GOS 1098010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963660345
Annotathon code: GOS_1098010
Sample :
  • GPS :17°28'33s; 149°48'44w
  • Polynesia Archipelagos: Moorea, Cooks Bay - Fr. Polynesia
  • Coral Reef (-1.4m, 28.9°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : fbmtd
Annotated on : 2010-01-05 10:32:26
  • baumert frederic
  • dougados marie thérèse

Synopsis

  • Taxonomy: Deltaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28221
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Deltaproteobacteria - Order:
    Bacteria; Proteobacteria; Deltaproteobacteria;

Genomic Sequence

>JCVI_READ_1092963660345 GOS_1098010 Genomic DNA
TCATAAAAATCTAATTTATTTTGATGACCAAAACCTTTAGGAGTACAATCAATTACAACAGAACTTCTAGAAACAGCTTCTTCCATTGTAAATTCTGGCT
CTAAACCAATTTCTTTAAAATTTTCAACTCTTTCTTCATGAACAGCAAGTCTAGCACCTTTTGCTATTAAATTTTTAATTTTAGGTGCATCTTTTGTTAA
TGGTGATTGTTTGTGAAATGTGACTTCATCAATACCTAAATTGCTTTTCTGTTCACATAAGATTCCTATTAGTGGTTCGCCAATGGTTCCAGTTCCAACA
ACATGTACAATTTTTCTTTCCATAATACTAATTCCCCCGAATTAATCTCTATATTTTTTAACGTTAACAATAAACCAAGTTAAAATAGTAATAAATACAA
CAAAAAGTGCTGACAAAAAGTAAGATAAATAATTAAACATACCTATCCTCAATATCTTTCTTTTTTAAAACCTCGATTTTTAATAATAACATAAAAATCA
TTAATGAAGTAAAAGACAATAAAGAAAATAAAAATGGATTTAAGATTCCTGATGGCTGTTTATTCATTCCTAATTGAGGGTGAGATTGAATTTCTGCTGC
CCAAAAGTTAACAGATGCGAAAATTATTGGTATATTTAAAAAAGCTATAATTCCAATTATGGCACATACAAGAGCAACTCTCTGTCTGTATAAGCCAACA
TTTCTCAAAATAAAATATCCAATATAAACTAAAAAAAGAACTAAGGTAGTAATAAGCCTTGGCTCCCAAACCCATGGCTGGCCCCAAATGGGTGTTGCCC
AAA

Translation

[3 - 368/803]   indirect strand
>GOS_1098010 Translation [3-368   indirect strand]
WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPIIFASVNFWAAEIQSHPQLGMNKQPSGILNPFLFSLLSFTSL
MIFMLLLKIEVLKKKDIEDRYV

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

-La séquence étudiée contient un ORF codant et incomplet en 5'(la longueur manquante en 5' peut être estimée à 9 acides nucléiques ). Pour estimer cette longueur manquante, nous avons fait un alignement multiple sans notre sequence afin de déterminer où commencent les similitudes entres les homologues présumés. Cet alignement nous a montré que les similitudes commencent 3 acides amines avant le début de notre sequence donc 9 acides nucléiques.


-Notre recherche de domaines protéiques conservés stipule l'existence d'1 domaine protéique. Celui-ci semble être associé à des fonctions d'hème transporteur à travers la chaine respiratoire du complexe VI. La recherche d'homologues par Blast nous indique que toutes les protéines significativement similaires à la nôtre concourent à la même fonction. On peut donc supposer que notre séquence peut elle aussi avoir un rôle dans le transport.


-Les résultats de l'arbre construit à partir du rapport taxonomique semblent nous montrer que l'organisme qui porte le fragment d'ADN étudié provient d'un transfert horizontal entre delta et firmicutes.

ORF finding

PROTOCOLE: SMS/ORFfinder/sens direct/frame1,2,3/no ORF/initiation codon:any codon/genetic code:universel

SMS/ORFfinder/sens indirect/frame1,2,3/2 ORF/initiation codon:any codon/genetic code:universel


Blast P sur >ORF number 1 in reading frame 1 on the reverse strand extends from base 463 to base 801.

BlastP sur >ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 371.

BlastX >GOS_1098010 ADN génomique (Polynesia Archipelagos: Moorea, Cooks Bay)


sms/protein molecular weight






ANALYSE DES RÉSULTATS:


La recherche d'ORF de la séquence GOS dans le sens direct et indirect nous permet de dire:

- qu'il n'y a pas d'ORF dans le sens direct

- par contre nous avons obtenus deux ORF de taille similaire dans le sens indirect: un ORF au cadre de lecture 1 allant de la base 463 à la base 801,et un autre ORF au cadre de lecture 3 de la base 3 à la base 371.


Pour savoir lequel choisir nous avons approfondi notre analyse en effectuant un Blast p contre nr et contre swissprot sur chacun des orf ainsi qu'un blastx sur la séquence nucléotidique.


Au vu des résultats Blast, nous avons constaté qu'il existait ,des similitudes pertinantes au niveau des e-value avec l'ORF en sens indirect au cadre de lecture 3.

Les Blast nous montrent également que cet ORF présente des homologues ayant des e-values assez semblables.

De plus, cette séquence comportant 122 acides aminés semble codante et a peu de chance d'être un faux positif.

Tout ceci porte à croire que l'ORF en sens indirect et au cadre de lecture 3est l'ORF à sélectionner.

Notre choix s'est donc porté sur l'ORF en sens indirect et au cadre de lecture 3 qui semble être incomplet en 5'et semble ne pas commençer pas par une méthionine.


Pour déterminer le poids moléculaire nous sommes passés par protein weight via sms

Vu que notre sèquence est incomplète en 5', il n'est pas nécessaire de calculer le poids moléculaire.

RÉSULTATS BRUTS:
ORF Finder results
Results for 803 residue sequence "GOS_1098010 ADN génomique (Polynesia Archipelagos: Moorea, Cooks Bay)" starting "TCATAAAAAT"

No ORFs were found in reading frame 1. No ORFs were found in reading frame 2. No ORFs were found in reading frame 3.







ORF Finder results
Results for 803 residue sequence "GOS_1098010 ADN génomique (Polynesia Archipelagos: Moorea, Cooks Bay)" starting "TCATAAAAAT"


>ORF number 1 in reading frame 1 on the reverse strand extends from base 463 to base 801.
TTCGGGGGAATTAGTATTATGGAAAGAAAAATTGTACATGTTGTTGGAACTGGAACCATT
GGCGAACCACTAATAGGAATCTTATGTGAACAGAAAAGCAATTTAGGTATTGATGAAGTC
ACATTTCACAAACAATCACCATTAACAAAAGATGCACCTAAAATTAAAAATTTAATAGCA
AAAGGTGCTAGACTTGCTGTTCATGAAGAAAGAGTTGAAAATTTTAAAGAAATTGGTTTA
GAGCCAGAATTTACAATGGAAGAAGCTGTTTCTAGAAGTTCTGTTGTAATTGATTGTACT
CCTAAAGGTTTTGGTCATCAAAATAAATTAGATTTTTAT

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
FGGISIMERKIVHVVGTGTIGEPLIGILCEQKSNLGIDEVTFHKQSPLTKDAPKIKNLIA
KGARLAVHEERVENFKEIGLEPEFTMEEAVSRSSVVIDCTPKGFGHQNKLDFY

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 371.
TGGGCAACACCCATTTGGGGCCAGCCATGGGTTTGGGAGCCAAGGCTTATTACTACCTTA
GTTCTTTTTTTAGTTTATATTGGATATTTTATTTTGAGAAATGTTGGCTTATACAGACAG
AGAGTTGCTCTTGTATGTGCCATAATTGGAATTATAGCTTTTTTAAATATACCAATAATT
TTCGCATCTGTTAACTTTTGGGCAGCAGAAATTCAATCTCACCCTCAATTAGGAATGAAT
AAACAGCCATCAGGAATCTTAAATCCATTTTTATTTTCTTTATTGTCTTTTACTTCATTA
ATGATTTTTATGTTATTATTAAAAATCGAGGTTTTAAAAAAGAAAGATATTGAGGATAGG
TATGTTTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII
FASVNFWAAEIQSHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKKDIEDR
YV*



BlastP sur >ORF number 1 in reading frame 1 on the reverse strand extends from base 463 to base 801.
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01911188.1|  hypothetical protein PPSIR1_08217 [Plesioc...   108    1e-22
ref|YP_001152981.1|  glyceraldehyde-3-phosphate dehydrogenase ...  52.0    2e-05 Gene info
ref|YP_931204.1|  glyceraldehyde-3-phosphate dehydrogenase [Py...  51.6    2e-05 Gene info
ref|YP_001794115.1|  glyceraldehyde-3-phosphate dehydrogenase,...  50.1    6e-05 Gene info
ref|YP_448366.1|  glyceraldehyde-3-phosphate dehydrogenase [Me...  47.8    3e-04 Gene info
ref|YP_001055524.1|  glyceraldehyde-3-phosphate dehydrogenase ...  47.8    4e-04 Gene info
ref|NP_613903.1|  glyceraldehyde-3-phosphate dehydrogenase [Me...  46.6    8e-04 Gene info
ref|NP_559513.1|  glyceraldehyde-3-phosphate dehydrogenase [Py...  46.6    9e-04 Gene info
ref|YP_001541603.1|  glyceraldehyde-3-phosphate dehydrogenase ...  44.7    0.003 Gene info


BlastP sur >ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 371.

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_03856718.1|  ABC-type transport system involved in cyto...  90.5    4e-17
ref|YP_387968.1|  cytochrome c-type biogenesis protein CcmC [D...  87.4    4e-16 Gene info
ref|ZP_02170570.1|  cytochrome c assembly protein [Bacillus se...  87.0    5e-16
ref|YP_002522425.1|  heme exporter protein C [Thermomicrobium ...  81.3    3e-14 Gene info
ref|YP_002480937.1|  cytochrome c assembly protein [Desulfovib...  80.1    6e-14 Gene info
ref|YP_923152.1|  cytochrome c assembly protein [Nocardioides ...  80.1    7e-14 Gene info
ref|YP_360214.1|  putative heme exporter protein CcmC [Carboxy...  79.7    8e-14 Gene info
ref|ZP_03311797.1|  hypothetical protein DESPIG_01714 [Desulfo...  79.3    1e-13
ref|YP_002437533.1|  cytochrome c assembly protein [Desulfovib...  78.2    2e-13 Gene info


BlastX 	>GOS_1098010 ADN génomique (Polynesia Archipelagos: Moorea, Cooks Bay)

>ref|ZP_01911188.1|  hypothetical protein PPSIR1_08217 [Plesiocystis pacifica SIR-1]
 gb|EDM75884.1|  hypothetical protein PPSIR1_08217 [Plesiocystis pacifica SIR-1]
Length=353

 Score =  108 bits (269),  Expect = 8e-22
 Identities = 48/97 (49%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  323  MERKIVHVVGTGTIGEPLIGILCEQKSNLGIDEVTFHKQSPLTKDAPKIKNLIAKGARLA  144
            M ++IVH++GTGTIGEPLIG+    +    IDEVTFHK++PLT +  K++++I +GA+L 
Sbjct  1    MSKRIVHIIGTGTIGEPLIGLFTAFEKQWEIDEVTFHKRTPLTDERAKVESMIRRGAKLV  60

Query  143  VHEERVENFKEIGLEPEFTMEEAVSRSSVVIDCTPKG  33
            V  ++V++F+ IG    +T +EA++R+S VIDCTP G
Sbjct  61   VDSDKVKDFEGIGHTVSYTADEAIARASAVIDCTPVG  97


>ref|YP_387968.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio desulfuricans 
subsp. desulfuricans str. G20]
 gb|ABB38273.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio desulfuricans 
subsp. desulfuricans str. G20]
Length=230

 GENE ID: 3756066 Dde_1474 | cytochrome c-type biogenesis protein CcmC
[Desulfovibrio desulfuricans subsp. desulfuricans str. G20]

 Score = 87.8 bits (216),  Expect = 1e-15
 Identities = 34/67 (50%), Positives = 50/67 (74%), Gaps = 0/67 (0%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            W    WG  W W+PRL TTLV++ VY GY +LR++GL R+R A+VCA++GI+AF+++P++
Sbjct  104  WGRHSWGVWWTWDPRLTTTLVMWFVYAGYLMLRSMGLARERRAVVCAVLGIVAFIDVPLV  163

Query  621  FASVNFW  601
            F S   W
Sbjct  164  FFSARLW  170


>ref|YP_002480937.1| Gene info cytochrome c assembly protein [Desulfovibrio desulfuricans subsp. 
desulfuricans str. ATCC 27774]
 gb|ACL50259.1| Gene info cytochrome c assembly protein [Desulfovibrio desulfuricans subsp. 
desulfuricans str. ATCC 27774]
Length=230

 GENE ID: 7286084 Ddes_2365 | cytochrome c assembly protein
[Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]

 Score = 85.5 bits (210),  Expect = 6e-15
 Identities = 35/82 (42%), Positives = 54/82 (65%), Gaps = 3/82 (3%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            WA   WG  W W+PRL TTL+++ VY GY +LR + L  QR  +VCA++G++AFL++P++
Sbjct  100  WARRSWGVWWTWDPRLTTTLIMWFVYAGYLVLRGLDLPPQRRNMVCAVVGVVAFLDVPLV  159

Query  621  FASVNFWAAEIQSHPQLGMNKQ  556
            F S   W +    HP +  +K+
Sbjct  160  FLSARIWRS---IHPSVFASKE  178


>ref|ZP_02170570.1|  cytochrome c assembly protein [Bacillus selenitireducens MLS10]
 gb|EDP82481.1|  cytochrome c assembly protein [Bacillus selenitireducens MLS10]
Length=239

 Score = 85.1 bits (209),  Expect = 7e-15
 Identities = 34/75 (45%), Positives = 52/75 (69%), Gaps = 2/75 (2%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            WA   W   W WEPRL TTL+LF +YIGY ++RN+ +  QR A + ++ GII+F+N+PI+
Sbjct  108  WARSAWNTWWTWEPRLTTTLILFFMYIGYIMIRNLDMEWQRKARLASVFGIISFINVPIV  167

Query  621  FASVNFWAAEIQSHP  577
            + S+ +W + +  HP
Sbjct  168  YMSIRWWESNL--HP  180


>ref|ZP_03311797.1|  hypothetical protein DESPIG_01714 [Desulfovibrio piger ATCC 29098]
 gb|EEB33385.1|  hypothetical protein DESPIG_01714 [Desulfovibrio piger ATCC 29098]
Length=228

 Score = 84.7 bits (208),  Expect = 9e-15
 Identities = 34/81 (41%), Positives = 53/81 (65%), Gaps = 3/81 (3%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            WA   WG  W W+PRL TTLV++ +Y GY +LR + L  QR  ++CA++G++AFL++P++
Sbjct  102  WARRSWGVWWTWDPRLTTTLVMWFIYAGYLVLRGLDLPPQRKRMICAVVGVVAFLDVPLV  161

Query  621  FASVNFWAAEIQSHPQLGMNK  559
            F S   W +    HP +  +K
Sbjct  162  FLSARLWRS---IHPAVFASK  179


>ref|YP_002437533.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris str. 'Miyazaki 
F']
 gb|ACL10065.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris str. 'Miyazaki 
F']
Length=228

 GENE ID: 7175075 DvMF_3129 | cytochrome c assembly protein
[Desulfovibrio vulgaris str. 'Miyazaki F']

 Score = 82.4 bits (202),  Expect = 5e-14
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 3/81 (3%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            W    WG  W W+PRL TTLV++ VY GY +LR + L R+R+  V A++GI+AFL++P++
Sbjct  102  WGRHSWGVWWTWDPRLTTTLVMWFVYAGYLVLRTLDLPRERLGTVSAVVGIVAFLDVPLV  161

Query  621  FASVNFWAAEIQSHPQLGMNK  559
            F S   W +    HP +  +K
Sbjct  162  FLSARLWRS---IHPAVFASK  179


>ref|YP_003197851.1| Gene info cytochrome c assembly protein [Desulfohalobium retbaense DSM 
5692]
 gb|ACV68273.1| Gene info cytochrome c assembly protein [Desulfohalobium retbaense DSM 
5692]
Length=234

 GENE ID: 8418807 Dret_0985 | cytochrome c assembly protein
[Desulfohalobium retbaense DSM 5692]

 Score = 82.0 bits (201),  Expect = 6e-14
 Identities = 34/86 (39%), Positives = 53/86 (61%), Gaps = 4/86 (4%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            WA P W   W W+PRL TTLV++ VY  Y +LR  GL  ++   +CA++G++AFL++P++
Sbjct  108  WAKPAWNTWWTWDPRLSTTLVMWFVYAAYLVLRGSGLAPEKRRFLCAVLGVVAFLDVPLV  167

Query  621  FASVNFWAAEIQSHPQLGMNKQPSGI  544
            F S   W +    HP + +  Q  G+
Sbjct  168  FLSARLWRS---IHPSV-LGSQSGGL  189


>ref|YP_010268.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio vulgaris 
subsp. vulgaris str. Hildenborough]
 ref|YP_967389.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris subsp. 
vulgaris DP4]
 ref|ZP_04791348.1|  cytochrome c assembly protein [Desulfovibrio vulgaris RCH1]
 gb|AAS95527.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio vulgaris 
subsp. vulgaris str. Hildenborough]
 gb|ABM28962.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris subsp. 
vulgaris DP4]
 gb|EER80026.1|  cytochrome c assembly protein [Desulfovibrio vulgaris RCH1]
Length=224

 GENE ID: 2795268 ccmC | cytochrome c-type biogenesis protein CcmC
[Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough]
(10 or fewer PubMed links)

 Score = 80.1 bits (196),  Expect = 2e-13
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            W    WG  W W+PRL TTLV++ VY GY +LR++ L R R A V A++GI AF+++P++
Sbjct  98   WGRHSWGVWWTWDPRLTTTLVMWFVYAGYLVLRSMNLSRDRQATVSAVVGIAAFVDVPLV  157

Query  621  FASVNFW  601
            F S   W
Sbjct  158  FLSARLW  164


>ref|YP_002953624.1| Gene info heme exporter protein C [Desulfovibrio magneticus RS-1]
 dbj|BAH75738.1| Gene info heme exporter protein C [Desulfovibrio magneticus RS-1]
Length=222

 GENE ID: 7983000 ccmC | heme exporter protein C [Desulfovibrio magneticus RS-1]

 Score = 78.2 bits (191),  Expect = 9e-13
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  801  WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  622
            WA PIW   W W+PRL TTLV++ VY  Y +LR   +  QR   V A++G++AFL++P++
Sbjct  94   WARPIWNVWWTWDPRLTTTLVMWFVYAAYLLLRASDVGGQRQDTVLAVLGVVAFLDVPLV  153

Query  621  FASVNFW  601
            F S  +W
Sbjct  154  FISARYW  160



Protein Molecular Weight results
Results for 122 residue sequence "GOS_1098010 Traduction [3-368 sens indirect]" starting "WATPIWGQPW"
14.13 kD


Multiple Alignement

PROTOCOLE:

EBI / Programme Clustalw2 / Parametres par defaut/ Sortie format clustal"


ANALYSE DES RÉSULTATS:


L'alignement multiple montre des similitudes entre les homologues présumés donnés par le blast contre nr et notre séquence, notamment sur la fin de notre orf.

Par contre voyant là où les similitudes s'arrètent, l'hypothèse d'une protéine tronquée en 5' est probable.

A noter également que les similitudes se terminent avant la fin de notre séquence qui s'achève par un codon stop

CLUSTAL W (1.83) multiple sequence alignment

Deltapro1       MRDSIRP-RSPLP-----------------------RYAAAMAGLALAVS--QYFIFVYA
Deltapro2       MPKLS-----ALP-----------------------QLLVFLGGLAFAAC--QWLIYAYA
Deltapro3       MRNNW-----LAP-------------------------LALAAGAGLAVC--QYLIYVYA
Deltapro4       ------------------------------------------------------------
Deltapro5       MGKFIKW------------------------------GLPALALVVLAAG--WWLGLEWA
Deltapro6       MGANVNVERAPHKVALAANGDAARRATSGASAGASIAFYVLLAASALAVIGTLHFVAYVV
GOS_1098010     ------------------------------------------------------------
                                                                            

Deltapro1       PEEQTMGIVQKIFYIHLPLAWWALISFFAVFVASAMYLNKRTWFWDNLAGAAAEIGVLFS
Deltapro2       PVEQTLGLAQKIFYIHLPLAWWALMSFLAVFAGSVAYLWRRNPAADRLCAAAAEVGVLLS
Deltapro3       PVESMMGLVQKIFYTHLPLAWWSFVSFFTVFIASIAFLRTRDRRWDSLAGAAAEVGVLCS
Deltapro4       ------------MYAHVPAVWIAMVALTLNFICSVTYLFKPSWKTDALAEASAEVGLLFG
Deltapro5       PPDREMGDVQRIMYVHVPLQWVAMVAMAINFVVAISYLMKASWKLDAAAEASAEIGLVLG
Deltapro6       PTEASMGIVQKIFYFHAPAGYAMYIGATVCFIGSAGYLARGTQRWDSLAKAGAEVAVAMG
GOS_1098010     ------------------------------------------------------------
                                                                            

Deltapro1       GLALVTGSVWGRHSWGVWWTWDPRLTTTLVMWFVYAGYLMLRSMGLARERRAVVCAVLGI
Deltapro2       GLALVTGMLWARRSWGVWWTWDPRLTTTLIMWFVYAGYLVLRGLDLPPQRRNMVCAVVGV
Deltapro3       GLALVTGSIWGRHSWGVWWTWDPRLTTTLVMWFVYAGYLVLRSMNLSRDRQATVSAVVGI
Deltapro4       AVGVLLGAIWGRPTWGVYWTWDPRLTTAAILLVAYMGYMALRRFVEDAEKRAVWSAVVGI
Deltapro5       TAGMITGAIWGRPTWGVYWSWDPRLTSQAIMLVTYTGYLVLRRFVEDPEKRATWSSVVAI
Deltapro6       LIVLVTGPLWAAKAWGVYWTWDPRLTTSLLSVLIYIAYVVLRAFTGDSDAERKFAAALGV
GOS_1098010     ---------WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGI
                         *.   **  * *:*** :  :  . * .*. ** .    :     .: :.:

Deltapro1       VAFIDVPLVFFSARLWRS---IHPSVFASRG--GGL-EPEML-TTAVVCVLCFGFLWYAL
Deltapro2       VAFLDVPLVFLSARIWRS---IHPSVFASKE--GGL-EPEMR-LTVIACVLSFGLLWAGL
Deltapro3       AAFVDVPLVFLSARLWRS---IHPAVFASRD--GGL-EPEMK-LTAVVCVAVFGLMWAAL
Deltapro4       IAAVDLPIIWFSVKWWRS---LHQV--QSSP--KTV-DPAMV-FPLR--ISAFAFLAFMI
Deltapro5       IGAINLPIVWFSVRWWRS---LHQV--QSTP--KTV-DPEMT-LALR--VSAFGMLFLTL
Deltapro6       LGAANLPIIHYSVKMWGG---NHPTVITGKG--GGLGHPDMK-MALGFGFLSFTLLTLAL
GOS_1098010     IAFLNIPIIFASVNFWAAEIQSHPQLGMNKQPSGIL-NPFLFSLLSFTSLMIFMLL-LK-
                 .  ::*::  *.. * .    *     .      : .* :        .  * ::    

Deltapro1       T--AIRTRQLADTDRLDSL----------------ATTDDL
Deltapro2       V--WLRKRQLDLAARLDRLQQSH------------CTPEGL
Deltapro3       T--GVRYMQTRQTDRLDTL----------------ATREAL
Deltapro4       VFLIYRYRI-ALHERQAEVALPEALPTDDP--ASRRSAGVA
Deltapro5       WFLVLRYRQ-ALAEREAEVALPDALPSDLAAAGGANSTRVA
Deltapro6       V--WARYRVDLASARLAELEQ-EAL---------EAGIGED
GOS_1098010     -IEVLKKKD--------------------------IEDRYV


   Alignement multiple en intégrant les séquences du groupe extérieur après 1ère correction:

D4.Sti.aur      ------------------------------------------------------------
D5.My.xant      -------------------------------------MGKFIKWGLPALALVVLAAGWWL
gi25637115      ----------------------------------MRQRASMVRRVVGLGALAGVALTAWL
gi22163320      --------------------------MATVTNTVRRPATTAWLSVLAALSFLSVALSVVL
gi11971618      --------------------------MKTFDRLLVKVGTPRAQRLFGGAALVTLGGTAVM
h.GC.Gram+      ----------------MHNSLAARLTPFMLAVGALLTTAGFILAFTTAPPVNGATVDGVE
gi25779231      ----MTEKTKKALKLPEAGQWPDRIAPTVLVAGAVLSTIGFLLAFLWASPVNGAAVNGVE
gi21063485      ----------------MHKNRADALVPALLVLGALLIAADVVWTFTLAPLVQGAQLPEPV
D1.Ds.desu      -------------------------------MRDSIRPRSPLPRYAAAMAGLALAVSQYF
D3.Ds.Delt      -------------------------------MRN--NWLAPL----ALAAGAGLAVCQYL
D2.Ds.desu      -------------------------------MPK----LSALPQLLVFLGGLAFAACQWL
D6.So.Delt      -----MGANVNVERAPHKVALAANGDAARRATSGASAGASIAFYVLLAASALAVIGTLHF
F1.Ba.sele      ---------------------------MKGMEDLGRMTPSSFQKWFFVFTAVMMFIAMYL
F3.Hl.oren      ------------------------------MKDK----VNSILLIILIFT---MLTNLYL
F2.C.hydro      ----------------------------------------MGLLAYVVLS-----VAIYM
GOS_109801      ------------------------------------------------------------
F4.Dt.Firm      ----------------------------------------MIWQVILGLWMTAVVIASFV
F5.Mi.Firm      ----------------------------------MRSYEKGLWLLIL-LLTAAVVYAVFF
GN.b.Chlor      -------------------------MPRKSCSMSDRLRLNQAARILLGVWMAGIIVAMFL
A1.Sa.stel      ----------------------MASIWEYANPVKFIRTTDRVLPWLSAAAVIALVVGLFW
A2.Rhb.cap      -----------------------MSIWEYANPVKFMQTSGRLLPWVVAATVLTLLPGLVW
A3.Rhba.Al      -----------------------MSLWEYANPAKFMALSARILPALTIASCCLLLVGLFW
A5.Me.nodu      --------------------MAQGLFTRLAQPSHFLRWSGAALPWISGLAALLLAAGLYL
A7.Az.caul      ----------------------MGILA-LANPTRFVWLSDRVLPWLSWAAVVVLAAGLFL
A4.O.alexa      ------------------------MWSYFANPERFDRLARALIPWCWGVAAVLFAVGLPW
B2.Bu.xeno      ------MHMT-----------RINWFH-YASPRVFDGLAARLAPCFAVVSGVLILAGLAI
B8.Ra.pick      MTNRSGLHTPPIAAPREPASRRWNWLA-YASPVRFDPLARKLVPWFGAAALMFLVAGLYV
B4.Nim.eur      --------------------MTINWFK-YASPASFYFLAGRMIPYFSIAAIIFLIVGLYI
B7.Nis.mul      --------------------MAINWFK-YSSPASFYFLAGKMIPLFSIAAIVLCAVGLYI
B5.Nim.eut      ---------------------MINWFK-YSSPKMFYPLAGKLIPWFAVAAAMLTIIGMYV
B3.Rhf.fer      -----------------MNTRVIHWFK-FASPQNFYVLAGRMQPWFTALAIVLMAVGLWI
B9.Dc.arom      ------------------MKDRFNLYR-FASPATFYPLAGALIPFFVAISVLFGLAGLYL
B1.Ga.Beta      --------------------MAINWFK-YSAPTTFYPLAGKLIPWFAISSAILFAVGLYI
B6.L.cholo      -------------------MKKLHLFH-FSAPSRFYALTGALLPWLWTAAALLAAAGLYI
Ga1.Pe.syr      -----------MKSNAMKSSIGWAWLHTLGSPKGFYRVSARLLPWMSVVAVLLLVIGMVW
Ga2.Pe.men      --------------------MNWTWFHKWGSPKWFYEMSGRWLPWLSIAAVLLIVSGLVW
Ga7.Ne.cae      ---------------------MPRWFYQLASPRWSYNIMGKLLPGFAICAALLLIGGTIW
Ga3.Ac.suc      ---------------------MWKWLHPYAKPETQYRLCGKLSPFFAVLTVLLLGIGLVW
Ga6.He.inf      ---------------------MWKWLHPYAKPETQYRICGKLSPLFAFLTLILLGVGIVW
Ga5.Py.ing      ---------------------MWKWLHPYAKPEKSYQLAGKLLPWFVVLTIITFIIGLLW
Ga8.Ste.ma      ------------------MNPIVRWFHQLGSPPTFDRFAARWSRVFYLAAVPVLLVGMWQ
                                                                            

