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia ambifaria MC40-6 ..........................................   64 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia multivorans ATCC 17616 ....................................   64 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Legionella pneumophila str. Paris ......................................   64 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Legionella pneumophila str. Corby ......................................   64 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shigella boydii Sb227 ..................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shigella boydii CDC 3083-94 ............................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shigella flexneri ......................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella amazonensis SB2B ............................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Serratia proteamaculans 568 ............................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shigella flexneri 5 str. 8401 ..........................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Escherichia coli IAI1 ..................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Escherichia coli K-12 ..................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli O6 ....................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli O157:H7 ...............................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli 536 ...................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli UTI89 .................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Shigella sonnei Ss046 ..................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli E24377A ...............................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli ATCC 8739 .............................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli S88 ...................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli O157:H7 str. EC4115 ...................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli IAI39 .................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli str. K-12 substr. DH10B ...............................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli UMN026 ................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli O127:H6 str. E2348/69 .................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli 55989 .................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli ED1a ..................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Escherichia coli BW2952 ................................................   63 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor >gi|67473563|s
. . . Haemophilus somnus 129PT ...............................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas fluorescens SBW25 ..........................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella frigidimarina NCIMB 400 .....................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia vietnamiensis G4 ..........................................   63 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudoalteromonas atlantica T6c ........................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas putida KT2440 ..............................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|60415977|s
. . . Pseudomonas putida .....................................................   63 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|60415977|s
. . . Bordetella avium 197N ..................................................   62 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas fluorescens Pf0-1 ..........................................   62 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella woodyi ATCC 51908 ...........................................   62 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Ralstonia solanacearum .................................................   62 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas syringae pv. tomato ........................................   61 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas syringae pv. phaseolicola 1448A ............................   61 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella halifaxensis HAW-EB4 ........................................   61 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia phymatum STM815 ...........................................   61 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia xenovorans LB400 ..........................................   60 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shigella dysenteriae Sd197 .............................................   60 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Alteromonas macleodii 'Deep ecotype' ...................................   60 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella pealeana ATCC 700345 ........................................   60 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas syringae pv. syringae B728a ................................   60 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas entomophila L48 ............................................   59 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella putrefaciens CN-32 ..........................................   59 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166988086|
. . . Shewanella sp. W3-18-1 .................................................   59 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|166988086|
. . . Ralstonia metallidurans CH34 ...........................................   59 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Burkholderia phytofirmans PsJN .........................................   59 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ..............   59 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ........   58 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Idiomarina loihiensis ..................................................   58 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Edwardsiella ictaluri 93-146 ...........................................   58 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Desulfococcus oleovorans Hxd3 ..........................................   58 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Bdellovibrio bacteriovorus .............................................   58 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Escherichia fergusonii ATCC 35469 ......................................   58 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudomonas fluorescens Pf-5 ...........................................   57 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Candidatus Blochmannia floridanus ......................................   57 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella piezotolerans WP3 ...........................................   57 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Photorhabdus luminescens subsp. laumondii ..............................   57 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Ralstonia eutropha JMP134 ..............................................   57 1 hit  [b-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Sodalis glossinidius str. 'morsitans' ..................................   56 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Candidatus Blochmannia pennsylvanicus str. BPEN ........................   56 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella baltica OS155 ...............................................   56 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ......................   56 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Erwinia tasmaniensis ...................................................   56 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Pectobacterium atrosepticum ............................................   56 1 hit  [enterobacteria]         RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella baltica OS223 ...............................................   56 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella oneidensis ..................................................   56 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Pseudoalteromonas haloplanktis TAC125 ..................................   56 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella sp. ANA-3 ...................................................   55 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella baltica OS185 ...............................................   55 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella baltica OS195 ...............................................   55 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Shewanella sp. MR-7 ....................................................   54 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|123029559|
. . . Shewanella sp. MR-4 ....................................................   54 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|123029559|
. . . Shewanella denitrificans OS217 .........................................   53 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Haemophilus ducreyi ....................................................   53 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Coxiella burnetii ......................................................   51 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Acinetobacter sp. ADP1 .................................................   51 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Anaeromyxobacter dehalogenans 2CP-1 ....................................   51 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Anaeromyxobacter dehalogenans 2CP-C ....................................   50 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ....................   50 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Actinobacillus pleuropneumoniae L20 ....................................   50 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Anaeromyxobacter sp. K .................................................   50 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Colwellia psychrerythraea 34H ..........................................   48 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Geobacter sulfurreducens ...............................................   47 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Francisella tularensis subsp. mediasiatica FSC147 ......................   46 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Francisella tularensis subsp. tularensis WY96-3418 .....................   46 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Geobacter metallireducens GS-15 ........................................   46 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Francisella novicida U112 ..............................................   46 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Francisella tularensis subsp. tularensis ...............................   46 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|118574581|
. . . Francisella tularensis subsp. tularensis FSC198 ........................   46 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|118574581|
. . . Syntrophus aciditrophicus SB ...........................................   45 1 hit  [d-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor
. . . Francisella tularensis subsp. holarctica LVS ...........................   43 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|122325710|
. . . Francisella tularensis subsp. holarctica OSU18 .........................   43 1 hit  [g-proteobacteria]       RecName: Full=Protein tolB; Flags: Precursor >gi|122325710|
. . . Stenotrophomonas maltophilia K279a .....................................   31 1 hit  [g-proteobacteria]       RecName: Full=Xaa-Pro dipeptidase; Short=X-Pro dipeptidase;
. . . Stenotrophomonas maltophilia R551-3 ....................................   31 1 hit  [g-proteobacteria]       RecName: Full=Xaa-Pro dipeptidase; Short=X-Pro dipeptidase;
. . Mycobacterium avium subsp. paratuberculosis ------------------------------   33 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Chlorobaculum tepidum ....................................................   33 1 hit  [green sulfur bacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . Mycobacterium avium 104 ..................................................   32 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Mycobacterium gilvum PYR-GCK .............................................   32 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Mycobacterium vanbaalenii PYR-1 ..........................................   31 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Mycobacterium sp. MCS ....................................................   31 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Mycobacterium sp. KMS ....................................................   31 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Nocardioides sp. JS614 ...................................................   31 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Chlorobium luteolum DSM 273 ..............................................   31 1 hit  [green sulfur bacteria]  RecName: Full=Protein tolB; Flags: Precursor
. . Mycobacterium leprae .....................................................   30 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Mycobacterium leprae Br4923 ..............................................   30 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. . Candidatus Protochlamydia amoebophila UWE25 ..............................   30 1 hit  [chlamydias]             RecName: Full=Protein tolB; Flags: Precursor
. . Mycobacterium sp. JLS ....................................................   30 1 hit  [high GC Gram+]          RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fa
. Methanocaldococcus jannaschii ----------------------------------------------   35 1 hit  [euryarchaeotes]         RecName: Full=Probable aspartate aminotransferase 1; Short=
. Macaca fascicularis (cynomolgus monkey) ....................................   34 1 hit  [primates]               RecName: Full=Zinc finger protein 283
. Homo sapiens (man) .........................................................   32 1 hit  [primates]               RecName: Full=Zinc finger protein 283; AltName: Full=HZF19
. Xenopus laevis (common platanna) ...........................................   30 1 hit  [frogs & toads]          RecName: Full=RNA-binding protein 26; AltName: Full=RNA-bin

BLAST

PROTOCOLE:


Blastp contre nr, paramètres par défaut au NCBI sauf "Max target sequences" _ 1000 (expected E-value threshold_10)


Blastp contre SwissProt, paramètres par défaut au NCBI sauf "Max target sequences" _ 100(expected E-value threshold_10)


Blastp contre Envir, paramètres par défaut au NCBI sauf "Max target sequences" _ 10000(expected E-value threshold_10)


Blastx contre nr, paramètres par défaut au NCBIsauf "Max target sequences" _ 500(expected E-value threshold_10)[abandonné au vu des résultats précédents]


Blastx contre Environmental, paramètres par défaut au NCBI sauf "Max target sequences" _ 5000 (expected E-value threshold_10)[abandonné au vu des résultats précédents]




ANALYSE DES RÉSULTATS:


a) Blastp contre nr


Les scores de similitude ne présentent aucune rupture franche des E-values (la plus faible _ 8e-67) et des hits (le plus élevé_256). La valeur de seuil retenue est de 1e-10 (arbitraire).

Le nombre élevé d'homologues permet l'analyse phylogénique.


b) Blastp contre SwissProt:


Les scores de similitude ne présentent aucune rupture franche des E-values (la plus faible _ 1e-66) et des hits (le plus élevé_252). La valeur de seuil proposée précédemment(1e-10) est confirmée.

Il y a de nombreux homologues utilisables qui possèdent des fiches manuellement annotées.


c) Blastp contre Envir,

Il n'est pas nécessaire: les résultats des blast vs NR et SP sont satisfaisants.

(Très nombreuses séquences homologues (E-value minimale _ 5e-116) en croissance régulière des E-values sans seuil apparent.

Hits nombreux (maximum _ 418)sur tout le champ, pas de "rupture"franche.

Les séquences homologues du métagénome marin ne seront pas retenues car les taxons ne sont pas identifiés et les séquences homologues dans nr et SP sont largement suffisantes pour inférer un arbre phylogénique.)


d)Blastx contre nr

Inutile dans cette situation


e)Blastx contre Envir

Inutile dans cette situation


>>>>>>>(voir rubrique Analyse des résultats du champ Rapport Taxonomique pour le détail des séquences sélectionnées)





RÉSULTATS BRUTS:

Blastp contre nr, paramètres par défaut au NCBI sauf "Max target sequences" = 1000 (expected E-value threshold=10)
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05069250.1|  Tol-Pal system beta propeller repeat prote...   256    8e-67
ref|YP_266021.1|  translocation protein TolB [Candidatus Pelag...   252    2e-65 Gene info
ref|ZP_06055283.1|  Tol-Pal system beta propeller repeat prote...   218    2e-55
ref|YP_001413393.1|  beta-propeller repeat-containing to-pal s...   181    3e-44 Gene info
ref|YP_002827280.1|  TolB protein precursor [Rhizobium sp. NGR...   180    9e-44 Gene info
ref|ZP_01545735.1|  translocation protein TolB precursor [Stap...   178    2e-43
ref|NP_356906.2|  translocation protein TolB [Agrobacterium tu...   178    3e-43 Gene info
ref|ZP_05113665.1|  Tol-Pal system beta propeller repeat prote...   176    1e-42
ref|ZP_05181511.1|  translocation protein TolB [Brucella sp. 8...   176    2e-42
ref|YP_001369764.1|  translocation protein TolB [Ochrobactrum ...   176    2e-42 Gene info
ref|ZP_04681112.1|  Tol-Pal system beta propeller repeat prote...   175    2e-42
ref|YP_002131930.1|  periplasmic component of the Tol biopolym...   175    2e-42 Gene info
ref|NP_386845.1|  translocation protein TolB [Sinorhizobium me...   175    3e-42 Gene info
ref|YP_222362.1|  translocation protein TolB [Brucella abortus...   174    5e-42 Gene info
ref|ZP_05176369.1|  translocation protein TolB [Brucella ceti ...   174    5e-42
ref|YP_002545507.1|  Tol-Pal system beta propeller repeat prot...   174    6e-42 Gene info
ref|ZP_00953320.1|  translocation protein TolB precursor [Ocea...   174    6e-42
ref|YP_001259549.1|  translocation protein TolB [Brucella ovis...   174    6e-42 Gene info
ref|YP_001328292.1|  translocation protein TolB [Sinorhizobium...   173    9e-42 Gene info
ref|YP_001622931.1|  translocation protein TolB [Brucella suis...   173    1e-41 Gene info
ref|NP_698682.1|  translocation protein TolB [Brucella suis 13...   173    1e-41 Gene info
ref|ZP_05165303.1|  translocation protein TolB [Brucella suis ...   173    1e-41
ref|ZP_05170264.1|  translocation protein TolB [Brucella pinni...   172    1e-41
ref|ZP_00055341.1|  COG0823: Periplasmic component of the Tol ...   172    2e-41
ref|YP_001593513.1|  translocation protein TolB [Brucella cani...   172    2e-41 Gene info
ref|NP_539256.1|  translocation protein TolB [Brucella meliten...   172    2e-41 Gene info
ref|YP_422574.1|  translocation protein TolB [Magnetospirillum...   172    2e-41 Gene info
ref|ZP_01226887.1|  tolB protein, periplasmic component, biopo...   171    3e-41
ref|ZP_02165877.1|  translocation protein TolB precursor [Hoef...   171    4e-41
ref|ZP_05086614.1|  Tol-Pal system beta propeller repeat prote...   171    4e-41
ref|ZP_03508193.1|  translocation protein TolB [Rhizobium etli...   169    1e-40
ref|YP_470945.1|  translocation protein TolB [Rhizobium etli C...   169    1e-40 Gene info
ref|YP_001979817.1|  protein transporter, uptake component pro...   169    2e-40 Gene info
ref|YP_002977280.1|  Tol-Pal system beta propeller repeat prot...   168    3e-40 Gene info
ref|YP_002282693.1|  translocation protein TolB [Rhizobium leg...   168    4e-40 Gene info
emb|CAK32578.1|  periplasmic component of the Tol biopolymer t...   167    9e-40
ref|YP_769547.1|  translocation protein TolB [Rhizobium legumi...   166    1e-39 Gene info
ref|YP_675708.1|  translocation protein TolB [Mesorhizobium sp...   166    1e-39 Gene info
ref|ZP_06123097.1|  Tol-Pal system beta propeller repeat prote...   166    1e-39
ref|ZP_03518927.1|  translocation protein TolB [Rhizobium etli...   164    4e-39
ref|YP_002550620.1|  periplasmic component of the Tol biopolym...   163    9e-39 Gene info
ref|YP_002298010.1|  protein TolB precursor [Rhodospirillum ce...   163    9e-39 Gene info
ref|YP_002518710.1|  TolB protein [Caulobacter crescentus NA10...   162    1e-38 Gene info
ref|NP_422024.1|  translocation protein TolB [Caulobacter cres...   162    1e-38 Gene info
ref|ZP_01045368.1|  TolB [Nitrobacter sp. Nb-311A] >gb|EAQ3669...   161    3e-38
ref|YP_001686045.1|  translocation protein TolB [Caulobacter s...   161    4e-38 Gene info
ref|NP_946471.1|  translocation protein TolB [Rhodopseudomonas...   161    4e-38 Gene info
ref|YP_534592.1|  translocation protein TolB [Rhodopseudomonas...   160    5e-38 Gene info
ref|YP_571267.1|  translocation protein TolB [Rhodopseudomonas...   160    6e-38 Gene info
sp|Q20X63.2|TOLB_RHOPB  RecName: Full=Protein tolB; Flags: Pre...   160    6e-38
ref|ZP_01439698.1|  translocation protein TolB precursor [Fulv...   160    8e-38
ref|YP_002290259.1|  Tol-Pal system beta propeller repeat prot...   159    1e-37 Gene info
ref|YP_426182.1|  translocation protein TolB [Rhodospirillum r...   159    1e-37 Gene info
ref|YP_001523440.1|  twin-arginine translocation pathway signa...   159    2e-37 Gene info
ref|ZP_03527206.1|  translocation protein TolB [Rhizobium etli...   159    2e-37
ref|YP_485431.1|  translocation protein TolB [Rhodopseudomonas...   159    2e-37 Gene info
emb|CAM74763.1|  TOLB PROTEIN PRECURSOR [Magnetospirillum gryp...   158    4e-37
ref|YP_319322.1|  translocation protein TolB [Nitrobacter wino...   157    8e-37 Gene info
ref|YP_783606.1|  translocation protein TolB [Rhodopseudomonas...   157    9e-37 Gene info
ref|YP_757646.1|  TolB domain-containing protein [Maricaulis m...   156    1e-36 Gene info
ref|ZP_02190335.1|  Periplasmic component of the Tol biopolyme...   155    2e-36
ref|NP_104897.1|  translocation protein TolB [Mesorhizobium lo...   154    4e-36 Gene info
ref|YP_578701.1|  translocation protein TolB [Nitrobacter hamb...   154    4e-36 Gene info
ref|YP_034182.1|  translocation protein TolB [Bartonella hense...   154    5e-36 Gene info
ref|ZP_05813245.1|  Tol-Pal system beta propeller repeat prote...   154    7e-36
ref|ZP_04769461.1|  Tol-Pal system beta propeller repeat prote...   152    2e-35
ref|YP_032713.1|  translocation protein TolB [Bartonella quint...   151    3e-35 Gene info
ref|NP_773792.1|  translocation protein TolB [Bradyrhizobium j...   151    5e-35 Gene info
sp|Q89ED5.2|TOLB_BRAJA  RecName: Full=Protein tolB; Flags: Pre...   150    5e-35
ref|YP_758888.1|  tolB protein [Hyphomonas neptunium ATCC 1544...   150    7e-35 Gene info
ref|YP_002972622.1|  translocation protein TolB [Bartonella gr...   150    1e-34 Gene info
ref|YP_988482.1|  translocation protein TolB [Bartonella bacil...   149    1e-34 Gene info
ref|YP_001417943.1|  beta-propeller repeat-containing to-pal s...   149    2e-34 Gene info
ref|ZP_05374685.1|  Tol-Pal system beta propeller repeat prote...   148    3e-34
ref|ZP_01016534.1|  translocation protein TolB precursor [Parv...   147    4e-34
ref|YP_001610370.1|  translocation protein TolB [Bartonella tr...   146    1e-33 Gene info
ref|YP_001242674.1|  translocation protein TolB [Bradyrhizobiu...   140    1e-31 Gene info
ref|YP_744927.1|  translocation protein TolB [Granulibacter be...   139    1e-31 Gene info
ref|ZP_01744202.1|  translocation protein TolB precursor [Sagi...   139    2e-31
ref|ZP_01904146.1|  translocation protein TolB precursor [Rose...   138    3e-31
ref|YP_537438.1|  translocation protein TolB [Rickettsia belli...   138    3e-31 Gene info
ref|ZP_05782917.1|  Tol-Pal system beta propeller repeat prote...   137    5e-31
ref|ZP_01444829.1|  translocation protein TolB precursor [Rose...   137    5e-31
ref|YP_001532454.1|  translocation protein TolB [Dinoroseobact...   137    7e-31 Gene info
ref|YP_682383.1|  translocation protein TolB [Roseobacter deni...   137    9e-31 Gene info
ref|ZP_05067624.1|  Tol-Pal system beta propeller repeat prote...   136    1e-30
ref|ZP_02140964.1|  translocation protein TolB precursor [Rose...   135    2e-30
ref|ZP_01037803.1|  translocation protein TolB precursor [Rose...   135    2e-30
ref|ZP_05341354.1|  Tol-Pal system beta propeller repeat prote...   135    2e-30
ref|YP_003060773.1|  Tol-Pal system beta propeller repeat prot...   134    4e-30 Gene info
ref|ZP_05055224.1|  Tol-Pal system beta propeller repeat prote...   134    5e-30
ref|ZP_00958821.1|  translocation protein TolB precursor [Rose...   132    3e-29
ref|ZP_01879823.1|  translocation protein TolB precursor [Rose...   131    4e-29
ref|ZP_03502484.1|  translocation protein TolB [Rhizobium etli...   130    1e-28
ref|ZP_01004011.1|  translocation protein TolB precursor [Lokt...   130    1e-28
ref|ZP_05785079.1|  Tol-Pal system beta propeller repeat prote...   129    1e-28
ref|ZP_00999824.1|  translocation protein TolB precursor [Ocea...   129    2e-28
ref|ZP_01448606.1|  translocation protein TolB precursor [alph...   128    4e-28
ref|YP_001494524.1|  translocation protein TolB [Rickettsia ri...   127    5e-28 Gene info
ref|YP_001649775.1|  translocation protein TolB [Rickettsia ri...   127    5e-28 Gene info
ref|ZP_04699635.1|  Tol-Pal system beta propeller repeat prote...   127    6e-28
ref|YP_001236008.1|  TolB domain-containing protein [Acidiphil...   127    7e-28 Gene info
ref|ZP_05741561.1|  Tol-Pal system beta propeller repeat prote...   127    8e-28
ref|ZP_05099473.1|  Tol-Pal system beta propeller repeat prote...   127    8e-28
ref|YP_002916604.1|  translocation protein TolB [Rickettsia pe...   127    8e-28 Gene info
ref|ZP_00956375.1|  translocation protein TolB precursor [Sulf...   127    9e-28
ref|YP_001499201.1|  translocation protein TolB [Rickettsia ma...   127    9e-28 Gene info
ref|ZP_00142137.1|  tolB protein precursor [Rickettsia sibiric...   127    1e-27
ref|NP_360043.1|  translocation protein TolB [Rickettsia conor...   126    1e-27 Gene info
ref|YP_002845060.1|  TolB protein precursor [Rickettsia africa...   126    1e-27 Gene info
ref|ZP_01741365.1|  translocation protein TolB precursor [Rhod...   125    2e-27
ref|ZP_01015578.1|  translocation protein TolB precursor [Rhod...   125    2e-27
ref|YP_246508.1|  translocation protein TolB [Rickettsia felis...   125    3e-27 Gene info
ref|YP_508917.1|  translocation protein TolB [Jannaschia sp. C...   125    3e-27 Gene info
ref|YP_001770211.1|  beta-propeller repeat-containing to-pal s...   124    4e-27 Gene info
ref|YP_001492523.1|  translocation protein TolB [Rickettsia ca...   124    4e-27 Gene info
ref|YP_001753438.1|  beta-propeller repeat-containing to-pal s...   124    5e-27 Gene info
ref|ZP_01752962.1|  translocation protein TolB precursor [Rose...   124    5e-27
ref|ZP_05124336.1|  Tol-Pal system beta propeller repeat prote...   124    7e-27
ref|ZP_05844631.1|  Tol-Pal system beta propeller repeat prote...   124    7e-27
ref|YP_353744.1|  translocation protein TolB [Rhodobacter spha...   124    8e-27 Gene info
ref|ZP_01155457.1|  translocation protein TolB precursor [Ocea...   124    8e-27
ref|YP_002526386.1|  Protein tolB precursor [Rhodobacter sphae...   124    9e-27 Gene info
ref|ZP_06172708.1|  Tol-Pal system beta propeller repeat prote...   123    9e-27
ref|YP_003064961.1|  translocation protein TolB [Candidatus Li...   123    9e-27 Gene info
ref|YP_614359.1|  translocation protein TolB [Silicibacter sp....   123    1e-26 Gene info
ref|YP_002499609.1|  Tol-Pal system beta propeller repeat prot...   123    1e-26 Gene info
ref|ZP_01057716.1|  translocation protein TolB precursor [Rose...   123    1e-26
ref|NP_220686.1|  translocation protein TolB [Rickettsia prowa...   122    2e-26 Gene info
ref|ZP_05075063.1|  Tol-Pal system beta propeller repeat prote...   122    3e-26
ref|ZP_05034602.1|  Tol-Pal system beta propeller repeat prote...   121    4e-26
ref|YP_067255.1|  translocation protein TolB [Rickettsia typhi...   121    5e-26 Gene info
ref|YP_001166773.1|  translocation protein TolB [Rhodobacter s...   120    6e-26 Gene info
ref|YP_001262630.1|  translocation protein TolB [Sphingomonas ...   120    6e-26 Gene info
ref|YP_001927930.1|  Tol-Pal system beta propeller repeat prot...   120    7e-26 Gene info
ref|YP_001493262.1|  translocation protein TolB [Rickettsia ak...   120    7e-26 Gene info
ref|YP_168312.1|  translocation protein TolB [Ruegeria pomeroy...   120    9e-26 Gene info
ref|YP_001642199.1|  beta-propeller repeat-containing to-pal s...   119    2e-25 Gene info
ref|YP_003071219.1|  protein tolB precursor [Methylobacterium ...   119    2e-25 Gene info
ref|YP_161900.1|  translocation protein TolB [Zymomonas mobili...   119    2e-25 Gene info
ref|ZP_05090636.1|  Tol-Pal system beta propeller repeat prote...   119    3e-25
ref|ZP_01863933.1|  translocation protein TolB precursor [Eryt...   118    3e-25
ref|ZP_03513184.1|  translocation protein TolB [Rhizobium etli...   118    5e-25
ref|ZP_02145764.1|  TolB-like protein [Phaeobacter gallaeciens...   117    5e-25
ref|ZP_02149622.1|  translocation protein TolB precursor [Phae...   117    5e-25
ref|ZP_02153184.1|  translocation protein TolB precursor [Ocea...   117    5e-25
ref|ZP_01749340.1|  translocation protein TolB precursor [Rose...   117    5e-25
ref|YP_001248099.1|  protein precursor [Orientia tsutsugamushi...   117    8e-25 Gene info
ref|YP_001203317.1|  protein tolB precursor [Bradyrhizobium sp...   117    8e-25 Gene info
ref|YP_914494.1|  translocation protein TolB [Paracoccus denit...   115    3e-24 Gene info
ref|YP_003328842.1|  translocation protein [Anaplasma centrale...   114    4e-24
ref|YP_001938237.1|  TolB protein precursor [Orientia tsutsuga...   114    9e-24 Gene info
ref|YP_153606.1|  translocation protein TolB [Anaplasma margin...   113    1e-23 Gene info
ref|YP_002563315.1|  TOLB protein precursor (tolB) [Anaplasma ...   112    2e-23 Gene info
ref|YP_495675.1|  translocation protein TolB [Novosphingobium ...   112    3e-23 Gene info
ref|ZP_05077692.1|  Tol-Pal system beta propeller repeat prote...   112    3e-23
ref|YP_458790.1|  translocation protein TolB [Erythrobacter li...   110    9e-23 Gene info
ref|YP_001831414.1|  beta-propeller repeat-containing to-pal s...   108    3e-22 Gene info
ref|YP_192083.1|  translocation protein TolB [Gluconobacter ox...   108    4e-22 Gene info
ref|ZP_01041788.1|  translocation protein TolB precursor [Eryt...   104    6e-21
ref|YP_864398.1|  TolB domain-containing protein [Magnetococcu...   103    1e-20 Gene info
ref|ZP_01302759.1|  TolB-like protein [Sphingomonas sp. SKA58]...   102    2e-20
ref|YP_615384.1|  translocation protein TolB [Sphingopyxis ala...   102    3e-20 Gene info
ref|YP_003189096.1|  secretion system type I outer membrane pr...   101    6e-20 Gene info
ref|YP_002275609.1|  translocation protein TolB [Gluconacetoba...   100    8e-20 Gene info
ref|YP_001601087.1|  translocation protein TolB [Gluconacetoba...   100    9e-20 Gene info
ref|YP_496296.1|  translocation protein TolB [Novosphingobium ...  96.7    1e-18 Gene info
ref|ZP_01074850.1|  tolB protein [Marinomonas sp. MED121] >gb|...  95.5    3e-18
ref|YP_001341051.1|  translocation protein TolB [Marinomonas s...  95.5    3e-18 Gene info
ref|YP_528001.1|  translocation protein TolB [Saccharophagus d...  92.8    2e-17 Gene info
sp|Q1GYT1.2|TOLB_METFK  RecName: Full=Protein tolB; Flags: Pre...  92.8    2e-17
ref|ZP_01551691.1|  translocation protein TolB precursor [Meth...  92.0    3e-17
ref|YP_003049508.1|  Tol-Pal system beta propeller repeat prot...  91.7    5e-17 Gene info
ref|ZP_05103342.1|  Tol-Pal system beta propeller repeat prote...  91.7    5e-17
ref|YP_003052163.1|  Tol-Pal system beta propeller repeat prot...  89.0    2e-16 Gene info
ref|ZP_04762634.1|  Tol-Pal system beta propeller repeat prote...  87.4    8e-16
ref|ZP_01307544.1|  Periplasmic component of the Tol biopolyme...  87.4    8e-16
ref|YP_546447.1|  TolB-like protein [Methylobacillus flagellat...  87.0    1e-15 Gene info
ref|YP_985989.1|  TolB domain-containing protein [Acidovorax s...  86.3    2e-15 Gene info
ref|ZP_04774897.1|  Tol-Pal system beta propeller repeat prote...  85.9    2e-15
ref|ZP_04958954.1|  Tol-Pal system beta propeller repeat prote...  85.9    2e-15
ref|YP_505595.1|  translocation protein TolB [Anaplasma phagoc...  85.5    3e-15 Gene info
ref|YP_002553437.1|  Tol-Pal system beta propeller repeat prot...  85.5    3e-15 Gene info
ref|ZP_05316139.1|  Tol-Pal system beta propeller repeat prote...  85.1    4e-15
ref|YP_741087.1|  TolB domain-containing protein [Alkalilimnic...  85.1    4e-15 Gene info
ref|NP_840312.1|  translocation protein TolB [Nitrosomonas eur...  85.1    4e-15 Gene info
ref|ZP_03544167.1|  Tol-Pal system beta propeller repeat prote...  84.7    6e-15
ref|YP_436031.1|  translocation protein TolB [Hahella chejuens...  84.3    7e-15 Gene info
ref|YP_982280.1|  TolB domain-containing protein [Polaromonas ...  84.0    8e-15 Gene info
ref|YP_342208.1|  hypothetical protein Noc_0145 [Nitrosococcus...  84.0    9e-15 Gene info
ref|ZP_05048925.1|  Tol-Pal system beta propeller repeat prote...  84.0    9e-15
sp|Q9PC84.2|TOLB_XYLFA  RecName: Full=Protein tolB; Flags: Pre...  84.0    1e-14
ref|NP_299183.1|  translocation protein TolB [Xylella fastidio...  83.6    1e-14 Gene info
ref|YP_158517.1|  translocation protein TolB [Aromatoleum arom...  83.2    1e-14 Gene info
ref|ZP_05128762.1|  Tol-Pal system beta propeller repeat prote...  83.2    1e-14
ref|ZP_01626344.1|  translocation protein TolB precursor [mari...  83.2    2e-14
ref|YP_573904.1|  translocation protein TolB [Chromohalobacter...  82.8    2e-14 Gene info
ref|YP_995806.1|  TolB domain-containing protein [Verminephrob...  82.8    2e-14 Gene info
ref|YP_413393.1|  translocation protein TolB [Nitrosospira mul...  82.8    2e-14 Gene info
sp|Q2Y5H0.2|TOLB_NITMU  RecName: Full=Protein tolB; Flags: Pre...  82.4    2e-14
ref|YP_001914357.1|  translocation protein TolB [Xanthomonas o...  82.4    3e-14 Gene info
ref|YP_523347.1|  TolB-like [Rhodoferax ferrireducens T118] >s...  82.4    3e-14 Gene info
ref|ZP_00652080.1|  TolB, N-terminal [Xylella fastidiosa Dixon...  81.6    4e-14
ref|YP_001829655.1|  beta-propeller repeat-containing to-pal s...  81.6    4e-14 Gene info
emb|CBA26343.1|  Protein tolB [Curvibacter putative symbiont o...  81.3    6e-14
ref|YP_001775657.1|  TolB protein precursor [Xylella fastidios...  81.3    6e-14 Gene info
ref|YP_003277659.1|  protein tolB [Comamonas testosteroni CNB-...  81.3    6e-14 Gene info
ref|NP_779110.1|  translocation protein TolB [Xylella fastidio...  81.3    6e-14 Gene info
ref|ZP_01225044.1|  translocation protein TolB precursor [mari...  80.9    7e-14
ref|YP_746538.1|  translocation protein TolB [Nitrosomonas eut...  80.9    7e-14 Gene info
ref|ZP_03334884.1|  Protein tolB precursor [Wolbachia endosymb...  80.9    8e-14
ref|YP_001975033.1|  Protein tolB precursor [Wolbachia endosym...  80.9    8e-14 Gene info
ref|ZP_00683807.1|  TolB, N-terminal [Xylella fastidiosa Ann-1...  80.5    9e-14
ref|ZP_05339722.1|  Tol-Pal system beta propeller repeat prote...  80.5    1e-13
ref|XP_002338644.1|  predicted protein [Populus trichocarpa] >...  80.5    1e-13 Gene info
ref|ZP_05062172.1|  Tol-Pal system beta propeller repeat prote...  80.5    1e-13
ref|YP_001564417.1|  beta-propeller repeat-containing to-pal s...  80.1    1e-13 Gene info
ref|YP_450581.1|  translocation protein TolB [Xanthomonas oryz...  80.1    1e-13 Gene info
ref|YP_113693.1|  translocation protein TolB [Methylococcus ca...  80.1    1e-13 Gene info
ref|YP_002944583.1|  Tol-Pal system beta propeller repeat prot...  80.1    1e-13 Gene info
ref|YP_548812.1|  TolB-like [Polaromonas sp. JS666] >sp|Q12C28...  80.1    1e-13 Gene info
sp|Q5H299.2|TOLB_XANOR  RecName: Full=Protein tolB; Flags: Pre...  80.1    1e-13
ref|YP_200307.1|  translocation protein TolB [Xanthomonas oryz...  80.1    1e-13 Gene info
ref|YP_001790976.1|  beta-propeller repeat-containing to-pal s...  80.1    1e-13 Gene info
ref|YP_002354447.1|  Tol-Pal system beta propeller repeat prot...  79.3    2e-13 Gene info
ref|YP_958970.1|  translocation protein TolB [Marinobacter aqu...  79.0    3e-13 Gene info
ref|YP_002029501.1|  Tol-Pal system beta propeller repeat prot...  79.0    3e-13 Gene info
ref|ZP_01103321.1|  TolB protein precursor [Congregibacter lit...  79.0    3e-13
ref|NP_638365.1|  translocation protein TolB [Xanthomonas camp...  78.6    4e-13 Gene info
ref|YP_001973407.1|  putative tolB protein precursor [Stenotro...  78.2    5e-13 Gene info
ref|NP_899779.1|  translocation protein TolB [Chromobacterium ...  77.8    6e-13 Gene info
ref|ZP_01167776.1|  TolB, N-terminal:TolB, N-terminal [Oceanos...  77.8    6e-13
ref|YP_971737.1|  TolB domain-containing protein [Acidovorax a...  77.8    6e-13 Gene info
ref|ZP_01617471.1|  translocation protein TolB precursor [mari...  77.8    7e-13
ref|NP_643450.1|  translocation protein TolB [Xanthomonas axon...  77.4    9e-13 Gene info
ref|YP_003262437.1|  Tol-Pal system beta propeller repeat prot...  77.0    9e-13 Gene info
ref|ZP_02244190.1|  translocation protein TolB [Xanthomonas or...  77.0    1e-12
ref|ZP_00374719.1|  tolB protein, putative [Wolbachia endosymb...  77.0    1e-12
ref|ZP_05133430.1|  Tol-Pal system beta propeller repeat prote...  76.6    2e-12
ref|ZP_01915984.1|  translocation protein TolB precursor [Limn...  76.3    2e-12
ref|YP_858094.1|  beta-propeller repeat-containing to-pal syst...  76.3    2e-12 Gene info
ref|NP_965870.1|  translocation protein TolB [Wolbachia endosy...  75.9    2e-12 Gene info
ref|YP_931921.1|  translocation protein TolB [Azoarcus sp. BH7...  75.9    2e-12 Gene info
ref|ZP_04831939.1|  Tol-Pal system beta propeller repeat prote...  75.9    2e-12
ref|ZP_01314250.1|  hypothetical protein Wendoof_01000957 [Wol...  75.9    3e-12
ref|ZP_00373533.1|  tolB protein, putative [Wolbachia endosymb...  75.9    3e-12
ref|YP_002514296.1|  hypothetical protein Tgr7_2229 [Thioalkal...  75.9    3e-12 Gene info
ref|YP_003074764.1|  Tol-Pal system beta propeller repeat prot...  75.9    3e-12 Gene info
ref|ZP_03788116.1|  translocation protein TolB precursor [Wolb...  75.5    3e-12
ref|ZP_03690289.1|  Tol-Pal system beta propeller repeat prote...  75.1    4e-12
ref|YP_001140655.1|  periplasmic component of the Tol biopolym...  75.1    4e-12 Gene info
gb|AAC44597.1|  TolB [Haemophilus influenzae]                      74.7    5e-12
ref|ZP_01790331.1|  translocation protein TolB precursor [Haem...  74.7    6e-12
ref|ZP_05095706.1|  Tol-Pal system beta propeller repeat prote...  74.7    6e-12
ref|YP_315964.1|  translocation protein TolB [Thiobacillus den...  73.9    9e-12 Gene info
ref|YP_903740.1|  TolB domain-containing protein [Candidatus R...  73.9    1e-11 Gene info
ref|ZP_01220135.1|  translocation protein TolB precursor [Phot...  73.9    1e-11
ref|YP_130731.1|  translocation protein TolB [Photobacterium p...  73.6    1e-11 Gene info
ref|ZP_01312699.1|  TolB-like [Desulfuromonas acetoxidans DSM ...  73.2    1e-11
ref|ZP_01795920.1|  translocation protein TolB precursor [Haem...  73.2    1e-11
ref|YP_358380.1|  TolB protein [Pelobacter carbinolicus DSM 23...  73.2    2e-11 Gene info
ref|YP_001020543.1|  TolB protein precursor, periplasmic compo...  72.8    2e-11 Gene info
ref|ZP_01892889.1|  Periplasmic component of the Tol biopolyme...  72.8    2e-11
ref|ZP_05877800.1|  TolB protein precursor [Vibrio furnissii C...  72.8    2e-11
ref|YP_002263294.1|  translocation protein TolB [Aliivibrio sa...  72.4    3e-11 Gene info
ref|ZP_01792019.1|  translocation protein TolB precursor [Haem...  72.0    4e-11
ref|YP_003169393.1|  Tol-Pal system beta propeller repeat prot...  71.6    4e-11 Gene info
ref|YP_248097.1|  translocation protein TolB [Haemophilus infl...  71.6    4e-11 Gene info
ref|ZP_05850147.1|  tol-Pal system beta propeller repeat prote...  71.6    4e-11
ref|NP_438543.1|  translocation protein TolB [Haemophilus infl...  71.6    4e-11 GeoGene info
ref|ZP_00156218.2|  COG0823: Periplasmic component of the Tol ...  71.6    5e-11
ref|ZP_00155385.2|  COG0823: Periplasmic component of the Tol ...  71.2    5e-11
ref|ZP_05498260.1|  Tol-Pal system beta propeller repeat prote...  71.2    6e-11
ref|ZP_06181742.1|  translocation protein TolB precursor [Vibr...  71.2    6e-11
ref|NP_797439.1|  translocation protein TolB [Vibrio parahaemo...  71.2    6e-11 Gene info
ref|ZP_05881443.1|  TolB protein precursor [Vibrio metschnikov...  71.2    7e-11
ref|ZP_06033685.1|  TolB protein precursor [Vibrio mimicus VM2...  70.9    7e-11
ref|ZP_01814019.1|  translocation protein TolB precursor [Vibr...  70.9    7e-11
ref|ZP_03560719.1|  Periplasmic component of the Tol biopolyme...  70.9    8e-11
ref|ZP_04466577.1|  translocation protein TolB [Haemophilus in...  70.9    8e-11
ref|ZP_01786228.1|  translocation protein TolB precursor [Haem...  70.9    9e-11
ref|YP_001292340.1|  translocation protein TolB [Haemophilus i...  70.5    9e-11 Gene info
ref|YP_001345078.1|  translocation protein TolB [Actinobacillu...  70.5    1e-10 Gene info
ref|ZP_04561202.1|  translocation protein TolB [Citrobacter sp...  70.5    1e-10
ref|NP_231470.1|  translocation protein TolB [Vibrio cholerae ...  70.5    1e-10 Gene info
ref|YP_001219316.1|  biopolymer transport protein TolB [Candid...  70.5    1e-10 Gene info
ref|ZP_01678914.1|  tolB protein [Vibrio cholerae 2740-80] >gb...  70.5    1e-10
ref|ZP_05919398.1|  tol-Pal system beta propeller repeat prote...  70.1    1e-10
ref|ZP_03806446.1|  hypothetical protein PROPEN_04851 [Proteus...  70.1    1e-10
ref|ZP_04887422.1|  putative TolB protein [Burkholderia pseudo...  70.1    1e-10
ref|ZP_01973134.1|  tolB protein [Vibrio cholerae NCTC 8457] >...  70.1    1e-10
ref|ZP_03835926.2|  hypothetical protein CIT292_01743 [Citroba...  70.1    1e-10
ref|YP_002636365.1|  translocation protein TolB precursor [Sal...  69.7    2e-10 Gene info
ref|ZP_01794316.1|  translocation protein TolB precursor [Haem...  69.7    2e-10
ref|YP_001453953.1|  translocation protein TolB [Citrobacter k...  69.7    2e-10 Gene info
ref|YP_001438681.1|  translocation protein TolB [Enterobacter ...  69.7    2e-10 Gene info
ref|ZP_03699243.1|  Tol-Pal system beta propeller repeat prote...  69.7    2e-10
ref|YP_001588983.1|  translocation protein TolB [Salmonella en...  69.7    2e-10 Gene info
ref|YP_001571202.1|  translocation protein TolB [Salmonella en...  69.7    2e-10 Gene info
ref|YP_002918510.1|  translocation protein TolB precursor [Kle...  69.7    2e-10 Gene info
ref|ZP_02356835.1|  translocation protein TolB [Burkholderia o...  69.7    2e-10
ref|ZP_01788363.1|  translocation protein TolB precursor [Haem...  69.3    2e-10
ref|YP_002980701.1|  Tol-Pal system beta propeller repeat prot...  69.3    2e-10 Gene info
ref|ZP_01784541.1|  translocation protein TolB precursor [Haem...  69.3    2e-10
ref|ZP_05716449.1|  translocation protein TolB precursor [Vibr...  69.3    2e-10
ref|YP_002155723.1|  Tol-Pal system beta propeller repeat prot...  68.9    3e-10 Gene info
ref|YP_001028613.1|  translocation protein TolB [Burkholderia ...  68.9    3e-10 Gene info
ref|ZP_05111989.1|  TolB colicin import protein [Legionella dr...  68.9    3e-10
ref|YP_103660.1|  translocation protein TolB [Burkholderia mal...  68.9    3e-10 Gene info
ref|ZP_04923365.1|  Tol-Pal system beta propeller repeat prote...  68.9    3e-10
ref|ZP_03789837.1|  Tol-Pal system beta propeller repeat prote...  68.9    3e-10
ref|YP_109360.1|  translocation protein TolB [Burkholderia pse...  68.9    3e-10 Gene info
ref|ZP_04577145.1|  TolB protein [Oxalobacter formigenes HOxBL...  68.9    3e-10