D4.Sti.aur      -----------------MYAHVPAVWIAMVALTLNFICSVTYLFKPSWKT--DALAEASA
D5.My.xant      GLEWAPPDREMGDVQRIMYVHVPLQWVAMVAMAINFVVAISYLMKASWKL--DAAAEASA
gi25637115      GLVATPPAEFFGNLVRLLYVHPSMAWVAFLAFGVTTLASALYLWPRTRRPEWDLLAAASA
gi22163320      IFLYAPRDVDQGEVQRLFYLHLPAAWLAYLSFFIIFVSSILYLVRGHARW--DRLARSAA
gi11971618      ALAVVPPDAEQGDVQRLMYVHVPAAWLAFLSFGVVFAASIGYLRTGQIRW--DRMAVASA
h.GC.Gram+      MIGDTLVSNQLLFSQKIFYFHMPVAIASFLALVGTAYCGIRFLASRDAAW--DLRARVST
gi25779231      MIGGQMVTSVLLLSQKIFYFHMPVAITSFIALAFAGYYAVRFLMTKNRRF--DTCSKIAM
gi21063485      VIAGQMVTTKLLLSQKIFYLHVPVAVASFAAMGVAAFHALRFLMTKDRAH--DVRSRTAM
D1.Ds.desu      IFVYAPEEQTMGIVQKIFYIHLPLAWWALISFFAVFVASAMYLNKRTWFW--DNLAGAAA
D3.Ds.Delt      IYVYAPVESMMGLVQKIFYTHLPLAWWSFVSFFTVFIASIAFLRTRDRRW--DSLAGAAA
D2.Ds.desu      IYAYAPVEQTLGLAQKIFYIHLPLAWWALMSFLAVFAGSVAYLWRRNPAA--DRLCAAAA
D6.So.Delt      VAYVVPTEASMGIVQKIFYFHAPAGYAMYIGATVCFIGSAGYLARGTQRW--DSLAKAGA
F1.Ba.sele      VFIWTPIERNMGIVQKIFYFHVASAWNAFFAFFIVAVFSVLFLVTKKRVY--ELMAGVSA
F3.Hl.oren      IFYYAPLEKVMGVVQKIFYFHVASAWIGFLALAVVFASNILYLRCGRKKW--SQLSLASA
F2.C.hydro      VFVVAPEEKMMGIVQKIFYFHVSAAWVAFLAFFVVFVGSIMFLIKRDYYW--DGISLASA
GOS_109801      ------------------------------------------------------------
F4.Dt.Firm      YVPAIPGFGATGETARIIIYHVPAAWVAVLAYLMAMVNSIGYLKKGDIAL--DRKAQVNA
F5.Mi.Firm      LVPPAMGLGS---LVRIAFFHIPVAWVAVLAFLVSAWYAVRYLRRPSARF--DAFSAESA
GN.b.Chlor      VVPQYVGLGD---AGRIIILHVPTAWITTVAFAVSAVYSIRYLWKRRTAD--DAGAVAAA
A1.Sa.stel      GFFLTPDDYRQGATVKIIYLHVPAALIAINAWLMMLVASLIWIVRRHHVS--ALAARAAA
A2.Rhb.cap      GFFFTPVAAEFGATVKVIYVHVPAATLAINIWVMMLVASLIWLIRRHHVS--ALAAKAAA
A3.Rhba.Al      GFFLTPSDYKQGSTVKIIFLHVPSALMAINAWLMMLVASLIWLIRRHHVS--ALAAKAAA
A5.Me.nodu      SVFVAPADYQQGETVRIMFIHVPAAWLGVFFYGAMAVSALGTLVWRHPLA--DVAQRAAA
A7.Az.caul      -AFRAPPDYQQGETVRIMYIHVPFAWLAMFGYSLMAMSSLGVLVWRHPLA--DVAHKALA
A4.O.alexa      ALYFSPGDYQQSDTVRIMYVHVPAAWLAMFAYAGLGGASFVYFIWRHNLA--DLAARAIA
B2.Bu.xeno      GLVIAPTDALQGDVYRIMFVHVPAAWMSMFIYVVMAMYCALGLVFNARLA--AMMALALA
B8.Ra.pick      GFVVAPTDAQQGEVYRIIFLHVPAAWMSMFIYLVMAGYCALALVLHTRLS--SMMASALA
B4.Nim.eur      AFFSAPTDFQQGEAYRIIFIHVPAAWMSMFLYVVMAFWAGIGLAFNTRLS--SMVASAIA
B7.Nis.mul      GFFVAPTDFQQGEAYRIIFIHVPAAWLSMFLYVIMALWSGIGLAFNTRLS--AMVATAIA
B5.Nim.eut      GFFMAPTDAQQGEGYRIIFLHVPVSWMSMFIYLVMAFWAAIGLAFNNRLA--AMMASALA
B3.Rhf.fer      SFFVAPTDAQQGEGYRIIFVHVPASQMSMFIYLVMAAWAGFGLAFNTRLS--GMMASALA
B9.Dc.arom      GMLVAPTDFQQGEGYRIIFIHVPASWMSMFIYLVMAFWAAIGLAFNTRLS--GMMAQALA
B1.Ga.Beta      GFVVAPSDATQGEFYRIIFIHVPSSIISMFLYLIMAGYAALGLIFNTRLS--SMMASAIA
B6.L.cholo      GFVIAPTDATQGEVYRVIFIHVPTAWVSMVLYLAMAFWAAIGWAFNARMG--SMLARAIA
Ga1.Pe.syr      GLAFAPPDYQQGNSFRIIYIHVPAAMLAQSCYVMLAVCGLVGLVWRIKLA--DVALHCAA
Ga2.Pe.men      GLAFAPPDYQQGNSFRIIYIHVPAAFLAQSIYVTLAIAGLVGLVWKMKLA--DVALQQAA
Ga7.Ne.cae      ALMFAPEDYQQGNSFRIIYIHVPSAILAQSCYMLMAVAGAIGLIWKMKVA--DMVAKSCA
Ga3.Ac.suc      GLAFAPADYQQGNSFRIMYVHVPSAIWSMSIYVAMAIAGVIGLVWQIKQA--HLSIIAMA
Ga6.He.inf      GLAFAPADYQQGNSFRIMYVHVPTAIWSMGVYGSMAIAAVVALVWQIKQA--HLAMIAMA
Ga5.Py.ing      GLLFAPADYQQGDSFRIIYIHVPAAMMAMGAYSSMAIAAFVALVWQIRLA--EMTVAAMA
Ga8.Ste.ma      ALLVVPPEAKQLDSFRILYIHVPSAWMSLFVFALMALYAAIALIWRIKVC--EILAMACA
                                                                            

D4.Sti.aur      EVGLLFGAVGVLLGAIWGRPTWGVYWTWDPRLTTAAILLVAYMGYMALRRFVEDAEKRAV
D5.My.xant      EIGLVLGTAGMITGAIWGRPTWGVYWSWDPRLTSQAIMLVTYTGYLVLRRFVEDPEKRAT
gi25637115      EAGVVFTGLTLVTGSIWGRPTWGVWWTWDALLTATAVLFLLYLGYLALRRIPMDEERRAK
gi22163320      ELGFIFTTLVLLTGSIWGRPIWGTWWTWDARLTTTLILWFIYLGYFLLRAYVADPERGAR
gi11971618      EIGVLFCSLTLFLGSLWGRPVWGTWWTWDPRLTTTVVLLLIYLGYLSVRRVADSPSRRAH
h.GC.Gram+      EVALIFVIMVMASGEMWERFEWGVWWTWEPRLTTYFILTLLVMGYFVLRAAVDEPERRAV
gi25779231      EIALLFVACTMITGDLWTRFEWGVWWTWDPRLTTYLILMLIIIAYFILRNAIDEPERRAT
gi21063485      QITLVFIVATMISGDLWTRFEWGVWWVWEPRLTTYFILMLLVIGYFVLRNALDDPEKAAR
D1.Ds.desu      EIGVLFSGLALVTGSVWGRHSWGVWWTWDPRLTTTLVMWFVYAGYLMLRSMGLARERRAV
D3.Ds.Delt      EVGVLCSGLALVTGSIWGRHSWGVWWTWDPRLTTTLVMWFVYAGYLVLRSMNLSRDRQAT
D2.Ds.desu      EVGVLLSGLALVTGMLWARRSWGVWWTWDPRLTTTLIMWFVYAGYLVLRGLDLPPQRRNM
D6.So.Delt      EVAVAMGLIVLVTGPLWAAKAWGVYWTWDPRLTTSLLSVLIYIAYVVLRAFTGDSDAERK
F1.Ba.sele      EIGVIFTAIVLTTGPIWARSAWNTWWTWEPRLTTTLILFFMYIGYIMIRNLDMEWQRKAR
F3.Hl.oren      EIGVVFISIVLITGPLWAKPVWNTWWTWDPRLTTTLILWFMYVAYLILHGGREKNEKRER
F2.C.hydro      EIGVVFTTIVITTGPIWAKTVWNAWWTWDPKLTTAIIMWFIYLAYVVLRLAAGEEEKTAR
GOS_109801      ----------------WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVAL
F4.Dt.Firm      ELGTIFCVLATVTGAIWSHAAWGVYWNWDPRQTSIAVLLMIYAAYFVLRSAIPDSDRRAR
F5.Mi.Firm      RLGLIFVVLATLSGAVFSKLTWGSYWNWDPRQTTIFVLLLIYAAYLTLRSVIPDAHRRAR
GN.b.Chlor      EAGFLFCVLATTSGMWFANIVWGTPWNWDPRETTILILLLIYAAYFALRSALDDVERRRR
A1.Sa.stel      PVGAVMTVIALATGAIWGQPMWGTWWAWDPRLTSFLILFLFYLGYMALWEAIENDDSAAD
A2.Rhb.cap      PIGMVMTLIALITGAFWGQPMWGTWWEWDPRLTSFLILFLFYLGYMALWEAIENPDTAAD
A3.Rhba.Al      PIGITMTLIAIATGAIWGKPMWGTYWAWDPRLTSFMILLVFYFGYLALWEAIEDKDTAAD
A5.Me.nodu      PVGAAFTLICLVTGSLWGKPMWGTYWVWDARLTSMLVLLLIYCGLLALWRTIEDPGRAAR
A7.Az.caul      PVGATFTCLCLITGALWGRPMWGTYWVWDARLTSVLVLFLLYLGVMALRAAIDDPNRAGR
A4.O.alexa      PAGAVFAFICLATGSLWGRPMWGAWWVWDARLTSMLVLFLLYLGYMALRGAIEDEKLSAR
B2.Bu.xeno      PTGALFTFIALLSGALWGKPTWGAWWVWDARLSSELILLFLYIGFISLHAAIDEPRRADR
B8.Ra.pick      PTGALFTAIALWTGALWGKPTWGTWWVWDARLTSELLLLFLYLGFIALESAIEDPRRAER
B4.Nim.eur      PTGAMFTFLALWTGAWWGKPMWGTWWVWDARLTSELILFFLYIGFMSLQAAIDDPRRADK
B7.Nis.mul      PTGAMFTFIALWTGALWGKPMWGTWWVWDARLTSELILLFLYIGFMSLQAAIDDPRRADK
B5.Nim.eut      PTGAMFTFLSLWTGALWGKPMWGTWWVWDARLTSELILLFLYIGFMALQSAVDEPRRADK
B3.Rhf.fer      PTGALFAFLSLITGSLWGKPMWGAWWVWDARLTSELILLFLYLGFLALQSSIDDPRRADK
B9.Dc.arom      PTGALMAFISLWTGALWGKPMWGAWWVWDARLTSELILLFLYIGYMALTAAIDDARRADK
B1.Ga.Beta      PTGALFAFISLWTGALWGKPMWGAWWVWDARLTSELILLFLYLGFIALHASIDDPRRADR
B6.L.cholo      PTGALFTFMALWTGALWGKPTWGTWWVWDARLTSEFILLLLYLGYMALVAAIDDTRRADR
Ga1.Pe.syr      PIGAWMTALALATGAIWGKPTWGAWWVWDARLTSMLILLFLYFGLIALGNAISNRDSAAK
Ga2.Pe.men      PIGAWMTAIALLTGAIWGKPTWGTYWVWDARLTSMLILLFLYFGVIALGNAISNRDSAAK
Ga7.Ne.cae      PIGASIAVLALATGAIWGKPTWGSWWVWDARLTSMLILLFLYLGVIALHSAIENEATAAQ
Ga3.Ac.suc      PIGAVFNFLALATGSIWGKPMWGTWWVWDARLTASLILFFLYLGVMALYSSFQDRNTGMK
Ga6.He.inf      PIGALFTFLSLVTGAIWGKPMWGTWWVWDARLTAELILFFLYLGVLALYSAFSDRNIGAK
Ga5.Py.ing      PVGAVFTFIALFTGAAWGKPMWGAWWVWDARLTSELILLFIYLGIIALYNAFSDKVLAGR
Ga8.Ste.ma      PMGAGFTLITLLTGSIWGKGTWGTWWDWDPRMTSELVLLFLYLGVIGLYHAIEDRRSAAR
                                :    *.  * *:.   :  :  .   . . :            

D4.Sti.aur      WSAVVGIIAAVDLP-IIWFSVKWWRSLHQVQ-----------------------------
D5.My.xant      WSSVVAIIGAINLP-IVWFSVRWWRSLHQVQ-----------------------------
gi25637115      RSAIWALIAFIDVP-IVNQSVYWWHTLHQRPTL---------------------------
gi22163320      YAAVLGIVGFVDIP-IIHMSVRWWRTLHPQPIV---------------------------
gi11971618      WSAVIGVIGFIDVP-IVHMSVVWWRSLHQEATV---------------------------
h.GC.Gram+      FASVFGIIMFIDVP-ICFAITRLVPSGVHP------------------------------
gi25779231      YGAVLSIIALIDVP-ICFMVTRLIPSSIHP------------------------------
gi21063485      FAAVFCIVAFVDAP-ISFLITRLVPSSVHP------------------------------
D1.Ds.desu      VCAVLGIVAFIDVP-LVFFSARLWRS-IHP------------------------------
D3.Ds.Delt      VSAVVGIAAFVDVP-LVFLSARLWRS-IHP------------------------------
D2.Ds.desu      VCAVVGVVAFLDVP-LVFLSARIWRS-IHP------------------------------
D6.So.Delt      FAAALGVLGAANLP-IIHYSVKMWGG-NHP------------------------------
F1.Ba.sele      LASVFGIISFINVP-IVYMSIRWWESNLHP------------------------------
F3.Hl.oren      LAAVYGIIAFINVP-LVFFSIRWWRT-IHP------------------------------
F2.C.hydro      FAAIFGIIGFLDVP-LVFAAGRWWQKTFHP------------------------------
GOS_109801      VCAIIGIIAFLNIP-IIFASVNFWAAEIQS------------------------------
F4.Dt.Firm      LSAVYSILAFITVPFLVFIVPRIYYS-LHP------------------------------
F5.Mi.Firm      VAAIYALFSFLTVPFLVFIIPRFYFS-LHP------------------------------
GN.b.Chlor      LSAVYNLFAAVTMPFLLFVAPRMAESTLHPNCAFIQGSHCDGIWLEMNGTRVGQLGDVVL
A1.Sa.stel      LTSILCLVGSVFAI-LSRYAVNFWNQGLHQGASVMRAG----------------------
A2.Rhb.cap      LTGVLCLVGSVFAV-LSRYAAIFWNQGLHQGS----------------------------
A3.Rhba.Al      LTSILCIVGSVFAL-LSRYAVNFWSQGLHQGA----------------------------
A5.Me.nodu      AVAILTLVGAVNLP-IIKFSVNWWST-LHQPA----------------------------
A7.Az.caul      AAAVLTLVGFINVP-IVKFSVDWWNT-LHQPA----------------------------
A4.O.alexa      AGAVLAMAGLINLP-VIKFSVDWWNT-LHQGA----------------------------
B2.Bu.xeno      ACAVLGLIGVVNIP-VIYFSVQWWYT-LHQGP----------------------------
B8.Ra.pick      ACAVLGVVGVVNIP-VIYFSVQWWNT-LHQGA----------------------------
B4.Nim.eur      AGAIIALVGVVNIP-IIYFSVQWWNT-LHQGA----------------------------
B7.Nis.mul      AGAVIALVGVVNVP-IIYFSVKWWNT-LHQGA----------------------------
B5.Nim.eut      AGAVLALVGVVNIP-IIYFSVQWWNT-LHQGA----------------------------
B3.Rhf.fer      ACAVLALVGVVNVP-IIYFSVKWWNT-LHQGA----------------------------
B9.Dc.arom      AGGLLLLVGVVNVP-IIYFSVKWWNT-LHQGS----------------------------
B1.Ga.Beta      AAALLAIVGSVNVP-IIYFSVKWWNT-LHQGS----------------------------
B6.L.cholo      AGALLAVVGAVNVP-IIYFSVKWWNT-LHQGA----------------------------
Ga1.Pe.syr      ACAVLAIVGVVNIP-IIKYSVEWWNT-LHQGS----------------------------
Ga2.Pe.men      ACAVLAIVGVVNIP-IIKYSVEWWNS-LHQTA----------------------------
Ga7.Ne.cae      SSAVLSLVGLVNIP-IIKYSVEWWNT-LHQPA----------------------------
Ga3.Ac.suc      ATAILCIVGVINIP-IIHFSVEWWNT-LHQGA----------------------------
Ga6.He.inf      AAGILCITTVVILP-IIHFSVEWWNT-LHQGA----------------------------
Ga5.Py.ing      AASILTLVGVINLP-IIHYSVVWWNT-LHQGP----------------------------
Ga8.Ste.ma      AAGLLAIVGVSLLP-VIRYSVDWWGG-LHQRQ----------------------------
                  .   :        :                                            

D4.Sti.aur      ------------------------------------------------------------
D5.My.xant      ------------------------------------------------------------
gi25637115      --------------------------------------------------------TVGP
gi22163320      --------------------------------------------------------VR--
gi11971618      --------------------------------------------------------VR--
h.GC.Gram+      --------------------------------------------------------TIFR
gi25779231      --------------------------------------------------------VVVR
gi21063485      --------------------------------------------------------VVFR
D1.Ds.desu      --------------------------------------------------------SVFA
D3.Ds.Delt      --------------------------------------------------------AVFA
D2.Ds.desu      --------------------------------------------------------SVFA
D6.So.Delt      --------------------------------------------------------TVIT
F1.Ba.sele      --------------------------------------------------------VVVG
F3.Hl.oren      --------------------------------------------------------VVIS
F2.C.hydro      --------------------------------------------------------IIFN
GOS_109801      --------------------------------------------------------HPQL
F4.Dt.Firm      ---------------------------------------------------------DLI
F5.Mi.Firm      ---------------------------------------------------------APV
GN.b.Chlor      ALQGIEQRGDLAVVQVEVRMPGLRDVALLTPSFELSSGKPADRPEFPGQQFLLAVEGVDL
A1.Sa.stel      --------------------------------------------------------ALAG
A2.Rhb.cap      --------------------------------------------------------TLSL
A3.Rhba.Al      --------------------------------------------------------SLSL
A5.Me.nodu      --------------------------------------------------------SILR
A7.Az.caul      --------------------------------------------------------SVFR
A4.O.alexa      --------------------------------------------------------SVFR
B2.Bu.xeno      --------------------------------------------------------SLGF
B8.Ra.pick      --------------------------------------------------------SISL
B4.Nim.eur      --------------------------------------------------------SVSL
B7.Nis.mul      --------------------------------------------------------SVSL
B5.Nim.eut      --------------------------------------------------------SVSL
B3.Rhf.fer      --------------------------------------------------------SVSL
B9.Dc.arom      --------------------------------------------------------SVNL
B1.Ga.Beta      --------------------------------------------------------TIKY
B6.L.cholo      --------------------------------------------------------SVSL
Ga1.Pe.syr      --------------------------------------------------------TFSL
Ga2.Pe.men      --------------------------------------------------------TFKI
Ga7.Ne.cae      --------------------------------------------------------TFTL
Ga3.Ac.suc      --------------------------------------------------------SITK
Ga6.He.inf      --------------------------------------------------------SITK
Ga5.Py.ing      --------------------------------------------------------TISK
Ga8.Ste.ma      --------------------------------------------------------SINV
                                                                            

D4.Sti.aur      SSPKTVD------------PAMVFPLRISAFAFLAFMIVFLIYRYRIALHERQAEVALPE
D5.My.xant      STPKTVD------------PEMTLALRVSAFGMLFLTLWFLVLRYRQALAEREAEVALPD
gi25637115      TNAVEVH------------GIMAVALAVSFVSFTLVWIWMVWARFDLARRQRVLEEAEVE
gi22163320      SEGPAMP------------PEMLVTMIVTLVAFCILYVFLLAVKYRIETTRDEVM-----
gi11971618      AGAPTMD------------PGMLATLLLGAVAFSIVYGYLMAVRMRVGRLEDSAAGSLMR
h.GC.Gram+      TDSGLS-------------PDMLMPLLLALFGMMFIAYGLYLLRVRTAELENRLEHAKEI
gi25779231      -EGGMS-------------ADMGITLMFCLVGIMLIGFALYRFRFRQVRLTERVEALKEQ
gi21063485      TDSGLP-------------PLMLIPFLLGMAGVLMIAFALYRYALRVNAAADEVEDLKRR
D1.Ds.desu      SRGGGL------------EPEMLTTAVVCVLCFGFLWYALTAIRTRQLADTDRLD----S
D3.Ds.Delt      SRDGGL------------EPEMKLTAVVCVAVFGLMWAALTGVRYMQTRQTDRLD----T
D2.Ds.desu      SKEGGL------------EPEMRLTVIACVLSFGLLWAGLVWLRKRQLDLAARLDRLQQS
D6.So.Delt      GKGGGLG-----------HPDMKMALGFGFLSFTLLTLALVWARYRVDLASARLAELEQE
F1.Ba.sele      QGGGGL------------ETSMLITLIFSVFTFTCLFVVLLQRGLQVEKLRLAVARLKSR
F3.Hl.oren      TSGISI------------TGEMLFTLLFSLATFTLLYVYLLKTRCRGIKLAYKIDLLKER
F2.C.hydro      NPSGGL------------DPAMKPAFFISLFAFTALYIYLLVKSARINLLHRELNRLKDI
GOS_109801      GMNKQP-------------SGILNPFLFSLLSFTSLMIFMLLLKIEVLKKKDIEDRYV--
F4.Dt.Firm      GAGEGVSVMSG---------EVLVVFLASLAGFTALYAWMYKVQVRL----ENLLYKQAM
F5.Mi.Firm      INGSGSIDMDP---------VMLKTLLASLLDMTLIYIAVLYHRVNS----ERGVHHET-
GN.b.Chlor      TNGRALLNMEAPGTGLLSNSRTFWTFMAANIGFLGLFIWLYRLRADVLLLQERLARREVT
A1.Sa.stel      DTEERVSNV------------YAVPLFVCMAGFVLLFIALVFLRTQTEIRARRTRALMAR
A2.Rhb.cap      DKEEHIADV------------YWQPLVLSIAGFGMLFVALLLLRTRTEIRARRLKALEQR
A3.Rhba.Al      DKEQHVDNT------------FYFPLLICIAGMVLLFMTLVLIRTRTEIRSRRLLALRLR
A5.Me.nodu      MGGPTIHPT------------MLYPLLVMIAAFSVLGIALHLAAMRTEILRRRVRTLAIL
A7.Az.caul      MGGSTIDGS------------LLWPLLTCATGFTLLFLALHMLAMRTEILRRRVQALEAR
A4.O.alexa      FDGPTIDAS------------QLWPLAIMALGFTVLYLALVLTQMRAMMMERRAEALERR
B2.Bu.xeno      GSGVSMSES------------MVWGIVVMSFGFWAYSIAVTFVRVRVIIRTRERTSPWEA
B8.Ra.pick      TAAPSMAMT------------MLLGMLLMTLACWMYSICVALIRVRCIMRERADDDLNPS
B4.Nim.eur      IQSPKMATA------------MLSGMLIMALAVWMYSIVMILIRARLIILERERHTAWVS
B7.Nis.mul      TQSPKMATT------------MLTGMLIMSIACWMYAIAVILIRTRAIILERERHTAWVG
B5.Nim.eut      TQAPSMAAL------------MLIGMLLMALASWMYTVAIVLMRVRCIILEREQHAGWLD
B3.Rhf.fer      TRSPTMAST------------MLAGMLIMVVAFWMYTIATTLARVRNIILDRERHTEWVK
B9.Dc.arom      AKS-SMAQT------------MLWGMLLMAMCFWMYSIAVALMRVRTIMLERERNTDWVK
B1.Ga.Beta      SGT-SMHIA------------MQQAMFTMLAACWLYAIAIALMRVRSIILEREKNTKWIT
B6.L.cholo      TAAPKMAET------------MLNAMLLMSLACWAYAFAMVFMRTRAIILERERETAWVG
Ga1.Pe.syr      TEKPAMPAE------------MWLPLLFTTLGFYCLFGVLLMMRMRLEVLRREARTQWVK
Ga2.Pe.men      TEKPAMPVE------------MWLPLLLAVLGFYCFFGAVLLYRMRLEVLKREARSSWVK
Ga7.Ne.cae      TERPAMPAE------------MWVPLLVMVIGFYCMFAVSLMMRTRNEILYRERRASWVR
Ga3.Ac.suc      FEKPSIATP------------MLIPLIFSIFGFMALTVWLTLVRYRNALLREDIKRPWVR
Ga6.He.inf      FEKPSIAIP------------MLVPLILCIFGFLTLYIWLTLVRYRVELLKEDAKRPWVK
Ga5.Py.ing      FGKPSMALE------------MLWPLLIMILAFATLLGALTLMRFRNEILARESHRPWVR
Ga8.Ste.ma      FGESAISSA------------MIAPLWWMVIGTKFWFAGSVLAKARADNLDREAGKAWVG
                                                                            

D4.Sti.aur      ALP--TDDPAS--RRSAGVA----------------------------------------
D5.My.xant      ALP--SDLAAAGGANSTRVA----------------------------------------
gi25637115      QAL--AERLEAVEAGS--------------------------------------------
gi22163320      ------ELRGTLEQYG--------------------------------------------
gi11971618      RPTPRAGLVGARAEGGERRG----------------------------------------
h.GC.Gram+      LDEE--------------------------------------------------------
gi25779231      LED---------------------------------------------------------
gi21063485      LEELDGEASRAAAAAALDRLQARAADVALTGGSGGARGATAFDASAGSRAPGEADTPAGS
D1.Ds.desu      LATTDDL-----------------------------------------------------
D3.Ds.Delt      LATREAL-----------------------------------------------------
D2.Ds.desu      HCTPEGL-----------------------------------------------------
D6.So.Delt      ALEAGIGED---------------------------------------------------
F1.Ba.sele      KQERMIS-----------------------------------------------------
F3.Hl.oren      IGGY--------------------------------------------------------
F2.C.hydro      VNEKFYG-----------------------------------------------------
GOS_109801      ------------------------------------------------------------
F4.Dt.Firm      KRGA--------------------------------------------------------
F5.Mi.Firm      ------------------------------------------------------------
GN.b.Chlor      YGLPA-------------------------------------------------------
A1.Sa.stel      ERVA--------------------------------------------------------
A2.Rhb.cap      ERMA--------------------------------------------------------
A3.Rhba.Al      NN----------------------------------------------------------
A5.Me.nodu      EAERLDGLPAPQAA----------------------------------------------
A7.Az.caul      AAAR-DGA----------------------------------------------------
A4.O.alexa      RERRLELEAEL-------------------------------------------------
B2.Bu.xeno      RLEERPA-----------------------------------------------------
B8.Ra.pick      ----TPA-----------------------------------------------------
B4.Nim.eur      ELKEGVLE----------------------------------------------------
B7.Nis.mul      QLQEAAQ-----------------------------------------------------
B5.Nim.eut      ELKEVKQ-----------------------------------------------------
B3.Rhf.fer      NAVE--------------------------------------------------------
B9.Dc.arom      AVLEGEGK----------------------------------------------------
B1.Ga.Beta      ELAEVK------------------------------------------------------
B6.L.cholo      ELAGRPT-----------------------------------------------------
Ga1.Pe.syr      AEILRSLGHTAAQSENTL------------------------------------------
Ga2.Pe.men      TEVQNLVEGKA-------------------------------------------------
Ga7.Ne.cae      ELLEKQ------------------------------------------------------
Ga3.Ac.suc      ALVK--------------------------------------------------------
Ga6.He.inf      ALAQTLK-----------------------------------------------------
Ga5.Py.ing      QLALNNVKMTGKN-----------------------------------------------
Ga8.Ste.ma      GRVDAARPAGEAQP----------------------------------------------
                                                                            

D4.Sti.aur      --------------------------
D5.My.xant      --------------------------
gi25637115      --------------------------
gi22163320      --------------------------
gi11971618      --------------------------
h.GC.Gram+      --------------------------
gi25779231      --------------------------
gi21063485      RAPGEADAPTRSCPDVSRASHMPKED
D1.Ds.desu      --------------------------
D3.Ds.Delt      --------------------------
D2.Ds.desu      --------------------------
D6.So.Delt      --------------------------
F1.Ba.sele      --------------------------
F3.Hl.oren      --------------------------
F2.C.hydro      --------------------------
GOS_109801      --------------------------
F4.Dt.Firm      --------------------------
F5.Mi.Firm      --------------------------
GN.b.Chlor      --------------------------
A1.Sa.stel      --------------------------
A2.Rhb.cap      --------------------------
A3.Rhba.Al      --------------------------
A5.Me.nodu      --------------------------
A7.Az.caul      --------------------------
A4.O.alexa      --------------------------
B2.Bu.xeno      --------------------------
B8.Ra.pick      --------------------------
B4.Nim.eur      --------------------------
B7.Nis.mul      --------------------------
B5.Nim.eut      --------------------------
B3.Rhf.fer      --------------------------
B9.Dc.arom      --------------------------
B1.Ga.Beta      --------------------------
B6.L.cholo      --------------------------
Ga1.Pe.syr      --------------------------
Ga2.Pe.men      --------------------------
Ga7.Ne.cae      --------------------------
Ga3.Ac.suc      --------------------------
Ga6.He.inf      --------------------------
Ga5.Py.ing      --------------------------
Ga8.Ste.ma

Protein Domains

PROTOCOLE: interPro/Submit job/Table View/Raw Output



ANALYSE DES RÉSULTATS:


Pour déterminer les domaines protéiques de notre séquence nous avons utilisés interpro et au vu des résultas il semblerait que notre séquence présente des domaines protéiques conservés similaires à d'autres protéines. Nous avons choisi le domaine de numéro d'accesion IPR002541 vu que les autres domaines étaient les "children" du domaine choisi. La e value est assez basse pour penser que ce n'est pas dû au hasard. Il semblerait également que ce domaine est une fonction relative à un héme transporteur appartenant à la super famille des cytochromes C.