ref|YP_001060215.1|  translocation protein TolB [Burkholderia ...  68.9    3e-10 Gene info
ref|YP_334628.1|  translocation protein TolB [Burkholderia pse...  68.9    3e-10 Gene info
ref|ZP_02903490.1|  Tol-Pal system beta propeller repeat prote...  68.9    3e-10
ref|YP_992167.1|  translocation protein TolB [Burkholderia mal...  68.9    3e-10 Gene info
ref|ZP_06080737.1|  TolB protein precursor [Vibrio sp. RC586] ...  68.6    3e-10
ref|ZP_00442669.2|  Tol-Pal system beta propeller repeat prote...  68.6    3e-10
ref|ZP_01064816.1|  translocation protein TolB precursor [Vibr...  68.6    3e-10
ref|YP_003209710.1|  Protein tolB [Cronobacter turicensis] >em...  68.6    4e-10 Gene info
ref|YP_204345.1|  translocation protein TolB [Vibrio fischeri ...  68.6    4e-10 Gene info
ref|YP_001155060.1|  translocation protein TolB [Polynucleobac...  68.6    4e-10 Gene info
ref|ZP_05043399.1|  Tol-Pal system beta propeller repeat prote...  68.6    4e-10
ref|ZP_05926187.1|  TolB protein precursor [Vibrio sp. RC341] ...  68.6    4e-10
ref|YP_215739.1|  translocation protein TolB [Salmonella enter...  68.6    4e-10 Gene info
ref|ZP_02464577.1|  translocation protein TolB [Burkholderia t...  68.6    4e-10
ref|YP_844888.1|  TolB domain-containing protein [Syntrophobac...  68.2    4e-10 Gene info
ref|ZP_03344645.1|  translocation protein TolB [Salmonella ent...  68.2    5e-10
ref|ZP_02062630.1|  Tol-Pal system beta propeller repeat prote...  68.2    5e-10
ref|ZP_01125809.1|  TolB [Nitrococcus mobilis Nb-231] >gb|EAR2...  68.2    5e-10
ref|YP_001764069.1|  translocation protein TolB [Burkholderia ...  68.2    5e-10 Gene info
ref|ZP_02959681.1|  hypothetical protein PROSTU_01566 [Provide...  68.2    5e-10
ref|ZP_01739350.1|  translocation protein TolB precursor [Mari...  68.2    5e-10
ref|NP_459733.1|  translocation protein TolB [Salmonella typhi...  67.8    6e-10 Gene info
ref|ZP_02387497.1|  translocation protein TolB [Burkholderia t...  67.8    7e-10
ref|ZP_02373637.1|  translocation protein TolB [Burkholderia t...  67.8    7e-10
ref|YP_620202.1|  translocation protein TolB [Burkholderia cen...  67.8    7e-10 Gene info
ref|ZP_00943225.1|  TolB protein [Ralstonia solanacearum UW551...  67.8    7e-10
ref|YP_834446.1|  translocation protein TolB [Burkholderia cen...  67.8    7e-10 Gene info
ref|YP_001100659.1|  TolB periplasmic protein precursor [Hermi...  67.4    8e-10 Gene info
ref|YP_002256583.1|  protein tolb precursor [Ralstonia solanac...  67.4    8e-10 Gene info
ref|YP_441919.1|  translocation protein TolB [Burkholderia tha...  67.4    8e-10 Gene info
ref|ZP_00991076.1|  translocation protein TolB precursor [Vibr...  67.4    8e-10
ref|YP_001093653.1|  TolB domain-containing protein [Shewanell...  67.4    8e-10 Gene info
ref|ZP_02533809.1|  TolB [Endoriftia persephone 'Hot96_1+Hot96...  67.4    9e-10
ref|ZP_06053912.1|  TolB protein precursor [Grimontia hollisae...  67.4    9e-10
ref|ZP_05081977.1|  Tol-Pal system beta propeller repeat prote...  67.0    1e-09
ref|YP_002239638.1|  Tol-Pal system beta propeller repeat prot...  67.0    1e-09 Gene info
ref|ZP_06167538.1|  Tol-Pal system beta propeller repeat prote...  67.0    1e-09
ref|YP_002910568.1|  Putative TolB protein [Burkholderia gluma...  67.0    1e-09 Gene info
ref|ZP_01261908.1|  translocation protein TolB precursor [Vibr...  67.0    1e-09
ref|ZP_02348023.1|  tol-Pal system beta propeller repeat prote...  67.0    1e-09
ref|ZP_06068811.1|  tol-Pal system beta propeller repeat prote...  66.6    1e-09
ref|NP_455304.1|  translocation protein TolB [Salmonella enter...  66.6    2e-09 Gene info
ref|NP_761028.1|  translocation protein TolB [Vibrio vulnificu...  66.6    2e-09 Gene info
ref|ZP_05731917.1|  Tol-Pal system beta propeller repeat prote...  66.2    2e-09
ref|YP_001175970.1|  translocation protein TolB [Enterobacter ...  66.2    2e-09 Gene info
ref|YP_095600.1|  TolB colicin import protein [Legionella pneu...  66.2    2e-09 Gene info
ref|NP_935068.1|  translocation protein TolB [Vibrio vulnificu...  66.2    2e-09 Gene info
ref|NP_890772.1|  translocation protein TolB [Bordetella bronc...  66.2    2e-09 Gene info
ref|ZP_01870311.1|  translocation protein TolB precursor [Vibr...  66.2    2e-09
ref|ZP_03841045.1|  TolB protein [Proteus mirabilis ATCC 29906...  66.2    2e-09
ref|NP_881876.1|  translocation protein TolB [Bordetella pertu...  66.2    2e-09 Gene info
ref|YP_001354157.1|  periplasmic component of the Tol biopolym...  66.2    2e-09 Gene info
ref|ZP_04629837.1|  hypothetical protein yberc0001_38250 [Yers...  66.2    2e-09
ref|YP_001981531.1|  tolB protein [Cellvibrio japonicus Ueda10...  66.2    2e-09 Gene info
ref|YP_002150353.1|  TolB protein [Proteus mirabilis HI4320] >...  66.2    2e-09 Gene info
ref|YP_001007120.1|  translocation protein TolB [Yersinia ente...  66.2    2e-09 Gene info
ref|YP_002232312.1|  translocation protein TolB [Burkholderia ...  65.9    2e-09 Gene info
ref|ZP_06177473.1|  translocation protein TolB precursor [Vibr...  65.9    2e-09
gb|EEZ94985.1|  Tol-Pal system beta propeller repeat protein T...  65.9    2e-09
ref|ZP_03320561.1|  hypothetical protein PROVALCAL_03527 [Prov...  65.9    2e-09
ref|YP_692478.1|  tolB protein [Alcanivorax borkumensis SK2] >...  65.9    2e-09 Gene info
ref|ZP_02378661.1|  Tol-Pal system beta propeller repeat prote...  65.9    3e-09
sp|Q0VRJ2.2|TOLB_ALCBS  RecName: Full=Protein tolB; Flags: Pre...  65.5    3e-09
ref|ZP_01985132.1|  Tol-Pal system beta propeller repeat prote...  65.5    3e-09
ref|YP_391168.1|  TolB-like [Thiomicrospira crunogena XCL-2] >...  65.5    3e-09 Gene info
ref|NP_670354.1|  translocation protein TolB [Yersinia pestis ...  65.5    3e-09 Gene info
sp|Q934G6.1|TOLB_DICD3  RecName: Full=Protein tolB; Flags: Pre...  65.5    3e-09
ref|NP_752749.1|  translocation protein TolB [Escherichia coli...  65.5    3e-09 Gene info
ref|ZP_02335608.1|  Tol-Pal system beta propeller repeat prote...  65.5    3e-09
ref|ZP_05118182.1|  Tol-Pal system beta propeller repeat prote...  65.5    3e-09
ref|YP_368132.1|  translocation protein TolB [Burkholderia sp....  65.5    3e-09 Gene info
pdb|1C5K|A  Chain A, The Structure Of Tolb, An Essential Compo...  65.5    4e-09 Related structures
ref|NP_245904.1|  translocation protein TolB [Pasteurella mult...  65.5    4e-09 Gene info
ref|YP_087915.1|  translocation protein TolB [Mannheimia succi...  65.1    4e-09 Gene info
ref|ZP_04634267.1|  hypothetical protein yfred0001_12280 [Yers...  65.1    4e-09
ref|ZP_01235935.1|  translocation protein TolB precursor [Vibr...  65.1    4e-09
ref|ZP_05888040.1|  TolB protein precursor [Vibrio coralliilyt...  65.1    4e-09
ref|YP_001473596.1|  TolB domain-containing protein [Shewanell...  65.1    4e-09 Gene info
ref|NP_885945.1|  translocation protein TolB [Bordetella parap...  65.1    4e-09 Gene info
ref|YP_001349885.1|  translocation protein TolB [Pseudomonas a...  65.1    5e-09 Gene info
ref|NP_249663.1|  translocation protein TolB [Pseudomonas aeru...  65.1    5e-09 Gene info
ref|ZP_01364346.1|  hypothetical protein PaerPA_01001453 [Pseu...  65.1    5e-09
ref|YP_003286538.1|  TolB protein precursor [Vibrio sp. Ex25] ...  64.7    5e-09 Gene info
ref|YP_126800.1|  TolB protein [Legionella pneumophila str. Le...  64.7    5e-09 Gene info
ref|ZP_05722705.1|  Tol-Pal system beta propeller repeat prote...  64.7    5e-09
ref|ZP_01162185.1|  translocation protein TolB precursor [Phot...  64.7    5e-09
sp|Q478F2.2|TOLB_DECAR  RecName: Full=Protein tolB; Flags: Pre...  64.7    6e-09
ref|ZP_01976917.1|  conserved hypothetical protein [Vibrio cho...  64.7    6e-09
ref|ZP_02158485.1|  tolB protein [Shewanella benthica KT99] >g...  64.7    6e-09
ref|ZP_04619143.1|  hypothetical protein yaldo0001_8380 [Yersi...  64.7    6e-09
ref|YP_001629261.1|  translocation protein TolB [Bordetella pe...  64.7    6e-09 Gene info
ref|YP_001783488.1|  beta-propeller repeat-containing to-pal s...  64.7    6e-09 Gene info
ref|YP_287249.1|  translocation protein TolB [Dechloromonas ar...  64.7    6e-09 Gene info
ref|YP_772570.1|  translocation protein TolB [Burkholderia amb...  64.3    6e-09 Gene info
ref|ZP_02892050.1|  Tol-Pal system beta propeller repeat prote...  64.3    7e-09
ref|YP_001580768.1|  translocation protein TolB [Burkholderia ...  64.3    7e-09 Gene info
ref|YP_123853.1|  TolB protein [Legionella pneumophila str. Pa...  64.3    7e-09 Gene info
ref|YP_001250314.1|  TolB colicin import protein [Legionella p...  64.3    8e-09 Gene info
ref|YP_001003783.1|  TolB domain-containing protein [Halorhodo...  64.3    8e-09 Gene info
ref|ZP_05620483.1|  putative TolB periplasmic receptor [Enhydr...  63.9    9e-09
ref|ZP_01216687.1|  TolB protein [Psychromonas sp. CNPT3] >gb|...  63.9    9e-09
ref|YP_407114.1|  translocation protein TolB [Shigella boydii ...  63.9    9e-09 Gene info
ref|ZP_05971137.1|  periplasmic protein involved in the tonb-i...  63.9    9e-09
ref|YP_001879397.1|  tol-Pal system beta propeller repeat prot...  63.9    1e-08 Gene info
ref|NP_706494.2|  translocation protein TolB [Shigella flexner...  63.9    1e-08 Gene info
ref|ZP_06155705.1|  TolB protein precursor [Photobacterium dam...  63.9    1e-08
ref|ZP_03084474.1|  translocation protein TolB [Escherichia co...  63.9    1e-08
ref|YP_003005203.1|  Tol-Pal system beta propeller repeat prot...  63.9    1e-08 Gene info
ref|YP_927961.1|  tolB protein [Shewanella amazonensis SB2B] >...  63.9    1e-08 Gene info
gb|ACI86509.1|  periplasmic protein TolB [Escherichia coli]        63.9    1e-08
ref|YP_001477511.1|  translocation protein TolB [Serratia prot...  63.9    1e-08 Gene info
ref|YP_688154.1|  translocation protein TolB [Shigella flexner...  63.9    1e-08 Gene info
ref|ZP_01115753.1|  TolB [Reinekea sp. MED297] >gb|EAR08238.1|...  63.5    1e-08
ref|YP_002386180.1|  translocation protein TolB [Escherichia c...  63.5    1e-08 Gene info
ref|NP_286468.1|  translocation protein TolB [Escherichia coli...  63.5    1e-08 Gene info
pdb|3IAX|A  Chain A, The Crystal Structure Of The Tolb Box Of ...  63.5    1e-08 Related structures
ref|YP_001898267.1|  Tol-Pal system beta propeller repeat prot...  63.5    1e-08 Gene info
ref|YP_718470.1|  translocation protein TolB [Haemophilus somn...  63.5    1e-08 Gene info
ref|YP_003041789.1|  periplasmic protein involved in the tonb-...  63.5    1e-08 Gene info
ref|YP_002874414.1|  TolB colicin import protein [Pseudomonas ...  63.5    1e-08 Gene info
ref|ZP_04579279.1|  TolB [Oxalobacter formigenes OXCC13] >gb|E...  63.5    1e-08
ref|YP_001797210.1|  Tol-Pal system beta propeller repeat prot...  63.2    1e-08 Gene info
gb|EFA15764.1|  protein TolB, precursor [Serratia odorifera 4R...  63.2    1e-08
ref|YP_003256414.1|  hypothetical protein D11S_1837 [Aggregati...  63.2    1e-08 Gene info
ref|ZP_02195937.1|  translocation protein TolB precursor [Vibr...  63.2    1e-08
ref|YP_002893882.1|  Tol-Pal system beta propeller repeat prot...  63.2    1e-08 Gene info
ref|ZP_04946464.1|  TolB [Burkholderia dolosa AUO158] >gb|EAY6...  63.2    1e-08
ref|YP_002986783.1|  Tol-Pal system beta propeller repeat prot...  63.2    2e-08 Gene info
ref|YP_750152.1|  TolB domain-containing protein [Shewanella f...  63.2    2e-08 Gene info
ref|YP_001118579.1|  translocation protein TolB [Burkholderia ...  63.2    2e-08 Gene info
ref|YP_662501.1|  TolB-like [Pseudoalteromonas atlantica T6c] ...  63.2    2e-08 Gene info
ref|NP_743382.1|  translocation protein TolB [Pseudomonas puti...  63.2    2e-08 Gene info
ref|ZP_05945083.1|  TolB protein precursor [Vibrio orientalis ...  62.8    2e-08
ref|YP_001266596.1|  translocation protein TolB [Pseudomonas p...  62.8    2e-08 Gene info
ref|YP_001670420.1|  translocation protein TolB [Pseudomonas p...  62.8    2e-08 Gene info
ref|ZP_03574046.1|  Tol-Pal system beta propeller repeat prote...  62.8    2e-08
ref|YP_003007784.1|  Tol-Pal system beta propeller repeat prot...  62.4    2e-08 Gene info
ref|YP_787410.1|  TolB protein [Bordetella avium 197N] >sp|Q2K...  62.4    2e-08 Gene info
ref|YP_001334417.1|  translocation protein TolB [Klebsiella pn...  62.4    3e-08 Gene info
sp|Q3K7W5.2|TOLB_PSEPF  RecName: Full=Protein tolB; Flags: Pre...  62.4    3e-08
ref|YP_001761102.1|  beta-propeller repeat-containing to-pal s...  62.0    3e-08 Gene info
ref|ZP_01451343.1|  translocation protein TolB precursor [Mari...  62.0    3e-08
ref|ZP_05360656.1|  Tol-Pal system beta propeller repeat prote...  62.0    3e-08
ref|ZP_02477799.1|  Dna-J like membrane chaperone protein [Hae...  62.0    3e-08
ref|YP_942178.1|  TolB domain-containing protein [Psychromonas...  62.0    4e-08 Gene info
ref|NP_518856.1|  translocation protein TolB [Ralstonia solana...  62.0    4e-08 Gene info
ref|ZP_06124557.1|  translocation protein TolB [Providencia re...  61.6    4e-08
ref|YP_350130.1|  translocation protein TolB [Pseudomonas fluo...  61.6    4e-08 Gene info
ref|NP_793736.1|  translocation protein TolB [Pseudomonas syri...  61.6    5e-08 Gene info
ref|ZP_01135945.1|  outer membrane protein [Pseudoalteromonas ...  61.6    5e-08
ref|ZP_02882496.1|  Tol-Pal system beta propeller repeat prote...  61.6    5e-08
ref|YP_001377900.1|  TolB domain-containing protein [Anaeromyx...  61.6    5e-08 Gene info
ref|ZP_05641045.1|  translocation protein TolB [Pseudomonas sy...  61.6    5e-08
ref|ZP_04626174.1|  hypothetical protein ykris0001_32600 [Yers...  61.2    5e-08
ref|YP_275907.1|  translocation protein TolB [Pseudomonas syri...  61.2    5e-08 Gene info
ref|YP_001673916.1|  beta-propeller repeat-containing to-pal s...  61.2    6e-08 Gene info
ref|YP_001858674.1|  beta-propeller repeat-containing to-pal s...  61.2    6e-08 Gene info
ref|YP_557129.1|  translocation protein TolB [Burkholderia xen...  60.8    7e-08 Gene info
ref|YP_002800786.1|  Beta propeller TolB [Azotobacter vineland...  60.8    7e-08 Gene info
ref|YP_402365.1|  translocation protein TolB [Shigella dysente...  60.8    8e-08 Gene info
ref|YP_002126974.1|  Periplasmic component of the Tol biopolym...  60.8    8e-08 Gene info
ref|YP_001502419.1|  beta-propeller repeat-containing to-pal s...  60.8    8e-08 Gene info
ref|YP_001750842.1|  translocation protein TolB [Pseudomonas p...  60.5    9e-08 Gene info
ref|YP_234504.1|  translocation protein TolB [Pseudomonas syri...  60.5    9e-08 Gene info
ref|YP_001444807.1|  translocation protein TolB [Vibrio harvey...  60.5    1e-07 Gene info
ref|YP_002006314.1|  translocation protein TolB [Cupriavidus t...  60.1    1e-07 Gene info
ref|ZP_03397330.1|  translocation protein TolB [Pseudomonas sy...  60.1    2e-07
ref|YP_609565.1|  translocation protein TolB [Pseudomonas ento...  59.7    2e-07 Gene info
ref|YP_963793.1|  TolB domain-containing protein [Shewanella s...  59.7    2e-07 Gene info
ref|YP_003296619.1|  translocation protein [Edwardsiella tarda...  59.7    2e-07 Gene info
ref|YP_584817.1|  translocation protein TolB [Ralstonia metall...  59.7    2e-07 Gene info
emb|CAI78611.1|  tolB protein [uncultured delta proteobacterium]   59.7    2e-07
ref|YP_001894406.1|  translocation protein TolB [Burkholderia ...  59.3    2e-07 Gene info
ref|YP_002923087.1|  tol protein B [Candidatus Hamiltonella de...  59.3    2e-07 Gene info
ref|ZP_04588687.1|  translocation protein TolB [Pseudomonas sy...  59.3    2e-07
ref|ZP_03266458.1|  Tol-Pal system beta propeller repeat prote...  59.3    2e-07
ref|YP_001186774.1|  translocation protein TolB [Pseudomonas m...  59.3    3e-07 Gene info
ref|NP_871415.1|  hypothetical protein WGLp412 [Wigglesworthia...  58.9    3e-07 Gene info
ref|YP_155469.1|  periplasmic component of the Tol biopolymer ...  58.9    3e-07 Gene info
ref|YP_002934253.1|  Tol-Pal system beta propeller repeat prot...  58.9    3e-07 Gene info
ref|YP_001530091.1|  beta-propeller repeat-containing to-pal s...  58.9    3e-07 Gene info
ref|ZP_06061936.1|  tol-Pal system beta propeller repeat prote...  58.9    3e-07
ref|NP_967192.1|  adventurous gliding motility protein W [Bdel...  58.5    4e-07 Gene info
ref|YP_002474726.1|  dna-J like membrane chaperone, translocat...  58.5    4e-07 Gene info
pdb|2HQS|A  Chain A, Crystal Structure Of TolbPAL COMPLEX >pdb...  58.5    4e-07 Related structures
pdb|2W8B|A  Chain A, Crystal Structure Of Processed Tolb In Co...  58.5    4e-07 Related structures
ref|ZP_04716497.1|  Periplasmic component of the Tol biopolyme...  58.5    4e-07
pdb|2W8B|B  Chain B, Crystal Structure Of Processed Tolb In Co...  58.2    5e-07 Related structures
ref|YP_002383478.1|  translocation protein TolB [Escherichia f...  58.2    5e-07 Gene info
ref|YP_261839.1|  translocation protein TolB [Pseudomonas fluo...  57.8    6e-07 Gene info
pdb|1CRZ|A  Chain A, Crystal Structure Of The E. Coli Tolb Pro...  57.8    6e-07 Related structures
ref|NP_878630.1|  tolB protein precursor [Candidatus Blochmann...  57.8    6e-07 Gene info
ref|ZP_06066401.1|  tol-Pal system beta propeller repeat prote...  57.8    6e-07
ref|ZP_03831580.1|  translocation protein TolB [Pectobacterium...  57.8    7e-07
ref|YP_002311182.1|  TolB protein [Shewanella piezotolerans WP...  57.8    7e-07 Gene info
ref|YP_264537.1|  TolB periplasmic receptor [Psychrobacter arc...  57.8    7e-07 Gene info
ref|NP_928751.1|  translocation protein TolB [Photorhabdus lum...  57.8    7e-07 Gene info
ref|YP_295019.1|  translocation protein TolB [Ralstonia eutrop...  57.8    7e-07 Gene info
ref|YP_001953693.1|  Tol-Pal system beta propeller repeat prot...  57.8    7e-07 Gene info
ref|ZP_05705981.1|  TolB protein [Cardiobacterium hominis ATCC...  57.0    1e-06
ref|ZP_03828573.1|  translocation protein TolB [Pectobacterium...  57.0    1e-06
ref|YP_454566.1|  translocation protein TolB [Sodalis glossini...  57.0    1e-06 Gene info
ref|YP_277848.1|  hypothetical protein BPEN_348 [Candidatus Bl...  57.0    1e-06 Gene info
ref|YP_727274.1|  translocation protein TolB [Ralstonia eutrop...  57.0    1e-06 Gene info
ref|YP_001050124.1|  TolB domain-containing protein [Shewanell...  56.6    1e-06 Gene info
ref|YP_003016833.1|  Tol-Pal system beta propeller repeat prot...  56.6    1e-06 Gene info
ref|ZP_04978681.1|  TonB family auxiliary protein TolB [Mannhe...  56.6    1e-06
ref|YP_002649426.1|  Protein TolB (Translocation of group A co...  56.6    1e-06 Gene info
ref|YP_001908217.1|  translocation protein TolB [Erwinia tasma...  56.6    1e-06 Gene info
ref|YP_049479.1|  translocation protein TolB [Pectobacterium a...  56.6    2e-06 Gene info
ref|YP_003260436.1|  Tol-Pal system beta propeller repeat prot...  56.6    2e-06 Gene info
ref|YP_002358455.1|  Tol-Pal system beta propeller repeat prot...  56.2    2e-06 Gene info
ref|ZP_05989953.1|  TonB family auxiliary protein TolB [Mannhe...  56.2    2e-06
ref|NP_718332.1|  tolB protein [Shewanella oneidensis MR-1] >s...  56.2    2e-06 Gene info
ref|YP_340384.1|  required for outer membrane integrity, uptak...  56.2    2e-06 Gene info
ref|YP_580398.1|  TolB-like [Psychrobacter cryohalolentis K5] ...  56.2    2e-06 Gene info
ref|ZP_04617340.1|  hypothetical protein yruck0001_31470 [Yers...  56.2    2e-06
ref|YP_870164.1|  TolB domain-containing protein [Shewanella s...  55.8    3e-06 Gene info
ref|YP_003147028.1|  Tol-Pal system beta propeller repeat prot...  55.8    3e-06 Gene info
ref|YP_001365948.1|  beta-propeller repeat-containing to-pal s...  55.5    3e-06 Gene info
ref|YP_001554216.1|  beta-propeller repeat-containing to-pal s...  55.5    3e-06 Gene info
ref|ZP_04752928.1|  translocation protein TolB precursor [Acti...  55.5    4e-06
ref|ZP_04641224.1|  hypothetical protein ymoll0001_12380 [Yers...  55.1    4e-06
ref|ZP_04613610.1|  hypothetical protein yrohd0001_550 [Yersin...  54.7    6e-06
ref|ZP_04637517.1|  hypothetical protein yinte0001_25120 [Yers...  54.7    6e-06
ref|YP_734496.1|  TolB domain-containing protein [Shewanella s...  54.7    6e-06 Gene info
ref|YP_902973.1|  WD40 domain-containing protein [Pelobacter p...  54.7    6e-06 Gene info
ref|ZP_03353713.1|  translocation protein TolB [Salmonella ent...  54.3    7e-06
emb|CAI78812.3|  TolB protein [uncultured candidate division W...  54.3    7e-06
ref|YP_001173291.1|  translocation protein TolB [Pseudomonas s...  54.3    8e-06 Gene info
ref|ZP_05825639.1|  tolerance to colicins E2 [Acinetobacter sp...  53.9    9e-06
ref|ZP_03379799.1|  translocation protein TolB [Salmonella ent...  53.9    9e-06
ref|YP_562403.1|  TolB-like protein [Shewanella denitrificans ...  53.9    1e-05 Gene info
ref|NP_874138.1|  colicin tolerance protein [Haemophilus ducre...  53.5    1e-05 Gene info
ref|ZP_06055937.1|  tolerance protein to colicins E2 [Acinetob...  53.5    1e-05
ref|YP_001706450.1|  tolerance to colicins E2, E, A, and K, re...  53.5    1e-05 Gene info
ref|ZP_05828760.1|  tol-Pal system beta propeller repeat prote...  53.5    1e-05
ref|YP_002218537.1|  Tol-Pal system beta propeller repeat prot...  52.8    2e-05 Gene info
gb|ABO13011.2|  tolerance to colicins E2 E, A, and K [Acinetob...  52.8    2e-05 Gene info
ref|ZP_03822581.1|  protein TolB precursor [Acinetobacter sp. ...  52.8    2e-05
ref|YP_002604303.1|  AglW [Desulfobacterium autotrophicum HRM2...  52.4    3e-05 Gene info
ref|YP_001596058.1|  TolB protein [Coxiella burnetii RSA 331] ...  52.0    3e-05 Gene info
ref|YP_001425326.2|  TolB [Coxiella burnetii Dugway 5J108-111]...  52.0    4e-05 Gene info
ref|YP_001085613.1|  tolerance to colicins E2 E, A, and K [Aci...  52.0    4e-05 Gene info
ref|YP_047202.1|  tolerance to colicins E2, E, A, and K, requi...  52.0    4e-05 Gene info
ref|YP_002491115.1|  TolB domain protein [Anaeromyxobacter deh...  51.6    5e-05 Gene info
ref|ZP_05629392.1|  translocation protein TolB [Actinobacillus...  51.2    6e-05
ref|ZP_01945963.1|  TolB protein [Coxiella burnetii 'MSU Goat ...  51.2    6e-05
ref|YP_002306218.1|  TolB [Coxiella burnetii CbuK_Q154] >gb|AC...  51.2    7e-05 Gene info
ref|YP_463872.1|  TolB-like protein [Anaeromyxobacter dehaloge...  50.8    7e-05 Gene info
ref|YP_002797159.1|  TolB [Laribacter hongkongensis HLHK9] >gb...  50.8    8e-05 Gene info
ref|YP_001651353.1|  colicin tolerance protein [Actinobacillus...  50.8    9e-05 Gene info
ref|ZP_00133958.2|  COG0823: Periplasmic component of the Tol ...  50.8    9e-05
ref|YP_002133061.1|  TolB domain protein [Anaeromyxobacter sp....  50.8    9e-05 Gene info
ref|ZP_02218507.1|  TolB protein [Coxiella burnetii RSA 334] >...  50.4    1e-04
ref|ZP_04754840.1|  group A colicin translocation; TolB protei...  48.5    4e-04
ref|ZP_05248523.1|  TolB protein [Francisella philomiragia sub...  48.5    4e-04
ref|YP_268469.1|  tolB protein [Colwellia psychrerythraea 34H]...  48.1    6e-04 Gene info
ref|YP_001677187.1|  group A colicin translocation; TolB prote...  47.8    8e-04 Gene info
ref|NP_951087.1|  tolB protein [Geobacter sulfurreducens PCA] ...  47.4    8e-04 Gene info
ref|ZP_01899198.1|  Periplasmic component of the Tol biopolyme...  47.0    0.001
ref|YP_001891239.1|  group A colicin translocation; tolB prote...  46.6    0.001 Gene info
ref|YP_001122227.1|  beta propeller repeat-containing outer me...  46.6    0.002 Gene info
ref|ZP_03665503.1|  TolB protein precursor [Francisella tulare...  46.6    0.002
ref|YP_386470.1|  WD-40-like beta propeller repeat-containing ...  46.6    0.002 Gene info
ref|YP_898015.1|  group A colicin translocation; tolB protein ...  46.6    0.002 Gene info
ref|YP_169845.1|  TolB protein precursor [Francisella tularens...  46.6    0.002 Gene info
ref|ZP_03247758.1|  TolB amino- domain family protein [Francis...  46.6    0.002
ref|ZP_04989292.1|  TolB protein precursor [Francisella novici...  46.6    0.002
ref|ZP_04987826.1|  TolB protein precursor [Francisella tulare...  46.2    0.002
ref|YP_003248293.1|  TolB domain protein [Fibrobacter succinog...  46.2    0.002 Gene info
gb|AAW50014.1|  hypothetical protein FTT0840 [synthetic constr...  46.2    0.002
sp|Q2LRP7.2|TOLB_SYNAS  RecName: Full=Protein tolB; Flags: Pre...  45.1    0.005
ref|YP_460922.1|  tolB protein [Syntrophus aciditrophicus SB] ...  44.7    0.005 Gene info
ref|ZP_01978930.1|  tolB protein [Vibrio cholerae MZO-2] >gb|E...  43.9    0.009
ref|ZP_01291310.1|  WD40-like Beta Propeller [delta proteobact...  43.9    0.009
ref|YP_001228992.1|  WD40 domain-containing protein [Geobacter...  43.5    0.013 Gene info
ref|YP_513122.1|  TolB protein precursor [Francisella tularens...  43.1    0.016 Gene info
ref|ZP_02274143.1|  TolB protein precursor [Francisella tulare...  43.1    0.017
ref|ZP_04985048.1|  protein tolB precursor [Francisella tulare...  43.1    0.017
ref|ZP_01044391.1|  Periplasmic component of the Tol biopolyme...  42.7    0.020
ref|ZP_03343290.1|  translocation protein TolB [Salmonella ent...  41.6    0.046
ref|ZP_05312590.1|  Tol-Pal system beta propeller repeat prote...  41.2    0.071
ref|YP_002140302.1|  Tol-Pal system beta propeller repeat prot...  40.0    0.14  Gene info
ref|YP_595067.1|  periplasmic component of the Tol biopolymer ...  39.3    0.25  Gene info
ref|YP_003023361.1|  Tol-Pal system beta propeller repeat prot...  38.9    0.28  Gene info
ref|ZP_05292200.1|  tolB protein precursor, periplasmic protei...  38.5    0.42 
ref|ZP_03404647.1|  translocation protein TolB [Salmonella ent...  38.1    0.50 
ref|YP_001876166.1|  WD40 domain-containing protein [Elusimicr...  38.1    0.60  Gene info
ref|YP_001968101.1|  Protein tolB precursor [Actinobacillus pl...  38.1    0.61  Gene info
ref|YP_002536560.1|  Tol-Pal system beta propeller repeat prot...  37.7    0.70  Gene info
ref|XP_002543355.1|  glutathione-disulfide reductase [Uncinoca...  37.7    0.72  Gene info
ref|YP_001280460.1|  WD40 domain-containing protein [Psychroba...  37.7    0.79  Gene info
ref|ZP_03401708.1|  translocation protein TolB [Salmonella ent...  37.4    0.94 
ref|YP_001960110.1|  WD40 domain protein beta Propeller [Chlor...  37.0    1.1   Gene info
ref|ZP_05292119.1|  tolB protein precursor, periplasmic protei...  37.0    1.3  
ref|ZP_04607993.1|  formamidopyrimidine-DNA glycosylase [Micro...  36.6    1.5  
ref|ZP_02363154.1|  Rhs element Vgr protein, putative [Burkhol...  36.6    1.8  
ref|YP_001942807.1|  Tol-Pal system beta propeller repeat prot...  36.2    2.1   Gene info
ref|YP_002753636.1|  tolB protein, putative [Acidobacterium ca...  36.2    2.1   Gene info
ref|XP_001272573.1|  phosphomannomutase (Sec53), putative [Asp...  35.8    2.9   Gene info
ref|YP_003128143.1|  aminotransferase class I and II [Methanoc...  35.8    3.0   Gene info
ref|NP_246964.1|  aspartate aminotransferase (aspB1) [Methanoc...  35.8    3.0   Gene info
ref|YP_003264667.1|  WD40 domain protein beta Propeller [Halia...  35.4    3.5   Gene info
ref|XP_001257775.1|  phosphomannomutase (Sec53), putative [Neo...  35.4    3.9   Gene info
ref|XP_002194322.1|  PREDICTED: DNA primase polypeptide 2 [Tae...  35.0    4.1   UniGene infoGene info
ref|NP_001012898.1|  DNA primase polypeptide 2 [Gallus gallus]...  35.0    5.2   UniGene infoGene info
ref|XP_001216058.1|  phosphomannomutase [Aspergillus terreus N...  34.7    5.5   Gene info
ref|YP_001966686.1|  putative membrane protein [Bacillus cereu...  34.7    5.7   Gene info
ref|YP_001137442.1|  hypothetical protein cgR_0572 [Corynebact...  34.3    7.3   Gene info
ref|ZP_04087567.1|  hypothetical protein bthur0011_52710 [Baci...  34.3    7.7  
sp|Q95K52.1|ZN283_MACFA  RecName: Full=Zinc finger protein 283...  34.3    9.0  


Alignments 


>ref|ZP_05069250.1|  Tol-Pal system beta propeller repeat protein TolB [Candidatus 
Pelagibacter sp. HTCC7211]
 gb|EDZ60249.1|  Tol-Pal system beta propeller repeat protein TolB [Candidatus 
Pelagibacter sp. HTCC7211]
Length=447

 Score =  256 bits (655),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/204 (61%), Positives = 159/204 (77%), Gaps = 6/204 (2%)

Query  1    MKKNLFLIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSIN  60
            MKK L  IF    +I P   F+L+E+DITRGNL+P+P++VSP   +E++K     +L   
Sbjct  1    MKKKL--IFICLFLIIPIKAFALIEVDITRGNLNPLPLAVSPLSIDENSKKSFEKILDKE  58

Query  61   NLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYK  120
            N+G EIS ++ENNL  +GLF+ ++K+AFLQ PDIA+LKPRFEDW LIK++ LITGKV Y 
Sbjct  59   NIGSEISIIVENNLRTSGLFNPLNKDAFLQAPDIANLKPRFEDWNLIKAQALITGKVAY-  117

Query  121  IIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTR  180
             ID+K  +++EF+LWD+L  K +   + TTVP+NWRRVGH ISDK+YERLTGE GYFDTR
Sbjct  118  -IDEK--LRVEFRLWDVLAGKEMMALAFTTVPNNWRRVGHIISDKIYERLTGEKGYFDTR  174

Query  181  IIYVAEEGPKTQRVKKLAIMDQDG  204
            IIYVAEEGPKTQR KKLAIMDQDG
Sbjct  175  IIYVAEEGPKTQRKKKLAIMDQDG  198


>ref|YP_266021.1| Gene info translocation protein TolB [Candidatus Pelagibacter ubique HTCC1062]
 ref|ZP_01264233.1|  translocation protein TolB precursor [Candidatus Pelagibacter 
ubique HTCC1002]
 sp|Q4FN21.1|TOLB_PELUB Gene info RecName: Full=Protein tolB; Flags: Precursor
 gb|AAZ21418.1| Gene info tolB protein [Candidatus Pelagibacter ubique HTCC1062]
 gb|EAS84720.1|  translocation protein TolB precursor [Candidatus Pelagibacter 
ubique HTCC1002]
Length=446

 GENE ID: 3517109 tolB | translocation protein TolB
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  252 bits (643),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 153/186 (82%), Gaps = 4/186 (2%)

Query  20   CFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGL  79
             F+L+E+DITRGNL+P+P++VSP   +  +K+    +L   +LG EIS V+ENNL ++GL
Sbjct  17   AFALIEVDITRGNLNPLPVAVSPLSIDNKSKENFKKILKQEDLGSEISIVVENNLRQSGL  76