RÉSULTATS BRUTS:
GOS_1098010	16510EA0EE9C931C	122	SignalPHMM	SignalP	signal-peptide	1	32	NA	?	28-Oct-2009	NULL	NULL
GOS_1098010	16510EA0EE9C931C	122	TMHMM	tmhmm	transmembrane_regions	14	32	NA	?	28-Oct-2009	NULL	NULL
GOS_1098010	16510EA0EE9C931C	122	TMHMM	tmhmm	transmembrane_regions	42	62	NA	?	28-Oct-2009	NULL	NULL
GOS_1098010	16510EA0EE9C931C	122	TMHMM	tmhmm	transmembrane_regions	86	106	NA	?	28-Oct-2009	NULL	NULL
GOS_1098010	16510EA0EE9C931C	122	HMMPfam	PF01578	Cytochrom_C_asm	1	67	        5.7e-09	T	         8-Oct-2009	IPR002541	Cytochrome c assembly protein	Biological Process: protein complex assembly (GO:0006461), Biological Process: respiratory chain complex IV assembly (GO:0008535), Cellular Component: membrane (GO:0016020)
GOS_1098010	16510EA0EE9C931C	122	FPrintScan	PR01386	CCMCBIOGNSIS	8	28	3.4e-12	T	28-Oct-2009	IPR003557	Cytochrome c-type biogenesis protein CcmC	Molecular Function: heme transporter activity (GO:0015232), Biological Process: heme transport (GO:0015886), Cellular Component: membrane (GO:0016020), Biological Process: cytochrome complex assembly (GO:0017004)
GOS_1098010	16510EA0EE9C931C	122	FPrintScan	PR01386	CCMCBIOGNSIS	43	69	3.4e-12	T	28-Oct-2009	IPR003557	Cytochrome c-type biogenesis protein CcmC	Molecular Function: heme transporter activity (GO:0015232), Biological Process: heme transport (GO:0015886), Cellular Component: membrane (GO:0016020), Biological Process: cytochrome complex assembly (GO:0017004)
GOS_1098010	16510EA0EE9C931C	122	FPrintScan	PR01386	CCMCBIOGNSIS	89	113	3.4e-12	T	28-Oct-2009	IPR003557	Cytochrome c-type biogenesis protein CcmC	Molecular Function: heme transporter activity (GO:0015232), Biological Process: heme transport (GO:0015886), Cellular Component: membrane (GO:0016020), Biological Process: cytochrome complex assembly (GO:0017004)

Phylogeny

PROTOCOLE:

a)phylogeny.fr/à la carte/bioNJ/paramètres par defaut (pas de bootstrap)/Groupe exterieur protéobactéries sauf groupe delta


b)phylogeny.fr/à la carte/phyML/paramètres par defaut (pas de bootstrap)/Groupe exterieur protéobactéries sauf groupe delta



PROTOCOLE UTILISÉ EN INTEGRANT LES AUTRES BACTÉRIES TEL QUE SUGGERÉ PAR LA 1ÈRE CORRECTION:


a)phylogeny.fr/à la carte/phyML/paramètres par defaut (pas de bootstrap)/Groupe exterieur autres bactéries(firmicutes,GNS)


b)phylogeny.fr/à la carte/bioNJ/paramètres par defaut (pas de bootstrap)/Groupe exterieur autres bactéries(firmicutes,GNS)




Analyse des résultats:

On distingue bien une séparation entre notre groupe d'étude:les (d proteobactéries) et notre groupe extérieur: (ensemble des protéobactéries).

On peut par ailleurs remarquer que notre séquence émerge au sein de notre groupe d'étude donc le groupe d'étude choisi semble cohérent. On peut donc conclure que notre séquence provient d'une delta proteobactérie. En outre,


-L'arbre semble être cohérent avec la méthode des distances

-L'arbre semble également être cohérent avec l'arbre produit par le maximum de vraissemblance

-la séquence semble s'intégrer dans le groupe des delta-protéobactéries




Analyse des résultats en intégrant les autres bactéries tel que suggéré par la 1ère correction:


En incluant les autrtes bactéries telles que les firmicutes et les GNS, nous obtenons deux groupes distincts les protéobactéries groupe d'étude, les autres bactéries.


Nous constatons également que notre séquence GOS émmerge entre les Delta et les firmicutes que nous avons rajouté. On peut donc penser à un transfert horizontal des delta vers les autres bactéries notamment les firmicutes.



Ainsi, que nous considérons l'arbre de BioNJ ou l'arbre de PhyML obtenus aprés intégration des autres bactéries, nous remarquons que notre séquence apparait au sein des delta et des firmicutes. Ce fait renforce l'hypothèse d'un transfert horizontal des delta vers les firmicutes. Et c'est probablement de ce transfert qu'est issue notre séquence.


De plus ces arbres sont concordants et respectent globalement la phylogénie de référence.


On peut donc conclure que notre séquence provient d'un transfert horizontal des delta vers les firmicutes





RÉSULTATS BRUTS:
    
a)

                                                                          ------0.2----
 
                                             +-------Alphapro3_Rhodobacterales/Alphaproteobacteria/ZP_01449272.1_gi_1
                                             |
             +-------------------------------+    +-----Alphapro2_Rhodobacter_capsulatus/Alphaproteobacteria/P29961.1_gi
             |                               +----+
             |                                    +---Alphapro1_Sagittula_stellata_E-37/Alphaproteobacteria/ZP_0174839
             |
             |  +-------------Alphapro5_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
 +-----------+  |
 |           |  |    +------------Alphapro4_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/Z
 |           |  | +--+
 |           |  | |  |
 |           |  | |  +--------Alphapro7_Azorhizobium_caulinodans_ORS_571/Alphaproteobacteria/Y
 |           |  | |
 |           +--+ |        +---------Gammapro7_Neptuniibacter_caesariensis/Gammaproteobacteria/ZP_011
 |              | |    +---+
 |              | |    |   |     +-Gammapro1_Pseudomonas_syringae_pv._syringae_B728a/Gammaproteobac
 |              | |    |   +-----+
 |              | |    |         +---Gammapro2_Pseudomonas_mendocina_ymp/Gammaproteobacteria/YP_00118
 |              | |  +-+
 |              +-+  | |+---------------------------Gammapro8_Stenotrophomonas_maltophilia_R551-3/Gammaproteobacteri
 |                |  | ||
 |                |  | ++ +------------Gammapro5_Psychromonas_ingrahamii_37/Gammaproteobacteria/YP_9443
 |                |  |  | |
 |                |  |  +-+       +------Gammapro3_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/Y
 |                |  |    +-------+
 |                |  |            +---------Gammapro6_Haemophilus_influenzae_R3021/Gammaproteobacteria/ZP_01
 |                |  |
 |                |  |        +-------Betaprot6_Leptothrix_cholodnii_SP-6/Betaproteobacteria/YP_001790
 |                +--+      +-+
 |                   |      | +------Betaprot9_Dechloromonas_aromatica_RCB/Betaproteobacteria/YP_2871
 |                   |      |
 |                   |      |
 |                   |      | +----Betaprot5_Nitrosomonas_eutropha_C91/Betaproteobacteria/YP_746314
 |                   |      |-+
 |                   |      | | +---Betaprot4_Nitrosomonas_europaea_ATCC_19718/Betaproteobacteria/NP
 |                   |    +-+ +-+
 |                   |    | |   +-Betaprot7_Nitrosospira_multiformis_ATCC_25196/Betaproteobacteria
 |                   |    | |
 |                   |    | |+-----Betaprot10_Gallionella/Betaproteobacteria/ZP_04830534.1_gi_25182
 |                   +----+ ++
 |                        |  +---Betaprot3_Rhodoferax_ferrireducens_T118/Betaproteobacteria/YP_52
 |                        |
 |                        |   +-------Betaprot2_Burkholderia_xenovorans_LB400/Betaproteobacteria/YP_55
 |                        +---+
 |                            +------Betaprot8_Ralstonia_pickettii_12J/Betaproteobacteria/YP_00190040
 |
 |    +----------------------------------------Deltapro6_Sorangium/Deltaproteobacteria/YP_001613489.1_gi_162451
 |    |
 |    |            +----------------------------GOS_1098010_Traduction_3-368_sens_indirect
 |    |            |
 +----++-----------+
      ||           |                   +-----Deltapro1_Desulfovibrio_desulfuricans_subsp._desulfuricans_str.
      ||           +-------------------+
      ||                               | +--------------Deltapro2_Desulfovibrio_desulfuricans_subsp./Deltaproteobacteria
      ++                               +-+
       |                                 +----Deltapro3_Desulfovibrio/Deltaproteobacteria/ZP_04791348.1_gi_465
       |
       |            +-------Deltapro4_Stigmatella_aurantiaca_DW4/3-1/Deltaproteobacteria/ZP
       +------------+
                    +----------Deltapro5_Myxococcus_xanthus_DK_1622/Deltaproteobacteria/YP_6314

 

                  


 b)                                                                     -----0.2---
 
                                           +------------Deltapro2_Desulfovibrio_desulfuricans_subsp./Deltaproteobacteria
                                        +--+
                                        |  +-----Deltapro3_Desulfovibrio/Deltaproteobacteria/ZP_04791348.1_gi_465
                         +--------------+
       +-----------------+              +-Deltapro1_Desulfovibrio_desulfuricans_subsp._desulfuricans_str.
       |                 |
       |                 +--------------------------GOS_1098010_Traduction_3-368_sens_indirect
 +-----+
 |     |  +-----------------------------------Deltapro6_Sorangium/Deltaproteobacteria/YP_001613489.1_gi_162451
 |     |  |
 |     +--+
 |        |       +-----Deltapro4_Stigmatella_aurantiaca_DW4/3-1/Deltaproteobacteria/ZP
 |        +-------+
 |                +----------Deltapro5_Myxococcus_xanthus_DK_1622/Deltaproteobacteria/YP_6314
 |
 |                                        +-------Alphapro3_Rhodobacterales/Alphaproteobacteria/ZP_01449272.1_gi_1
 |              +-------------------------+
 |              |                         | +-----Alphapro2_Rhodobacter_capsulatus/Alphaproteobacteria/P29961.1_gi
 |              |                         +-+
 |              |                           +--Alphapro1_Sagittula_stellata_E-37/Alphaproteobacteria/ZP_0174839
 |              |
 +--------------+   +---------Alphapro5_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
                |   |
                |   |       +---------Alphapro4_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/Z
                |   |  +----+
                |   |  |    +-------Alphapro7_Azorhizobium_caulinodans_ORS_571/Alphaproteobacteria/Y
                |   |  |
                +---+  |             +--------Gammapro7_Neptuniibacter_caesariensis/Gammaproteobacteria/ZP_011
                    |  |             |
                    |  |           +-+    +-Gammapro1_Pseudomonas_syringae_pv._syringae_B728a/Gammaproteobac
                    |  |           | |    |
                    |  |           | +----+
                    +--+     +-----+      +Gammapro2_Pseudomonas_mendocina_ymp/Gammaproteobacteria/YP_00118
                       |     |     |
                       |     |     |  +-----------------Gammapro8_Stenotrophomonas_maltophilia_R551-3/Gammaproteobacteri
                       |     |     |  |
                       |     |     +--+   +-----------Gammapro5_Psychromonas_ingrahamii_37/Gammaproteobacteria/YP_9443
                       |     |        +---+
                       |     |            |     +------Gammapro3_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/Y
                       |     |            +-----+
                       +-----+                  +-----Gammapro6_Haemophilus_influenzae_R3021/Gammaproteobacteria/ZP_01
                             |
                             |        +-------Betaprot2_Burkholderia_xenovorans_LB400/Betaproteobacteria/YP_55
                             |     +--+
                             |     |  +-----Betaprot8_Ralstonia_pickettii_12J/Betaproteobacteria/YP_00190040
                             |     |
                             |     |  +--Betaprot5_Nitrosomonas_eutropha_C91/Betaproteobacteria/YP_746314
                             |     |  |
                             +-----+  |    +-------Betaprot6_Leptothrix_cholodnii_SP-6/Betaproteobacteria/YP_001790
                                   |--+    |
                                   |  |+---+
                                   |  ||   +---Betaprot9_Dechloromonas_aromatica_RCB/Betaproteobacteria/YP_2871
                                   |  ++
                                   |   | +-Betaprot4_Nitrosomonas_europaea_ATCC_19718/Betaproteobacteria/NP
                                   |   +-+
                                   |     +-Betaprot7_Nitrosospira_multiformis_ATCC_25196/Betaproteobacteria
                                   |
                                   |   +-----Betaprot10_Gallionella/Betaproteobacteria/ZP_04830534.1_gi_25182
                                   +---+
                                       +-Betaprot3_Rhodoferax_ferrireducens_T118/Betaproteobacteria/YP_52









 a)Arbre PhyMl obtenu en intégrant les autres bactéries(firmicutes, GNS)tel que suggéré par la 1ère correction::

                                                                   -------0.5------
 
                                           +-----Deltapro1_Desulfovibrio_desulfuricans_subsp._desulfuricans_str.
                                      +----+
                                      |    +------Deltapro3_Desulfovibrio/Deltaproteobacteria/ZP_04791348.1_gi_465
                    +-----------------+
               +----+                 +------Deltapro2_Desulfovibrio_desulfuricans_subsp./Deltaproteobacteria
               |    |
               |    +-----------------------GOS_1098010_Traduction_3-368_sens_indirect
              ++
              ||   +--------------Firmicut1_Bacillus_selenitireducens_MLS10/Firmicutes/ZP_02170570
              ||   |
              |+---+  +----------------------Firmicut2_Carboxydothermus_hydrogenoformans_Z-2901/Firmicutes/YP
              |    +--+
              |       +--------Firmicut3_Halothermothrix_orenii_H_168/Firmicutes/YP_002508134.1
        +-----+
        |     |               +-------high_GC_Gram+_Actinoba5_Eggerthella/Actinobacteria/YP_003182922.
        |     |               |
        |     |    +----------+  +---------high_GC_Gram+_Actinoba3_Cryptobacterium/Actinobacteria/YP_003150
        |     |    |          +--+
        |     |    |             +---------high_GC_Gram+_Actinoba4_Collinsella_stercoris_DSM_13279/Actinoba
        |     +----+
      +-+          |
      | |          |              +--------Firmicut4_Dethiobacter/Firmicutes/ZP_03729618.1_gi_225175624_ref
      | |          +--------------+
      | |                         |  +------------------GNS_bacteria_Chlorofl2_Roseiflexus_sp._RS-1/Chloroflexi/YP_00127
      | |                         +--+
 +----+ |                            +---------------Firmicut5_Mitsuokella/Firmicutes/ZP_05404459.1_gi_255659050_ref
 |    | |
 |    | +----------GNS_bacteria_Chlorofl1_Thermomicrobium_roseum_DSM_5159/Chlorofle
 |    |
 |    |  +---------------------high_GC_Gram+_Actinoba2_Acidimicrobium/Actinobacteria/YP_0031089
 |    +--+
 |       +---------high_GC_Gram+_Actinoba1_Nocardioides_sp._JS614/Actinobacteria/YP
 |
 |     +---------------------------Deltapro6_Sorangium/Deltaproteobacteria/YP_001613489.1_gi_162451
 |-----+
 |     |         +------Deltapro4_Stigmatella_aurantiaca_DW4/3-1/Deltaproteobacteria/ZP
 |     +---------+
 |               +--------Deltapro5_Myxococcus_xanthus_DK_1622/Deltaproteobacteria/YP_6314
 |
 |                +--------Alphapro4_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/Z
 |                |
 |              +-+  +-----------Alphapro5_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
 |              | +--+
 |              |    +-------Alphapro7_Azorhizobium_caulinodans_ORS_571/Alphaproteobacteria/Y
 |              |
 |              |      +--------------------Gammapro8_Stenotrophomonas_maltophilia_R551-3/Gammaproteobacteri
 |              |      |
 |              |      |                      +------Alphapro3_Rhodobacterales/Alphaproteobacteria/ZP_01449272.1_gi_1
 |              |     ++                      |
 |              |     ||  +-------------------+  +------Alphapro2_Rhodobacter_capsulatus/Alphaproteobacteria/P29961.1_gi
 |              |     ||  |                   +--+
 |              |     ||  |                      +----Alphapro1_Sagittula_stellata_E-37/Alphaproteobacteria/ZP_0174839
 |              |     |+--+
 |              |     |   |    +-------Gammapro7_Neptuniibacter_caesariensis/Gammaproteobacteria/ZP_011
 |              |     |   |    |
 |              | +---+   +----+   +--Gammapro1_Pseudomonas_syringae_pv._syringae_B728a/Gammaproteobac
 |              | |   |        +---+
 +--------------+ |   |            +---Gammapro2_Pseudomonas_mendocina_ymp/Gammaproteobacteria/YP_00118
                | |   |
                | |   |  +--------Gammapro5_Psychromonas_ingrahamii_37/Gammaproteobacteria/YP_9443
                | |   |  |
                | |   +--+
                | |      |       +-----Gammapro3_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/Y
                | |      +-------+
                | |              +-----Gammapro6_Haemophilus_influenzae_R3021/Gammaproteobacteria/ZP_01
                | |
                | |             +Betaprot5_10
                | |             |
                | |          +--+Betaprot5
                | |          |  |
                | |          |  +Betaprot5_Nitrosomonas_eutropha_C91/Betaproteobacteria/YP_746314
                | |          |
                | |          |         +Betaprot10_9
                | |          |         |
                +-+          |   +-----+Betaprot10
                  |          |   |     |
                  |         ++   |     +Betaprot10_Gallionella/Betaproteobacteria/ZP_04830534.1_gi_25182
                  |         ||+--+
                  |         |||  |     +Betaprot6_8
                  |         |||  |     |
                  |         |||  |     |Betaprot6
                  |         |||  +-----+
                  |         |||        +Betaprot6_Leptothrix_cholodnii_SP-6/Betaproteobacteria/YP_001790
                  |         |||
                  |         |++    +Betaprot4_7
                  |         | |    |
                  |         | |    |Betaprot4
                  |         | | +--+
                  |         | | |  +Betaprot4_Nitrosomonas_europaea_ATCC_19718/Betaproteobacteria/NP
                  |         | | |
                  |         | +-++Betaprot7_6
                  |         |   ||
                  |         |   ||Betaprot7
                  |         |   ++
                  +---------+    +Betaprot7_Nitrosospira_multiformis_ATCC_25196/Betaproteobacteria
                            |
                            |          +Betaprot2_5
                            |          |
                            |          |Betaprot2
                            |   +------+
                            |   |      |
                            |   |      +Betaprot2_Burkholderia_xenovorans_LB400/Betaproteobacteria/YP_55
                            |+--+
                            ||  |     +Betaprot8_4
                            ||  |     |
                            ||  +-----+Betaprot8
                            ||        |
                            |+        +Betaprot8_Ralstonia_pickettii_12J/Betaproteobacteria/YP_00190040
                            ||
                            ||    +Betaprot3_3
                            ||    |
                            |+----+Betaprot3
                            |     |
                            |     +Betaprot3_Rhodoferax_ferrireducens_T118/Betaproteobacteria/YP_52
                            |
                            |    +Betaprot9_2
                            |    |
                            +----+Betaprot9
                                 |
                                 +Betaprot9_Dechloromonas_aromatica_RCB/Betaproteobacteria/YP_2871

 b) Arbre BioNJ obtenu en intégrant les autres bactéries(firmicutes, GNS) tel que suggéré par la 1ère correction:



 
                                  +Betaprot9_10
                                  |
                                  |Betaprot9
                           +------+
                           |      +Betaprot9_Dechloromonas_aromatica_RCB/Betaproteobacteria/YP_2871
                           |
                           |    +Betaprot5_9
                           |    |
                           |    |Betaprot5
                           |----+
                           |    +Betaprot5_Nitrosomonas_eutropha_C91/Betaproteobacteria/YP_746314
                           |
                           |      +Betaprot4_8
                           |      |
                           |      |Betaprot4
                           |  +---+
                           |  |   +Betaprot4_Nitrosomonas_europaea_ATCC_19718/Betaproteobacteria/NP
                           |  |
                          ++--+ +Betaprot7_7
                          ||  | |
                          ||  | |
                          ||  +-+Betaprot7
                          ||    |
                          ||    +Betaprot7_Nitrosospira_multiformis_ATCC_25196/Betaproteobacteria
                          ||
                          ||    +Betaprot3_6
                          ||    |
                         +++----+Betaprot3
                         ||     |
                         ||     +Betaprot3_Rhodoferax_ferrireducens_T118/Betaproteobacteria/YP_52
                         ||
                         ||           +Betaprot2_5
                         ||           |
                         ||+----------+Betaprot2
                         |||          |
                         |||          +Betaprot2_Burkholderia_xenovorans_LB400/Betaproteobacteria/YP_55
                         |++
                         | |       +Betaprot8_4
                +--------+ |       |
                |        | +-------+Betaprot8
                |        |         |
                |        |         +Betaprot8_Ralstonia_pickettii_12J/Betaproteobacteria/YP_00190040
                |        |
                |        |        +Betaprot10_3
                |        |        |
                |        |        |Betaprot10
                |        |+-------+
                |        ||       +Betaprot10_Gallionella/Betaproteobacteria/ZP_04830534.1_gi_25182
                |        ||
                |        ++        +Betaprot6_2
              +-+         |        |
              | |         |        |Betaprot6
              | |         +--------+
              | |                  +Betaprot6_Leptothrix_cholodnii_SP-6/Betaproteobacteria/YP_001790
              | |
              | |   +------------------------Gammapro8_Stenotrophomonas_maltophilia_R551-3/Gammaproteobacteri
              | |   |
              | |+--+   +---------Gammapro7_Neptuniibacter_caesariensis/Gammaproteobacteria/ZP_011
              | ||  |   |
              | ||  +---+     +---Gammapro1_Pseudomonas_syringae_pv._syringae_B728a/Gammaproteobac
              | ||      |     |
  +-----------+ ++      +-----+
  |           |  |            +---Gammapro2_Pseudomonas_mendocina_ymp/Gammaproteobacteria/YP_00118
  |           |  |
  |           |  |  +----------Gammapro5_Psychromonas_ingrahamii_37/Gammaproteobacteria/YP_9443
  |           |  +--+
  |           |     |          +-----Gammapro3_Actinobacillus_succinogenes_130Z/Gammaproteobacteria/Y
  |           |     +----------+
  |           |                +--------Gammapro6_Haemophilus_influenzae_R3021/Gammaproteobacteria/ZP_01
  |           |
  |           | +------------Alphapro5_Methylobacterium_nodulans_ORS_2060/Alphaproteobacteria
  |           | |
 ++           | |                            +---------Alphapro3_Rhodobacterales/Alphaproteobacteria/ZP_01449272.1_gi_1
 ||           +-+ +--------------------------+
 ||             | |                          |  +-----Alphapro2_Rhodobacter_capsulatus/Alphaproteobacteria/P29961.1_gi
 ||             | |                          +--+
 ||             +-+                             +-------Alphapro1_Sagittula_stellata_E-37/Alphaproteobacteria/ZP_0174839
 ||               |
 ||               | +-----------Alphapro4_Oceanicaulis_alexandrii_HTCC2633/Alphaproteobacteria/Z
 ||               +-+
 ||                 +----------Alphapro7_Azorhizobium_caulinodans_ORS_571/Alphaproteobacteria/Y
 ||
 ||  +---------------------------------Deltapro6_Sorangium/Deltaproteobacteria/YP_001613489.1_gi_162451
 ||  |
 |+--+            +--------Deltapro4_Stigmatella_aurantiaca_DW4/3-1/Deltaproteobacteria/ZP
 |   +------------+
 |                +-----------Deltapro5_Myxococcus_xanthus_DK_1622/Deltaproteobacteria/YP_6314
 |
 |+-------------GNS_bacteria_Chlorofl1_Thermomicrobium_roseum_DSM_5159/Chlorofle
 ||
 ||                        +------------high_GC_Gram+_Actinoba4_Collinsella_stercoris_DSM_13279/Actinoba
 ||                        |
 ||       +----------------++--------------high_GC_Gram+_Actinoba3_Cryptobacterium/Actinobacteria/YP_003150
 ||       |                ++
 ||       |                 +-------------high_GC_Gram+_Actinoba5_Eggerthella/Actinobacteria/YP_003182922.
 ||     +-+
 ||     | |                +---------------Firmicut5_Mitsuokella/Firmicutes/ZP_05404459.1_gi_255659050_ref
 ||     | |                |
 ||     | +----------------+   +------------------------GNS_bacteria_Chlorofl2_Roseiflexus_sp._RS-1/Chloroflexi/YP_00127
 ++     |                  |   |
  |     |                  +---+
  |     |                      +---------------Firmicut4_Dethiobacter/Firmicutes/ZP_03729618.1_gi_225175624_ref
  |  +--+
  |  |  |  +-----------------------------GOS_1098010_Traduction_3-368_sens_indirect
  |  |  |  |
  |  |  |  |     +-------------------Firmicut1_Bacillus_selenitireducens_MLS10/Firmicutes/ZP_02170570
  |  |  |  |-----+
  |  |  |  |     | +-----------------------Firmicut2_Carboxydothermus_hydrogenoformans_Z-2901/Firmicutes/YP
  |  |  +--+     +-+
  |  |     |       +-------------Firmicut3_Halothermothrix_orenii_H_168/Firmicutes/YP_002508134.1
  +--+     |
     |     |               +-------------Deltapro2_Desulfovibrio_desulfuricans_subsp./Deltaproteobacteria
     |     +---------------+
     |                     |  +----Deltapro1_Desulfovibrio_desulfuricans_subsp._desulfuricans_str.
     |                     +--+
     |                        +----------Deltapro3_Desulfovibrio/Deltaproteobacteria/ZP_04791348.1_gi_465
     |
     |  +------------------------high_GC_Gram+_Actinoba2_Acidimicrobium/Actinobacteria/YP_0031089
     +--+
        +---------------high_GC_Gram+_Actinoba1_Nocardioides_sp._JS614/Actinobacteria/YP


 

Taxonomy report

PROTOCOLE:

BlastP contre swissprot/Taxonomy report

BlastP contre NRprot/Taxonomy report/query 1000




ANALYSE DES RÉSULTATS:

Dans les résultats de Blast obtenus,nous ne voyons pas de "cassure" nette de la e-value qui nous permettrait de distinguer le groupe d'étude du groupe extérieur. D'ailleur, sur le lignage report, on voit que les groupes taxonomiques ayant les six plus fortes evalues sont: Les [d-proteobacteria],[firmicutes],[GNS bacteria],[high GC Gram+]. Il faut bien admettre que c'est peu informatif.

Seulement, on sait que les firmicutes sont assez représentés (20.5%) dans la base de donnée et peu présent dans les dix e-value les plus fortes. ce n'est donc pas trés significatif.

Par contre le groupe des [d-proteobacteria] est bien représenté dans le classement malgré le fait qu'il ne prenne que 2.3% de la base de donnée.

Il semble donc logique de prendre les [d-proteobacteria] comme groupe d'étude monophylétique et un groupe extérieur de même niveau taxonomique donc constitué de l'ensemble des protéo bactéries.


PS:Les séquences au format fasta du groupe d'étude et des groupes extérieurs se trouvent au début du bloc note classées et annotées dans le même ordre que ce qui suit.