Query  80   FDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILG  139
            F+ +DK AFLQ+PD+A+LKPRFEDW LIK++ L+TGKVT+  +D+K  +++EF+LWD+L 
Sbjct  77   FNPLDKNAFLQEPDVANLKPRFEDWNLIKAQALVTGKVTF--VDEK--LRVEFRLWDVLA  132

Query  140  AKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQRVKKLAI  199
             K +   + TTVPSNWRRVGH I+DKVYERLTGE GYFDTRIIYV+EEGPKT+R+KKLAI
Sbjct  133  GKEMMALAFTTVPSNWRRVGHIITDKVYERLTGEKGYFDTRIIYVSEEGPKTKRIKKLAI  192

Query  200  MDQDGF  205
            MDQDGF
Sbjct  193  MDQDGF  198


>ref|ZP_06055283.1|  Tol-Pal system beta propeller repeat protein TolB [alpha proteobacterium 
HIMB114]
 gb|EEY75052.1|  Tol-Pal system beta propeller repeat protein TolB [alpha proteobacterium 
HIMB114]
Length=445

 Score =  218 bits (556),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 149/204 (73%), Gaps = 8/204 (3%)

Query  1    MKKNLFLIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSIN  60
            MKK L  +F I    K    F++V IDITRGNL+P+P ++S F+   D  +K +  +   
Sbjct  1    MKKILVTLFLILFTSK---SFAVVTIDITRGNLEPLPTAISNFYI--DNPEKFSEKIKSL  55

Query  61   NLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYK  120
             L   + KVI+ NL ++GLF  +D ++++Q+P ++HLKPRFEDW LIK++++++GK+   
Sbjct  56   KLEENLPKVIKGNLMRSGLFYVLDNKSYIQQPKLSHLKPRFEDWRLIKAQIMVSGKLR--  113

Query  121  IIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTR  180
             ID+K  +++EF+LWD++ AK ++G +L   PS+WRR+ H ISDK+Y+RLTGE GYFDTR
Sbjct  114  -IDEKGRLRVEFRLWDVVSAKEIEGLALFATPSSWRRIAHIISDKIYQRLTGEEGYFDTR  172

Query  181  IIYVAEEGPKTQRVKKLAIMDQDG  204
            IIYVAE GPKTQR KKLAIMDQDG
Sbjct  173  IIYVAESGPKTQREKKLAIMDQDG  196


>ref|YP_001413393.1| Gene info beta-propeller repeat-containing to-pal system protein TolB [Parvibaculum 
lavamentivorans DS-1]
 sp|A7HV03.1|TOLB_PARL1 Gene info RecName: Full=Protein tolB; Flags: Precursor
 gb|ABS63736.1| Gene info Tol-Pal system beta propeller repeat TolB [Parvibaculum lavamentivorans 
DS-1]
Length=446

 GENE ID: 5455208 Plav_2122 | beta-propeller repeat-containing to-pal system
protein TolB [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score =  181 bits (460),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 126/191 (65%), Gaps = 21/191 (10%)

Query  19   ICFSL-----VEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENN  73
            + F+L     ++IDIT+GN+DP+PI+++ F                 ++G ++S VI NN
Sbjct  28   VAFALPARAALQIDITQGNVDPLPIAITDFVGE-------------GSVGADMSAVISNN  74

Query  74   LEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFK  133
            LE++GLF  + K +F++K    +++PRF DW +I S+ L+TG+     ++    +++EF+
Sbjct  75   LERSGLFRPLPKASFIEKVSDINVQPRFGDWRVINSQALVTGQTR---MEADGRLRVEFR  131

Query  134  LWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQR  193
            LWD+LG + + G    T P NWRRV H ISD +Y+RLTGE GYFDTRI+YV+E GPK  R
Sbjct  132  LWDVLGEQQLTGLQFFTTPDNWRRVAHLISDAIYKRLTGEDGYFDTRIVYVSETGPKNAR  191

Query  194  VKKLAIMDQDG  204
            VK+L IMDQDG
Sbjct  192  VKRLTIMDQDG  202


>ref|YP_002827280.1| Gene info TolB protein precursor [Rhizobium sp. NGR234]
 gb|ACP26527.1| Gene info TolB protein precursor [Rhizobium sp. NGR234]
Length=457

 GENE ID: 7790434 tolB1 | TolB protein precursor [Rhizobium sp. NGR234]
(10 or fewer PubMed links)

 Score =  180 bits (456),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 132/212 (62%), Gaps = 29/212 (13%)

Query  1    MKKNLF----LIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNV  56
            +++N F    L+F   L   P    ++VEI+I +GN++P+P++++ F   E         
Sbjct  26   LRRNFFRLFTLVFAGVLFAAP--ANAVVEININKGNVEPLPVAITDFLQGE---------  74

Query  57   LSINNLGLEISKVIENNLEKTGLFDAIDKEAFLQK---PDIAHLKPRFEDWALIKSKVLI  113
                 LG +IS V+  +L+++GLF  IDK AF++K   PD A   PRFEDW +I ++ L+
Sbjct  75   -----LGQKISDVVAADLKRSGLFAPIDKGAFIEKIANPDAA---PRFEDWKVINAQALV  126

Query  114  TGKVTYKIIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGE  173
            TG+VT    +    +K EF+LWD    + + G    T P NWRRV H I+D +YER+TGE
Sbjct  127  TGRVTQ---EGDGRLKAEFRLWDTFAGQQMLGQQFYTQPENWRRVAHIIADAIYERITGE  183

Query  174  SGYFDTRIIYVAEEGPKTQRVKKLAIMDQDGF  205
             GYFDTRI+YVAE GPK  R ++LAIMDQDGF
Sbjct  184  KGYFDTRIVYVAESGPKNARKRQLAIMDQDGF  215


>ref|ZP_01545735.1|  translocation protein TolB precursor [Stappia aggregata IAM 12614]
 gb|EAV45664.1|  translocation protein TolB precursor [Stappia aggregata IAM 12614]
Length=260

 Score =  178 bits (452),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 130/202 (64%), Gaps = 13/202 (6%)

Query  3    KNLFLIFFIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNL  62
            + L  +   +++I P    +LVEIDIT+GN++P+PI++ P FS E    K         L
Sbjct  17   RGLAFVLASFVVIAPLPAAALVEIDITQGNIEPLPIAL-PSFSAEGGDGK---------L  66

Query  63   GLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKII  122
              +++ VI  +L+++GLF  +D  +F+QK    +  PRF DW  I ++ L+TG VT K  
Sbjct  67   AADMTNVIAADLKRSGLFRPLDPASFIQKNMSVNSTPRFGDWRQISAQALVTGTVT-KQP  125

Query  123  DDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRII  182
            D +  ++ EF+LWD+  A+ + G    T P NWRR+ H I+D +YERLTGE GYFDTRI+
Sbjct  126  DGR--LRAEFRLWDVFAAEQMLGQQFYTTPDNWRRLAHIIADAIYERLTGEKGYFDTRIV  183

Query  183  YVAEEGPKTQRVKKLAIMDQDG  204
            +V E GPK +RVK+LAIMDQDG
Sbjct  184  FVDETGPKDKRVKRLAIMDQDG  205


>ref|NP_356906.2| Gene info translocation protein TolB [Agrobacterium tumefaciens str. C58]
 sp|Q8U9L4.2|TOLB_AGRT5 Gene info RecName: Full=Protein tolB; Flags: Precursor
 gb|AAK89691.2| Gene info tolB protein [Agrobacterium tumefaciens str. C58]
Length=435

 GENE ID: 1135588 tolB | translocation protein TolB
[Agrobacterium tumefaciens str. C58] (10 or fewer PubMed links)

 Score =  178 bits (451),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 123/186 (66%), Gaps = 16/186 (8%)

Query  20   CFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGL  79
             F+ VEI+I +GN++P+PI+++ F S++              +G ++S VI  +L+++GL
Sbjct  24   AFARVEININKGNVEPLPIAITDFMSSD-------------GIGAQVSAVIAADLQRSGL  70

Query  80   FDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILG  139
            F  ++K AF++K      +PRFEDW +I ++ L+TG+VT    +    ++ EF+LWD   
Sbjct  71   FAPVNKNAFIEKISNPDQQPRFEDWKVINAQALVTGRVTR---ESDGRLRAEFRLWDTFA  127

Query  140  AKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQRVKKLAI  199
             + + G    T P NWRRV H I+D +YER+TGE GYFDTR+++V+E GPKT R ++L+I
Sbjct  128  GQQLSGQQFFTQPENWRRVAHIIADAIYERVTGEKGYFDTRVVFVSESGPKTARKRQLSI  187

Query  200  MDQDGF  205
            MDQDGF
Sbjct  188  MDQDGF  193


>ref|ZP_05113665.1|  Tol-Pal system beta propeller repeat protein TolB [Labrenzia 
alexandrii DFL-11]
 gb|EEE44264.1|  Tol-Pal system beta propeller repeat protein TolB [Labrenzia 
alexandrii DFL-11]
Length=449

 Score =  176 bits (446),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 128/195 (65%), Gaps = 13/195 (6%)

Query  10   FIYLIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKV  69
            F++  + P    +LVEIDIT+GN++P+PI++ P FS E    K         L  +++ V
Sbjct  24   FLFAALTPLPVAALVEIDITQGNVEPLPIAL-PQFSAEGGDSK---------LAADMTAV  73

Query  70   IENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIK  129
            I  +L+++GLF+ +D  +F+QK    +  PRF DW  I ++ L+TG VT K  D +  ++
Sbjct  74   IAADLKRSGLFNPLDPASFIQKNMSVNSTPRFGDWRTISAQALVTGTVT-KQADGR--LR  130

Query  130  IEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGP  189
             EF+LWD+  A+ + G    T P NWRR+ H I+D VYER+TGE GYFDTRI++V E GP
Sbjct  131  AEFRLWDVFAAEQMLGQQFYTTPENWRRLAHIIADAVYERITGEKGYFDTRIVFVDETGP  190

Query  190  KTQRVKKLAIMDQDG  204
            K +RVK+LA+MDQDG
Sbjct  191  KDKRVKRLALMDQDG  205


>ref|ZP_05181511.1|  translocation protein TolB [Brucella sp. 83/13]
 ref|ZP_06097449.1|  tolB [Brucella sp. 83/13]
 gb|EEZ33567.1|  tolB [Brucella sp. 83/13]
Length=443

 Score =  176 bits (445),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 126/199 (63%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGSN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF+LWD  G + + G    T P NWRRV H I+D +YERLTGE GYFDTR+++V 
Sbjct  123  --LKAEFRLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGEKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199


>ref|YP_001369764.1| Gene info translocation protein TolB [Ochrobactrum anthropi ATCC 49188]
 sp|A6WY81.1|TOLB_OCHA4 Gene info RecName: Full=Protein tolB; Flags: Precursor
 gb|ABS13935.1| Gene info Tol-Pal system beta propeller repeat TolB [Ochrobactrum anthropi 
ATCC 49188]
Length=443

 GENE ID: 5379607 tolB | translocation protein TolB
[Ochrobactrum anthropi ATCC 49188]

 Score =  176 bits (445),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 126/199 (63%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGPN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF+LWD  G + + G    T P NWRRV H I+D +YERLTGE GYFDTR+++V 
Sbjct  123  --LKAEFRLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGEKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199

------------------------------------------------------------------------------------------------------


Blastp contre SwissProt, paramètres par défaut au NCBI sauf "Max target sequences" = 100(expected E-value threshold=10)