Groupe d'étude:

ref|YP_387968.1| 87 4e-16 [d-proteobacteria1]

ref|YP_002480937.1| 80 7e-14 [d-proteobacteria2]

ref|ZP_04791348.1| 77 6e-13 [d-proteobacteria3]

ref|ZP_01461144.1| 71 2e-11 [d-proteobacteria4]

ref|YP_631455.1| 62 2e-08 [d-proteobacteria5]

ref|YP_001613489.1| 54 4e-06 [d-proteobacteria6]


Groupe extérieur:

ref|ZP_01748393.1| 46 8e-04 [a-proteobacteria1]

sp|P29961.1| 53 9e-06 [a-proteobacteria2]

ref|ZP_01449272.1| 56 9e-07 [a-proteobacteria3]

ref|ZP_00957159.1| 60 6e-08 [a-proteobacteria4]

ref|YP_002495527.1| 63 9e-09 [a-proteobacteria5]

ref|YP_001527373.1| 71 3e-11 [a-proteobacteria7]


ref|YP_555629.1| 63 6e-09 [b-proteobacteria2]

ref|YP_521336.1| 61 3e-08 [b-proteobacteria3]

ref|NP_840840.1| 59 9e-08 [b-proteobacteria4]

ref|YP_746314.1| 59 1e-07 [b-proteobacteria5]

ref|YP_001790579.1| 56 8e-07 [b-proteobacteria6]

ref|YP_411907.1| 56 1e-06 [b-proteobacteria7]

ref|YP_001900404.1| 53 5e-06 [b-proteobacteria8]

ref|YP_287190.1| 51 2e-05 [b-proteobacteria9]

ref|ZP_04830534.1| 48 2e-04 [b-proteobacteria10]


ref|YP_236461.1| 71 2e-11 [g-proteobacteria1]

ref|YP_001188276.1| 67 4e-10 [g-proteobacteria2]

ref|YP_001344150.1| 65 1e-09 [g-proteobacteria3]

ref|YP_944323.1| 59 1e-07 [g-proteobacteria5]

ref|ZP_01785964.1| 56 1e-06 [g-proteobacteria6]

ref|ZP_01167364.1| 52 1e-05 [g-proteobacteria7]

ref|YP_002029084.1| 46 6e-04 [g-proteobacteria8]



Groupe d'étude aprés 1ére correction; les protéobactéries


ref|YP_387968.1| 87 4e-16 [d-proteobacteria1]

ref|YP_002480937.1| 80 7e-14 [d-proteobacteria2]

ref|ZP_04791348.1| 77 6e-13 [d-proteobacteria3]

ref|ZP_01461144.1| 71 2e-11 [d-proteobacteria4]

ref|YP_631455.1| 62 2e-08 [d-proteobacteria5]

ref|YP_001613489.1| 54 4e-06 [d-proteobacteria6]


ref|ZP_01748393.1| 46 8e-04 [a-proteobacteria1]

sp|P29961.1| 53 9e-06 [a-proteobacteria2]

ref|ZP_01449272.1| 56 9e-07 [a-proteobacteria3]

ref|ZP_00957159.1| 60 6e-08 [a-proteobacteria4]

ref|YP_002495527.1| 63 9e-09 [a-proteobacteria5]

ref|YP_001527373.1| 71 3e-11 [a-proteobacteria7]


ref|YP_555629.1| 63 6e-09 [b-proteobacteria2]

ref|YP_521336.1| 61 3e-08 [b-proteobacteria3]

ref|NP_840840.1| 59 9e-08 [b-proteobacteria4]

ref|YP_746314.1| 59 1e-07 [b-proteobacteria5]

ref|YP_001790579.1| 56 8e-07 [b-proteobacteria6]

ref|YP_411907.1| 56 1e-06 [b-proteobacteria7]

ref|YP_001900404.1| 53 5e-06 [b-proteobacteria8]

ref|YP_287190.1| 51 2e-05 [b-proteobacteria9]

ref|ZP_04830534.1| 48 2e-04 [b-proteobacteria10]


ref|YP_236461.1| 71 2e-11 [g-proteobacteria1]

ref|YP_001188276.1| 67 4e-10 [g-proteobacteria2]

ref|YP_001344150.1| 65 1e-09 [g-proteobacteria3]

ref|YP_944323.1| 59 1e-07 [g-proteobacteria5]

ref|ZP_01785964.1| 56 1e-06 [g-proteobacteria6]

ref|ZP_01167364.1| 52 1e-05 [g-proteobacteria7]

ref|YP_002029084.1| 46 6e-04 [g-proteobacteria8]


Groupe exterieur: les autres bactéries


ref|ZP_02170570.1| 87 5e-16 [firmicutes]

ref|YP_360214.1| 79 8e-14 [firmicutes]

ref|YP_002508134.1| 74 3e-12 [firmicutes]

ref|ZP_03729618.1| 54 3e-06 [firmicutes]

ref|ZP_05404459.1| 52 1e-05 [firmicutes]


ref|YP_002522425.1| 81 3e-14 [GNS bacteria]

ref|YP_003319667.1| 75 2e-12 [GNS bacteria]

ref|YP_001275121.1| 46 6e-04 [GNS bacteria]


ref|YP_923152.1| 80 7e-14 [high GC Gram+]

ref|YP_003108975.1| 68 2e-10 [high GC Gram+]

ref|ZP_06159956.1| 60 8e-08 [high GC Gram+]

ref|YP_003150905.1| 59 1e-07 [high GC Gram+]

ref|ZP_03298332.1| 56 6e-07 [high GC Gram+]

ref|YP_003182922.1| 56 1e-06 [high GC Gram+]






RÉSULTATS BRUTS:

BlastP contre swissprot

Lineage Report

cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Gammaproteobacteria [g-proteobacteria]
. . . . Pseudomonas aeruginosa ----------------------------   65 1 hit  [g-proteobacteria]  RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . . Escherichia coli O157:H7 ..........................   58 1 hit  [enterobacteria]    RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . . Escherichia coli O6 ...............................   58 1 hit  [enterobacteria]    RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . . Escherichia coli K-12 .............................   58 1 hit  [enterobacteria]    RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . . Shigella flexneri .................................   58 1 hit  [enterobacteria]    RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . . Haemophilus influenzae ............................   55 1 hit  [g-proteobacteria]  RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . Bradyrhizobium japonicum ----------------------------   62 1 hit  [a-proteobacteria]  RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . Rhodobacter capsulatus ..............................   53 1 hit  [a-proteobacteria]  RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . Paracoccus denitrificans PD1222 .....................   47 1 hit  [a-proteobacteria]  RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . Wolinella succinogenes ..............................   35 1 hit  [e-proteobacteria]  RecName: Full=Protein nrfI
. . Thermosynechococcus elongatus BP-1 --------------------   40 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Gloeobacter violaceus .................................   40 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. CC9902 ..............................   38 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. NATL1A ...................   38 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9211 .................   37 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. NATL2A ...................   36 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Acaryochloris marina MBIC11017 ........................   35 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. CC9311 ..............................   35 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. WH 7803 .............................   35 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9312 .................   35 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9215 .................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9301 .................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. AS9601 ...................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Trichodesmium erythraeum IMS101 .......................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. JA-2-3B'a(2-13) .....................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. JA-3-3Ab ............................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Nostoc punctiforme PCC 73102 ..........................   34 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Cyanothece sp. ATCC 51142 .............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. RCC307 ..............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus elongatus PCC 6301 ......................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1235
. . Synechococcus elongatus PCC 7942 ......................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1235
. . Nostoc sp. PCC 7120 ...................................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Cyanothece sp. PCC 8801 ...............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Anabaena variabilis ATCC 29413 ........................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechocystis sp. PCC 6803 ............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. WH 8102 .............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Cyanothece sp. PCC 7424 ...............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. CC9605 ..............................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus subsp. pastoris str. CCMP1986 .   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Microcystis aeruginosa NIES-843 .......................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9313 .................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9303 .................   33 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Prochlorococcus marinus str. MIT 9515 .................   32 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. . Synechococcus sp. PCC 7002 ............................   31 1 hit  [cyanobacteria]     RecName: Full=Cytochrome c biogenesis protein ccsA
. Marchantia polymorpha -----------------------------------   54 2 hits [liverworts]        RecName: Full=Putative cytochrome c biosynthesis ccmC-like 
. Arabidopsis thaliana (thale-cress) ......................   49 2 hits [eudicots]          RecName: Full=Putative cytochrome c biosynthesis ccmC-like 
. Heterosigma akashiwo NIES-293 ...........................   39 1 hit  [eukaryotes]        RecName: Full=Cytochrome c biogenesis protein ccsA >gi|2122
. Heterosigma akashiwo CCMP452 ............................   39 1 hit  [eukaryotes]        RecName: Full=Cytochrome c biogenesis protein ccsA >gi|2122
. Porphyra purpurea .......................................   38 1 hit  [red algae]         RecName: Full=Cytochrome c biogenesis protein ccsA
. Odontella sinensis ......................................   37 1 hit  [diatoms]           RecName: Full=Cytochrome c biogenesis protein ccsA
. Ipomoea purpurea ........................................   37 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Porphyra yezoensis ......................................   36 1 hit  [red algae]         RecName: Full=Cytochrome c biogenesis protein ccsA
. Welwitschia mirabilis ...................................   35 1 hit  [seed plants]       RecName: Full=Cytochrome c biogenesis protein ccsA
. Eucalyptus globulus subsp. globulus .....................   35 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Gossypium hirsutum (cotton) .............................   35 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Gossypium barbadense (Egyptian cotton) ..................   35 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Piper cenocladum ........................................   35 1 hit  [flowering plants]  RecName: Full=Cytochrome c biogenesis protein ccsA
. Cyanophora paradoxa .....................................   35 1 hit  [eukaryotes]        RecName: Full=Cytochrome c biogenesis protein ccsA
. Populus alba (abele) ....................................   34 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Populus trichocarpa (black cottonwood) ..................   34 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Manihot esculenta (yuca) ................................   34 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Guillardia theta ........................................   34 1 hit  [cryptomonads]      RecName: Full=Cytochrome c biogenesis protein ccsA
. Barbarea verna ..........................................   34 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Olimarabidopsis pumila ..................................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Cyanidium caldarium .....................................   33 1 hit  [red algae]         RecName: Full=Cytochrome c biogenesis protein ccsA
. Coffea arabica (arabica coffee) .........................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Adiantum capillus-veneris (maidenhair fern) .............   33 1 hit  [ferns]             RecName: Full=Cytochrome c biogenesis protein ccsA
. Capsella bursa-pastoris .................................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Atropa belladonna (deadly nightshade) ...................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Nasturtium officinale (watercress) ......................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Cuscuta exaltata ........................................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Lactuca sativa (cultivated lettuce) .....................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Lepidium virginicum .....................................   33 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Galdieria sulphuraria ...................................   33 1 hit  [red algae]         RecName: Full=Cytochrome c biogenesis protein ccsA
. Fagopyrum esculentum subsp. ancestrale ..................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Aethionema cordifolium ..................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Chlorella vulgaris ......................................   32 1 hit  [green algae]       RecName: Full=Cytochrome c biogenesis protein ccsA
. Panax ginseng (insam) ...................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Nicotiana tabacum (tobacco) .............................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1222
. Nicotiana sylvestris ....................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1222
. Nuphar advena ...........................................   32 1 hit  [flowering plants]  RecName: Full=Cytochrome c biogenesis protein ccsA
. Lobularia maritima (sweet-alyssum) ......................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Nicotiana tomentosiformis ...............................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Nymphaea alba (white water-lily) ........................   32 1 hit  [flowering plants]  RecName: Full=Cytochrome c biogenesis protein ccsA
. Aethionema grandiflorum .................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Guizotia abyssinica (werinnua) ..........................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Mesostigma viride .......................................   32 1 hit  [green plants]      RecName: Full=Cytochrome c biogenesis protein ccsA
. Chlamydomonas reinhardtii ...............................   32 1 hit  [green algae]       RecName: Full=Cytochrome c biogenesis protein ccsA
. Trachelium caeruleum ....................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Phaseolus vulgaris (French bean) ........................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Nandina domestica .......................................   32 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Cuscuta reflexa (giant dodder) ..........................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Arabis hirsuta (hairy rockcress) ........................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Helianthus annuus .......................................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Calycanthus floridus var. glaucus .......................   31 1 hit  [flowering plants]  RecName: Full=Cytochrome c biogenesis protein ccsA
. Draba nemorosa ..........................................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Pelargonium x hortorum (geranium) .......................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Liriodendron tulipifera .................................   31 1 hit  [flowering plants]  RecName: Full=Cytochrome c biogenesis protein ccsA
. Solanum bulbocastanum (ornamental nightshade) ...........   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1222
. Solanum tuberosum (potatoes) ............................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA >gi|1222
. Spinacia oleracea .......................................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Lemna minor .............................................   31 1 hit  [monocots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Solanum lycopersicum (tomato) ...........................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA
. Mus musculus (mouse) ....................................   31 1 hit  [rodents]           RecName: Full=Potassium voltage-gated channel subfamily A m
. Jasminum nudiflorum (winter jasmine) ....................   31 1 hit  [eudicots]          RecName: Full=Cytochrome c biogenesis protein ccsA



BlastP contre NRprot
Lineage Report

root
. cellular organisms
. . Bacteria           [bacteria]
. . . Thermobaculum terrenum ATCC BAA-798 --------------------------------------   90  2 hits [bacteria]               ABC-type transport system involved in cytochrome c biogenes
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................   87  2 hits [d-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Desulfovibrio de
. . . Bacillus selenitireducens MLS10 ..........................................   87  2 hits [firmicutes]             cytochrome c assembly protein [Bacillus selenitireducens ML
. . . Thermomicrobium roseum DSM 5159 ..........................................   81  2 hits [GNS bacteria]           heme exporter protein C [Thermomicrobium roseum DSM 5159] >
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........   80  2 hits [d-proteobacteria]       cytochrome c assembly protein [Desulfovibrio desulfuricans 
. . . Nocardioides sp. JS614 ...................................................   80  2 hits [high GC Gram+]          cytochrome c assembly protein [Nocardioides sp. JS614] >gi|
. . . Carboxydothermus hydrogenoformans Z-2901 .................................   79  2 hits [firmicutes]             putative heme exporter protein CcmC [Carboxydothermus hydro
. . . Desulfovibrio piger ATCC 29098 ...........................................   79  2 hits [d-proteobacteria]       hypothetical protein DESPIG_01714 [Desulfovibrio piger ATCC
. . . Desulfovibrio vulgaris str. 'Miyazaki F' .................................   78  2 hits [d-proteobacteria]       cytochrome c assembly protein [Desulfovibrio vulgaris str. 
. . . Deinococcus radiodurans R1 ...............................................   77  2 hits [bacteria]               cytochrome c-type biogenesis protein, heme exporter protein
. . . Desulfohalobium retbaense DSM 5692 .......................................   77  2 hits [d-proteobacteria]       cytochrome c assembly protein [Desulfohalobium retbaense DS
. . . Desulfovibrio vulgaris str. Hildenborough ................................   77  2 hits [d-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Desulfovibrio vu
. . . Desulfovibrio vulgaris DP4 ...............................................   77  2 hits [d-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Desulfovibrio vu
. . . Desulfovibrio vulgaris RCH1 ..............................................   77  2 hits [d-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Desulfovibrio vu
. . . Thermus aquaticus Y51MC23 ................................................   76  2 hits [bacteria]               cytochrome c assembly protein [Thermus aquaticus Y51MC23] >
. . . Denitrovibrio acetiphilus DSM 12809 ......................................   75  2 hits [bacteria]               ABC-type transport system involved in cytochrome c biogenes
. . . Sphaerobacter thermophilus DSM 20745 .....................................   75  2 hits [GNS bacteria]           ABC-type transport system involved in cytochrome c biogenes
. . . Thermus thermophilus HB27 ................................................   74  2 hits [bacteria]               heme exporter protein C [Thermus thermophilus HB27] >gi|461
. . . Thermus thermophilus HB8 .................................................   74  2 hits [bacteria]               cytochrome c-type biogenesis protein, heme exporter protein
. . . Halothermothrix orenii H 168 .............................................   74  2 hits [firmicutes]             cytochrome c assembly protein [Halothermothrix orenii H 168
. . . Desulfovibrio magneticus RS-1 ............................................   73  2 hits [d-proteobacteria]       heme exporter protein C [Desulfovibrio magneticus RS-1] >gi
. . . Sphingomonas wittichii RW1 ...............................................   73  2 hits [a-proteobacteria]       heme exporter protein CcmC [Sphingomonas wittichii RW1] >gi
. . . Lawsonia intracellularis PHE/MN1-00 ......................................   72  2 hits [d-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Desulfovibrio salexigens DSM 2638 ........................................   72  2 hits [d-proteobacteria]       cytochrome c assembly protein [Desulfovibrio salexigens DSM
. . . Pseudomonas syringae pv. syringae B728a ..................................   71  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Pseudomonas syri
. . . Stigmatella aurantiaca DW4/3-1 ...........................................   71  2 hits [d-proteobacteria]       cytochrome c-type biogenesis protein, heme exporter protein
. . . Azorhizobium caulinodans ORS 571 .........................................   71  2 hits [a-proteobacteria]       cytochrome c-type biogenesis protein [Azorhizobium caulinod
. . . Meiothermus ruber DSM 1279 ...............................................   71  2 hits [bacteria]               ABC-type transport system involved in cytochrome c biogenes
. . . Rickettsia canadensis str. McKiel ........................................   71  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia canadensis str. McKiel]
. . . Asticcacaulis excentricus CB 48 ..........................................   69  2 hits [a-proteobacteria]       heme exporter protein CcmC [Asticcacaulis excentricus CB 48
. . . Desulfomicrobium baculatum DSM 4028 ......................................   69  2 hits [d-proteobacteria]       cytochrome c assembly protein [Desulfomicrobium baculatum D
. . . Pseudomonas fluorescens Pf0-1 ............................................   68  4 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Pseudomonas fluo
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................   68  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas syringae pv. phaseo
. . . Acidimicrobium ferrooxidans DSM 10331 ....................................   68  2 hits [high GC Gram+]          cytochrome c assembly protein [Acidimicrobium ferrooxidans 
. . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................   68  1 hit  [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas syringae pv. tabaci
. . . Rickettsia rickettsii str. 'Sheila Smith' ................................   68  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia rickettsii str. 'Sheila
. . . Rickettsia rickettsii str. Iowa ..........................................   68  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia rickettsii str. 'Sheila
. . . Pseudomonas syringae pv. oryzae str. 1_6 .................................   68  1 hit  [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Pseudomonas syri
. . . Pseudomonas fluorescens ..................................................   68  1 hit  [g-proteobacteria]       inner membrane protein [Pseudomonas fluorescens]
. . . Pseudomonas fluorescens SBW25 ............................................   67  2 hits [g-proteobacteria]       cytochrome C biogenesis, heme exporter protein C [Pseudomon
. . . Neorickettsia sennetsu str. Miyayama .....................................   67  2 hits [a-proteobacteria]       CcmC family heme exporter protein [Neorickettsia sennetsu s
. . . Rickettsia africae ESF-5 .................................................   67  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia africae ESF-5] >gi|2280
. . . Rickettsia conorii str. Malish 7 .........................................   67  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia conorii str. Malish 7] 
. . . Rickettsia sibirica 246 ..................................................   67  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia conorii str. Malish 7] 
. . . Rickettsia peacockii str. Rustic .........................................   67  2 hits [a-proteobacteria]       heme chaperone heme-lyase [Rickettsia peacockii str. Rustic
. . . Pseudomonas mendocina ymp ................................................   67  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas mendocina ymp] >gi|
. . . Candidatus Koribacter versatilis Ellin345 ................................   67  2 hits [bacteria]               cytochrome c assembly protein [Candidatus Koribacter versat
. . . Rickettsia massiliae MTU5 ................................................   67  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia massiliae MTU5] >gi|157
. . . Brevundimonas sp. BAL3 ...................................................   67  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brevundimonas sp. BAL3] >gi|196
. . . Rickettsia felis URRWXCal2 ...............................................   67  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia felis URRWXCal2] >gi|67
. . . Bordetella petrii DSM 12804 ..............................................   66  1 hit  [b-proteobacteria]       heme exporter protein CcmC [Bordetella petrii DSM 12804] >g
. . . Bordetella petrii ........................................................   66  1 hit  [b-proteobacteria]       heme exporter protein CcmC [Bordetella petrii DSM 12804] >g
. . . Rickettsia akari str. Hartford ...........................................   66  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia akari str. Hartford] >g
. . . Bartonella quintana str. Toulouse ........................................   66  2 hits [a-proteobacteria]       Heme exporter protein C [Bartonella quintana str. Toulouse]
. . . Pseudomonas putida W619 ..................................................   66  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas putida W619] >gi|16
. . . Janthinobacterium sp. Marseille ..........................................   66  2 hits [b-proteobacteria]       heme exporter protein CcmC [Janthinobacterium sp. Marseille
. . . Meiothermus silvanus DSM 9946 ............................................   66  2 hits [bacteria]               ABC-type transport system involved in cytochrome c biogenes
. . . Rhizobium etli 8C-3 ......................................................   66  1 hit  [a-proteobacteria]       heme ABC transporter, permease protein (involved in cytochr
. . . Aurantimonas manganoxydans SI85-9A1 ......................................   66  2 hits [a-proteobacteria]       heme export protein C [Aurantimonas manganoxydans SI85-9A1]
. . . Methylobacterium extorquens PA1 ..........................................   66  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium extorquens PA1
. . . Agrobacterium radiobacter K84 ............................................   65  2 hits [a-proteobacteria]       heme ABC transporter [Agrobacterium radiobacter K84] >gi|22
. . . Pseudomonas putida F1 ....................................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas putida F1] >gi|1485
. . . Methylobacterium extorquens AM1 ..........................................   65  2 hits [a-proteobacteria]       heme exporter protein, cytochrome c-type biogenesis protein
. . . Pseudomonas entomophila L48 ..............................................   65  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC; heme ABC export 
. . . Pseudomonas putida GB-1 ..................................................   65  3 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas putida GB-1] >gi|16
. . . Rhizobium etli CIAT 652 ..................................................   65  2 hits [a-proteobacteria]       heme ABC transporter, permease protein (involved in cytochr
. . . Pseudomonas putida KT2440 ................................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas putida KT2440] >gi|
. . . Methylobacterium extorquens DM4 ..........................................   65  2 hits [a-proteobacteria]       heme exporter protein, cytochrome c-type biogenesis protein
. . . Neorickettsia risticii str. Illinois .....................................   65  2 hits [a-proteobacteria]       heme exporter protein, CcmC family [Neorickettsia risticii 
. . . Actinobacillus succinogenes 130Z .........................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Actinobacillus succinogenes 130
. . . Rickettsia bellii OSU 85-389 .............................................   65  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia bellii OSU 85-389] >gi|
. . . Beijerinckia indica subsp. indica ATCC 9039 ..............................   65  2 hits [a-proteobacteria]       heme exporter protein CcmC [Beijerinckia indica subsp. indi
. . . Pseudomonas fluorescens Pf-5 .............................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas fluorescens Pf-5] >
. . . Rickettsia bellii RML369-C ...............................................   65  2 hits [a-proteobacteria]       Heme exporter protein C [Rickettsia bellii RML369-C] >gi|91
. . . Methylobacterium chloromethanicum CM4 ....................................   65  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium chloromethanic
. . . Pseudomonas aeruginosa LESB58 ............................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa LESB58] 
. . . Pseudomonas aeruginosa PAO1 ..............................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa PACS2 .............................................   65  1 hit  [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa UCBPP-PA14 ........................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa C3719 .............................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa 2192 ..............................................   65  4 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa ...................................................   65  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PAO1] >g
. . . Pseudomonas aeruginosa PA7 ...............................................   64  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas aeruginosa PA7] >gi
. . . Methylobacterium populi BJ001 ............................................   64  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium populi BJ001] 
. . . Rickettsia prowazekii str. Madrid E ......................................   64  1 hit  [a-proteobacteria]       HEME exporter protein C (ccmC) [Rickettsia prowazekii str. 
. . . Rickettsia prowazekii ....................................................   64  1 hit  [a-proteobacteria]       HEME exporter protein C (ccmC) [Rickettsia prowazekii str. 
. . . Caulobacter crescentus CB15 ..............................................   64  2 hits [a-proteobacteria]       heme exporter protein C [Caulobacter crescentus CB15] >gi|2
. . . Caulobacter crescentus NA1000 ............................................   64  2 hits [a-proteobacteria]       heme exporter protein C [Caulobacter crescentus CB15] >gi|2
. . . Pseudomonas putida .......................................................   64  1 hit  [g-proteobacteria]       CcmC protein [Pseudomonas putida]
. . . Granulibacter bethesdensis CGDNIH1 .......................................   64  2 hits [a-proteobacteria]       heme chaperone heme-lyase [Granulibacter bethesdensis CGDNI
. . . Colwellia psychrerythraea 34H ............................................   64  2 hits [g-proteobacteria]       heme exporter protein CcmC [Colwellia psychrerythraea 34H] 
. . . Chelativorans sp. BNC1 ...................................................   63  2 hits [a-proteobacteria]       heme exporter protein CcmC [Mesorhizobium sp. BNC1] >gi|110
. . . Bartonella tribocorum CIP 105476 .........................................   63  2 hits [a-proteobacteria]       heme exporter protein C [Bartonella tribocorum CIP 105476] 
. . . Burkholderia xenovorans LB400 ............................................   63  2 hits [b-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Burkholderi
. . . Providencia rustigianii DSM 4541 .........................................   63  1 hit  [enterobacteria]         hypothetical protein PrusD4_12089 [Providencia rustigianii 
. . . Mannheimia succiniciproducens MBEL55E ....................................   63  2 hits [g-proteobacteria]       CcmC protein [Mannheimia succiniciproducens MBEL55E] >gi|52
. . . Deinococcus deserti VCD115 ...............................................   63  2 hits [bacteria]               putative cytochrome c-type biogenesis protein ccmC; putativ
. . . Shewanella putrefaciens 200 ..............................................   63  7 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella putrefaciens 200] >g
. . . Bartonella grahamii as4aup ...............................................   63  2 hits [a-proteobacteria]       heme exporter protein CcmC [Bartonella grahamii as4aup] >gi
. . . marine gamma proteobacterium HTCC2148 ....................................   63  2 hits [g-proteobacteria]       heme exporter protein CcmC [marine gamma proteobacterium HT
. . . Ralstonia metallidurans CH34 .............................................   63  4 hits [b-proteobacteria]       heme exporter protein CcmC [Ralstonia metallidurans CH34] >
. . . Methylobacterium nodulans ORS 2060 .......................................   63  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium nodulans ORS 2
. . . Methylobacterium sp. 4-46 ................................................   63  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium sp. 4-46] >gi|
. . . Pectobacterium wasabiae WPP163 ...........................................   63  2 hits [enterobacteria]         heme exporter protein CcmC [Pectobacterium wasabiae WPP163]
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................   62  1 hit  [enterobacteria]         heme exporter protein C [Pectobacterium carotovorum subsp. 
. . . Agrobacterium tumefaciens str. C58 .......................................   62  2 hits [a-proteobacteria]       ABC transporter, membrane spanning protein (heme) [Agrobact
. . . Ochrobactrum intermedium LMG 3301 ........................................   62  2 hits [a-proteobacteria]       heme exporter protein CcmC [Ochrobactrum intermedium LMG 33
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................   62  1 hit  [enterobacteria]         heme exporter protein C [Pectobacterium carotovorum subsp. 
. . . Pectobacterium atrosepticum SCRI1043 .....................................   62  2 hits [enterobacteria]         heme exporter protein C [Pectobacterium atrosepticum SCRI10
. . . Burkholderia sp. H160 ....................................................   62  2 hits [b-proteobacteria]       heme exporter protein CcmC [Burkholderia sp. H160] >gi|2094
. . . Cellvibrio japonicus Ueda107 .............................................   62  2 hits [g-proteobacteria]       heme exporter protein C [Cellvibrio japonicus Ueda107] >gi|
. . . Rhizobium etli CFN 42 ....................................................   62  2 hits [a-proteobacteria]       heme ABC transporter, permease protein (involved in cytochr
. . . Nitrosomonas sp. AL212 ...................................................   62  2 hits [b-proteobacteria]       heme exporter protein CcmC [Nitrosomonas sp. AL212] >gi|254
. . . Slackia heliotrinireducens DSM 20476 .....................................   62  2 hits [high GC Gram+]          ABC-type transport system involved in cytochrome c biogenes
. . . Bradyrhizobium japonicum USDA 110 ........................................   62  2 hits [a-proteobacteria]       heme exporter protein C [Bradyrhizobium japonicum USDA 110]
. . . Bradyrhizobium japonicum .................................................   62  2 hits [a-proteobacteria]       heme exporter protein C [Bradyrhizobium japonicum USDA 110]
. . . Rhodospirillum rubrum ATCC 11170 .........................................   62  2 hits [a-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Rhodospirillum r
. . . Vibrio fischeri ES114 ....................................................   62  2 hits [g-proteobacteria]       heme exporter subunit C [Vibrio fischeri ES114] >gi|1973348
. . . Vibrio fischeri MJ11 .....................................................   62  2 hits [g-proteobacteria]       heme exporter subunit C [Vibrio fischeri ES114] >gi|1973348
. . . Rickettsia typhi str. Wilmington .........................................   62  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia typhi str. Wilmington] 
. . . Myxococcus xanthus DK 1622 ...............................................   62  2 hits [d-proteobacteria]       heme exporter protein CcmC [Myxococcus xanthus DK 1622] >gi
. . . Halorhodospira halophila SL1 .............................................   62  2 hits [g-proteobacteria]       heme exporter protein CcmC [Halorhodospira halophila SL1] >
. . . Rhodopseudomonas palustris BisA53 ........................................   62  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris BisA
. . . Pseudomonas stutzeri A1501 ...............................................   61  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas stutzeri A1501] >gi
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................   61  2 hits [g-proteobacteria]       heme exporter protein CcmC [Alkalilimnicola ehrlichii MLHE-
. . . Ochrobactrum anthropi ATCC 49188 .........................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Ochrobactrum anthropi ATCC 4918
. . . Aliivibrio salmonicida LFI1238 ...........................................   61  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Aliivibrio salmo
. . . Serratia proteamaculans 568 ..............................................   61  2 hits [enterobacteria]         heme exporter protein CcmC [Serratia proteamaculans 568] >g
. . . Deinococcus geothermalis DSM 11300 .......................................   61  2 hits [bacteria]               cytochrome c assembly protein [Deinococcus geothermalis DSM
. . . Fulvimarina pelagi HTCC2506 ..............................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Fulvimarina pelagi HTCC2506] >g
. . . Bartonella bacilliformis KC583 ...........................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Bartonella bacilliformis KC583]
. . . Haemophilus parasuis SH0165 ..............................................   61  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein/heme exporter protein 
. . . Bartonella henselae str. Houston-1 .......................................   61  2 hits [a-proteobacteria]       Heme exporter protein C [Bartonella henselae str. Houston-1
. . . Rhodopseudomonas palustris CGA009 ........................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris CGA0
. . . Rhodopseudomonas palustris TIE-1 .........................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris CGA0
. . . Azotobacter vinelandii DJ ................................................   61  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein [Azotobacter vinelandi
. . . Haemophilus parasuis 29755 ...............................................   61  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus parasuis 29755] >gi|16
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   61  2 hits [enterobacteria]         heme exporter protein CcmC [Pectobacterium carotovorum subs
. . . Methylobacterium radiotolerans JCM 2831 ..................................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylobacterium radiotolerans 
. . . Shewanella benthica KT99 .................................................   61  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella benthica KT99] >gi|1
. . . Rhizobium leguminosarum bv. viciae 3841 ..................................   61  2 hits [a-proteobacteria]       putative heme exporter protein c (cytochrome c-type biogene
. . . Mannheimia haemolytica PHL213 ............................................   61  2 hits [g-proteobacteria]       heme ABC superfamily ATP binding cassette transporter, memb
. . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................   61  2 hits [g-proteobacteria]       heme ABC superfamily ATP binding cassette transporter, memb
. . . Mannheimia haemolytica serotype A2 str. OVINE ............................   61  2 hits [g-proteobacteria]       heme ABC superfamily ATP binding cassette transporter, memb
. . . Providencia stuartii ATCC 25827 ..........................................   61  2 hits [enterobacteria]         hypothetical protein PROSTU_03509 [Providencia stuartii ATC
. . . Rhizobium leguminosarum bv. trifolii WSM1325 .............................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhizobium leguminosarum bv. tri
. . . Allochromatium vinosum DSM 180 ...........................................   61  2 hits [g-proteobacteria]       cytochrome c assembly protein [Allochromatium vinosum DSM 1
. . . Magnetospirillum gryphiswaldense MSR-1 ...................................   61  2 hits [a-proteobacteria]       Cytochrome c assembly protein [Magnetospirillum gryphiswald
. . . Rhodoferax ferrireducens T118 ............................................   61  2 hits [b-proteobacteria]       heme exporter protein CcmC [Rhodoferax ferrireducens T118] 
. . . Rhizobium leguminosarum bv. trifolii WSM2304 .............................   61  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhizobium leguminosarum bv. tri
. . . Providencia rettgeri DSM 1131 ............................................   61  2 hits [enterobacteria]         hypothetical protein PROVRETT_00558 [Providencia rettgeri D
. . . Glaciecola sp. HTCC2999 ..................................................   60  1 hit  [g-proteobacteria]       heme exporter protein C [Glaciecola sp. HTCC2999]
. . . Acidobacterium capsulatum ATCC 51196 .....................................   60  2 hits [bacteria]               putative heme exporter protein C [Acidobacterium capsulatum
. . . Teredinibacter turnerae T7901 ............................................   60  2 hits [g-proteobacteria]       heme exporter protein CcmC [Teredinibacter turnerae T7901] 
. . . Brucella suis 1330 .......................................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella canis ATCC 23365 ................................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella suis ATCC 23445 .................................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella melitensis ATCC 23457 ...........................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella microti CCM 4915 ................................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella melitensis bv. 1 str. 16M .......................................   60  4 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella suis bv. 4 str. 40 ..............................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella ceti M13/05/1 ...................................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella ceti B1/94 ......................................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella pinnipedialis M163/99/10 ........................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella pinnipedialis B2/94 .............................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella ceti M644/93/1 ..................................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella suis bv. 5 str. 513 .............................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella suis bv. 3 str. 686 .............................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella sp. F5/99 .......................................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella suis 1330] >gi|1616180
. . . Brucella neotomae 5K33 ...................................................   60  3 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella neotomae 5K33] >gi|261
. . . Brucella abortus S19 .....................................................   60  2 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus str. 2308 A .............................................   60  2 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus bv. 6 str. 870 ..........................................   60  3 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus bv. 3 str. Tulya ........................................   60  3 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus bv. 2 str. 86/8/59 ......................................   60  3 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus bv. 4 str. 292 ..........................................   60  3 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella abortus bv. 9 str. C68 ..........................................   60  3 hits [a-proteobacteria]       Cytochrome c assembly protein [Brucella abortus S19] >gi|23
. . . Brucella melitensis bv. 3 str. Ether .....................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella melitensis bv. 3 str. Eth
. . . Brucella sp. 83/13 .......................................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella sp. 83/13]
. . . Brucella ceti str. Cudo ..................................................   60  2 hits [a-proteobacteria]       heme exporter protein C [Brucella melitensis 16M] >gi|22562
. . . Brucella pinnipedialis M292/94/1 .........................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella melitensis 16M] >gi|22562
. . . Brucella melitensis bv. 1 str. Rev.1 .....................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella melitensis 16M] >gi|22562
. . . Brucella ceti M490/95/1 ..................................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella melitensis 16M] >gi|22562
. . . Brucella melitensis bv. 2 str. 63/9 ......................................   60  1 hit  [a-proteobacteria]       heme exporter protein C [Brucella melitensis 16M] >gi|22562
. . . Brucella abortus bv. 1 str. 9-941 ........................................   60  2 hits [a-proteobacteria]       CcmC, heme exporter protein [Brucella abortus bv. 1 str. 9-
. . . Brucella melitensis biovar Abortus 2308 ..................................   60  2 hits [a-proteobacteria]       CcmC, heme exporter protein [Brucella abortus bv. 1 str. 9-
. . . Brucella abortus NCTC 8038 ...............................................   60  2 hits [a-proteobacteria]       CcmC, heme exporter protein [Brucella abortus bv. 1 str. 9-
. . . Photobacterium sp. SKA34 .................................................   60  2 hits [g-proteobacteria]       heme exporter protein C [Photobacterium sp. SKA34] >gi|8905
. . . Brucella ovis ATCC 25840 .................................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Brucella ovis ATCC 25840] >gi|1
. . . Haemophilus ducreyi 35000HP ..............................................   60  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein [Haemophilus ducreyi 3
. . . Hyphomicrobium denitrificans ATCC 51888 ..................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Hyphomicrobium denitrificans AT
. . . Nitrobacter hamburgensis X14 .............................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Nitrobacter hamburgensis X14] >
. . . Nitrobacter sp. Nb-311A ..................................................   60  2 hits [a-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Nitrobacter sp. 
. . . Sinorhizobium medicae WSM419 .............................................   60  2 hits [a-proteobacteria]       heme exporter protein CcmC [Sinorhizobium medicae WSM419] >
. . . Alteromonadales bacterium TW-7 ...........................................   60  2 hits [g-proteobacteria]       heme exporter protein C (Cytochrome c-type biogenesis prote
. . . Oceanicaulis alexandrii HTCC2633 .........................................   60  2 hits [a-proteobacteria]       heme exporter protein c [Oceanicaulis alexandrii HTCC2633] 
. . . Collinsella intestinalis DSM 13280 .......................................   60  2 hits [high GC Gram+]          hypothetical protein COLINT_03358 [Collinsella intestinalis
. . . alpha proteobacterium BAL199 .............................................   60  2 hits [a-proteobacteria]       hypothetical protein BAL199_16538 [alpha proteobacterium BA
. . . Photobacterium angustum S14 ..............................................   60  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio angustum S14] >gi|90438842|
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................   60  2 hits [enterobacteria]         putative heme exporter protein C [Yersinia enterocolitica s
. . . Nitrosomonas europaea ATCC 19718 .........................................   59  2 hits [b-proteobacteria]       heme exporter CcmC [Nitrosomonas europaea ATCC 19718] >gi|3
. . . Pseudoalteromonas haloplanktis TAC125 ....................................   59  2 hits [g-proteobacteria]       heme exporter protein C (cytochrome c-type biogenesis prote
. . . Yersinia pestis KIM 10 ...................................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Microtus str. 91001 ...............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis Antiqua ..................................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis Nepal516 .................................................   59  4 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis Pestoides F ..............................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis CA88-4125 ................................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pseudotuberculosis IP 31758 .....................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis Angola ...................................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Orientalis str. IP275 .............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis FV-1 .....................................................   59  1 hit  [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pseudotuberculosis YPIII ........................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis CO92 .....................................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Orientalis str. PEXU2 .............................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis Pestoides A ..............................................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Yersinia pestis biovar Orientalis str. India 195 .........................   59  2 hits [enterobacteria]         heme exporter protein C [Yersinia pestis KIM] >gi|45442217|
. . . Magnetospirillum magneticum AMB-1 ........................................   59  2 hits [a-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Rhizobium sp. NGR234 .....................................................   59  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhizobium sp. NGR234] >gi|22734
. . . Yersinia pseudotuberculosis IP 32953 .....................................   59  2 hits [enterobacteria]         putative ABC type heme exporter, permease subunit ccmC [Yer
. . . Yersinia pseudotuberculosis PB1/+ ........................................   59  2 hits [enterobacteria]         putative ABC type heme exporter, permease subunit ccmC [Yer
. . . Pasteurella dagmatis ATCC 43325 ..........................................   59  2 hits [g-proteobacteria]       heme ABC superfamily ATP binding cassette transporter, perm
. . . Rhizobium etli Kim 5 .....................................................   59  1 hit  [a-proteobacteria]       putative heme exporter protein c (cytochrome c-type biogene
. . . Yersinia bercovieri ATCC 43970 ...........................................   59  2 hits [enterobacteria]         Heme exporter protein C [Yersinia bercovieri ATCC 43970] >g
. . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................   59  2 hits [b-proteobacteria]       heme exporter protein CcmC [Candidatus Accumulibacter phosp
. . . Cryptobacterium curtum DSM 15641 .........................................   59  2 hits [high GC Gram+]          ABC-type transport system involved in cytochrome c biogenes
. . . Nitrobacter winogradskyi Nb-255 ..........................................   59  2 hits [a-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Nitrobacter wino
. . . Nitrosomonas eutropha C91 ................................................   59  4 hits [b-proteobacteria]       heme exporter protein CcmC [Nitrosomonas eutropha C91] >gi|
. . . Sinorhizobium meliloti 1021 ..............................................   59  2 hits [a-proteobacteria]       putative HEME exporter C (cytochrome C-type biogenesis prot
. . . Providencia alcalifaciens DSM 30120 ......................................   59  2 hits [enterobacteria]         hypothetical protein PROVALCAL_03797 [Providencia alcalifac
. . . Shewanella halifaxensis HAW-EB4 ..........................................   59  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella halifaxensis HAW-EB4
. . . Erythrobacter sp. SD-21 ..................................................   59  2 hits [a-proteobacteria]       ABC-type transport system heme exporter [Erythrobacter sp. 
. . . Psychromonas ingrahamii 37 ...............................................   59  2 hits [g-proteobacteria]       heme exporter protein CcmC [Psychromonas ingrahamii 37] >gi
. . . Magnetospirillum magnetotacticum MS-1 ....................................   59  1 hit  [a-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Wolbachia endosymbiont strain TRS of Brugia malayi .......................   58  2 hits [a-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Cupriavidus taiwanensis ..................................................   58  2 hits [b-proteobacteria]       ABC transporter, heme transfer protein, cytochrome c-type b
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas syringae pv. tomato
. . . Actinobacillus minor NM305 ...............................................   58  2 hits [g-proteobacteria]       heme exporter protein C [Actinobacillus minor NM305] >gi|24
. . . Actinobacillus minor 202 .................................................   58  2 hits [g-proteobacteria]       heme exporter protein C [Actinobacillus minor 202] >gi|2574
. . . Rhodopseudomonas palustris BisB18 ........................................   58  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris BisB
. . . Haemophilus somnus 2336 ..................................................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Haemophilus somnus 2336] >gi|16
. . . Edwardsiella ictaluri 93-146 .............................................   58  2 hits [enterobacteria]         heme exporter protein CcmC [Edwardsiella ictaluri 93-146] >
. . . Haemophilus somnus 129PT .................................................   58  2 hits [g-proteobacteria]       heme ABC transporter, permease (heme exporter protein C) [H
. . . Yersinia intermedia ATCC 29909 ...........................................   58  2 hits [enterobacteria]         Heme exporter protein C [Yersinia intermedia ATCC 29909] >g
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................   58  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein [Actinobacillus pleuro
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................   58  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein [Actinobacillus pleuro
. . . Vibrio orientalis CIP 102891 .............................................   58  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Vibrio orientali
. . . Ralstonia eutropha H16 ...................................................   58  4 hits [b-proteobacteria]       ABC heme export system [Ralstonia eutropha H16] >gi|3252721
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................   58  1 hit  [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Actinobacillus pleuropneumoniae L20 ......................................   58  2 hits [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Escherichia coli O127:H6 str. E2348/69 ...................................   58  2 hits [enterobacteria]         heme exporter protein C; membrane component of ABC superfam
. . . Hirschia baltica ATCC 49814 ..............................................   58  2 hits [a-proteobacteria]       heme exporter protein CcmC [Hirschia baltica ATCC 49814] >g
. . . Escherichia coli CFT073 ..................................................   58  2 hits [enterobacteria]         Heme exporter protein C [Escherichia coli CFT073] >gi|91211
. . . Escherichia coli UTI89 ...................................................   58  2 hits [enterobacteria]         Heme exporter protein C [Escherichia coli CFT073] >gi|91211
. . . Shigella flexneri 5 str. 8401 ............................................   58  2 hits [enterobacteria]         Heme exporter protein C [Escherichia coli CFT073] >gi|91211
. . . Escherichia sp. 3_2_53FAA ................................................   58  2 hits [enterobacteria]         Heme exporter protein C [Escherichia coli CFT073] >gi|91211
. . . Escherichia coli O157:H7 str. FRIK966 ....................................   58  1 hit  [enterobacteria]         Heme exporter protein C [Escherichia coli CFT073] >gi|91211
. . . Congregibacter litoralis KT71 ............................................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Congregibacter litoralis KT71] 
. . . Escherichia coli O157:H7 EDL933 ..........................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. Sakai ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli str. K-12 substr. MG1655 ................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella flexneri 2a str. 2457T ..........................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella flexneri 2a str. 301 ............................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella sonnei Ss046 ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella boydii Sb227 ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella dysenteriae Sd197 ...............................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli str. K-12 substr. W3110 .................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli APEC O1 .................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli E24377A .................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli HS ......................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4113 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4401 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4501 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4486 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4196 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4076 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC869 ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC508 ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli ATCC 8739 ...............................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli str. K-12 substr. DH10B .................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli SMS-3-5 .................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella boydii CDC 3083-94 ..............................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli 53638 ...................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli B7A .....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli F11 .....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli E22 .....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli E110019 .................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli B171 ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli 101-1 ...................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4024 .....................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4206 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4045 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4042 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. EC4115 .....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli SE11 ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. TW14588 ....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia fergusonii ATCC 35469 ........................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli IAI1 ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli S88 .....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli ED1a ....................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli 55989 ...................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli IAI39 ...................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli UMN026 ..................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli 83972 ...................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli BW2952 ..................................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli BL21(DE3) ...............................................   58  4 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli B str. REL606 ...........................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. TW14359 ....................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella sp. D9 ..........................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia sp. 4_1_40B ..................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O26:H11 str. 11368 ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O111:H- str. 11128 ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 str. FRIK2000 ...................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O157:H7 .................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli O6 ......................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli K-12 ....................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shigella flexneri ........................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli .........................................................   58  5 hits [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Escherichia coli DH1 .....................................................   58  1 hit  [enterobacteria]         heme exporter protein C [Escherichia coli O157:H7 EDL933] >
. . . Shewanella sp. W3-18-1 ...................................................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sp. W3-18-1] >gi|124
. . . Shewanella putrefaciens CN-32 ............................................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sp. W3-18-1] >gi|124
. . . Yersinia rohdei ATCC 43380 ...............................................   58  2 hits [enterobacteria]         Heme exporter protein C [Yersinia rohdei ATCC 43380] >gi|23
. . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................   58  2 hits [b-proteobacteria]       heme exporter protein CcmC [Polynucleobacter necessarius su
. . . Yersinia kristensenii ATCC 33638 .........................................   58  2 hits [enterobacteria]         Heme exporter protein C [Yersinia kristensenii ATCC 33638] 
. . . Shigella dysenteriae 1012 ................................................   58  2 hits [enterobacteria]         heme exporter protein C [Shigella dysenteriae 1012] >gi|194
. . . Rhizobium etli GR56 ......................................................   58  1 hit  [a-proteobacteria]       putative heme exporter protein c (cytochrome c-type biogene
. . . Aggregatibacter actinomycetemcomitans D11S-1 .............................   58  2 hits [g-proteobacteria]       CcmC [Aggregatibacter actinomycetemcomitans D11S-1] >gi|261
. . . Escherichia coli O103:H2 str. 12009 ......................................   58  2 hits [enterobacteria]         heme exporter protein C [Escherichia coli O103:H2 str. 1200
. . . Aggregatibacter aphrophilus NJ8700 .......................................   58  2 hits [g-proteobacteria]       CcmC [Aggregatibacter aphrophilus NJ8700] >gi|247533230|gb|
. . . Yersinia mollaretii ATCC 43969 ...........................................   58  2 hits [enterobacteria]         Heme exporter protein C [Yersinia mollaretii ATCC 43969] >g
. . . Wolbachia endosymbiont of Drosophila melanogaster ........................   58  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Droso
. . . Shewanella pealeana ATCC 700345 ..........................................   58  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella pealeana ATCC 700345
. . . Rhodobacterales bacterium HTCC2654 .......................................   58  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Rhodobacter
. . . Idiomarina baltica OS145 .................................................   58  2 hits [g-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Pantoea citrea ...........................................................   58  1 hit  [enterobacteria]         CcmC [Pantoea citrea]
. . . Erythrobacter sp. NAP1 ...................................................   58  2 hits [a-proteobacteria]       ABC-type transport system heme exporter [Erythrobacter sp. 
. . . Ralstonia eutropha JMP134 ................................................   58  2 hits [b-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Ralstonia eutrop
. . . Sodalis glossinidius str. 'morsitans' ....................................   58  2 hits [enterobacteria]         heme exporter protein C [Sodalis glossinidius str. 'morsita
. . . Pseudomonas syringae pv. tomato T1 .......................................   57  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudomonas syringae pv. tomato
. . . Photobacterium profundum SS9 .............................................   57  2 hits [g-proteobacteria]       putative heme exporter protein C [Photobacterium profundum 
. . . uncultured bacterium .....................................................   57  2 hits [bacteria]               cytochrome c-type biogenesis protein CcmC [uncultured bacte
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................   57  2 hits [g-proteobacteria]       CcmC [Pasteurella multocida subsp. multocida str. Pm70] >gi
. . . Pseudoalteromonas atlantica T6c ..........................................   57  2 hits [g-proteobacteria]       heme exporter protein CcmC [Pseudoalteromonas atlantica T6c
. . . Rhodopseudomonas palustris BisB5 .........................................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris BisB
. . . Caulobacter sp. K31 ......................................................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Caulobacter sp. K31] >gi|167351
. . . Roseovarius sp. TM1035 ...................................................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Roseovarius sp. TM1035] >gi|149
. . . Zymomonas mobilis subsp. mobilis NCIMB 11163 .............................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Zymomonas mobilis subsp. mobili