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q4FN21.1|TOLB_PELUB  RecName: Full=Protein tolB; Flags: Pre...   252    1e-66 Gene info
sp|A7HV03.1|TOLB_PARL1  RecName: Full=Protein tolB; Flags: Pre...   181    2e-45 Gene info
sp|Q8U9L4.2|TOLB_AGRT5  RecName: Full=Protein tolB; Flags: Pre...   178    2e-44 Gene info
sp|A6WY81.1|TOLB_OCHA4  RecName: Full=Protein tolB; Flags: Pre...   176    1e-43 Gene info
sp|Q926C2.1|TOLB_RHIME  RecName: Full=Protein tolB; Flags: Pre...   175    2e-43
sp|Q57BI3.1|TOLB_BRUAB  RecName: Full=Protein tolB; Flags: Pre...   174    3e-43
sp|A5VS52.1|TOLB_BRUO2  RecName: Full=Protein tolB; Flags: Pre...   174    4e-43 Gene info
sp|A6UCS7.1|TOLB_SINMW  RecName: Full=Protein tolB; Flags: Pre...   173    6e-43 Gene info
sp|A9WWH3.1|TOLB_BRUSI  RecName: Full=Protein tolB; Flags: Pre...   173    7e-43 Gene info
sp|Q8FZ07.1|TOLB_BRUSU  RecName: Full=Protein tolB; Flags: Pre...   173    7e-43
sp|A9M7J5.1|TOLB_BRUC2  RecName: Full=Protein tolB; Flags: Pre...   172    1e-42 Gene info
sp|Q93TG4.1|TOLB_BRUME  RecName: Full=Protein tolB; Flags: Pre...   172    1e-42
sp|Q2W2B0.1|TOLB_MAGMM  RecName: Full=Protein tolB; Flags: Pre...   172    1e-42 Gene info
sp|Q2K4L8.1|TOLB_RHIEC  RecName: Full=Protein tolB; Flags: Pre...   169    8e-42 Gene info
sp|B3PYX5.1|TOLB_RHIE6  RecName: Full=Protein tolB; Flags: Pre...   169    1e-41 Gene info
sp|B5ZNL9.1|TOLB_RHILW  RecName: Full=Protein tolB; Flags: Pre...   168    2e-41 Gene info
sp|Q1MC72.1|TOLB_RHIL3  RecName: Full=Protein tolB; Flags: Pre...   166    6e-41 Gene info
sp|Q11DI2.1|TOLB_MESSB  RecName: Full=Protein tolB; Flags: Pre...   166    8e-41 Gene info
sp|B9JRY0.1|TOLB_AGRVS  RecName: Full=Protein tolB; Flags: Pre...   163    6e-40
sp|Q9A3H4.1|TOLB_CAUCR  RecName: Full=Protein tolB; Flags: Pre...   162    9e-40
sp|Q6NAR1.1|TOLB_RHOPA  RecName: Full=Protein tolB; Flags: Pre...   161    3e-39
sp|Q20X63.2|TOLB_RHOPB  RecName: Full=Protein tolB; Flags: Pre...   160    4e-39
sp|Q2RVF0.1|TOLB_RHORT  RecName: Full=Protein tolB; Flags: Pre...   159    7e-39 Gene info
sp|Q2IZ40.1|TOLB_RHOP2  RecName: Full=Protein tolB; Flags: Pre...   159    1e-38 Gene info
sp|Q3SP21.1|TOLB_NITWN  RecName: Full=Protein tolB; Flags: Pre...   157    5e-38 Gene info
sp|Q98F84.1|TOLB_RHILO  RecName: Full=Protein tolB; Flags: Pre...   154    2e-37
sp|Q1QHQ6.1|TOLB_NITHX  RecName: Full=Protein tolB; Flags: Pre...   154    3e-37 Gene info
sp|Q6G5R6.1|TOLB_BARHE  RecName: Full=Protein tolB; Flags: Pre...   154    4e-37
sp|Q6FYQ1.1|TOLB_BARQU  RecName: Full=Protein tolB; Flags: Pre...   151    2e-36
sp|Q89ED5.2|TOLB_BRAJA  RecName: Full=Protein tolB; Flags: Pre...   150    3e-36
sp|Q1RJW5.1|TOLB_RICBR  RecName: Full=Protein tolB; Flags: Pre...   138    2e-32 Gene info
sp|A8LHQ6.1|TOLB_DINSH  RecName: Full=Protein tolB; Flags: Pre...   137    4e-32 Gene info
sp|Q167Z6.1|TOLB_ROSDO  RecName: Full=Protein tolB; Flags: Pre...   137    6e-32 Gene info
sp|A8GRJ1.1|TOLB_RICRS  RecName: Full=Protein tolB; Flags: Pre...   127    3e-29 Gene info
sp|B0BWZ3.1|TOLB_RICRO  RecName: Full=Protein tolB; Flags: Pre...   127    4e-29 Gene info
sp|C4K1V5.1|TOLB_RICPU  RecName: Full=Protein tolB; Flags: Pre...   127    5e-29
sp|A8F168.1|TOLB_RICM5  RecName: Full=Protein tolB; Flags: Pre...   127    6e-29 Gene info
sp|Q92IL4.1|TOLB_RICCN  RecName: Full=Protein tolB; Flags: Pre...   126    7e-29
sp|C3PN07.1|TOLB_RICAE  RecName: Full=Protein tolB; Flags: Pre...   126    7e-29
sp|Q4UM77.1|TOLB_RICFE  RecName: Full=Protein tolB; Flags: Pre...   125    2e-28
sp|Q28TS0.1|TOLB_JANSC  RecName: Full=Protein tolB; Flags: Pre...   125    2e-28 Gene info
sp|A8EZF5.1|TOLB_RICCK  RecName: Full=Protein tolB; Flags: Pre...   124    3e-28 Gene info
sp|Q3J041.1|TOLB_RHOS4  RecName: Full=Protein tolB; Flags: Pre...   124    5e-28 Gene info
sp|Q1GE19.1|TOLB_SILST  RecName: Full=Protein tolB; Flags: Pre...   123    6e-28 Gene info
sp|Q9ZDM5.1|TOLB_RICPR  RecName: Full=Protein tolB; Flags: Pre...   122    1e-27
sp|Q68X69.1|TOLB_RICTY  RecName: Full=Protein tolB; Flags: Pre...   121    3e-27
sp|A4WQ04.1|TOLB_RHOS5  RecName: Full=Protein tolB; Flags: Pre...   120    4e-27 Gene info
sp|A5V876.1|TOLB_SPHWW  RecName: Full=Protein tolB; Flags: Pre...   120    4e-27 Gene info
sp|A8GMX9.1|TOLB_RICAH  RecName: Full=Protein tolB; Flags: Pre...   120    5e-27 Gene info
sp|Q5LNU4.1|TOLB_SILPO  RecName: Full=Protein tolB; Flags: Pre...   120    6e-27
sp|Q5NR65.1|TOLB_ZYMMO  RecName: Full=Protein tolB; Flags: Pre...   119    1e-26
sp|A5CBX4.1|TOLB_ORITB  RecName: Full=Protein tolB; Flags: Pre...   117    5e-26 Gene info
sp|B3CUF6.1|TOLB_ORITI  RecName: Full=Protein tolB; Flags: Pre...   114    6e-25 Gene info
sp|Q5PBH8.1|TOLB_ANAMM  RecName: Full=Protein tolB; Flags: Pre...   113    9e-25 Gene info
sp|Q2GBD2.1|TOLB1_NOVAD  RecName: Full=Protein tolB 1; Flags: ...   112    2e-24 Gene info
sp|Q5FQB9.1|TOLB_GLUOX  RecName: Full=Protein tolB; Flags: Pre...   108    2e-23
sp|Q1GWC1.1|TOLB_SPHAL  RecName: Full=Protein tolB; Flags: Pre...   102    2e-21
sp|Q2G9L1.1|TOLB2_NOVAD  RecName: Full=Protein tolB 2; Flags: ...  96.7    8e-20 Gene info
sp|A6VXD7.1|TOLB_MARMS  RecName: Full=Protein tolB; Flags: Pre...  95.5    2e-19 Gene info
sp|Q21HP0.1|TOLB_SACD2  RecName: Full=Protein tolB; Flags: Pre...  92.8    1e-18 Gene info
sp|Q1GYT1.2|TOLB_METFK  RecName: Full=Protein tolB; Flags: Pre...  92.8    1e-18
sp|Q0AC40.1|TOLB_ALHEH  RecName: Full=Protein tolB; Flags: Pre...  85.1    2e-16 Gene info
sp|Q82XN9.1|TOLB_NITEU  RecName: Full=Protein tolB; Flags: Pre...  85.1    3e-16
sp|Q2SCL8.1|TOLB_HAHCH  RecName: Full=Protein tolB; Flags: Pre...  84.3    4e-16 Gene info
sp|A1VNY1.1|TOLB_POLNA  RecName: Full=Protein tolB; Flags: Pre...  84.0    5e-16 Gene info
sp|Q3JER8.1|TOLB_NITOC  RecName: Full=Protein tolB; Flags: Pre...  84.0    6e-16 Gene info
sp|Q9PC84.2|TOLB_XYLFA  RecName: Full=Protein tolB; Flags: Pre...  84.0    7e-16
sp|Q5P4Z6.1|TOLB_AZOSE  RecName: Full=Protein tolB; Flags: Pre...  83.2    9e-16 Gene info
sp|Q1QWF3.1|TOLB_CHRSD  RecName: Full=Protein tolB; Flags: Pre...  82.8    1e-15 Gene info
sp|Q2Y5H0.2|TOLB_NITMU  RecName: Full=Protein tolB; Flags: Pre...  82.4    2e-15
sp|B2STJ5.1|TOLB_XANOP  RecName: Full=Protein tolB; Flags: Pre...  82.4    2e-15 Gene info
sp|Q21WN7.1|TOLB_RHOFD  RecName: Full=Protein tolB; Flags: Pre...  82.4    2e-15 Gene info
sp|B0U2E8.1|TOLB_XYLFM  RecName: Full=Protein tolB; Flags: Pre...  81.3    4e-15 Gene info
sp|Q87CZ5.1|TOLB_XYLFT  RecName: Full=Protein tolB; Flags: Pre...  81.3    4e-15 Gene info
sp|B3CP06.1|TOLB_WOLPP  RecName: Full=Protein tolB; Flags: Pre...  80.9    5e-15 Gene info
sp|Q2P570.1|TOLB_XANOM  RecName: Full=Protein tolB; Flags: Pre...  80.1    8e-15 Gene info
sp|Q609K4.1|TOLB_METCA  RecName: Full=Protein tolB; Flags: Pre...  80.1    8e-15
sp|Q12C28.1|TOLB_POLSJ  RecName: Full=Protein tolB; Flags: Pre...  80.1    9e-15 Gene info
sp|Q5H299.2|TOLB_XANOR  RecName: Full=Protein tolB; Flags: Pre...  80.1    9e-15
sp|Q8P6F2.1|TOLB_XANCP  RecName: Full=Protein tolB; Flags: Pre...  78.6    2e-14
sp|Q7P1V3.1|TOLB_CHRVO  RecName: Full=Protein tolB; Flags: Pre...  77.8    4e-14
sp|Q8PHV7.1|TOLB_XANAC  RecName: Full=Protein tolB; Flags: Pre...  77.4    6e-14
sp|A0KP93.1|TOLB_AERHH  RecName: Full=Protein tolB; Flags: Pre...  76.3    1e-13 Gene info
sp|Q73IV6.1|TOLB_WOLPM  RecName: Full=Protein tolB; Flags: Pre...  75.9    1e-13
sp|A1K2H9.1|TOLB_AZOSB  RecName: Full=Protein tolB; Flags: Pre...  75.9    1e-13 Gene info
sp|C0R560.1|TOLB_WOLWR  RecName: Full=Protein tolB; Flags: Pre...  75.9    2e-13
sp|B8GUI9.1|TOLB_THISH  RecName: Full=Protein tolB; Flags: Pre...  75.9    2e-13
sp|A4SJ35.1|TOLB_AERS4  RecName: Full=Protein tolB; Flags: Pre...  75.1    3e-13 Gene info
sp|Q3SGT4.1|TOLB_THIDA  RecName: Full=Protein tolB; Flags: Pre...  73.9    6e-13 Gene info
sp|A1AWG2.1|TOLB_RUTMC  RecName: Full=Protein tolB; Flags: Pre...  73.9    6e-13 Gene info
sp|Q6LP47.1|TOLB_PHOPR  RecName: Full=Protein tolB; Flags: Pre...  73.6    7e-13
sp|Q3A097.1|TOLB_PELCD  RecName: Full=Protein tolB; Flags: Pre...  73.2    1e-12 Gene info
sp|B6EGK3.1|TOLB_ALISL  RecName: Full=Protein tolB; Flags: Pre...  72.4    2e-12 Gene info
sp|Q4QNG0.1|TOLB_HAEI8  RecName: Full=Protein tolB; Flags: Pre...  71.6    3e-12 Gene info
sp|P44677.1|TOLB_HAEIN  RecName: Full=Protein tolB; Flags: Pre...  71.6    3e-12
sp|A5UAA5.1|TOLB_HAEIE  RecName: Full=Protein tolB; Flags: Pre...  71.2    3e-12 Gene info
sp|Q87QT9.1|TOLB_VIBPA  RecName: Full=Protein tolB; Flags: Pre...  71.2    4e-12
sp|A5UGQ1.1|TOLB_HAEIG  RecName: Full=Protein tolB; Flags: Pre...  70.5    6e-12 Gene info
sp|A6VQ96.1|TOLB_ACTSZ  RecName: Full=Protein tolB; Flags: Pre...  70.5    6e-12 Gene info
sp|Q9KR11.1|TOLB_VIBCH  RecName: Full=Protein tolB; Flags: Pre...  70.5    7e-12
sp|A5CWT2.1|TOLB_VESOH  RecName: Full=Protein tolB; Flags: Pre...  70.5    7e-12 Gene info
sp|B5FD05.1|TOLB_VIBFM  RecName: Full=Protein tolB; Flags: Pre...  68.9    2e-11 Gene info
sp|Q62I10.1|TOLB_BURMA  RecName: Full=Protein tolB; Flags: Pre...  68.9    2e-11
sp|Q63RA8.1|TOLB_BURPS  RecName: Full=Protein tolB; Flags: Pre...  68.9    2e-11
sp|B7VMJ2.1|TOLB_VIBSL  RecName: Full=Protein tolB; Flags: Pre...  68.6    2e-11
sp|Q5E689.1|TOLB_VIBF1  RecName: Full=Protein tolB; Flags: Pre...  68.6    3e-11 Gene info
sp|Q57RK3.1|TOLB_SALCH  RecName: Full=Protein tolB; Flags: Pre...  68.6    3e-11
sp|B1JWH3.1|TOLB_BURCC  RecName: Full=Protein tolB; Flags: Pre...  68.2    3e-11 Gene info
sp|Q8ZQT5.1|TOLB_SALTY  RecName: Full=Protein tolB; Flags: Pre...  67.8    4e-11
sp|Q2SYT0.2|TOLB_BURTA  RecName: Full=Protein tolB; Flags: Pre...  67.8    4e-11
sp|Q1BYS6.1|TOLB_BURCA  RecName: Full=Protein tolB; Flags: Pre...  67.8    5e-11 Gene info
sp|A0K4X6.1|TOLB_BURCH  RecName: Full=Protein tolB; Flags: Pre...  67.8    5e-11 Gene info
sp|A3QD46.1|TOLB_SHELP  RecName: Full=Protein tolB; Flags: Pre...  67.4    5e-11 Gene info
sp|B5XZC1.1|TOLB_KLEP3  RecName: Full=Protein tolB; Flags: Pre...  67.0    7e-11 Gene info
sp|Q8Z8C0.1|TOLB_SALTI  RecName: Full=Protein tolB; Flags: Pre...  66.6    1e-10
sp|Q8DAM3.1|TOLB_VIBVU  RecName: Full=Protein tolB; Flags: Pre...  66.6    1e-10
sp|A4W889.1|TOLB_ENT38  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10 Gene info
sp|Q5ZV69.1|TOLB_LEGPH  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10 Gene info
sp|Q7MJ87.1|TOLB_VIBVY  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10 Gene info
sp|Q7WFN4.1|TOLB_BORBR  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10
sp|Q7VU03.1|TOLB_BORPE  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10
sp|A1JRK8.1|TOLB_YERE8  RecName: Full=Protein tolB; Flags: Pre...  66.2    1e-10 Gene info
sp|B4EDC0.1|TOLB_BURCJ  RecName: Full=Protein tolB; Flags: Pre...  65.9    1e-10 Gene info
sp|Q0VRJ2.2|TOLB_ALCBS  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10
sp|Q31H79.1|TOLB_THICR  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10 Gene info
sp|Q8ZGZ1.1|TOLB_YERPE  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10
sp|Q934G6.1|TOLB_DICD3  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10
sp|Q39J78.1|TOLB_BURS3  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10 Gene info
sp|Q9CM71.1|TOLB_PASMU  RecName: Full=Protein tolB; Flags: Pre...  65.5    2e-10
sp|Q65UN0.1|TOLB_MANSM  RecName: Full=Protein tolB; Flags: Pre...  65.1    2e-10 Gene info
sp|A8FUE5.1|TOLB_SHESH  RecName: Full=Protein tolB; Flags: Pre...  65.1    3e-10 Gene info
sp|Q7W476.1|TOLB_BORPA  RecName: Full=Protein tolB; Flags: Pre...  65.1    3e-10
sp|P50601.2|TOLB_PSEAE  RecName: Full=Protein tolB; Flags: Pre...  65.1    3e-10
sp|Q5WWJ9.1|TOLB_LEGPL  RecName: Full=Protein tolB; Flags: Pre...  64.7    3e-10 Gene info
sp|Q478F2.2|TOLB_DECAR  RecName: Full=Protein tolB; Flags: Pre...  64.7    4e-10
sp|B0UVJ6.1|TOLB_HAES2  RecName: Full=Protein tolB; Flags: Pre...  64.7    4e-10 Gene info
sp|Q0BHY7.1|TOLB_BURCM  RecName: Full=Protein tolB; Flags: Pre...  64.3    4e-10 Gene info
sp|B1YTW7.1|TOLB_BURA4  RecName: Full=Protein tolB; Flags: Pre...  64.3    4e-10 Gene info
sp|A9AFQ0.1|TOLB_BURM1  RecName: Full=Protein tolB; Flags: Pre...  64.3    5e-10 Gene info
sp|Q5X4Z1.1|TOLB_LEGPA  RecName: Full=Protein tolB; Flags: Pre...  64.3    5e-10 Gene info
sp|A5IC68.1|TOLB_LEGPC  RecName: Full=Protein tolB; Flags: Pre...  64.3    5e-10 Gene info
sp|Q324H2.1|TOLB_SHIBS  RecName: Full=Protein tolB; Flags: Pre...  63.9    6e-10 Gene info
sp|B2TUC6.1|TOLB_SHIB3  RecName: Full=Protein tolB; Flags: Pre...  63.9    7e-10 Gene info
sp|Q83MM7.2|TOLB_SHIFL  RecName: Full=Protein tolB; Flags: Pre...  63.9    7e-10
sp|A1S7D5.1|TOLB_SHEAM  RecName: Full=Protein tolB; Flags: Pre...  63.9    7e-10 Gene info
sp|A8GB93.1|TOLB_SERP5  RecName: Full=Protein tolB; Flags: Pre...  63.9    7e-10 Gene info
sp|Q0T6X7.1|TOLB_SHIF8  RecName: Full=Protein tolB; Flags: Pre...  63.9    7e-10 Gene info
sp|B7M6B0.1|TOLB_ECO8A  RecName: Full=Protein tolB; Flags: Pre...  63.5    7e-10 Gene info
sp|P0A855.1|TOLB_ECOLI  RecName: Full=Protein tolB; Flags: Pre...  63.5    7e-10
sp|Q0I1N1.1|TOLB_HAES1  RecName: Full=Protein tolB; Flags: Pre...  63.5    8e-10 Gene info
sp|C3JYS2.1|TOLB_PSEFS  RecName: Full=Protein tolB; Flags: Pre...  63.5    9e-10
sp|Q084K1.1|TOLB_SHEFN  RecName: Full=Protein tolB; Flags: Pre...  63.2    1e-09 Gene info
sp|A4JBU1.1|TOLB_BURVG  RecName: Full=Protein tolB; Flags: Pre...  63.2    1e-09 Gene info
sp|Q15RP1.1|TOLB_PSEA6  RecName: Full=Protein tolB; Flags: Pre...  63.2    1e-09 Gene info
sp|P0A173.1|TOLB_PSEPK  RecName: Full=Protein tolB; Flags: Pre...  63.2    1e-09 Gene info
sp|Q2KV91.1|TOLB_BORA1  RecName: Full=Protein tolB; Flags: Pre...  62.4    2e-09 Gene info
sp|Q3K7W5.2|TOLB_PSEPF  RecName: Full=Protein tolB; Flags: Pre...  62.4    2e-09
sp|B1KIF6.1|TOLB_SHEWM  RecName: Full=Protein tolB; Flags: Pre...  62.0    2e-09 Gene info
sp|Q8Y1F5.1|TOLB_RALSO  RecName: Full=Protein tolB; Flags: Pre...  62.0    3e-09
sp|Q87Y40.1|TOLB_PSESM  RecName: Full=Protein tolB; Flags: Pre...  61.6    3e-09
sp|Q48FD0.1|TOLB_PSE14  RecName: Full=Protein tolB; Flags: Pre...  61.2    4e-09 Gene info
sp|B0TPX8.1|TOLB_SHEHH  RecName: Full=Protein tolB; Flags: Pre...  61.2    4e-09 Gene info
sp|B2JGA0.1|TOLB_BURP8  RecName: Full=Protein tolB; Flags: Pre...  61.2    4e-09 Gene info
sp|Q145B2.1|TOLB_BURXL  RecName: Full=Protein tolB; Flags: Pre...  60.8    5e-09 Gene info
sp|Q32II1.1|TOLB_SHIDS  RecName: Full=Protein tolB; Flags: Pre...  60.8    5e-09 Gene info
sp|B4RTH4.1|TOLB_ALTMD  RecName: Full=Protein tolB; Flags: Pre...  60.8    5e-09 Gene info
sp|A8H5P7.1|TOLB_SHEPA  RecName: Full=Protein tolB; Flags: Pre...  60.8    5e-09 Gene info
sp|Q4ZWK6.1|TOLB_PSEU2  RecName: Full=Protein tolB; Flags: Pre...  60.5    6e-09 Gene info
sp|Q1I6F4.1|TOLB_PSEE4  RecName: Full=Protein tolB; Flags: Pre...  59.7    1e-08 Gene info
sp|A4Y5U9.1|TOLB_SHEPC  RecName: Full=Protein tolB; Flags: Pre...  59.7    1e-08 Gene info
sp|Q1LJX8.1|TOLB_RALME  RecName: Full=Protein tolB; Flags: Pre...  59.7    1e-08 Gene info
sp|B2T077.1|TOLB_BURPP  RecName: Full=Protein tolB; Flags: Pre...  59.3    1e-08 Gene info
sp|C4K8V2.1|TOLB_HAMD5  RecName: Full=Protein tolB; Flags: Pre...  59.3    1e-08
sp|Q8D2E2.1|TOLB_WIGBR  RecName: Full=Protein tolB; Flags: Pre...  58.9    2e-08 Gene info
sp|Q5QYU0.1|TOLB_IDILO  RecName: Full=Protein tolB; Flags: Pre...  58.9    2e-08
sp|C5BEL8.1|TOLB_EDWI9  RecName: Full=Protein tolB; Flags: Pre...  58.9    2e-08
sp|A8ZUI2.1|TOLB_DESOH  RecName: Full=Protein tolB; Flags: Pre...  58.9    2e-08 Gene info
sp|Q6MRB2.1|TOLB_BDEBA  RecName: Full=Protein tolB; Flags: Pre...  58.5    2e-08
sp|B7LKL8.1|TOLB_ESCF3  RecName: Full=Protein tolB; Flags: Pre...  58.2    3e-08 Gene info
sp|Q4K7E4.1|TOLB_PSEF5  RecName: Full=Protein tolB; Flags: Pre...  57.8    4e-08 Gene info
sp|Q7VR84.1|TOLB_BLOFL  RecName: Full=Protein tolB; Flags: Pre...  57.8    4e-08 Gene info
sp|B8CLE4.1|TOLB_SHEPW  RecName: Full=Protein tolB; Flags: Pre...  57.8    5e-08 Gene info
sp|Q7N6T6.1|TOLB_PHOLL  RecName: Full=Protein tolB; Flags: Pre...  57.8    5e-08
sp|Q474K8.1|TOLB_RALEJ  RecName: Full=Protein tolB; Flags: Pre...  57.8    5e-08 Gene info
sp|Q2NUL4.1|TOLB_SODGM  RecName: Full=Protein tolB; Flags: Pre...  57.0    8e-08 Gene info
sp|Q492W9.1|TOLB_BLOPB  RecName: Full=Protein tolB; Flags: Pre...  57.0    8e-08
sp|A3D3E2.1|TOLB_SHEB5  RecName: Full=Protein tolB; Flags: Pre...  56.6    9e-08 Gene info
sp|C6DCE7.1|TOLB_PECCP  RecName: Full=Protein tolB; Flags: Pre...  56.6    9e-08
sp|B2VBQ7.1|TOLB_ERWT9  RecName: Full=Protein tolB; Flags: Pre...  56.6    9e-08
sp|Q6D7F2.1|TOLB_ERWCT  RecName: Full=Protein tolB; Flags: Pre...  56.6    1e-07
sp|B8EAK3.1|TOLB_SHEB2  RecName: Full=Protein tolB; Flags: Pre...  56.2    1e-07
sp|Q8EDJ8.1|TOLB_SHEON  RecName: Full=Protein tolB; Flags: Pre...  56.2    1e-07
sp|Q3IJ16.1|TOLB_PSEHT  RecName: Full=Protein tolB; Flags: Pre...  56.2    1e-07 Gene info
sp|A0KY89.1|TOLB_SHESA  RecName: Full=Protein tolB; Flags: Pre...  55.8    2e-07 Gene info
sp|A6WM46.1|TOLB_SHEB8  RecName: Full=Protein tolB; Flags: Pre...  55.5    2e-07 Gene info
sp|A9KY50.1|TOLB_SHEB9  RecName: Full=Protein tolB; Flags: Pre...  55.5    2e-07 Gene info
sp|Q0HTY0.1|TOLB_SHESR  RecName: Full=Protein tolB; Flags: Pre...  54.7    4e-07 Gene info
sp|Q12PE6.1|TOLB_SHEDO  RecName: Full=Protein tolB; Flags: Pre...  53.9    7e-07 Gene info
sp|Q7VKU3.1|TOLB_HAEDU  RecName: Full=Protein tolB; Flags: Pre...  53.5    8e-07
sp|Q83F59.1|TOLB_COXBU  RecName: Full=Protein tolB; Flags: Pre...  52.0    2e-06
sp|Q6F985.1|TOLB_ACIAD  RecName: Full=Protein tolB; Flags: Pre...  52.0    2e-06 Gene info
sp|B8JD21.1|TOLB_ANAD2  RecName: Full=Protein tolB; Flags: Pre...  51.6    4e-06 Gene info
sp|Q2INP9.1|TOLB_ANADE  RecName: Full=Protein tolB; Flags: Pre...  50.8    5e-06 Gene info
sp|B0BT52.1|TOLB_ACTPJ  RecName: Full=Protein tolB; Flags: Pre...  50.8    6e-06 Gene info
sp|A3MZ21.1|TOLB_ACTP2  RecName: Full=Protein tolB; Flags: Pre...  50.8    6e-06 Gene info
sp|B4UDE1.1|TOLB_ANASK  RecName: Full=Protein tolB; Flags: Pre...  50.8    6e-06 Gene info
sp|Q484P6.1|TOLB_COLP3  RecName: Full=Protein tolB; Flags: Pre...  48.1    4e-05 Gene info
sp|Q74H67.1|TOLB_GEOSL  RecName: Full=Protein tolB; Flags: Pre...  47.4    5e-05
sp|B2SET5.1|TOLB_FRATM  RecName: Full=Protein tolB; Flags: Pre...  46.6    1e-04 Gene info
sp|A4IYV5.1|TOLB_FRATW  RecName: Full=Protein tolB; Flags: Pre...  46.6    1e-04 Gene info
sp|Q39PS9.1|TOLB_GEOMG  RecName: Full=Protein tolB; Flags: Pre...  46.6    1e-04 Gene info
sp|A0Q4U6.1|TOLB_FRATN  RecName: Full=Protein tolB; Flags: Pre...  46.6    1e-04 Gene info
sp|Q5NGJ7.1|TOLB_FRATT  RecName: Full=Protein tolB; Flags: Pre...  46.6    1e-04
sp|Q2LRP7.2|TOLB_SYNAS  RecName: Full=Protein tolB; Flags: Pre...  45.1    3e-04
sp|Q2A580.1|TOLB_FRATH  RecName: Full=Protein tolB; Flags: Pre...  43.1    0.001
sp|Q60317.1|AAT1_METJA  RecName: Full=Probable aspartate amino...  35.8    0.19 
sp|Q95K52.1|ZN283_MACFA  RecName: Full=Zinc finger protein 283     34.3    0.59 
sp|Q73VL9.3|FPG_MYCPA  RecName: Full=Formamidopyrimidine-DNA g...  33.1    1.1  
sp|Q8KEQ0.1|TOLB_CHLTE  RecName: Full=Protein tolB; Flags: Pre...  33.1    1.3  
sp|Q8N7M2.4|ZN283_HUMAN  RecName: Full=Zinc finger protein 283...  32.3    1.8   Gene info
sp|A0QJ66.1|FPG_MYCA1  RecName: Full=Formamidopyrimidine-DNA g...  32.3    1.9   Gene info
sp|A4TE57.1|FPG_MYCGI  RecName: Full=Formamidopyrimidine-DNA g...  32.3    2.0   Gene info
sp|A1T737.1|FPG_MYCVP  RecName: Full=Formamidopyrimidine-DNA g...  32.0    2.5   Gene info
sp|Q1BAM5.1|FPG_MYCSS  RecName: Full=Formamidopyrimidine-DNA g...  32.0    2.9   Gene info
sp|B2FT23.1|PEPQ_STRMK  RecName: Full=Xaa-Pro dipeptidase; Sho...  31.6    3.1   Gene info
sp|B4SI11.1|PEPQ_STRM5  RecName: Full=Xaa-Pro dipeptidase; Sho...  31.6    3.2   Gene info
sp|Q2P6N8.1|PEPQ_XANOM  RecName: Full=Xaa-Pro dipeptidase; Sho...  31.2    3.9   Gene info
sp|A1SLU7.1|FPG_NOCSJ  RecName: Full=Formamidopyrimidine-DNA g...  31.2    4.5   Gene info
sp|Q3B584.2|TOLB_PELLD  RecName: Full=Protein tolB; Flags: Pre...  31.2    4.5  
sp|Q3BPR2.1|PEPQ_XANC5  RecName: Full=Xaa-Pro dipeptidase; Sho...  30.8    6.1   Gene info
sp|Q2T9I5.2|RBM26_XENLA  RecName: Full=RNA-binding protein 26;...  30.4    7.0   Gene info
sp|O69470.3|FPG_MYCLE  RecName: Full=Formamidopyrimidine-DNA g...  30.4    8.0  
sp|Q8PH57.1|PEPQ_XANAC  RecName: Full=Xaa-Pro dipeptidase; Sho...  30.4    8.3  
sp|Q6MA25.1|TOLB_PARUW  RecName: Full=Protein tolB; Flags: Pre...  30.0    9.1   Gene info
sp|A3PXU1.1|FPG_MYCSJ  RecName: Full=Formamidopyrimidine-DNA g...  30.0    9.5   Gene info