. . . Erythrobacter litoralis HTCC2594 .........................................   57  2 hits [a-proteobacteria]       ABC-type transport system heme exporter [Erythrobacter lito
. . . Phenylobacterium zucineum HLK1 ...........................................   57  2 hits [a-proteobacteria]       heme ABC transporter, permease protein (involved in cytochr
. . . Roseovarius sp. 217 ......................................................   57  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseovarius
. . . Shewanella amazonensis SB2B ..............................................   57  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella amazonensis SB2B] >g
. . . Psychromonas sp. CNPT3 ...................................................   57  2 hits [g-proteobacteria]       heme chaperone heme-lyase [Psychromonas sp. CNPT3] >gi|9031
. . . Mesorhizobium loti MAFF303099 ............................................   57  2 hits [a-proteobacteria]       heme exporter protein C [Mesorhizobium loti MAFF303099] >gi
. . . Ruegeria sp. TM1040 ......................................................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Silicibacter sp. TM1040] >gi|99
. . . Alteromonas macleodii 'Deep ecotype' .....................................   57  2 hits [g-proteobacteria]       heme exporter protein C [Alteromonas macleodii 'Deep ecotyp
. . . Citrobacter koseri ATCC BAA-895 ..........................................   57  2 hits [enterobacteria]         hypothetical protein CKO_00577 [Citrobacter koseri ATCC BAA
. . . Citrobacter sp. 30_2 .....................................................   57  2 hits [enterobacteria]         heme exporter protein C [Citrobacter sp. 30_2] >gi|22690778
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   57  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   57  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   57  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Rhodopseudomonas palustris HaA2 ..........................................   57  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodopseudomonas palustris HaA2
. . . Labrenzia aggregata IAM 12614 ............................................   57  2 hits [a-proteobacteria]       putative heme exporter c (cytochrome c-type biogenesis prot
. . . Citrobacter youngae ATCC 29220 ...........................................   57  4 hits [enterobacteria]         hypothetical protein CIT292_02013 [Citrobacter youngae ATCC
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............   56  2 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............   56  4 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi ........................   56  4 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. AG3 ...............   56  1 hit  [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Nitrosococcus oceani ATCC 19707 ..........................................   56  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Nitrosococcus oc
. . . Nitrosococcus oceani AFC27 ...............................................   56  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Nitrosococcus oc
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...   56  4 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........   56  1 hit  [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Haemophilus influenzae PittAA ............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae PittAA] >gi
. . . Haemophilus influenzae PittEE ............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae PittAA] >gi
. . . Roseobacter sp. AzwK-3b ..................................................   56  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseobacter
. . . Haemophilus influenzae 22.4-21 ...........................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae R3021] >gi|
. . . Mesorhizobium opportunistum WSM2075 ......................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Mesorhizobium opportunistum WSM
. . . Haemophilus influenzae 22.1-21 ...........................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae 22.1-21] >g
. . . Methylocella silvestris BL2 ..............................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Methylocella silvestris BL2] >g
. . . Wolbachia endosymbiont of Drosophila simulans ............................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Droso
. . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............   56  1 hit  [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Erwinia tasmaniensis Et1/99 ..............................................   56  2 hits [enterobacteria]         Heme exporter protein C [Erwinia tasmaniensis Et1/99] >gi|1
. . . Photobacterium profundum 3TCK ............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Photobacterium profundum 3TCK] >gi
. . . Collinsella stercoris DSM 13279 ..........................................   56  2 hits [high GC Gram+]          hypothetical protein COLSTE_02259 [Collinsella stercoris DS
. . . Methylibium petroleiphilum PM1 ...........................................   56  2 hits [b-proteobacteria]       ABC transporter permease [Methylibium petroleiphilum PM1] >
. . . Comamonas testosteroni CNB-1 .............................................   56  1 hit  [b-proteobacteria]       heme exorter protein C [Comamonas testosteroni CNB-2]
. . . Idiomarina loihiensis L2TR ...............................................   56  2 hits [g-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Wolbachia sp. wRi ........................................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia sp. wRi] >gi|22559221
. . . Acidiphilium cryptum JF-5 ................................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Acidiphilium cryptum JF-5] >gi|
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   56  4 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Zymomonas mobilis subsp. mobilis ATCC 10988 ..............................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Zymomonas mobilis subsp. mobili
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............   56  2 hits [b-proteobacteria]       heme exporter protein CcmC [Polynucleobacter necessarius su
. . . Bradyrhizobium sp. ORS278 ................................................   56  2 hits [a-proteobacteria]       heme ABC transporter (heme exporter protein C), permease pr
. . . Yersinia frederiksenii ATCC 33641 ........................................   56  2 hits [enterobacteria]         Heme exporter protein C [Yersinia frederiksenii ATCC 33641]
. . . marine gamma proteobacterium HTCC2143 ....................................   56  2 hits [g-proteobacteria]       heme exporter protein CcmC [marine gamma proteobacterium HT
. . . Bradyrhizobium sp. BTAi1 .................................................   56  2 hits [a-proteobacteria]       heme ABC transporter (heme exporter protein C), permease pr
. . . Zymomonas mobilis subsp. mobilis ZM4 .....................................   56  2 hits [a-proteobacteria]       ABC-type transport system heme exporter [Zymomonas mobilis 
. . . Vibrio cholerae MZO-3 ....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae MZO-3] >gi|1830131
. . . Leptothrix cholodnii SP-6 ................................................   56  2 hits [b-proteobacteria]       heme exporter protein CcmC [Leptothrix cholodnii SP-6] >gi|
. . . Vibrio cholerae RC385 ....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae RC385] >gi|1504202
. . . Cardiobacterium hominis ATCC 15826 .......................................   56  2 hits [g-proteobacteria]       heme exporter protein CcmC [Cardiobacterium hominis ATCC 15
. . . Rhodobacterales bacterium HTCC2255 .......................................   56  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [alpha prote
. . . Vibrio cholerae 2740-80 ..................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae 1587 .....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae MZO-2 ....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae TM 11079-80 ..............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae bv. albensis VL426 .......................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae 12129(1) .................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae V51 ......................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae AM-19226 .................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Vibrio cholerae CT 5369-93 ...............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae 2740-80] >gi|15321
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...   56  4 hits [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   56  4 hits [enterobacteria]         heme exporter protein C1 [Salmonella enterica subsp. enteri
. . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae V52 ......................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae O395 .....................................................   56  3 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae MAK 757 ..................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae NCTC 8457 ................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae B33 ......................................................   56  4 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae 623-39 ...................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae M66-2 ....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae BX 330286 ................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae TMA 21 ...................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae RC9 ......................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae MJ-1236 ..................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae MO10 .....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholera CIRS 101 ..................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae INDRE 91/1 ...............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio cholerae RC27 .....................................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio cholerae O1 biovar eltor st
. . . Vibrio vulnificus CMCP6 ..................................................   56  2 hits [g-proteobacteria]       putative heme exporter protein C [Vibrio vulnificus CMCP6] 
. . . Vibrio vulnificus YJ016 ..................................................   56  2 hits [g-proteobacteria]       putative heme exporter protein C [Vibrio vulnificus CMCP6] 
. . . uncultured marine bacterium 439 ..........................................   56  1 hit  [bacteria]               heme exporter protein C [uncultured marine bacterium 439]
. . . Vibrio sp. RC341 .........................................................   56  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Vibrio sp. RC341
. . . Vibrio furnissii CIP 102972 ..............................................   56  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Vibrio furnissii
. . . Alteromonas macleodii ATCC 27126 .........................................   56  1 hit  [g-proteobacteria]       heme exporter protein C [Alteromonas macleodii ATCC 27126]
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   56  4 hits [enterobacteria]         heme exporter protein [Salmonella enterica subsp. enterica 
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   56  2 hits [enterobacteria]         heme ABC transporter membrane protein [Klebsiella pneumonia
. . . Klebsiella pneumoniae NTUH-K2044 .........................................   56  2 hits [enterobacteria]         heme ABC transporter membrane protein [Klebsiella pneumonia
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   56  2 hits [enterobacteria]         heme ABC exporter [Salmonella enterica subsp. enterica sero
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   56  4 hits [enterobacteria]         heme ABC exporter [Salmonella enterica subsp. enterica sero
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   56  4 hits [enterobacteria]         heme ABC exporter [Salmonella enterica subsp. enterica sero
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   56  2 hits [enterobacteria]         heme ABC exporter [Salmonella enterica subsp. enterica sero
. . . Haemophilus influenzae R3021 .............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae 22.4-21] >g
. . . Nitrosospira multiformis ATCC 25196 ......................................   56  2 hits [b-proteobacteria]       heme exporter protein CcmC [Nitrosospira multiformis ATCC 2
. . . Eggerthella lenta DSM 2243 ...............................................   56  2 hits [high GC Gram+]          cytochrome c assembly protein [Eggerthella lenta DSM 2243] 
. . . Labrenzia alexandrii DFL-11 ..............................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Labrenzia alexandrii DFL-11] >g
. . . gamma proteobacterium NOR5-3 .............................................   56  2 hits [g-proteobacteria]       heme exporter protein CcmC [gamma proteobacterium NOR5-3] >
. . . Haemophilus influenzae R2846 .............................................   56  1 hit  [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Haemophilus influenzae 86-028NP ..........................................   56  2 hits [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Haemophilus influenzae PittGG ............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae PittGG] >gi
. . . Haemophilus influenzae NT127 .............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae PittGG] >gi
. . . Haemophilus influenzae 3655 ..............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae 3655] >gi|2
. . . Haemophilus influenzae 6P18H1 ............................................   56  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae 3655] >gi|2
. . . Silicibacter sp. TrichCH4B ...............................................   56  2 hits [a-proteobacteria]       heme exporter protein CcmC [Silicibacter sp. TrichCH4B] >gi
. . . Ehrlichia ruminantium str. Welgevonden ...................................   56  4 hits [a-proteobacteria]       Heme exporter protein C [Ehrlichia ruminantium str. Welgevo
. . . Ehrlichia ruminantium str. Gardel ........................................   56  2 hits [a-proteobacteria]       Heme exporter protein C [Ehrlichia ruminantium str. Welgevo
. . . Bordetella bronchiseptica RB50 ...........................................   56  2 hits [b-proteobacteria]       putative heme export protein [Bordetella bronchiseptica RB5
. . . Marinomonas sp. MED121 ...................................................   56  2 hits [g-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Marinomonas sp. 
. . . Vibrio parahaemolyticus 16 ...............................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus 16] >gi|21
. . . Cronobacter sakazakii ATCC BAA-894 .......................................   55  2 hits [enterobacteria]         hypothetical protein ESA_00871 [Enterobacter sakazakii ATCC
. . . Shewanella sp. MR-4 ......................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sp. MR-4] >gi|114045
. . . Shewanella sp. MR-7 ......................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sp. MR-4] >gi|114045
. . . Hoeflea phototrophica DFL-43 .............................................   55  2 hits [a-proteobacteria]       putative heme exporter c (cytochrome c-type biogenesis prot
. . . Shewanella sp. ANA-3 .....................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sp. ANA-3] >gi|11761
. . . Bordetella parapertussis 12822 ...........................................   55  1 hit  [b-proteobacteria]       putative heme export protein [Bordetella parapertussis 1282
. . . Bordetella parapertussis .................................................   55  1 hit  [b-proteobacteria]       putative heme export protein [Bordetella parapertussis 1282
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   55  4 hits [enterobacteria]         hypothetical protein SARI_00638 [Salmonella enterica subsp.
. . . Candidatus Vesicomyosocius okutanii HA ...................................   55  2 hits [g-proteobacteria]       heme exporter membrane protein CcmC [Candidatus Vesicomyoso
. . . Shewanella baltica OS185 .................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella baltica OS185] >gi|1
. . . Wolbachia endosymbiont of Muscidifurax uniraptor .........................   55  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Musci
. . . marine gamma proteobacterium HTCC2080 ....................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [marine gamma proteobacterium HT
. . . Vibrio sp. MED222 ........................................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio sp. MED222] >gi|218708852|r
. . . Vibrio splendidus LGP32 ..................................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio sp. MED222] >gi|218708852|r
. . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   55  1 hit  [enterobacteria]         heme exporter protein [Salmonella enterica subsp. enterica 
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   55  4 hits [enterobacteria]         hypothetical protein SPAB_00740 [Salmonella enterica subsp.
. . . Shewanella oneidensis MR-1 ...............................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella oneidensis MR-1] >gi
. . . Shewanella putrefaciens ..................................................   55  1 hit  [g-proteobacteria]       heme exporter protein CcmC [Shewanella oneidensis MR-1] >gi
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......   55  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........   55  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Haemophilus influenzae R2866 .............................................   55  1 hit  [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Haemophilus influenzae PittII ............................................   55  2 hits [g-proteobacteria]       COG0755: ABC-type transport system involved in cytochrome c
. . . Haemophilus influenzae Rd KW20 ...........................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae Rd KW20] >g
. . . Haemophilus influenzae RdAW ..............................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae Rd KW20] >g
. . . Haemophilus influenzae ...................................................   55  1 hit  [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae Rd KW20] >g
. . . Rhodobacter sp. SW2 ......................................................   55  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacter sp. SW2] >gi|259022
. . . Shewanella sediminis HAW-EB3 .............................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella sediminis HAW-EB3] >
. . . Haemophilus influenzae 7P49H1 ............................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae 7P49H1] >gi
. . . Novosphingobium aromaticivorans DSM 12444 ................................   55  2 hits [a-proteobacteria]       heme exporter protein CcmC [Novosphingobium aromaticivorans
. . . Marinomonas sp. MWYL1 ....................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Marinomonas sp. MWYL1] >gi|1508
. . . Laribacter hongkongensis HLHK9 ...........................................   55  2 hits [b-proteobacteria]       CcmC [Laribacter hongkongensis HLHK9] >gi|226715934|gb|ACO7
. . . Shewanella frigidimarina NCIMB 400 .......................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella frigidimarina NCIMB 
. . . Candidatus Pelagibacter sp. HTCC7211 .....................................   55  2 hits [a-proteobacteria]       heme exporter protein [Candidatus Pelagibacter sp. HTCC7211
. . . Moritella sp. PE36 .......................................................   55  2 hits [g-proteobacteria]       heme chaperone heme-lyase [Moritella sp. PE36] >gi|14980859
. . . Vibrionales bacterium SWAT-3 .............................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Vibrionales bacterium SWAT-3] >gi|
. . . Vibrio splendidus 12B01 ..................................................   55  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio splendidus 12B01] >gi|84377
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   55  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........   55  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   55  4 hits [enterobacteria]         ABC superfamily [Salmonella enterica subsp. enterica serova
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   55  4 hits [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........   55  4 hits [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   55  4 hits [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Erwinia pyrifoliae Ep1/96 ................................................   55  2 hits [enterobacteria]         Heme exporter protein C [Erwinia pyrifoliae Ep1/96] >gi|224
. . . Shewanella piezotolerans WP3 .............................................   55  2 hits [g-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Shewanella piezo
. . . Wolbachia endosymbiont of Culex quinquefasciatus Pel .....................   55  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Culex
. . . Wolbachia endosymbiont of Culex quinquefasciatus JHB .....................   55  2 hits [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Culex
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................   55  2 hits [g-proteobacteria]       heme chaperone heme-lyase [Aeromonas salmonicida subsp. sal
. . . Agrobacterium vitis S4 ...................................................   55  2 hits [a-proteobacteria]       ABC transporter membrane spanning protein (heme) [Agrobacte
. . . Rickettsia endosymbiont of Ixodes scapularis .............................   55  2 hits [a-proteobacteria]       heme exporter protein C [Rickettsia endosymbiont of Ixodes 
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........   55  4 hits [enterobacteria]         heme exporter protein [Salmonella typhimurium LT2] >gi|1676
. . . Shewanella woodyi ATCC 51908 .............................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella woodyi ATCC 51908] >
. . . Magnetococcus sp. MC-1 ...................................................   55  2 hits [proteobacteria]         heme exporter protein CcmC [Magnetococcus sp. MC-1] >gi|117
. . . Yersinia aldovae ATCC 35236 ..............................................   55  2 hits [enterobacteria]         Heme exporter protein C [Yersinia aldovae ATCC 35236] >gi|2
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   55  4 hits [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...   55  4 hits [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   55  1 hit  [enterobacteria]         ABC family protein [Salmonella enterica subsp. enterica ser
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Candidatus Ruthia magnifica str
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................   55  2 hits [g-proteobacteria]       heme exporter protein C [Aeromonas hydrophila subsp. hydrop
. . . Klebsiella pneumoniae 342 ................................................   55  2 hits [enterobacteria]         heme exporter protein C [Klebsiella pneumoniae 342] >gi|206
. . . gamma proteobacterium NOR51-B ............................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [gamma proteobacterium NOR51-B] 
. . . Sideroxydans lithotrophicus ES-1 .........................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Sideroxydans lithotrophicus ES-
. . . Shewanella baltica OS155 .................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella baltica OS155] >gi|1
. . . Shewanella baltica OS195 .................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella baltica OS155] >gi|1
. . . Shewanella baltica OS223 .................................................   55  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella baltica OS155] >gi|1
. . . Candidatus Solibacter usitatus Ellin6076 .................................   54  2 hits [bacteria]               cytochrome c assembly protein [Solibacter usitatus Ellin607
. . . Beggiatoa sp. PS .........................................................   54  2 hits [g-proteobacteria]       Cytochrome c assembly protein [Beggiatoa sp. PS] >gi|152066
. . . Vibrio mimicus VM223 .....................................................   54  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Vibrio mimicus V
. . . Methylococcus capsulatus str. Bath .......................................   54  2 hits [g-proteobacteria]       heme exporter protein CcmC [Methylococcus capsulatus str. B
. . . Vibrio mimicus VM573 .....................................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio mimicus VM573] >gi|25862548
. . . Vibrio mimicus VM603 .....................................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio mimicus VM573] >gi|25862548
. . . Vibrio mimicus MB-451 ....................................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio mimicus VM573] >gi|25862548
. . . Pantoea sp. At-9b ........................................................   54  2 hits [enterobacteria]         heme exporter protein CcmC [Pantoea sp. At-9b] >gi|25853277
. . . Vibrio shilonii AK1 ......................................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio shilonii AK1] >gi|148838101
. . . Dethiobacter alkaliphilus AHT 1 ..........................................   54  2 hits [firmicutes]             cytochrome c assembly protein [Dethiobacter alkaliphilus AH
. . . Phaeobacter gallaeciensis BS107 ..........................................   54  2 hits [a-proteobacteria]       heme exporter protein CcmC [Phaeobacter gallaeciensis BS107
. . . Phaeobacter gallaeciensis 2.10 ...........................................   54  2 hits [a-proteobacteria]       heme exporter protein CcmC [Phaeobacter gallaeciensis BS107
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   54  4 hits [enterobacteria]         heme exporter protein C2 [Salmonella enterica subsp. enteri
. . . Vibrio parahaemolyticus RIMD 2210633 .....................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Vibrio parahaemolyticus AQ3810 ...........................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Vibrio parahaemolyticus K5030 ............................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Vibrio parahaemolyticus AN-5034 ..........................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Vibrio parahaemolyticus Peru-466 .........................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Vibrio parahaemolyticus AQ4037 ...........................................   54  1 hit  [g-proteobacteria]       heme exporter protein C [Vibrio parahaemolyticus RIMD 22106
. . . Escherichia albertii TW07627 .............................................   54  2 hits [enterobacteria]         heme exporter protein C [Escherichia albertii TW07627] >gi|
. . . Sorangium cellulosum 'So ce 56' ..........................................   54  2 hits [d-proteobacteria]       heme exporter protein C [Sorangium cellulosum 'So ce 56'] >
. . . Vibrio sp. Ex25 ..........................................................   54  2 hits [g-proteobacteria]       heme exporter protein CcmC [Vibrio sp. Ex25] >gi|151939043|
. . . Vibrio alginolyticus 12G01 ...............................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio alginolyticus 12G01] >gi|91
. . . Vibrio sp. AND4 ..........................................................   54  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio sp. AND4] >gi|159174382|gb|
. . . Rickettsiella grylli .....................................................   54  2 hits [g-proteobacteria]       heme exporter protein CcmC [Rickettsiella grylli] >gi|15912
. . . Rhodobacterales bacterium Y4I ............................................   54  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacterales bacterium Y4I] 
. . . Sphingomonas sp. SKA58 ...................................................   54  2 hits [a-proteobacteria]       heme exporter protein CcmC [Sphingomonas sp. SKA58] >gi|944
. . . Xanthobacter autotrophicus Py2 ...........................................   53  2 hits [a-proteobacteria]       heme exporter protein CcmC [Xanthobacter autotrophicus Py2]
. . . Vibrio harveyi HY01 ......................................................   53  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio harveyi HY01] >gi|156975402
. . . Vibrio harveyi ATCC BAA-1116 .............................................   53  2 hits [g-proteobacteria]       heme exporter protein C [Vibrio harveyi HY01] >gi|156975402
. . . Vibrio coralliilyticus ATCC BAA-450 ......................................   53  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Vibrio coralliil
. . . Ralstonia pickettii 12J ..................................................   53  2 hits [b-proteobacteria]       heme exporter protein CcmC [Ralstonia pickettii 12J] >gi|18
. . . Roseobacter litoralis Och 149 ............................................   53  2 hits [a-proteobacteria]       heme exporter protein [Roseobacter litoralis Och 149] >gi|1
. . . Roseovarius nubinhibens ISM ..............................................   53  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseovarius
. . . Haemophilus influenzae PittHH ............................................   53  2 hits [g-proteobacteria]       heme exporter protein C [Haemophilus influenzae PittHH] >gi
. . . Candidatus Pelagibacter ubique HTCC1002 ..................................   53  2 hits [a-proteobacteria]       heme exporter protein [Candidatus Pelagibacter ubique HTCC1
. . . Dinoroseobacter shibae DFL 12 ............................................   53  2 hits [a-proteobacteria]       heme exporter protein CcmC [Dinoroseobacter shibae DFL 12] 
. . . Roseobacter denitrificans OCh 114 ........................................   53  2 hits [a-proteobacteria]       heme exporter protein [Roseobacter denitrificans OCh 114] >
. . . Grimontia hollisae CIP 101886 ............................................   53  2 hits [g-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Grimontia hollis
. . . Candidatus Pelagibacter ubique HTCC1062 ..................................   53  2 hits [a-proteobacteria]       heme exporter protein [Candidatus Pelagibacter ubique HTCC1
. . . Oceanicola batsensis HTCC2597 ............................................   53  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Oceanicola 
. . . Pseudoalteromonas tunicata D2 ............................................   53  2 hits [g-proteobacteria]       heme exporter protein C (Cytochrome c-type biogenesis prote
. . . Wolbachia endosymbiont of Dirofilaria immitis ............................   53  1 hit  [a-proteobacteria]       heme exporter protein CcmC [Wolbachia endosymbiont of Dirof
. . . Rhodobacter capsulatus ...................................................   53  2 hits [a-proteobacteria]       RecName: Full=Heme exporter protein C; AltName: Full=Cytoch
. . . Rhodobacterales bacterium HTCC2150 .......................................   53  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacterales bacterium HTCC2
. . . alpha proteobacterium HIMB114 ............................................   52  2 hits [a-proteobacteria]       heme exporter protein [alpha proteobacterium HIMB114] >gi|2
. . . Bermanella marisrubri ....................................................   52  2 hits [g-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . . Oligotropha carboxidovorans OM5 ..........................................   52  2 hits [a-proteobacteria]       heme exporter protein CcmC [Oligotropha carboxidovorans OM5
. . . Ehrlichia chaffeensis str. Sapulpa .......................................   52  2 hits [a-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Ehrlichia chaffe
. . . Ehrlichia chaffeensis str. Arkansas ......................................   52  2 hits [a-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Ehrlichia chaffe
. . . Mitsuokella multacida DSM 20544 ..........................................   52  2 hits [firmicutes]             cytochrome c-type biogenesis protein, heme exporter protein
. . . Yersinia ruckeri ATCC 29473 ..............................................   52  2 hits [enterobacteria]         Heme exporter protein C [Yersinia ruckeri ATCC 29473] >gi|2
. . . Neptuniibacter caesariensis ..............................................   52  2 hits [g-proteobacteria]       heme exporter protein CcmC [Oceanospirillum sp. MED92] >gi|
. . . Shewanella loihica PV-4 ..................................................   52  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella loihica PV-4] >gi|12
. . . Rhodospirillum centenum SW ...............................................   52  2 hits [a-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Rhodospirillum c
. . . Enhydrobacter aerosaccus SK60 ............................................   52  2 hits [g-proteobacteria]       heme exporter protein CcmC [Enhydrobacter aerosaccus SK60] 
. . . Roseobacter sp. MED193 ...................................................   52  2 hits [a-proteobacteria]       heme exporter protein CcmC [Roseobacter sp. MED193] >gi|858
. . . Shewanella denitrificans OS217 ...........................................   52  2 hits [g-proteobacteria]       heme exporter protein CcmC [Shewanella denitrificans OS217]
. . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................   51  2 hits [enterobacteria]         heme ABC superfamily ATP binding cassette transporter, memb
. . . Kangiella koreensis DSM 16069 ............................................   51  2 hits [g-proteobacteria]       heme exporter protein CcmC [Kangiella koreensis DSM 16069] 
. . . gamma proteobacterium HTCC2207 ...........................................   51  2 hits [g-proteobacteria]       heme exporter protein CcmC [marine gamma proteobacterium HT
. . . Pseudovibrio sp. JE062 ...................................................   51  2 hits [a-proteobacteria]       heme exporter protein CcmC [Pseudovibrio sp. JE062] >gi|211
. . . Dechloromonas aromatica RCB ..............................................   51  2 hits [b-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Dechloromonas ar
. . . Ehrlichia canis str. Jake ................................................   51  2 hits [a-proteobacteria]       cytochrome c-type biogenesis protein CcmC [Ehrlichia canis 
. . . Parvularcula bermudensis HTCC2503 ........................................   51  2 hits [a-proteobacteria]       heme exporter protein C (ABC transporter permease component
. . . Silicibacter lacuscaerulensis ITI-1157 ...................................   51  2 hits [a-proteobacteria]       heme exporter protein CcmC [Silicibacter lacuscaerulensis I
. . . Psychrobacter sp. PRwf-1 .................................................   51  2 hits [g-proteobacteria]       heme exporter protein CcmC [Psychrobacter sp. PRwf-1] >gi|1
. . . Citreicella sp. SE45 .....................................................   51  2 hits [a-proteobacteria]       heme exporter protein CcmC [Citreicella sp. SE45] >gi|26042
. . . Rhodobacter sphaeroides KD131 ............................................   51  2 hits [a-proteobacteria]       Heme exporter protein CcmC [Rhodobacter sphaeroides KD131] 
. . . Rhodobacter sphaeroides ATCC 17029 .......................................   51  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacter sphaeroides ATCC 17
. . . Rhodobacter sphaeroides 2.4.1 ............................................   51  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Rhodobacter
. . . Rhodobacter sphaeroides ..................................................   51  1 hit  [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Rhodobacter
. . . Gluconobacter oxydans 621H ...............................................   51  2 hits [a-proteobacteria]       Heme exporter protein C [Gluconobacter oxydans 621H] >gi|58
. . . Cronobacter turicensis ...................................................   51  2 hits [enterobacteria]         Heme exporter protein C [Cronobacter turicensis] >gi|260217
. . . Ralstonia pickettii 12D ..................................................   51  2 hits [b-proteobacteria]       heme exporter protein CcmC [Ralstonia pickettii 12D] >gi|24
. . . Rhodobacter sphaeroides ATCC 17025 .......................................   51  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacter sphaeroides ATCC 17
. . . Roseobacter sp. SK209-2-6 ................................................   50  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseobacter
. . . Nitrococcus mobilis Nb-231 ...............................................   50  2 hits [g-proteobacteria]       Cytochrome c-type biogenesis protein CcmC [Nitrococcus mobi
. . . Marinobacter sp. ELB17 ...................................................   50  2 hits [g-proteobacteria]       heme exporter protein CcmC [Marinobacter sp. ELB17] >gi|126
. . . Ruegeria sp. R11 .........................................................   50  2 hits [a-proteobacteria]       heme exporter protein CcmC [Ruegeria sp. R11] >gi|214031305
. . . Roseobacter sp. GAI101 ...................................................   50  2 hits [a-proteobacteria]       heme exporter protein [Roseobacter sp. GAI101] >gi|21404331
. . . Jannaschia sp. CCS1 ......................................................   50  2 hits [a-proteobacteria]       heme exporter protein CcmC [Jannaschia sp. CCS1] >gi|888646
. . . Psychrobacter arcticus 273-4 .............................................   50  2 hits [g-proteobacteria]       heme exporter, subunit CcmC [Psychrobacter arcticus 273-4] 
. . . Psychrobacter cryohalolentis K5 ..........................................   50  2 hits [g-proteobacteria]       heme exporter protein CcmC [Psychrobacter cryohalolentis K5
. . . Roseovarius sp. HTCC2601 .................................................   50  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseovarius
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................   50  2 hits [g-proteobacteria]       ABC transporter heme permease [Xanthomonas campestris pv. c
. . . Xanthomonas campestris pv. campestris str. 8004 ..........................   50  2 hits [g-proteobacteria]       ABC transporter heme permease [Xanthomonas campestris pv. c
. . . Rhodobacterales bacterium HTCC2083 .......................................   49  2 hits [a-proteobacteria]       heme exporter protein [Rhodobacterales bacterium HTCC2083] 
. . . Roseobacter sp. CCS2 .....................................................   49  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Roseobacter
. . . Octadecabacter antarcticus 307 ...........................................   49  2 hits [a-proteobacteria]       heme exporter protein CcmC [Octadecabacter antarcticus 307]
. . . Loktanella vestfoldensis SKA53 ...........................................   49  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Loktanella 
. . . Plesiocystis pacifica SIR-1 ..............................................   48  2 hits [d-proteobacteria]       cytochrome c assembly protein [Plesiocystis pacifica SIR-1]
. . . Xanthomonas campestris pv. campestris str. B100 ..........................   48  1 hit  [g-proteobacteria]       ABC transporter heme permease CcmC (c-type cytochrome bioge
. . . Xanthomonas campestris pv. campestris ....................................   48  1 hit  [g-proteobacteria]       ABC transporter heme permease CcmC (c-type cytochrome bioge
. . . Sulfitobacter sp. EE-36 ..................................................   48  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Sulfitobact
. . . Sulfitobacter sp. NAS-14.1 ...............................................   48  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Sulfitobact
. . . Gallionella ferruginea ES-2 ..............................................   48  2 hits [b-proteobacteria]       heme exporter protein CcmC [Gallionella ferruginea ES-2] >g
. . . Chloroherpeton thalassium ATCC 35110 .....................................   48  2 hits [green sulfur bacteria]  cytochrome c assembly protein [Chloroherpeton thalassium AT
. . . Paracoccus denitrificans PD1222 ..........................................   47  4 hits [a-proteobacteria]       hypothetical protein [Paracoccus denitrificans PD1222]
. . . Octadecabacter antarcticus 238 ...........................................   47  2 hits [a-proteobacteria]       heme exporter protein [Octadecabacter antarcticus 238] >gi|
. . . Gluconacetobacter diazotrophicus .........................................   47  1 hit  [a-proteobacteria]       heme exporter protein C [Gluconacetobacter diazotrophicus]
. . . Gluconacetobacter diazotrophicus PAl 5 ...................................   47  4 hits [a-proteobacteria]       heme exporter protein CcmC [Gluconacetobacter diazotrophicu
. . . Polaromonas naphthalenivorans CJ2 ........................................   47  2 hits [b-proteobacteria]       heme exporter protein CcmC [Polaromonas naphthalenivorans C
. . . Stenotrophomonas sp. SKA14 ...............................................   47  2 hits [g-proteobacteria]       ABC transporter heme permease [Stenotrophomonas sp. SKA14] 
. . . Sphingopyxis alaskensis RB2256 ...........................................   47  2 hits [a-proteobacteria]       heme exporter protein CcmC [Sphingopyxis alaskensis RB2256]
. . . Anaplasma marginale str. Puerto Rico .....................................   47  1 hit  [a-proteobacteria]       Cytochrome c-type biogenesis protein (ccmC) [Anaplasma marg
. . . Anaplasma marginale str. Virginia ........................................   47  1 hit  [a-proteobacteria]       Cytochrome c-type biogenesis protein (ccmC) [Anaplasma marg
. . . Anaplasma phagocytophilum HZ .............................................   47  2 hits [a-proteobacteria]       heme exporter protein CcmC [Anaplasma phagocytophilum HZ] >
. . . Roseiflexus sp. RS-1 .....................................................   46  2 hits [GNS bacteria]           cytochrome c assembly protein [Roseiflexus sp. RS-1] >gi|14
. . . Stenotrophomonas maltophilia R551-3 ......................................   46  2 hits [g-proteobacteria]       heme exporter protein CcmC [Stenotrophomonas maltophilia R5
. . . Anaplasma marginale str. St. Maries ......................................   46  2 hits [a-proteobacteria]       heme exporter protein C [Anaplasma marginale str. St. Marie
. . . Anaplasma marginale str. Florida .........................................   46  2 hits [a-proteobacteria]       heme exporter protein C [Anaplasma marginale str. St. Marie
. . . Stenotrophomonas maltophilia K279a .......................................   46  2 hits [g-proteobacteria]       putative heme exporter protein ccmC [Stenotrophomonas malto
. . . Gemmatimonas aurantiaca T-27 .............................................   46  2 hits [bacteria]               heme exporter protein CcmC [Gemmatimonas aurantiaca T-27] >
. . . Anaplasma marginale str. Mississippi .....................................   46  1 hit  [a-proteobacteria]       Cytochrome c-type biogenesis protein (ccmC) [Anaplasma marg
. . . Sphingobacterium spiritivorum ATCC 33300 .................................   46  2 hits [CFB group bacteria]     heme exporter protein C [Sphingobacterium spiritivorum ATCC
. . . Sphingobacterium spiritivorum ATCC 33861 .................................   46  2 hits [CFB group bacteria]     heme exporter protein C [Sphingobacterium spiritivorum ATCC
. . . Rhodobacteraceae bacterium KLH11 .........................................   46  2 hits [a-proteobacteria]       heme exporter protein CcmC [Rhodobacteraceae bacterium KLH1
. . . Sagittula stellata E-37 ..................................................   46  2 hits [a-proteobacteria]       heme exporter protein CcmC [Sagittula stellata E-37] >gi|12
. . . Haliangium ochraceum DSM 14365 ...........................................   46  2 hits [d-proteobacteria]       cytochrome c assembly protein [Haliangium ochraceum DSM 143
. . . Roseiflexus castenholzii DSM 13941 .......................................   46  2 hits [GNS bacteria]           cytochrome c assembly protein [Roseiflexus castenholzii DSM
. . . Alcanivorax sp. DG881 ....................................................   46  2 hits [g-proteobacteria]       heme exporter protein CcmC [Alcanivorax sp. DG881] >gi|1961
. . . Oceanibulbus indolifex HEL-45 ............................................   46  2 hits [a-proteobacteria]       heme exporter protein [Oceanibulbus indolifex HEL-45] >gi|1
. . . Hyphomonas neptunium ATCC 15444 ..........................................   46  2 hits [a-proteobacteria]       heme exporter protein CcmC [Hyphomonas neptunium ATCC 15444
. . . Oceanicola granulosus HTCC2516 ...........................................   46  2 hits [a-proteobacteria]       ABC heme exporter, inner membrane subunit CcmC [Oceanicola 
. . . Maricaulis maris MCS10 ...................................................   46  2 hits [a-proteobacteria]       heme exporter protein CcmC [Maricaulis maris MCS10] >gi|114
. . . Saccharophagus degradans 2-40 ............................................   46  2 hits [g-proteobacteria]       heme exporter protein CcmC [Saccharophagus degradans 2-40] 
. . . Thalassiobium sp. R2A62 ..................................................   45  2 hits [a-proteobacteria]       heme exporter protein CcmC [Thalassiobium sp. R2A62] >gi|25
. . . Alcanivorax borkumensis SK2 ..............................................   45  2 hits [g-proteobacteria]       Heme exporter protein C [Alcanivorax borkumensis SK2] >gi|1
. . . Hahella chejuensis KCTC 2396 .............................................   45  2 hits [g-proteobacteria]       ABC-type transport system involved in cytochrome c biogenes
. . Methanococcoides burtonii DSM 6242 -----------------------------------------   68  2 hits [euryarchaeotes]         ABC heme exporter, inner membrane subunit C [Methanococcoid
. . Methanosarcina mazei Go1 ...................................................   66  2 hits [euryarchaeotes]         Heme exporter, protein C [Methanosarcina mazei Go1] >gi|209
. . Methanosarcina acetivorans C2A .............................................   64  2 hits [euryarchaeotes]         heme exporter protein C [Methanosarcina acetivorans C2A] >g
. . Natronomonas pharaonis DSM 2160 ............................................   58  2 hits [euryarchaeotes]         ABC-type transport system permease protein 2 (heme exporter
. . Physcomitrella patens subsp. patens ........................................   57  2 hits [mosses]                 ATP-binding cassette transporter, subfamily I, member 13, A
. . Trichoplax adhaerens .......................................................   56  2 hits [placozoans]             hypothetical protein TRIADDRAFT_34635 [Trichoplax adhaerens
. . Physcomitrella patens ......................................................   55  2 hits [mosses]                 cytochrome c biogenesis C [Physcomitrella patens] >gi|90991
. . Ferroglobus placidus DSM 10642 .............................................   54  2 hits [euryarchaeotes]         cytochrome c assembly protein [Ferroglobus placidus DSM 106
. . Marchantia polymorpha ......................................................   54  3 hits [liverworts]             ABC transporter subunit [Marchantia polymorpha] >gi|586758|
. . Brassica napus (rapeseeds) .................................................   50  2 hits [eudicots]               cytochrome c biogenesis ccmC [Brassica napus] >gi|37591122|
. . Aureoumbra lagunensis ......................................................   49  2 hits [pelagophytes]           cytochrome c biogenesis protein [Aureoumbra lagunensis] >gi
. . Arabidopsis thaliana (thale-cress) .........................................   49 11 hits [eudicots]               RecName: Full=Putative cytochrome c biosynthesis ccmC-like 
. . Oryza sativa Japonica Group (Japanese rice) ................................   49  2 hits [monocots]               cytochrome c biogenesis C [Oryza sativa Japonica Group] >gi
. . Oryza sativa (red rice) ....................................................   49  1 hit  [monocots]               cytochrome c biogenesis C [Oryza sativa Japonica Group] >gi
. . Ignicoccus hospitalis KIN4/I ...............................................   49  2 hits [crenarchaeotes]         cytochrome c assembly protein [Ignicoccus hospitalis KIN4/I
. . Beta vulgaris subsp. vulgaris (Swiss chard) ................................   49  3 hits [eudicots]               cytochrome c biogenesis C [Beta vulgaris subsp. vulgaris]
. . Pleurozia purpurea .........................................................   47  2 hits [liverworts]             cytochrome c biogenesis C [Pleurozia purpurea] >gi|23778075
. . Raphanus sativus ...........................................................   47  1 hit  [eudicots]               cytochrome c maturation [Raphanus sativus]
. . Oenothera berteroana (Bertero's evening prim...) ...........................   46  1 hit  [eudicots]               unnamed protein product [Oenothera berteroana]
. . Chara vulgaris .............................................................   46  2 hits [green plants]           subunit of ABC transporter for cytochrome c1 [Chara vulgari
. . Agave attenuata ............................................................   46  1 hit  [monocots]               cytochrome c biogenesis ccmC [Agave attenuata]
. . Nicotiana tabacum (tobacco) ................................................   46  2 hits [eudicots]               cytochrome c maturation protein CcmC [Nicotiana tabacum] >g
. . Haloarcula marismortui ATCC 43049 ..........................................   46  2 hits [euryarchaeotes]         heme exporter protein C [Haloarcula marismortui ATCC 43049]
. . Aeropyrum pernix K1 ........................................................   46  2 hits [crenarchaeotes]         heme exporter protein C [Aeropyrum pernix K1] >gi|5103460|d
. . Ostreococcus lucimarinus CCE9901 ...........................................   45  2 hits [green algae]            plastid-localized, cytochrome c assembly protein [Ostreococ
. synthetic construct ----------------------------------------------------------   64  1 hit  [other sequences]        PA1477 [synthetic construct]

BLAST

PROTOCOLE:



a)Blast p de l'ORF contre swuissprot sur le site NCBI avec les paramètres par défaut

b)Blast p de l'ORF contre nr prot sur le site NCBI avec une valeur Max Targuets Sequence_1000


ANALYSE DES RÉSULTATS:


a)La recherche de protéines homologues par BLAST contre swissprot nous montre que la séquence d'ORF considéree est homologue à certaines protéines provenant d'origines diverses.

Cette recherche met également en évidence une fonction possible de notre protéine étant donné qu'elle possède de fortes similarités avec un grand nombre de protéines impliquées dans le transport: superfamille cytochrome C: heme transporteur


b)Etant donné que les fiches de banques des homologues issus de NR sont des annotations automatiques et donc a priori pas tres fiables; nous nous limiterons à dire que cette recherche par nr confirme l'hypothétique fonction d'hème transporteur induite par la recherche de swissprot.

RÉSULTATS BRUTS:


Database Name
    swissprot
Description
    Non-redundant SwissProt sequences See details
Program
    BLASTP 2.2.22+ Citation


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value
sp|Q9I3N5.1|CCMC_PSEAE  RecName: Full=Heme exporter protein C;...  65.1    1e-10
sp|P30962.1|CCMC_BRAJA  RecName: Full=Heme exporter protein C;...  62.4    8e-10
sp|P0ABM3.1|CCMC_ECO57  RecName: Full=Heme exporter protein C;...  58.5    1e-08
sp|P45034.1|CCMC_HAEIN  RecName: Full=Heme exporter protein C;...  55.8    7e-08
sp|P38453.1|CCMC_MARPO  RecName: Full=Putative cytochrome c bi...  54.3    2e-07 Gene info
sp|P29961.1|CCMC_RHOCA  RecName: Full=Heme exporter protein C;...  53.1    4e-07
sp|P92527.4|CCMC_ARATH  RecName: Full=Putative cytochrome c bi...  49.7    5e-06
sp|P52220.2|CCMC_PARDP  RecName: Full=Heme exporter protein C;...  47.8    2e-05 Gene info
sp|Q8DIH3.1|CCSA_THEEB  RecName: Full=Cytochrome c biogenesis ...  40.8    0.002 Gene info
sp|Q7NJ10.1|CCSA_GLOVI  RecName: Full=Cytochrome c biogenesis ...  40.0    0.003
sp|B2XT99.1|CCSA_HETA2  RecName: Full=Cytochrome c biogenesis ...  39.3    0.006
sp|Q3AXK1.1|CCSA_SYNS9  RecName: Full=Cytochrome c biogenesis ...  38.9    0.008 Gene info
sp|A2C1K1.1|CCSA_PROM1  RecName: Full=Cytochrome c biogenesis ...  38.1    0.014 Gene info
sp|P51369.1|CCSA_PORPU  RecName: Full=Cytochrome c biogenesis ...  38.1    0.015 Gene info
sp|P49523.1|CCSA_ODOSI  RecName: Full=Cytochrome c biogenesis ...  37.7    0.016 Gene info
sp|A7Y3L0.1|CCSA_IPOPU  RecName: Full=Cytochrome c biogenesis ...  37.7    0.018 Gene info
sp|A9BAR6.1|CCSA_PROM4  RecName: Full=Cytochrome c biogenesis ...  37.4    0.025 Gene info
sp|Q1XDB8.1|CCSA_PORYE  RecName: Full=Cytochrome c biogenesis ...  37.0    0.027 Gene info
sp|Q46LG5.1|CCSA_PROMT  RecName: Full=Cytochrome c biogenesis ...  37.0    0.030 Gene info
sp|B0CBA0.1|CCSA_ACAM1  RecName: Full=Cytochrome c biogenesis ...  35.8    0.073 Gene info
sp|B2Y206.1|CCSA_WELMI  RecName: Full=Cytochrome c biogenesis ...  35.4    0.081
sp|Q0IAM4.1|CCSA_SYNS3  RecName: Full=Cytochrome c biogenesis ...  35.4    0.082 Gene info
sp|Q49KU9.1|CCSA_EUCGG  RecName: Full=Cytochrome c biogenesis ...  35.4    0.083 Gene info
sp|Q2L962.1|CCSA_GOSHI  RecName: Full=Cytochrome c biogenesis ...  35.4    0.088 Gene info
sp|A0ZZ84.1|CCSA_GOSBA  RecName: Full=Cytochrome c biogenesis ...  35.4    0.090 Gene info
sp|Q06GK4.1|CCSA_PIPCE  RecName: Full=Cytochrome c biogenesis ...  35.4    0.093 Gene info
sp|P48257.1|CCSA_CYAPA  RecName: Full=Cytochrome c biogenesis ...  35.0    0.100 Gene info
sp|A5GLB4.1|CCSA_SYNPW  RecName: Full=Cytochrome c biogenesis ...  35.0    0.11  Gene info
sp|Q31BB2.1|CCSA_PROM9  RecName: Full=Cytochrome c biogenesis ...  35.0    0.12  Gene info
sp|Q9S1E4.1|NRFI_WOLSU  RecName: Full=Protein nrfI                 35.0    0.12 
sp|Q14FA9.1|CCSA_POPAL  RecName: Full=Cytochrome c biogenesis ...  34.7    0.13  Gene info
sp|A4GYW5.1|CCSA_POPTR  RecName: Full=Cytochrome c biogenesis ...  34.7    0.14  Gene info
sp|B1NWJ8.1|CCSA_MANES  RecName: Full=Cytochrome c biogenesis ...  34.7    0.14  Gene info
sp|A8G4E3.1|CCSA_PROM2  RecName: Full=Cytochrome c biogenesis ...  34.7    0.14  Gene info
sp|A3PCH3.1|CCSA_PROM0  RecName: Full=Cytochrome c biogenesis ...  34.7    0.15  Gene info
sp|A2BQQ0.1|CCSA_PROMS  RecName: Full=Cytochrome c biogenesis ...  34.7    0.15  Gene info
sp|P22554.1|CCSA_GUITH  RecName: Full=Cytochrome c biogenesis ...  34.3    0.18  Gene info
sp|Q118J9.1|CCSA_TRIEI  RecName: Full=Cytochrome c biogenesis ...  34.3    0.19  Gene info
sp|P56770.1|CCSA_ARATH  RecName: Full=Cytochrome c biogenesis ...  34.3    0.19  Gene info
sp|Q2JQ31.1|CCSA_SYNJB  RecName: Full=Cytochrome c biogenesis ...  34.3    0.20  Gene info
sp|Q2JV29.1|CCSA_SYNJA  RecName: Full=Cytochrome c biogenesis ...  34.3    0.21  Gene info
sp|A4QKF6.1|CCSA_BARVE  RecName: Full=Cytochrome c biogenesis ...  34.3    0.22  Gene info
sp|B2ITV8.1|CCSA_NOSP7  RecName: Full=Cytochrome c biogenesis ...  34.3    0.22  Gene info
sp|B1WP68.1|CCSA_CYAA5  RecName: Full=Cytochrome c biogenesis ...  33.9    0.25  Gene info
sp|A5GTF4.1|CCSA_SYNR3  RecName: Full=Cytochrome c biogenesis ...  33.9    0.25  Gene info
sp|A4QJY1.1|CCSA_OLIPU  RecName: Full=Cytochrome c biogenesis ...  33.9    0.26  Gene info
sp|Q5N3C1.1|CCSA_SYNP6  RecName: Full=Cytochrome c biogenesis ...  33.9    0.27  Gene info
sp|Q8YYB4.1|CCSA_ANASP  RecName: Full=Cytochrome c biogenesis ...  33.5    0.30  Gene info
sp|B7K1C1.1|CCSA_CYAP8  RecName: Full=Cytochrome c biogenesis ...  33.5    0.31  Gene info
sp|Q3MFU9.1|CCSA_ANAVT  RecName: Full=Cytochrome c biogenesis ...  33.5    0.31  Gene info
sp|O19901.1|CCSA_CYACA  RecName: Full=Cytochrome c biogenesis ...  33.5    0.31  Gene info
sp|P72978.1|CCSA_SYNY3  RecName: Full=Cytochrome c biogenesis ...  33.5    0.32  Gene info
sp|A0A384.1|CCSA_COFAR  RecName: Full=Cytochrome c biogenesis ...  33.5    0.32  Gene info
sp|Q85FH6.2|CCSA_ADICA  RecName: Full=Cytochrome c biogenesis ...  33.5    0.34  Gene info
sp|Q7U772.1|CCSA_SYNPX  RecName: Full=Cytochrome c biogenesis ...  33.5    0.34  Gene info
sp|B7KA41.1|CCSA_CYAP7  RecName: Full=Cytochrome c biogenesis ...  33.5    0.35  Gene info
sp|A4QKP4.1|CCSA_CAPBU  RecName: Full=Cytochrome c biogenesis ...  33.5    0.35  Gene info
sp|Q3AK79.1|CCSA_SYNSC  RecName: Full=Cytochrome c biogenesis ...  33.5    0.35  Gene info
sp|Q8S8U8.1|CCSA_ATRBE  RecName: Full=Cytochrome c biogenesis ...  33.5    0.36  Gene info
sp|A4QLY4.1|CCSA_NASOF  RecName: Full=Cytochrome c biogenesis ...  33.5    0.36  Gene info
sp|Q7V1U0.1|CCSA_PROMP  RecName: Full=Cytochrome c biogenesis ...  33.5    0.36  Gene info
sp|A8W3G6.1|CCSA_CUSEX  RecName: Full=Cytochrome c biogenesis ...  33.5    0.37  Gene info
sp|Q332S8.1|CCSA_LACSA  RecName: Full=Cytochrome c biogenesis ...  33.5    0.37  Gene info
sp|B0JLZ5.1|CCSA_MICAN  RecName: Full=Cytochrome c biogenesis ...  33.1    0.43  Gene info
sp|Q7V806.1|CCSA_PROMM  RecName: Full=Cytochrome c biogenesis ...  33.1    0.44  Gene info
sp|P12214.1|CCSA_MARPO  RecName: Full=Cytochrome c biogenesis ...  33.1    0.44  Gene info
sp|A2CAB5.1|CCSA_PROM3  RecName: Full=Cytochrome c biogenesis ...  33.1    0.45  Gene info
sp|A4QLF8.1|CCSA_LEPVR  RecName: Full=Cytochrome c biogenesis ...  33.1    0.46  Gene info
sp|P31564.1|CCSA_GALSU  RecName: Full=Cytochrome c biogenesis ...  33.1    0.46 
sp|B2XWJ0.1|CCSA_FAGEA  RecName: Full=Cytochrome c biogenesis ...  32.7    0.51  Gene info
sp|A4QJG5.1|CCSA_AETCO  RecName: Full=Cytochrome c biogenesis ...  32.7    0.53  Gene info
sp|P56315.1|CCSA_CHLVU  RecName: Full=Cytochrome c biogenesis ...  32.7    0.53  Gene info
sp|A2BW66.1|CCSA_PROM5  RecName: Full=Cytochrome c biogenesis ...  32.7    0.55  Gene info
sp|Q68RV7.1|CCSA_PANGI  RecName: Full=Cytochrome c biogenesis ...  32.7    0.56  Gene info
sp|P12216.1|CCSA_TOBAC  RecName: Full=Cytochrome c biogenesis ...  32.7    0.58  Gene info
sp|Q4FGG2.1|CCSA_NUPAD  RecName: Full=Cytochrome c biogenesis ...  32.7    0.59  Gene info
sp|A4QLP6.1|CCSA_LOBMA  RecName: Full=Cytochrome c biogenesis ...  32.7    0.60  Gene info
sp|Q33BX3.1|CCSA_NICTO  RecName: Full=Cytochrome c biogenesis ...  32.7    0.60  Gene info
sp|Q6EW01.1|CCSA_NYMAL  RecName: Full=Cytochrome c biogenesis ...  32.7    0.61  Gene info
sp|A4QJP9.1|CCSA_AETGR  RecName: Full=Cytochrome c biogenesis ...  32.7    0.62  Gene info
sp|B2LMP9.1|CCSA_GUIAB  RecName: Full=Cytochrome c biogenesis ...  32.7    0.62  Gene info
sp|Q9MUM3.1|CCSA_MESVI  RecName: Full=Cytochrome c biogenesis ...  32.3    0.65  Gene info
sp|P48269.2|CCSA_CHLRE  RecName: Full=Cytochrome c biogenesis ...  32.3    0.67  Gene info
sp|A9QCA0.1|CCSA_TRACE  RecName: Full=Cytochrome c biogenesis ...  32.3    0.72  Gene info
sp|A4GGE5.1|CCSA_PHAVU  RecName: Full=Cytochrome c biogenesis ...  32.3    0.74  Gene info
sp|Q09FR1.1|CCSA_NANDO  RecName: Full=Cytochrome c biogenesis ...  32.3    0.75  Gene info
sp|A7M9A9.1|CCSA_CUSRE  RecName: Full=Cytochrome c biogenesis ...  32.0    0.88  Gene info
sp|A4QK69.1|CCSA_ARAHI  RecName: Full=Cytochrome c biogenesis ...  32.0    0.91  Gene info
sp|Q1KXQ2.1|CCSA_HELAN  RecName: Full=Cytochrome c biogenesis ...  32.0    0.93  Gene info
sp|B1XQL3.1|CCSA_SYNP2  RecName: Full=Cytochrome c biogenesis ...  32.0    0.95  Gene info
sp|Q7YJT4.1|CCSA_CALFG  RecName: Full=Cytochrome c biogenesis ...  32.0    1.0   Gene info
sp|A4QL70.1|CCSA_DRANE  RecName: Full=Cytochrome c biogenesis ...  32.0    1.0   Gene info
sp|Q06FQ5.1|CCSA_PELHO  RecName: Full=Cytochrome c biogenesis ...  32.0    1.0   Gene info
sp|Q0G9H0.1|CCSA_LIRTU  RecName: Full=Cytochrome c biogenesis ...  32.0    1.0   Gene info
sp|Q2MID8.1|CCSA_SOLBU  RecName: Full=Cytochrome c biogenesis ...  32.0    1.1   Gene info
sp|Q9M3J1.1|CCSA_SPIOL  RecName: Full=Cytochrome c biogenesis ...  32.0    1.1   Gene info
sp|A9L9E6.1|CCSA_LEMMI  RecName: Full=Cytochrome c biogenesis ...  31.6    1.1   Gene info
sp|Q2MI51.1|CCSA_SOLLC  RecName: Full=Cytochrome c biogenesis ...  31.6    1.1   Gene info
sp|Q61762.1|KCNA5_MOUSE  RecName: Full=Potassium voltage-gated...  31.6    1.2   Gene info
sp|Q06R81.1|CCSA_JASNU  RecName: Full=Cytochrome c biogenesis ...  31.6    1.3   Gene info


Les 10 premiers alignements issus de Swissprot:


>sp|Q9I3N5.1|CCMC_PSEAE  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
Length=252

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (48%), Gaps = 6/121 (4%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P WG  WVW+ RL   L+L  +Y G   L      R   A  CA++ I+  +NIPII
Sbjct  116  WGKPTWGAWWVWDARLTAMLILLFLYFGIIALGQAISNRDSAAKACAVLAIVGVVNIPII  175

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILN---PFLFSLLSFTSLMIFMLL--LKIEVLKKK  115
              SV +W   +       + ++P+  +    P L  +L F      MLL  +++EVLK++
Sbjct  176  KYSVEWW-NTLHQPATFTITEKPAMPVEMWLPLLIMVLGFYCFFAAMLLVRMRLEVLKRE  234

Query  116  D  116
             
Sbjct  235  S  235


>sp|P30962.1|CCMC_BRAJA  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein cycZ
Length=263

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  W W+ RL + L+LFL+Y+G   L        R A   A++ ++  +N+PII
Sbjct  111  WGRPMWGTYWEWDARLTSVLILFLMYLGLMALWRAVDDPSRAARAAAVLTLVGAINLPII  170

Query  61   FASVNFWAAEIQ--SHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLL--LKIEVLKKK  115
              SV++W    Q  S  ++G +      L P L   ++FT L + + L  ++ E+L+++
Sbjct  171  KFSVDWWNTLHQPASVMRMGGSSLDKSFLIPLLVMAIAFTLLFVTLHLAAMRNEILRRR  229


>sp|P0ABM3.1|CCMC_ECO57  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
 sp|P0ABM2.1|CCMC_ECOL6  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
 sp|P0ABM1.1|CCMC_ECOLI  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
 sp|P0ABM4.1|CCMC_SHIFL  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
Length=245

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (50%), Gaps = 1/112 (0%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  WVW+ RL + LVL  +Y+G   L +    R+       I+ +I  +N+PII
Sbjct  114  WGKPMWGTWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPII  173

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVL  112
              SV +W    Q   ++  +  P+ + +P  +S+  F  L   + L+++  L
Sbjct  174  HYSVEWWNTLHQGSTRMQQSIDPA-MRSPLRWSIFGFLLLSATLTLMRMRNL  224


>sp|P45034.1|CCMC_HAEIN  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
Length=246

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  WVW+ RL   L+LF +Y+G   L +    R   A    I+ I   + +PII
Sbjct  114  WGKPMWGTWWVWDARLTAELILFFLYLGILALYSAFSDRNIGAKAAGILCITTVVILPII  173

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGI--LNPFLFSLLSFTSLMIFMLLLKIEV-LKKKDI  117
              SV +W    Q      + K    I  L P +  +  F +L I++ L++  + L K+D 
Sbjct  174  HFSVEWWNTLHQGASITKLEKPSIAIPMLVPLILCIFGFLTLYIWLTLVRYRMELLKEDA  233

Query  118  EDRYV  122
            +  +V
Sbjct  234  KRPWV  238


>sp|P38453.1|CCMC_MARPO Gene info RecName: Full=Putative cytochrome c biosynthesis ccmC-like mitochondrial 
protein
Length=228

 GENE ID: 2702650 ccmC | ABC transporter subunit [Marchantia polymorpha]
(10 or fewer PubMed links)

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  WVW+ RL + L+LF +Y+G   LR    +++  A V +I   I  +NIPII
Sbjct  111  WGKPMWGTFWVWDARLTSVLILFFIYLG--ALR----FQEFSADVASIFICIGLINIPII  164

Query  61   FASVNFWAAEIQ--SHPQLGMNKQPSGILNPFL  91
              SVN+W    Q  S  Q G +   S ++  FL
Sbjct  165  KFSVNWWNTLHQPSSISQFGTSIHISMLIPIFL  197


>sp|P29961.1|CCMC_RHOCA  RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein helC
Length=242

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 15/131 (11%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFIL----RNVGLYRQRVALVCAIIGIIAFLN  56
            W  P+WG  W W+PRL + L+LFL Y+GY  L     N         ++C +  + A L+
Sbjct  112  WGQPMWGTWWEWDPRLTSFLILFLFYLGYMALWEAIENPDTAADLTGVLCLVGSVFAVLS  171

Query  57   IPIIFASVNFWAAEIQSHPQLGMNKQ---PSGILNPFLFSLLSFTSLMIFMLLLK----I  109
                +A++ FW   +     L ++K+         P + S+  F  L + +LLL+    I
Sbjct  172  ---RYAAI-FWNQGLHQGSTLSLDKEEHIADVYWQPLVLSIAGFGMLFVALLLLRTRTEI  227

Query  110  EVLKKKDIEDR  120
               + K +E R
Sbjct  228  RARRLKALEQR  238


>sp|P92527.4|CCMC_ARATH  RecName: Full=Putative cytochrome c biosynthesis ccmC-like mitochondrial 
protein; AltName: Full=ABC transporter I family 
member 3; Short=ABC transporter ABCI.3; Short=AtABCI3
Length=232

 Score = 49.7 bits (117),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  WVW+ RL +  +LF +Y+G    + + +    + L+C     +  ++IPII
Sbjct  111  WGRPMWGTFWVWDARLTSVFILFFIYLGALCFQKLPVELASI-LIC-----VGLIDIPII  164

Query  61   FASVNFWAAEIQ--SHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKKDIE  118
              SVN+W    Q  S  + G +   S +L P L +  +F  L   + +L+  +L    +E
Sbjct  165  KFSVNWWNTLHQPGSISRFGTSIHVS-MLIPILSNFANFLFLTCILFVLETRLLILSFLE  223

Query  119  DR  120
              
Sbjct  224  SS  225


>sp|P52220.2|CCMC_PARDP Gene info RecName: Full=Heme exporter protein C; AltName: Full=Cytochrome 
c-type biogenesis protein ccmC
Length=241

 GENE ID: 4581276 Pden_1411 | heme exporter protein CcmC
[Paracoccus denitrificans PD1222] (10 or fewer PubMed links)

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFIL----RNVGLYRQRVALVCAIIGIIAFLN  56
            W  P+WG  W W+PRL + L+LFL Y+GY  L     N         ++C +  + A L+
Sbjct  111  WGQPMWGTWWEWDPRLTSFLILFLFYLGYMALWEAVENPDSAADLTGVLCLVGSVFALLS  170

Query  57   IPIIFASVNFWAAEIQSHPQLGM  79
                  +VNFW   +     L M
Sbjct  171  ----RYAVNFWNQGLHQGASLSM  189


>sp|Q8DIH3.1|CCSA_THEEB Gene info RecName: Full=Cytochrome c biogenesis protein ccsA
Length=319

 GENE ID: 1012158 ccsA | c-type cytochrome synthesis protein
[Thermosynechococcus elongatus BP-1] (10 or fewer PubMed links)

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA   WG PW W+P+    L+++LVY  Y   R    ++ R     AI+  + F  + + 
Sbjct  245  WANEAWGAPWSWDPKETWALIVWLVYAAYLHARMTRDWQGRKP---AILATVGFGVVWVC  301

Query  61   FASVNFWAAEIQSH  74
            +  VN     + S+
Sbjct  302  YLGVNLLGKGLHSY  315


>sp|Q7NJ10.1|CCSA_GLOVI  RecName: Full=Cytochrome c biogenesis protein ccsA
Length=338

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA   WG  W W+P+   +L+ + ++  Y   R    ++ R     A +G   F+++ I 
Sbjct  262  WANEAWGSYWSWDPKETWSLITWFIFAAYLHARITRGWQGRRPATLAAVG---FVSVWIT  318