Alignements

>sp|Q4FN21.1|TOLB_PELUB Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=446

 GENE ID: 3517109 tolB | translocation protein TolB
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  252 bits (643),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 153/186 (82%), Gaps = 4/186 (2%)

Query  20   CFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGL  79
             F+L+E+DITRGNL+P+P++VSP   +  +K+    +L   +LG EIS V+ENNL ++GL
Sbjct  17   AFALIEVDITRGNLNPLPVAVSPLSIDNKSKENFKKILKQEDLGSEISIVVENNLRQSGL  76

Query  80   FDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILG  139
            F+ +DK AFLQ+PD+A+LKPRFEDW LIK++ L+TGKVT+  +D+K  +++EF+LWD+L 
Sbjct  77   FNPLDKNAFLQEPDVANLKPRFEDWNLIKAQALVTGKVTF--VDEK--LRVEFRLWDVLA  132

Query  140  AKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQRVKKLAI  199
             K +   + TTVPSNWRRVGH I+DKVYERLTGE GYFDTRIIYV+EEGPKT+R+KKLAI
Sbjct  133  GKEMMALAFTTVPSNWRRVGHIITDKVYERLTGEKGYFDTRIIYVSEEGPKTKRIKKLAI  192

Query  200  MDQDGF  205
            MDQDGF
Sbjct  193  MDQDGF  198


>sp|A7HV03.1|TOLB_PARL1 Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=446

 GENE ID: 5455208 Plav_2122 | beta-propeller repeat-containing to-pal system
protein TolB [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score =  181 bits (460),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 126/191 (65%), Gaps = 21/191 (10%)

Query  19   ICFSL-----VEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENN  73
            + F+L     ++IDIT+GN+DP+PI+++ F                 ++G ++S VI NN
Sbjct  28   VAFALPARAALQIDITQGNVDPLPIAITDFVGE-------------GSVGADMSAVISNN  74

Query  74   LEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFK  133
            LE++GLF  + K +F++K    +++PRF DW +I S+ L+TG+     ++    +++EF+
Sbjct  75   LERSGLFRPLPKASFIEKVSDINVQPRFGDWRVINSQALVTGQTR---MEADGRLRVEFR  131

Query  134  LWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQR  193
            LWD+LG + + G    T P NWRRV H ISD +Y+RLTGE GYFDTRI+YV+E GPK  R
Sbjct  132  LWDVLGEQQLTGLQFFTTPDNWRRVAHLISDAIYKRLTGEDGYFDTRIVYVSETGPKNAR  191

Query  194  VKKLAIMDQDG  204
            VK+L IMDQDG
Sbjct  192  VKRLTIMDQDG  202


>sp|Q8U9L4.2|TOLB_AGRT5 Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=435

 GENE ID: 1135588 tolB | translocation protein TolB
[Agrobacterium tumefaciens str. C58] (10 or fewer PubMed links)

 Score =  178 bits (451),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 123/186 (66%), Gaps = 16/186 (8%)

Query  20   CFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLEISKVIENNLEKTGL  79
             F+ VEI+I +GN++P+PI+++ F S++              +G ++S VI  +L+++GL
Sbjct  24   AFARVEININKGNVEPLPIAITDFMSSD-------------GIGAQVSAVIAADLQRSGL  70

Query  80   FDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDKDYIKIEFKLWDILG  139
            F  ++K AF++K      +PRFEDW +I ++ L+TG+VT    +    ++ EF+LWD   
Sbjct  71   FAPVNKNAFIEKISNPDQQPRFEDWKVINAQALVTGRVTR---ESDGRLRAEFRLWDTFA  127

Query  140  AKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVAEEGPKTQRVKKLAI  199
             + + G    T P NWRRV H I+D +YER+TGE GYFDTR+++V+E GPKT R ++L+I
Sbjct  128  GQQLSGQQFFTQPENWRRVAHIIADAIYERVTGEKGYFDTRVVFVSESGPKTARKRQLSI  187

Query  200  MDQDGF  205
            MDQDGF
Sbjct  188  MDQDGF  193


>sp|A6WY81.1|TOLB_OCHA4 Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=443

 GENE ID: 5379607 tolB | translocation protein TolB
[Ochrobactrum anthropi ATCC 49188]

 Score =  176 bits (445),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 126/199 (63%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGPN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF+LWD  G + + G    T P NWRRV H I+D +YERLTGE GYFDTR+++V 
Sbjct  123  --LKAEFRLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGEKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199


>sp|Q926C2.1|TOLB_RHIME  RecName: Full=Protein tolB; Flags: Precursor
Length=436

 Score =  175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 126/209 (60%), Gaps = 24/209 (11%)

Query  1    MKKNLFLIFFIY-----LIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINN  55
            +++N F +  +      LI  P    +LVEI+I +GN++P+PI+++ F   E        
Sbjct  4    LRRNFFRLLMVLVAGCGLIASP--ANALVEININKGNVEPLPIAITDFLQGE--------  53

Query  56   VLSINNLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITG  115
                  L  +IS VI  +L+++GLF  IDK AF++K       PRFEDW +I ++ L+ G
Sbjct  54   ------LAQKISGVIAADLKRSGLFAPIDKGAFIEKISNPDATPRFEDWKVINAQALVIG  107

Query  116  KVTYKIIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESG  175
            +VT    +    +K EF+LWD    + + G    T P NWRRV H I+D +YER+TGE G
Sbjct  108  RVTQ---EGDGRLKAEFRLWDTFAGQQMLGQQFYTQPENWRRVAHIIADAIYERITGEKG  164

Query  176  YFDTRIIYVAEEGPKTQRVKKLAIMDQDG  204
            YFDTRI+YVAE GPK  R ++LAIMDQDG
Sbjct  165  YFDTRIVYVAESGPKNARKRQLAIMDQDG  193


>sp|Q57BI3.1|TOLB_BRUAB  RecName: Full=Protein tolB; Flags: Precursor
 sp|Q2YRD7.1|TOLB_BRUA2 Gene info RecName: Full=Protein tolB; Flags: Precursor
 sp|B2S7D4.1|TOLB_BRUA1 Gene info RecName: Full=Protein tolB; Flags: Precursor
 sp|C0REV9.1|TOLB_BRUMB  RecName: Full=Protein tolB; Flags: Precursor
Length=443

 Score =  174 bits (441),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGSN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF+LWD  G + + G    T P NWRRV H I+D +YERLTG+ GYFDTR+++V 
Sbjct  123  --LKAEFRLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGDKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199


>sp|A5VS52.1|TOLB_BRUO2 Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=443

 GENE ID: 5203462 tolB | translocation protein TolB [Brucella ovis ATCC 25840]

 Score =  174 bits (440),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGSN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF+LWD  G + + G    T P NWRRV H I+D +YERLTG+ GYFDTR+++V 
Sbjct  123  --LKAEFRLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGDKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199


>sp|A6UCS7.1|TOLB_SINMW Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=436

 GENE ID: 5323496 tolB | translocation protein TolB
[Sinorhizobium medicae WSM419]

 Score =  173 bits (439),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 125/209 (59%), Gaps = 24/209 (11%)

Query  1    MKKNLFLIFFIY-----LIIKPNICFSLVEIDITRGNLDPMPISVSPFFSNEDTKDKINN  55
            +++N F +  +      LI  P    +LVEIDI +GN++P+PI+++ F   E        
Sbjct  4    LRRNFFRLLMVLVAGCGLIASP--AKALVEIDINKGNVEPLPIAITDFVQGE--------  53

Query  56   VLSINNLGLEISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITG  115
                  L  +IS VI  +L+++GLF  I+K AF++K       PRFEDW +I ++ L+ G
Sbjct  54   ------LAQKISDVIAADLKRSGLFAPINKGAFIEKVSNPDATPRFEDWKVINAQALVIG  107

Query  116  KVTYKIIDDKDYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESG  175
            +VT    +    +K EF+LWD      + G    T P NWRRV H I+D +YER+TGE G
Sbjct  108  RVTK---EGDGRLKAEFRLWDTFAGTQMLGQQFYTQPENWRRVAHIIADAIYERITGEKG  164

Query  176  YFDTRIIYVAEEGPKTQRVKKLAIMDQDG  204
            YFDTRI+YVAE GPK  R ++LAIMDQDG
Sbjct  165  YFDTRIVYVAESGPKNARQRQLAIMDQDG  193


>sp|A9WWH3.1|TOLB_BRUSI Gene info RecName: Full=Protein tolB; Flags: Precursor
Length=443

 GENE ID: 5836586 tolB | translocation protein TolB [Brucella suis ATCC 23445]

 Score =  173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 125/199 (62%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGSN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF LWD  G + + G    T P NWRRV H I+D +YERLTG+ GYFDTR+++V 
Sbjct  123  --LKAEFHLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGDKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199


>sp|Q8FZ07.1|TOLB_BRUSU  RecName: Full=Protein tolB; Flags: Precursor
Length=443

 Score =  173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 125/199 (62%), Gaps = 20/199 (10%)

Query  10   FIYLIIKPNICF----SLVEIDITRGNLDPMPISVSPFFSNEDTKDKINNVLSINNLGLE  65
            F  +I    +C     ++VEI+I +G ++P+PI+++ F             LS + LG  
Sbjct  17   FACMIAASLVCTMPARAVVEININKGVIEPLPIAITDF-------------LSADQLGSN  63

Query  66   ISKVIENNLEKTGLFDAIDKEAFLQKPDIAHLKPRFEDWALIKSKVLITGKVTYKIIDDK  125
            I+ VI  +LE++GLF  IDK AF++K       PRFEDW +I ++ L+TG++T K  D +
Sbjct  64   ITSVIAADLERSGLFAPIDKGAFIEKISNPDAAPRFEDWKVINAQALVTGRIT-KQPDGR  122

Query  126  DYIKIEFKLWDILGAKMVDGFSLTTVPSNWRRVGHKISDKVYERLTGESGYFDTRIIYVA  185
              +K EF LWD  G + + G    T P NWRRV H I+D +YERLTG+ GYFDTR+++V 
Sbjct  123  --LKAEFHLWDTFGGQQMIGQQFFTTPDNWRRVAHIIADAIYERLTGDKGYFDTRVVFVD  180

Query  186  EEGPKTQRVKKLAIMDQDG  204
            E GP  +RVK+LAIMDQDG
Sbjct  181  ESGPAQKRVKRLAIMDQDG  199

--------------------------------------------------------------------------------------------------

Blastp contre Envir, paramètres par défaut au NCBI sauf "Max target sequences" = 10000(expected E-value threshold=10)

Très nombreux homologues (5e-116 <E-values en croissance régulière)

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ECP62255.1|  hypothetical protein GOS_5337766 [marine metag...   418    5e-116
gb|EDD49479.1|  hypothetical protein GOS_1294909 [marine metag...   379    3e-104
gb|ECO04082.1|  hypothetical protein GOS_3554351 [marine metag...   365    4e-100
gb|EBA82790.1|  hypothetical protein GOS_335118 [marine metage...   363    2e-99 
gb|ECU65527.1|  hypothetical protein GOS_3508370 [marine metag...   362    2e-99 
gb|EBY29175.1|  hypothetical protein GOS_6431854 [marine metag...   353    2e-96 
gb|ECJ81929.1|  hypothetical protein GOS_6327573 [marine metag...   351    6e-96 
gb|ECA08328.1|  hypothetical protein GOS_6298510 [marine metag...   349    3e-95 
gb|EBB30517.1|  hypothetical protein GOS_255925 [marine metage...   346    2e-94 
gb|EBW50842.1|  hypothetical protein GOS_6735707 [marine metag...   346    2e-94 
gb|ECB02956.1|  hypothetical protein GOS_5990245 [marine metag...   346    2e-94 
gb|EBZ21268.1|  hypothetical protein GOS_6269806 [marine metag...   340    1e-92 
gb|ECT40870.1|  hypothetical protein GOS_6100452 [marine metag...   337    1e-91 
gb|EBV43547.1|  hypothetical protein GOS_6906586 [marine metag...   327    1e-88 
gb|EBR24892.1|  hypothetical protein GOS_7630052 [marine metag...   326    2e-88 
gb|EDA13635.1|  hypothetical protein GOS_2057189 [marine metag...   323    1e-87 
gb|EBN56043.1|  hypothetical protein GOS_8226101 [marine metag...   315    6e-85 
gb|ECE45088.1|  hypothetical protein GOS_6411839 [marine metag...   295    5e-79 
gb|EBW38581.1|  hypothetical protein GOS_6755078 [marine metag...   294    1e-78 
gb|EBZ31369.1|  hypothetical protein GOS_5853755 [marine metag...   281    1e-74 
gb|ECF96758.1|  hypothetical protein GOS_4142623 [marine metag...   280    2e-74 
gb|EBH51008.1|  hypothetical protein GOS_9250416 [marine metag...   276    2e-73 
gb|EDB62101.1|  hypothetical protein GOS_1624097 [marine metag...   276    2e-73 
gb|ECT20568.1|  hypothetical protein GOS_7075475 [marine metag...   276    2e-73 
gb|EDF37128.1|  hypothetical protein GOS_966939 [marine metage...   275    5e-73 
gb|EBG81678.1|  hypothetical protein GOS_9369249 [marine metag...   275    7e-73 
gb|ECZ94578.1|  hypothetical protein GOS_2091649 [marine metag...   274    8e-73 
gb|ECN47291.1|  hypothetical protein GOS_5792142 [marine metag...   274    9e-73 
gb|ECM64177.1|  hypothetical protein GOS_5612413 [marine metag...   274    1e-72 
gb|ECW65210.1|  hypothetical protein GOS_2681891 [marine metag...   273    2e-72 
gb|EBW59148.1|  hypothetical protein GOS_6722741 [marine metag...   272    4e-72 
gb|EBB41164.1|  hypothetical protein GOS_237976 [marine metage...   271    6e-72 
gb|EDF81522.1|  hypothetical protein GOS_889462 [marine metage...   271    9e-72 
gb|ECY62965.1|  hypothetical protein GOS_2326463 [marine metag...   270    2e-71 
gb|ECQ46067.1|  hypothetical protein GOS_5572764 [marine metag...   270    2e-71 
gb|EBS38723.1|  hypothetical protein GOS_7445393 [marine metag...   269    3e-71 
gb|EDF09033.1|  hypothetical protein GOS_1016778 [marine metag...   269    3e-71 
gb|EBT16043.1|  hypothetical protein GOS_7319139 [marine metag...   269    3e-71 
gb|ECZ16945.1|  hypothetical protein GOS_2229995 [marine metag...   269    3e-71 
gb|EDA06720.1|  hypothetical protein GOS_2069784 [marine metag...   269    4e-71 
gb|EBT68267.1|  hypothetical protein GOS_7233381 [marine metag...   268    5e-71 
gb|EDF74318.1|  hypothetical protein GOS_901952 [marine metage...   268    5e-71 
gb|EDH64103.1|  hypothetical protein GOS_568654 [marine metage...   268    6e-71 
gb|EBX37677.1|  hypothetical protein GOS_6597093 [marine metag...   268    7e-71 
gb|EDE73379.1|  hypothetical protein GOS_1079447 [marine metag...   267    9e-71 
gb|EBH73477.1|  hypothetical protein GOS_9211776 [marine metag...   267    1e-70 
gb|ECN68598.1|  hypothetical protein GOS_4922562 [marine metag...   267    1e-70 
gb|EBJ78014.1|  hypothetical protein GOS_8840951 [marine metag...   267    1e-70 
gb|ECH24984.1|  hypothetical protein GOS_6025132 [marine metag...   267    1e-70 
gb|EBR54544.1|  hypothetical protein GOS_7581264 [marine metag...   267    1e-70 
gb|ECY89599.1|  hypothetical protein GOS_2277670 [marine metag...   267    1e-70 
gb|ECW74495.1|  hypothetical protein GOS_2664601 [marine metag...   267    1e-70 
gb|ECD74137.1|  hypothetical protein GOS_5741179 [marine metag...   267    2e-70 
gb|EDI47582.1|  hypothetical protein GOS_426391 [marine metage...   266    2e-70 
gb|EDI11395.1|  hypothetical protein GOS_486324 [marine metage...   266    2e-70 
gb|EBN70847.1|  hypothetical protein GOS_8201387 [marine metag...   266    3e-70 
gb|ECL64891.1|  hypothetical protein GOS_6054633 [marine metag...   266    3e-70 
gb|ECZ66260.1|  hypothetical protein GOS_2143238 [marine metag...   265    4e-70 
gb|ECB08695.1|  hypothetical protein GOS_5762254 [marine metag...   265    4e-70 
gb|ECK46778.1|  hypothetical protein GOS_3741080 [marine metag...   265    4e-70 
gb|EBQ78402.1|  hypothetical protein GOS_7698359 [marine metag...   265    4e-70 
gb|EDH73488.1|  hypothetical protein GOS_551395 [marine metage...   265    5e-70 
gb|ECK47020.1|  hypothetical protein GOS_3732070 [marine metag...   265    5e-70 
gb|ECK10068.1|  hypothetical protein GOS_5177951 [marine metag...   265    5e-70 
gb|ECI44502.1|  hypothetical protein GOS_4762182 [marine metag...   265    6e-70 
gb|EDA31640.1|  hypothetical protein GOS_2023808 [marine metag...   265    6e-70 
gb|EBS44424.1|  hypothetical protein GOS_7436338 [marine metag...   265    6e-70 
gb|ECM48213.1|  hypothetical protein GOS_6258001 [marine metag...   265    7e-70 
gb|EBI30742.1|  hypothetical protein GOS_9114744 [marine metag...   265    7e-70 
gb|EBE61764.1|  hypothetical protein GOS_9733690 [marine metag...   265    7e-70 
gb|ECE60537.1|  hypothetical protein GOS_6027733 [marine metag...   265    8e-70 
gb|ECZ49688.1|  hypothetical protein GOS_2173462 [marine metag...   264    9e-70 
gb|EBT82068.1|  hypothetical protein GOS_7210468 [marine metag...   264    9e-70 
gb|EDB82811.1|  hypothetical protein GOS_1585530 [marine metag...   264    1e-69 
gb|EBB87296.1|  hypothetical protein GOS_161868 [marine metage...   264    1e-69 
gb|ECX99953.1|  hypothetical protein GOS_2436308 [marine metag...   264    1e-69 
gb|ECR66757.1|  hypothetical protein GOS_4266304 [marine metag...   264    1e-69 
gb|EDG68192.1|  hypothetical protein GOS_739588 [marine metage...   264    1e-69 
gb|EDA31164.1|  hypothetical protein GOS_2024724 [marine metag...   264    1e-69 
gb|EBW39798.1|  hypothetical protein GOS_6753108 [marine metag...   264    1e-69 
gb|EBB98715.1|  hypothetical protein GOS_142847 [marine metage...   263    1e-69 
gb|EDD48747.1|  hypothetical protein GOS_1296122 [marine metag...   263    2e-69 
gb|EDE89021.1|  hypothetical protein GOS_1052209 [marine metag...   263    2e-69 
gb|ECZ56046.1|  hypothetical protein GOS_2162015 [marine metag...   263    2e-69 
gb|ECF57596.1|  hypothetical protein GOS_5694920 [marine metag...   263    3e-69 
gb|EBR40874.1|  hypothetical protein GOS_7603921 [marine metag...   263    3e-69 
gb|ECW90007.1|  hypothetical protein GOS_2635910 [marine metag...   263    3e-69 
gb|EBJ25489.1|  hypothetical protein GOS_8954930 [marine metag...   263    3e-69 
gb|ECT15505.1|  hypothetical protein GOS_7083662 [marine metag...   262    4e-69 
gb|EBA65733.1|  hypothetical protein GOS_364890 [marine metage...   262    4e-69 
gb|EDB32226.1|  hypothetical protein GOS_1843776 [marine metag...   262    4e-69 
gb|EDA24653.1|  hypothetical protein GOS_2036682 [marine metag...   262    5e-69 
gb|ECB84749.1|  hypothetical protein GOS_6255881 [marine metag...   261    6e-69 
gb|EBE75623.1|  hypothetical protein GOS_9710323 [marine metag...   261    6e-69 
gb|EDD08263.1|  hypothetical protein GOS_1362621 [marine metag...   261    6e-69 
gb|ECI10422.1|  hypothetical protein GOS_6135465 [marine metag...   261    6e-69 
gb|EBS05831.1|  hypothetical protein GOS_7497713 [marine metag...   261    6e-69 
gb|EDC07575.1|  hypothetical protein GOS_1540768 [marine metag...   261    6e-69 
...............................................................................

non reporté par souci d'économie d'espace.
...............................................................................
 
gb|ECS15394.1|  hypothetical protein GOS_5839783 [marine metag...  48.5    1e-04 
gb|ECO35642.1|  hypothetical protein GOS_5789266 [marine metag...  48.1    1e-04 
gb|EBZ37706.1|  hypothetical protein GOS_5593908 [marine metag...  47.8    2e-04 
gb|ECL79288.1|  hypothetical protein GOS_5469659 [marine metag...  47.8    2e-04 
gb|ECO34237.1|  hypothetical protein GOS_5845556 [marine metag...  47.8    2e-04 
gb|ECJ11991.1|  hypothetical protein GOS_5577433 [marine metag...  47.4    2e-04 
gb|EBI00812.1|  hypothetical protein GOS_9165072 [marine metag...  47.4    2e-04 
gb|EBS60404.1|  hypothetical protein GOS_7410715 [marine metag...  47.4    3e-04 
gb|EBG94503.1|  hypothetical protein GOS_9347131 [marine metag...  47.0    3e-04 
gb|EBU85061.1|  hypothetical protein GOS_6995929 [marine metag...  47.0    3e-04 
gb|ECD64310.1|  hypothetical protein GOS_6142854 [marine metag...  47.0    3e-04 
gb|ECC95101.1|  hypothetical protein GOS_5367357 [marine metag...  47.0    3e-04 
gb|EBG28169.1|  hypothetical protein GOS_9459382 [marine metag...  47.0    3e-04 
gb|ECK96908.1|  hypothetical protein GOS_5232363 [marine metag...  47.0    3e-04 
gb|ECP27320.1|  hypothetical protein GOS_5639732 [marine metag...  46.6    4e-04 
gb|ECI42322.1|  hypothetical protein GOS_4852884 [marine metag...  46.6    4e-04 
gb|EDE38378.1|  hypothetical protein GOS_1140249 [marine metag...  46.6    4e-04 
gb|EBU71477.1|  hypothetical protein GOS_7017463 [marine metag...  46.2    5e-04 
gb|EDJ33256.1|  hypothetical protein GOS_1714188 [marine metag...  45.8    6e-04 
gb|ECY52894.1|  hypothetical protein GOS_2344537 [marine metag...  45.8    7e-04 
gb|ECG01413.1|  hypothetical protein GOS_3963690 [marine metag...  45.8    7e-04 
gb|ECG53535.1|  hypothetical protein GOS_5351808 [marine metag...  45.8    7e-04 
gb|EBT26446.1|  hypothetical protein GOS_7302223 [marine metag...  45.8    7e-04 
gb|EBE83881.1|  hypothetical protein GOS_9696318 [marine metag...  45.4    8e-04 
gb|EBW97891.1|  hypothetical protein GOS_6660655 [marine metag...  45.1    0.001 
gb|EBH70908.1|  hypothetical protein GOS_9216182 [marine metag...  45.1    0.001 
gb|EBC03014.1|  hypothetical protein GOS_135792 [marine metage...  45.1    0.001 
gb|ECY50961.1|  hypothetical protein GOS_2347971 [marine metag...  44.7    0.001 
gb|ECS99586.1|  hypothetical protein GOS_8918850 [marine metag...  44.7    0.002 
gb|EBX07397.1|  hypothetical protein GOS_6645084 [marine metag...  44.7    0.002 
gb|ECU72581.1|  hypothetical protein GOS_3246232 [marine metag...  44.3    0.002 
gb|EBM09366.1|  hypothetical protein GOS_8464378 [marine metag...  44.3    0.002 
gb|EBH38992.1|  hypothetical protein GOS_9270946 [marine metag...  44.3    0.002 
gb|EDI44976.1|  hypothetical protein GOS_430887 [marine metage...  44.3    0.002 
gb|EBB24370.1|  hypothetical protein GOS_265957 [marine metage...  44.3    0.002 
gb|EBB91189.1|  hypothetical protein GOS_155410 [marine metage...  44.3    0.002 
gb|ECZ61317.1|  hypothetical protein GOS_2152408 [marine metag...  44.3    0.002 
gb|EBP13462.1|  hypothetical protein GOS_7961326 [marine metag...  44.3    0.002 
gb|EDJ68089.1|  hypothetical protein GOS_1652268 [marine metag...  44.3    0.002 
gb|ECI90739.1|  hypothetical protein GOS_6437190 [marine metag...  44.3    0.002 
gb|EBP48705.1|  hypothetical protein GOS_7903485 [marine metag...  43.9    0.002 
gb|ECE27962.1|  hypothetical protein GOS_3592959 [marine metag...  43.9    0.002 
gb|EDF42407.1|  hypothetical protein GOS_957583 [marine metage...  43.9    0.002 
gb|EBF41175.1|  hypothetical protein GOS_9602094 [marine metag...  43.9    0.003 
gb|EBT22511.1|  hypothetical protein GOS_7308468 [marine metag...  43.5    0.003 
gb|EBM30160.1|  hypothetical protein GOS_8431635 [marine metag...  43.5    0.003 
gb|EBP82906.1|  hypothetical protein GOS_7847951 [marine metag...  43.5    0.003 
gb|ECP27434.1|  hypothetical protein GOS_5634726 [marine metag...  43.5    0.004 
gb|ECJ01202.1|  hypothetical protein GOS_6019617 [marine metag...  43.1    0.004 
gb|EBT37546.1|  hypothetical protein GOS_7284179 [marine metag...  43.1    0.004 
gb|EBO54174.1|  hypothetical protein GOS_8062858 [marine metag...  43.1    0.004 
gb|ECH13646.1|  hypothetical protein GOS_6483839 [marine metag...  43.1    0.004 
gb|EDC10844.1|  hypothetical protein GOS_1534818 [marine metag...  43.1    0.005 
gb|EBK30624.1|  hypothetical protein GOS_8754380 [marine metag...  43.1    0.005 
gb|ECT02380.1|  hypothetical protein GOS_7104083 [marine metag...  43.1    0.005 
gb|ECV45820.1|  hypothetical protein GOS_2895009 [marine metag...  42.7    0.005 
gb|EBE73127.1|  hypothetical protein GOS_9714603 [marine metag...  42.7    0.006 
gb|EBP28616.1|  hypothetical protein GOS_7935612 [marine metag...  42.4    0.007 
gb|ECR37811.1|  hypothetical protein GOS_5418167 [marine metag...  42.4    0.008 
gb|ECL45645.1|  hypothetical protein GOS_3325294 [marine metag...  42.0    0.008 
gb|EBR47105.1|  hypothetical protein GOS_7593484 [marine metag...  42.0    0.009 
gb|ECS87408.1|  hypothetical protein GOS_8939237 [marine metag...  41.6    0.011 
gb|ECC40269.1|  hypothetical protein GOS_4042807 [marine metag...  41.6    0.011 
gb|EBS75696.1|  hypothetical protein GOS_7385651 [marine metag...  41.6    0.012 
gb|EBK84533.1|  hypothetical protein GOS_8665713 [marine metag...  41.6    0.012 
gb|ECE27961.1|  hypothetical protein GOS_3592958 [marine metag...  41.6    0.014 
gb|EBY18100.1|  hypothetical protein GOS_4085344 [marine metag...  41.6    0.014 
gb|ECS20183.1|  hypothetical protein GOS_5645184 [marine metag...  41.2    0.017 
gb|ECW55677.1|  hypothetical protein GOS_2699539 [marine metag...  41.2    0.017 
gb|ECB61618.1|  hypothetical protein GOS_3681210 [marine metag...  40.8    0.019 
gb|EBL55360.1|  hypothetical protein GOS_8552519 [marine metag...  40.8    0.019 
gb|EBG78134.1|  hypothetical protein GOS_9375177 [marine metag...  40.8    0.020 
gb|ECB89696.1|  hypothetical protein GOS_6058432 [marine metag...  40.8    0.021 
gb|EBZ17225.1|  hypothetical protein GOS_6424010 [marine metag...  40.8    0.022 
gb|EBC02575.1|  hypothetical protein GOS_136603 [marine metage...  40.8    0.023 
gb|ECW23525.1|  hypothetical protein GOS_2756847 [marine metag...  40.4    0.024 
gb|ECU26405.1|  hypothetical protein GOS_5061273 [marine metag...  40.4    0.025 
gb|EDE71943.1|  hypothetical protein GOS_1081975 [marine metag...  40.4    0.028 
gb|EDA99043.1|  hypothetical protein GOS_1900493 [marine metag...  40.4    0.028 
gb|EBZ61518.1|  hypothetical protein GOS_4621497 [marine metag...  40.4    0.030 
gb|ECM02391.1|  hypothetical protein GOS_4532620 [marine metag...  40.4    0.031 
gb|EBF91739.1|  hypothetical protein GOS_9519449 [marine metag...  40.0    0.032 
gb|ECC15203.1|  hypothetical protein GOS_5007054 [marine metag...  40.0    0.038 
gb|EBC41988.1|  hypothetical protein GOS_72902 [marine metagen...  39.7    0.046 
gb|ECP88257.1|  hypothetical protein GOS_4319019 [marine metag...  38.9    0.086 
gb|EDE96379.1|  hypothetical protein GOS_1039432 [marine metag...  38.5    0.12  
gb|EBV43548.1|  hypothetical protein GOS_6906587 [marine metag...  38.1    0.12  
gb|EBC48211.1|  hypothetical protein GOS_62954 [marine metagen...  38.1    0.13  
gb|EDD08166.1|  hypothetical protein GOS_1362839 [marine metag...  38.1    0.14  
gb|EDH03971.1|  hypothetical protein GOS_676677 [marine metage...  37.7    0.17  
gb|ECC94340.1|  hypothetical protein GOS_5395580 [marine metag...  37.7    0.20  
gb|ECK07251.1|  hypothetical protein GOS_5289446 [marine metag...  37.7    0.20  
gb|EBX41428.1|  hypothetical protein GOS_6591047 [marine metag...  37.4    0.24  
gb|EDF93890.1|  hypothetical protein GOS_868346 [marine metage...  37.0    0.30  
gb|EBP24190.1|  hypothetical protein GOS_7942928 [marine metag...  36.6    0.38  
gb|EBM79942.1|  hypothetical protein GOS_8351281 [marine metag...  36.6    0.40  
gb|ECH08494.1|  hypothetical protein GOS_3197026 [marine metag...  36.6    0.42  
gb|EBQ27097.1|  hypothetical protein GOS_7776274 [marine metag...  36.6    0.45  
gb|ECY30264.1|  hypothetical protein GOS_2382636 [marine metag...  36.2    0.51  
gb|ECY89587.1|  hypothetical protein GOS_2277701 [marine metag...  36.2    0.54  
gb|EBQ67276.1|  hypothetical protein GOS_7715403 [marine metag...  35.8    0.67  
gb|EDH42199.1|  hypothetical protein GOS_608768 [marine metage...  35.8    0.71  
gb|EDH94152.1|  hypothetical protein GOS_515040 [marine metage...  35.8    0.77  
gb|EBO51576.1|  hypothetical protein GOS_8067253 [marine metag...  35.4    0.79  
gb|EBY37024.1|  hypothetical protein GOS_6130645 [marine metag...  35.4    0.80  
gb|EBU13239.1|  hypothetical protein GOS_7161459 [marine metag...  35.4    0.81  
gb|EBG67764.1|  hypothetical protein GOS_9392758 [marine metag...  35.4    0.99  
gb|EBP88241.1|  hypothetical protein GOS_7838898 [marine metag...  35.0    1.1   
gb|ECG77727.1|  hypothetical protein GOS_4386149 [marine metag...  35.0    1.2   
gb|ECR94276.1|  hypothetical protein GOS_3187116 [marine metag...  35.0    1.2   
gb|ECJ74517.1|  hypothetical protein GOS_3131481 [marine metag...  34.7    1.4   
gb|ECR91157.1|  hypothetical protein GOS_3311947 [marine metag...  34.3    1.8   
gb|ECT21230.1|  hypothetical protein GOS_7074359 [marine metag...  34.3    1.9   
gb|EBB26081.1|  hypothetical protein GOS_263231 [marine metage...  34.3    1.9   
gb|EDD42271.1|  hypothetical protein GOS_1307374 [marine metag...  34.3    2.2   
gb|EDG51432.1|  hypothetical protein GOS_768725 [marine metage...  33.9    2.3   
gb|ECM66577.1|  hypothetical protein GOS_5510605 [marine metag...  33.9    2.3   
gb|EBG80066.1|  hypothetical protein GOS_9371883 [marine metag...  33.9    2.5   
gb|EDC59616.1|  hypothetical protein GOS_1448425 [marine metag...  33.9    2.8   
gb|ECS45220.1|  hypothetical protein GOS_4648593 [marine metag...  33.9    2.8   
gb|ECV57424.1|  hypothetical protein GOS_2873320 [marine metag...  33.5    3.3   
gb|EBW87936.1|  hypothetical protein GOS_6677151 [marine metag...  33.5    3.8   
gb|EBH01686.1|  hypothetical protein GOS_9334967 [marine metag...  33.1    3.9   
gb|EBM51903.1|  hypothetical protein GOS_8397060 [marine metag...  33.1    4.1   
gb|ECG27950.1|  hypothetical protein GOS_6403704 [marine metag...  33.1    4.6   
gb|EBQ06314.1|  hypothetical protein GOS_7808957 [marine metag...  33.1    5.0   
gb|EDE99850.1|  hypothetical protein GOS_1033194 [marine metag...  33.1    5.0   
gb|EBS07306.1|  hypothetical protein GOS_7495459 [marine metag...  33.1    5.1   
gb|EDE25783.1|  hypothetical protein GOS_1162097 [marine metag...  32.7    5.2   
gb|ECE05881.1|  hypothetical protein GOS_4445872 [marine metag...  32.7    5.5   
gb|ECD70468.1|  hypothetical protein GOS_5893065 [marine metag...  32.7    5.6   
gb|EBK76711.1|  hypothetical protein GOS_8678297 [marine metag...  32.7    5.7   
gb|EBS31458.1|  hypothetical protein GOS_7457029 [marine metag...  32.7    6.0   
gb|ECP69532.1|  hypothetical protein GOS_5062048 [marine metag...  32.7    6.5   
gb|EDG09828.1|  hypothetical protein GOS_840796 [marine metage...  32.3    6.8   
gb|ECL12280.1|  hypothetical protein GOS_4626913 [marine metag...  32.3    6.8   
gb|EBH12505.1|  hypothetical protein GOS_9316431 [marine metag...  32.3    6.9   
gb|EDD85818.1|  hypothetical protein GOS_1232459 [marine metag...  32.3    6.9   
gb|EBE83880.1|  hypothetical protein GOS_9696317 [marine metag...  32.3    7.5   
gb|EDC22199.1|  hypothetical protein GOS_1514615 [marine metag...  32.3    8.2   
gb|ECU34889.1|  hypothetical protein GOS_4711115 [marine metag...  32.3    8.2   
gb|ECW60710.1|  hypothetical protein GOS_2690181 [marine metag...  32.3    8.6   
gb|EBZ81901.1|  hypothetical protein GOS_3831421 [marine metag...  32.0    8.7   
gb|ECZ84118.1|  hypothetical protein GOS_2110843 [marine metag...  32.0    8.7   
gb|ECJ86603.1|  hypothetical protein GOS_6148062 [marine metag...  32.0    8.8   
gb|ECA44230.1|  hypothetical protein GOS_4841621 [marine metag...  32.0    9.6   
gb|EBP80880.1|  hypothetical protein GOS_7851150 [marine metag...  32.0    9.8   




--------------------------------------------------------------------------------------------------
Blastx contre nr, paramètres par défaut au NCBIsauf "Max target sequences" = 500(expected E-value threshold=10)

(Pas d'intérêt dans cette situation)
--------------------------------------------------------------------------------------------------

Blastx contre Environmental, paramètres par défaut au NCBI sauf "Max target sequences" = 5000 (expected E-value threshold=10)

(Pas d'intérêt en cette situation)