Query  61   FASVNFWAAEIQSHPQLGMN  80
            +  VNF A  + S+  L  N
Sbjct  319  YLGVNFLAQGLHSYGWLSGN  338







Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTP 2.2.22+ Citation




                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value
ref|ZP_03856718.1|  ABC-type transport system involved in cyto...  90.5    4e-17
ref|YP_387968.1|  cytochrome c-type biogenesis protein CcmC [D...  87.4    4e-16 Gene info
ref|ZP_02170570.1|  cytochrome c assembly protein [Bacillus se...  87.0    5e-16
ref|YP_002522425.1|  heme exporter protein C [Thermomicrobium ...  81.3    3e-14 Gene info
ref|YP_002480937.1|  cytochrome c assembly protein [Desulfovib...  80.1    7e-14 Gene info
ref|YP_923152.1|  cytochrome c assembly protein [Nocardioides ...  80.1    7e-14 Gene info
ref|YP_360214.1|  putative heme exporter protein CcmC [Carboxy...  79.7    8e-14 Gene info
ref|ZP_03311797.1|  hypothetical protein DESPIG_01714 [Desulfo...  79.3    1e-13
ref|YP_002437533.1|  cytochrome c assembly protein [Desulfovib...  78.2    2e-13 Gene info
ref|NP_294071.1|  cytochrome c-type biogenesis protein, heme e...  77.8    3e-13 Gene info
ref|YP_003197851.1|  cytochrome c assembly protein [Desulfohal...  77.8    3e-13 Gene info
ref|YP_010268.1|  cytochrome c-type biogenesis protein CcmC [D...  77.0    6e-13 Gene info
ref|ZP_03495760.1|  cytochrome c assembly protein [Thermus aqu...  76.6    7e-13
ref|ZP_03906980.1|  ABC-type transport system involved in cyto...  75.9    1e-12
ref|ZP_04494827.1|  ABC-type transport system involved in cyto...  75.5    2e-12
ref|YP_005010.1|  heme exporter protein C [Thermus thermophilu...  74.3    3e-12 Gene info
ref|YP_144672.1|  cytochrome c-type biogenesis protein, heme e...  74.3    3e-12 Gene info
ref|YP_002508134.1|  cytochrome c assembly protein [Halothermo...  74.3    3e-12 Gene info
ref|YP_002953624.1|  heme exporter protein C [Desulfovibrio ma...  73.9    4e-12 Gene info
ref|YP_001264471.1|  heme exporter protein CcmC [Sphingomonas ...  73.2    9e-12 Gene info
ref|YP_595328.1|  ABC-type transport system involved in cytoch...  72.8    1e-11 Gene info
ref|YP_002991144.1|  cytochrome c assembly protein [Desulfovib...  72.4    1e-11 Gene info
ref|YP_236461.1|  cytochrome c-type biogenesis protein CcmC [P...  71.6    2e-11 Gene info
ref|ZP_01461144.1|  cytochrome c-type biogenesis protein, heme...  71.6    2e-11
ref|YP_001527373.1|  cytochrome c-type biogenesis protein [Azo...  71.2    3e-11 Gene info
ref|ZP_04040448.1|  ABC-type transport system involved in cyto...  71.2    3e-11
ref|YP_001492767.1|  Heme exporter protein C [Rickettsia canad...  71.2    3e-11 Gene info
ref|ZP_04770486.1|  heme exporter protein CcmC [Asticcacaulis ...  69.7    9e-11
ref|YP_003159000.1|  cytochrome c assembly protein [Desulfomic...  69.3    1e-10 Gene info
ref|YP_565671.1|  ABC heme exporter, inner membrane subunit C ...  68.9    1e-10 Gene info
ref|YP_347311.1|  cytochrome c-type biogenesis protein CcmC [P...  68.9    2e-10 Gene info
ref|YP_275471.1|  heme exporter protein CcmC [Pseudomonas syri...  68.6    2e-10 Gene info
ref|YP_348690.2|  cytochrome c-type biogenesis protein CcmC [P...  68.6    2e-10 Gene info
ref|YP_003108975.1|  cytochrome c assembly protein [Acidimicro...  68.6    2e-10 Gene info
ref|ZP_05638872.1|  heme exporter protein CcmC [Pseudomonas sy...  68.2    2e-10
ref|YP_001495361.1|  heme exporter protein C [Rickettsia ricke...  68.2    3e-10 Gene info
ref|ZP_04587800.1|  cytochrome c-type biogenesis protein CcmC ...  68.2    3e-10
emb|CAA88015.1|  inner membrane protein [Pseudomonas fluorescens]  68.2    3e-10
ref|YP_002871397.1|  cytochrome C biogenesis, heme exporter pr...  67.8    3e-10 Gene info
ref|YP_506393.1|  CcmC family heme exporter protein [Neoricket...  67.8    3e-10 Gene info
ref|YP_002845695.1|  Heme exporter protein C [Rickettsia afric...  67.8    3e-10 Gene info
ref|NP_360921.1|  heme exporter protein C [Rickettsia conorii ...  67.8    3e-10 Gene info
ref|YP_002916694.1|  heme chaperone heme-lyase [Rickettsia pea...  67.8    3e-10 Gene info
ref|YP_001188276.1|  heme exporter protein CcmC [Pseudomonas m...  67.8    4e-10 Gene info
ref|YP_591377.1|  cytochrome c assembly protein [Candidatus Ko...  67.4    4e-10 Gene info
ref|YP_001499802.1|  Heme exporter protein C [Rickettsia massi...  67.4    4e-10 Gene info
ref|ZP_05031731.1|  heme exporter protein CcmC [Brevundimonas ...  67.4    5e-10
ref|YP_247334.1|  Heme exporter protein C [Rickettsia felis UR...  67.0    6e-10 Gene info
ref|YP_001632684.1|  heme exporter protein CcmC [Bordetella pe...  66.6    7e-10 Gene info
ref|YP_001494018.1|  Heme exporter protein C [Rickettsia akari...  66.6    7e-10 Gene info
ref|NP_634420.1|  Heme exporter, protein C [Methanosarcina maz...  66.6    7e-10 Gene info
ref|YP_031825.1|  Heme exporter protein C [Bartonella quintana...  66.6    8e-10 Gene info
ref|YP_001750502.1|  heme exporter protein CcmC [Pseudomonas p...  66.6    8e-10 Gene info
ref|YP_001352634.1|  heme exporter protein CcmC [Janthinobacte...  66.6    9e-10 Gene info
ref|ZP_04035396.1|  ABC-type transport system involved in cyto...  66.2    9e-10
ref|ZP_03509913.1|  heme ABC transporter, permease protein (in...  66.2    1e-09
ref|ZP_01229021.1|  heme export protein C [Aurantimonas mangan...  66.2    1e-09
ref|YP_001640075.1|  heme exporter protein CcmC [Methylobacter...  66.2    1e-09 Gene info
ref|YP_002546050.1|  heme ABC transporter [Agrobacterium radio...  65.9    1e-09 Gene info
ref|YP_001266883.1|  heme exporter protein CcmC [Pseudomonas p...  65.9    1e-09 Gene info
ref|YP_002963774.1|  heme exporter protein, cytochrome c-type ...  65.9    1e-09 Gene info
ref|YP_609283.1|  cytochrome c-type biogenesis protein CcmC; h...  65.9    1e-09 Gene info
ref|YP_001670120.1|  heme exporter protein CcmC [Pseudomonas p...  65.9    1e-09 Gene info
ref|YP_001980337.1|  heme ABC transporter, permease protein (i...  65.9    1e-09 Gene info
ref|NP_746440.1|  heme exporter protein CcmC [Pseudomonas puti...  65.9    1e-09 Gene info
ref|YP_003068850.1|  heme exporter protein, cytochrome c-type ...  65.9    1e-09 Gene info
ref|YP_003081701.1|  heme exporter protein, CcmC family [Neori...  65.9    1e-09 Gene info
ref|YP_001344150.1|  heme exporter protein CcmC [Actinobacillu...  65.9    1e-09 Gene info
ref|YP_001495678.1|  Heme exporter protein C [Rickettsia belli...  65.5    2e-09 Gene info
ref|YP_001831850.1|  heme exporter protein CcmC [Beijerinckia ...  65.5    2e-09 Gene info
ref|YP_258808.1|  heme exporter protein CcmC [Pseudomonas fluo...  65.5    2e-09 Gene info
ref|YP_538443.1|  Heme exporter protein C [Rickettsia bellii R...  65.1    2e-09 Gene info
ref|YP_002421602.1|  heme exporter protein CcmC [Methylobacter...  65.1    2e-09 Gene info
ref|YP_002441519.1|  heme exporter protein CcmC [Pseudomonas a...  65.1    2e-09 Gene info
ref|NP_250168.1|  heme exporter protein CcmC [Pseudomonas aeru...  65.1    2e-09 Gene info
ref|YP_001349204.1|  heme exporter protein CcmC [Pseudomonas a...  64.7    3e-09 Gene info
gb|AAT50530.1|  PA1477 [synthetic construct]                       64.7    3e-09
ref|YP_001925334.1|  heme exporter protein CcmC [Methylobacter...  64.7    3e-09 Gene info
ref|NP_616363.1|  heme exporter protein C [Methanosarcina acet...  64.7    3e-09 Gene info
ref|NP_221179.1|  HEME exporter protein C (ccmC) [Rickettsia p...  64.3    3e-09 Gene info
ref|NP_422466.1|  heme exporter protein C [Caulobacter crescen...  64.3    4e-09 Gene info
emb|CAA10529.1|  CcmC protein [Pseudomonas putida]                 64.3    4e-09
ref|YP_744092.1|  heme chaperone heme-lyase [Granulibacter bet...  64.3    4e-09 Gene info
ref|YP_267781.1|  heme exporter protein CcmC [Colwellia psychr...  64.3    4e-09 Gene info
ref|YP_675896.1|  heme exporter protein CcmC [Mesorhizobium sp...  63.9    5e-09 Gene info
ref|YP_001608607.1|  heme exporter protein C [Bartonella tribo...  63.9    5e-09 Gene info
ref|YP_555629.1|  ABC heme exporter, inner membrane subunit Cc...  63.9    6e-09 Gene info
ref|ZP_05973344.1|  hypothetical protein PrusD4_12089 [Provide...  63.5    6e-09
ref|YP_087795.1|  CcmC protein [Mannheimia succiniciproducens ...  63.5    7e-09 Gene info
ref|YP_002785454.1|  putative cytochrome c-type biogenesis pro...  63.5    7e-09 Gene info
ref|ZP_01707698.1|  heme exporter protein CcmC [Shewanella put...  63.2    7e-09
ref|YP_002971172.1|  heme exporter protein CcmC [Bartonella gr...  63.2    8e-09 Gene info
ref|ZP_05093827.1|  heme exporter protein CcmC [marine gamma p...  63.2    8e-09
ref|YP_584533.1|  heme exporter protein CcmC [Ralstonia metall...  63.2    8e-09 Gene info
ref|YP_002495527.1|  heme exporter protein CcmC [Methylobacter...  63.2    9e-09 Gene info
ref|YP_001770475.1|  heme exporter protein CcmC [Methylobacter...  63.2    9e-09 Gene info
ref|YP_003260087.1|  heme exporter protein CcmC [Pectobacteriu...  63.2    9e-09 Gene info
ref|ZP_03825414.1|  heme exporter protein C [Pectobacterium ca...  62.8    1e-08
ref|NP_355624.1|  ABC transporter, membrane spanning protein (...  62.8    1e-08 Gene info
ref|ZP_04679275.1|  heme exporter protein CcmC [Ochrobactrum i...  62.8    1e-08
ref|ZP_03833147.1|  heme exporter protein C [Pectobacterium ca...  62.8    1e-08
ref|YP_049981.1|  heme exporter protein C [Pectobacterium atro...  62.8    1e-08 Gene info
ref|ZP_03269639.1|  heme exporter protein CcmC [Burkholderia s...  62.8    1e-08
ref|YP_001982532.1|  heme exporter protein C [Cellvibrio japon...  62.4    1e-08 Gene info
ref|YP_471420.1|  heme ABC transporter, permease protein (invo...  62.4    2e-08 Gene info
ref|ZP_05315053.1|  heme exporter protein CcmC [Nitrosomonas s...  62.4    2e-08
ref|YP_003143173.1|  ABC-type transport system involved in cyt...  62.4    2e-08 Gene info
ref|NP_767109.1|  heme exporter protein C [Bradyrhizobium japo...  62.4    2e-08 Gene info
ref|YP_425130.1|  cytochrome c-type biogenesis protein CcmC [R...  62.0    2e-08 Gene info
ref|YP_205205.1|  heme exporter subunit C [Vibrio fischeri ES1...  62.0    2e-08 Gene info
ref|YP_067755.1|  heme exporter protein C [Rickettsia typhi st...  62.0    2e-08 Gene info
ref|YP_631455.1|  heme exporter protein CcmC [Myxococcus xanth...  62.0    2e-08 Gene info
ref|YP_001002935.1|  heme exporter protein CcmC [Halorhodospir...  62.0    2e-08 Gene info
ref|YP_779252.1|  heme exporter protein CcmC [Rhodopseudomonas...  62.0    2e-08 Gene info
ref|YP_001173045.1|  heme exporter protein CcmC [Pseudomonas s...  61.6    2e-08 Gene info
ref|YP_742521.1|  heme exporter protein CcmC [Alkalilimnicola ...  61.6    2e-08 Gene info
ref|YP_001368668.1|  heme exporter protein CcmC [Ochrobactrum ...  61.6    2e-08 Gene info
ref|YP_002263641.1|  cytochrome c-type biogenesis protein CcmC...  61.6    2e-08 Gene info
ref|YP_001479615.1|  heme exporter protein CcmC [Serratia prot...  61.6    2e-08 Gene info
ref|YP_604710.1|  cytochrome c assembly protein [Deinococcus g...  61.6    3e-08 Gene info
ref|ZP_01438815.1|  heme exporter protein CcmC [Fulvimarina pe...  61.6    3e-08
ref|YP_989535.1|  heme exporter protein CcmC [Bartonella bacil...  61.6    3e-08 Gene info
ref|YP_002476522.1|  cytochrome c-type biogenesis protein/heme...  61.6    3e-08 Gene info
ref|YP_032972.1|  Heme exporter protein C [Bartonella henselae...  61.6    3e-08 Gene info
ref|NP_945558.1|  heme exporter protein CcmC [Rhodopseudomonas...  61.2    3e-08 Gene info
ref|YP_002800183.1|  cytochrome c-type biogenesis protein [Azo...  61.2    3e-08 Gene info
ref|ZP_02477285.1|  heme exporter protein C [Haemophilus paras...  61.2    3e-08
ref|YP_003017989.1|  heme exporter protein CcmC [Pectobacteriu...  61.2    3e-08 Gene info
ref|YP_001757972.1|  heme exporter protein CcmC [Methylobacter...  61.2    3e-08 Gene info
ref|ZP_02159346.1|  heme exporter protein CcmC [Shewanella ben...  61.2    3e-08
ref|YP_770104.1|  putative heme exporter protein c (cytochrome...  61.2    3e-08 Gene info
ref|ZP_04977312.1|  heme ABC superfamily ATP binding cassette ...  61.2    3e-08
ref|ZP_02961478.1|  hypothetical protein PROSTU_03509 [Provide...  61.2    3e-08
ref|YP_002977844.1|  heme exporter protein CcmC [Rhizobium leg...  61.2    3e-08 Gene info
ref|ZP_04773131.1|  cytochrome c assembly protein [Allochromat...  61.2    3e-08
emb|CAM77635.1|  Cytochrome c assembly protein [Magnetospirill...  61.2    3e-08
ref|YP_521336.1|  heme exporter protein CcmC [Rhodoferax ferri...  61.2    3e-08 Gene info
ref|YP_002283229.1|  heme exporter protein CcmC [Rhizobium leg...  61.2    4e-08 Gene info
ref|ZP_03637494.1|  hypothetical protein PROVRETT_00558 [Provi...  61.2    4e-08
ref|ZP_03559650.1|  heme exporter protein C [Glaciecola sp. HT...  60.8    4e-08
ref|YP_002755776.1|  putative heme exporter protein C [Acidoba...  60.8    4e-08 Gene info
gb|ABO28734.1|  CcmC [Magnetospirillum gryphiswaldense MSR-1]      60.8    4e-08
ref|YP_003073364.1|  heme exporter protein CcmC [Teredinibacte...  60.8    4e-08 Gene info
ref|NP_697137.1|  heme exporter protein CcmC [Brucella suis 13...  60.8    4e-08 Gene info
ref|ZP_05963410.1|  heme exporter protein CcmC [Brucella neoto...  60.8    4e-08
ref|YP_001934120.1|  Cytochrome c assembly protein [Brucella a...  60.8    4e-08 Gene info
ref|ZP_05453521.1|  heme exporter protein C [Brucella melitens...  60.8    4e-08
ref|ZP_05180126.1|  heme exporter protein C [Brucella sp. 83/13]   60.8    4e-08
ref|ZP_01704475.1|  heme exporter protein CcmC [Shewanella put...  60.8    4e-08
ref|NP_540768.1|  heme exporter protein C [Brucella melitensis...  60.8    4e-08 Gene info
ref|YP_220870.1|  CcmC, heme exporter protein [Brucella abortu...  60.8    4e-08 Gene info
ref|ZP_01159966.1|  heme exporter protein C [Photobacterium sp...  60.8    5e-08
ref|ZP_05450412.1|  heme exporter protein C [Brucella neotomae...  60.8    5e-08
ref|YP_001258137.1|  heme exporter protein CcmC [Brucella ovis...  60.8    5e-08 Gene info
ref|NP_873302.1|  cytochrome c-type biogenesis protein [Haemop...  60.5    5e-08 Gene info
ref|ZP_05376654.1|  heme exporter protein CcmC [Hyphomicrobium...  60.5    5e-08
ref|YP_575762.1|  heme exporter protein CcmC [Nitrobacter hamb...  60.5    5e-08 Gene info
ref|ZP_01044478.1|  Cytochrome c-type biogenesis protein CcmC ...  60.5    5e-08
ref|YP_001328747.1|  heme exporter protein CcmC [Sinorhizobium...  60.5    6e-08 Gene info
ref|ZP_01611441.1|  heme exporter protein C (Cytochrome c-type...  60.5    6e-08
ref|ZP_00957159.1|  heme exporter protein c [Oceanicaulis alex...  60.5    6e-08
ref|YP_586195.1|  heme exporter protein CcmC [Ralstonia metall...  60.1    6e-08 Gene info
ref|ZP_04446615.1|  hypothetical protein COLINT_03358 [Collins...  60.1    7e-08
ref|ZP_02186450.1|  hypothetical protein BAL199_16538 [alpha p...  60.1    7e-08
ref|ZP_01235765.1|  heme exporter protein C [Vibrio angustum S...  60.1    8e-08
ref|YP_001005586.1|  putative heme exporter protein C [Yersini...  60.1    8e-08 Gene info
ref|NP_840840.1|  heme exporter CcmC [Nitrosomonas europaea AT...  59.7    9e-08 Gene info
ref|YP_339348.1|  heme exporter protein C (cytochrome c-type b...  59.7    9e-08 Gene info
ref|NP_668887.1|  heme exporter protein C [Yersinia pestis KIM...  59.7    9e-08 Gene info
ref|YP_423560.1|  ABC-type transport system involved in cytoch...  59.7    9e-08 Gene info
ref|YP_002827721.1|  heme exporter protein CcmC [Rhizobium sp....  59.7    1e-07 Gene info
ref|YP_071157.1|  putative ABC type heme exporter, permease su...  59.7    1e-07 Gene info
ref|ZP_05919616.1|  heme ABC superfamily ATP binding cassette ...  59.7    1e-07
ref|ZP_03500987.1|  putative heme exporter protein c (cytochro...  59.7    1e-07
ref|ZP_04628682.1|  Heme exporter protein C [Yersinia bercovie...  59.3    1e-07
ref|YP_003166001.1|  heme exporter protein CcmC [Candidatus Ac...  59.3    1e-07 Gene info
ref|YP_003150905.1|  ABC-type transport system involved in cyt...  59.3    1e-07 Gene info
ref|YP_316939.1|  cytochrome c-type biogenesis protein CcmC [N...  59.3    1e-07 Gene info
ref|YP_746314.1|  heme exporter protein CcmC [Nitrosomonas eut...  59.3    1e-07 Gene info
ref|NP_387338.1|  putative HEME exporter C (cytochrome C-type ...  59.3    1e-07 Gene info
ref|ZP_03320828.1|  hypothetical protein PROVALCAL_03797 [Prov...  59.3    1e-07
ref|YP_001676305.1|  heme exporter protein CcmC [Shewanella ha...  59.3    1e-07 Gene info
ref|ZP_01865148.1|  ABC-type transport system heme exporter [E...  59.3    1e-07
ref|YP_944323.1|  heme exporter protein CcmC [Psychromonas ing...  59.3    1e-07 Gene info
ref|ZP_00056246.1|  COG0755: ABC-type transport system involve...  59.3    1e-07
ref|YP_747849.1|  heme exporter protein CcmC [Nitrosomonas eut...  58.9    1e-07 Gene info
ref|YP_198464.1|  ABC-type transport system involved in cytoch...  58.9    1e-07 Gene info
ref|YP_002007324.1|  ABC transporter, heme transfer protein, c...  58.9    2e-07 Gene info
ref|NP_793409.1|  heme exporter protein CcmC [Pseudomonas syri...  58.9    2e-07 Gene info
ref|ZP_04754167.1|  heme exporter protein C [Actinobacillus mi...  58.9    2e-07
ref|ZP_05629221.1|  heme exporter protein C [Actinobacillus mi...  58.9    2e-07
ref|YP_530101.1|  heme exporter protein CcmC [Rhodopseudomonas...  58.9    2e-07 Gene info
ref|YP_001784058.1|  heme exporter protein CcmC [Haemophilus s...  58.9    2e-07 Gene info
ref|YP_002934170.1|  heme exporter protein CcmC [Edwardsiella ...  58.9    2e-07 Gene info
ref|YP_718605.1|  heme ABC transporter, permease (heme exporte...  58.9    2e-07 Gene info
ref|ZP_04635580.1|  Heme exporter protein C [Yersinia intermed...  58.9    2e-07
ref|YP_001652388.1|  cytochrome c-type biogenesis protein [Act...  58.9    2e-07 Gene info
ref|YP_326677.1|  ABC-type transport system permease protein 2...  58.5    2e-07 Gene info
ref|ZP_05944959.1|  cytochrome c-type biogenesis protein CcmC ...  58.5    2e-07
ref|NP_942854.1|  ABC heme export system [Ralstonia eutropha H...  58.5    2e-07 Gene info
ref|ZP_00134437.2|  COG0755: ABC-type transport system involve...  58.5    2e-07
ref|YP_002329848.1|  heme exporter protein C; membrane compone...  58.5    2e-07 Gene info
ref|YP_003058494.1|  heme exporter protein CcmC [Hirschia balt...  58.5    2e-07 Gene info
ref|NP_754622.1|  Heme exporter protein C [Escherichia coli CF...  58.5    2e-07 Gene info
ref|ZP_01101203.1|  heme exporter protein CcmC [Congregibacter...  58.5    2e-07
ref|NP_288779.1|  heme exporter protein C [Escherichia coli O1...  58.5    2e-07 Gene info
ref|YP_961592.1|  heme exporter protein CcmC [Shewanella sp. W...  58.5    2e-07 Gene info
ref|ZP_04613442.1|  Heme exporter protein C [Yersinia rohdei A...  58.5    2e-07
ref|YP_001798101.1|  heme exporter protein CcmC [Polynucleobac...  58.5    2e-07 Gene info
ref|ZP_04625158.1|  Heme exporter protein C [Yersinia kristens...  58.5    2e-07
ref|ZP_03066474.1|  heme exporter protein C [Shigella dysenter...  58.5    2e-07
ref|ZP_03520962.1|  putative heme exporter protein c (cytochro...  58.5    2e-07
gb|ABG91722.1|  cytochrome c biogenesis protein CcmC [Shewanel...  58.5    2e-07
ref|YP_003256571.1|  CcmC [Aggregatibacter actinomycetemcomita...  58.5    2e-07 Gene info
ref|YP_003222579.1|  heme exporter protein C [Escherichia coli...  58.5    2e-07 Gene info
ref|YP_003006563.1|  CcmC [Aggregatibacter aphrophilus NJ8700]...  58.2    3e-07 Gene info
ref|ZP_04640305.1|  Heme exporter protein C [Yersinia mollaret...  58.2    3e-07
ref|NP_966136.1|  heme exporter protein CcmC [Wolbachia endosy...  58.2    3e-07 Gene info
ref|YP_001500076.1|  heme exporter protein CcmC [Shewanella pe...  58.2    3e-07 Gene info
ref|ZP_01015906.1|  ABC heme exporter, inner membrane subunit ...  58.2    3e-07
ref|ZP_01043351.1|  ABC-type transport system involved in cyto...  58.2    3e-07
gb|AAD19539.1|  CcmC [Pantoea citrea]                              58.2    3e-07
ref|ZP_01039205.1|  ABC-type transport system heme exporter [E...  58.2    3e-07
ref|YP_298960.1|  cytochrome c-type biogenesis protein CcmC [R...  58.2    3e-07 Gene info
ref|YP_455316.1|  heme exporter protein C [Sodalis glossinidiu...  58.2    3e-07 Gene info
ref|ZP_03397065.1|  heme exporter protein CcmC [Pseudomonas sy...  57.8    3e-07
ref|YP_129163.1|  putative heme exporter protein C [Photobacte...  57.8    3e-07 Gene info
dbj|BAH90559.1|  cytochrome c-type biogenesis protein CcmC [un...  57.8    3e-07
ref|NP_244944.1|  CcmC [Pasteurella multocida subsp. multocida...  57.8    3e-07 Gene info
ref|YP_662814.1|  heme exporter protein CcmC [Pseudoalteromona...  57.8    4e-07 Gene info
ref|YP_567661.1|  heme exporter protein CcmC [Rhodopseudomonas...  57.8    4e-07 Gene info
ref|YP_001686602.1|  heme exporter protein CcmC [Caulobacter s...  57.8    4e-07 Gene info
ref|ZP_01881133.1|  heme exporter protein CcmC [Roseovarius sp...  57.8    4e-07
ref|YP_003225218.1|  heme exporter protein CcmC [Zymomonas mob...  57.8    4e-07 Gene info
ref|YP_457660.1|  ABC-type transport system heme exporter [Ery...  57.8    4e-07 Gene info
ref|YP_002128979.1|  heme ABC transporter, permease protein (i...  57.8    4e-07 Gene info
ref|ZP_01034521.1|  ABC heme exporter, inner membrane subunit ...  57.8    4e-07
ref|YP_926124.1|  heme exporter protein CcmC [Shewanella amazo...  57.8    4e-07 Gene info
ref|ZP_01214981.1|  heme chaperone heme-lyase [Psychromonas sp...  57.4    4e-07
ref|NP_108446.1|  heme exporter protein C [Mesorhizobium loti ...  57.4    4e-07 Gene info
ref|YP_612996.1|  heme exporter protein CcmC [Silicibacter sp....  57.4    4e-07 Gene info
ref|YP_002127360.1|  heme exporter protein C [Alteromonas macl...  57.4    4e-07 Gene info
ref|YP_001452168.1|  hypothetical protein CKO_00577 [Citrobact...  57.4    4e-07 Gene info
ref|ZP_04562729.1|  heme exporter protein C [Citrobacter sp. 3...  57.4    4e-07
ref|XP_001778930.1|  ATP-binding cassette transporter, subfami...  57.4    4e-07 UniGene infoGene info
ref|YP_002148755.1|  ABC superfamily [Salmonella enterica subs...  57.4    5e-07 Gene info
ref|YP_002116760.1|  ABC superfamily [Salmonella enterica subs...  57.4    5e-07 Gene info
ref|YP_483988.1|  heme exporter protein CcmC [Rhodopseudomonas...  57.4    5e-07 Gene info
ref|ZP_01549692.1|  putative heme exporter c (cytochrome c-typ...  57.4    5e-07
ref|ZP_03836178.1|  hypothetical protein CIT292_02013 [Citroba...  57.4    5e-07
ref|NP_458122.1|  heme exporter protein C2 [Salmonella enteric...  57.0    5e-07 Gene info
ref|NP_456797.1|  heme exporter protein C1 [Salmonella enteric...  57.0    5e-07 Gene info
ref|YP_342987.1|  cytochrome c-type biogenesis protein CcmC [N...  57.0    5e-07 Gene info
ref|ZP_03219968.1|  heme exporter protein C2 [Salmonella enter...  57.0    5e-07
ref|ZP_03413495.1|  heme exporter protein C2 [Salmonella enter...  57.0    6e-07
ref|ZP_01789960.1|  heme exporter protein C [Haemophilus influ...  57.0    6e-07
ref|ZP_01902444.1|  ABC heme exporter, inner membrane subunit ...  57.0    6e-07
ref|ZP_01796359.1|  heme exporter protein C [Haemophilus influ...  57.0    6e-07
ref|ZP_05812550.1|  heme exporter protein CcmC [Mesorhizobium ...  57.0    6e-07
ref|ZP_01783745.1|  heme exporter protein C [Haemophilus influ...  57.0    6e-07
ref|YP_002363756.1|  heme exporter protein CcmC [Methylocella ...  57.0    6e-07 Gene info
ref|ZP_00372400.1|  heme exporter protein CcmC [Wolbachia endo...  57.0    6e-07
ref|ZP_03387117.1|  heme exporter protein C2 [Salmonella enter...  57.0    6e-07
ref|YP_001907079.1|  Heme exporter protein C [Erwinia tasmanie...  57.0    6e-07 Gene info
ref|ZP_01219065.1|  heme exporter protein C [Photobacterium pr...  57.0    6e-07
ref|ZP_03298332.1|  hypothetical protein COLSTE_02259 [Collins...  57.0    6e-07
ref|YP_001020410.1|  ABC transporter permease [Methylibium pet...  57.0    6e-07 Gene info
gb|ACY32759.1|  heme exorter protein C [Comamonas testosteroni...  57.0    7e-07
ref|YP_155493.1|  ABC-type transport system involved in cytoch...  57.0    7e-07 Gene info
ref|ZP_03837546.1|  hypothetical protein CIT292_03509 [Citroba...  57.0    7e-07
ref|YP_002727027.1|  heme exporter protein CcmC [Wolbachia sp....  56.6    7e-07 Gene info
ref|YP_001235961.1|  heme exporter protein CcmC [Acidiphilium ...  56.6    7e-07 Gene info
ref|YP_002244323.1|  heme exporter protein C2 [Salmonella ente...  56.6    7e-07 Gene info
ref|ZP_04759968.1|  heme exporter protein CcmC [Zymomonas mobi...  56.6    7e-07
ref|YP_001156294.1|  heme exporter protein CcmC [Polynucleobac...  56.6    7e-07 Gene info
ref|YP_001202584.1|  heme ABC transporter (heme exporter prote...  56.6    7e-07 Gene info
ref|ZP_04632519.1|  Heme exporter protein C [Yersinia frederik...  56.6    7e-07
ref|ZP_01616635.1|  heme exporter protein CcmC [marine gamma p...  56.6    8e-07
ref|YP_001236572.1|  heme ABC transporter (heme exporter prote...  56.6    8e-07 Gene info
ref|YP_162993.1|  ABC-type transport system heme exporter [Zym...  56.6    8e-07 Gene info
ref|ZP_02957918.1|  heme exporter protein C [Vibrio cholerae M...  56.6    8e-07
ref|YP_001790579.1|  heme exporter protein CcmC [Leptothrix ch...  56.6    8e-07 Gene info
ref|ZP_04917125.1|  heme exporter protein C [Vibrio cholerae R...  56.6    8e-07
ref|ZP_05705005.1|  heme exporter protein CcmC [Cardiobacteriu...  56.6    8e-07
ref|ZP_01449272.1|  ABC heme exporter, inner membrane subunit ...  56.6    9e-07
ref|ZP_01676703.1|  heme exporter protein C [Vibrio cholerae 2...  56.6    9e-07
ref|YP_149925.1|  heme exporter protein C1 [Salmonella enteric...  56.6    9e-07 Gene info
ref|NP_231687.1|  heme exporter protein C [Vibrio cholerae O1 ...  56.6    9e-07 Gene info
ref|NP_760836.1|  putative heme exporter protein C [Vibrio vul...  56.6    9e-07 Gene info
gb|AAR37671.1|  heme exporter protein C [uncultured marine bac...  56.2    9e-07
ref|ZP_05924285.1|  cytochrome c-type biogenesis protein CcmC ...  56.2    9e-07
ref|ZP_05876569.1|  cytochrome c-type biogenesis protein CcmC ...  56.2    9e-07
ref|XP_002118736.1|  hypothetical protein TRIADDRAFT_34635 [Tr...  56.2    9e-07 Gene info
ref|ZP_04713394.1|  heme exporter protein C [Alteromonas macle...  56.2    1e-06
ref|YP_002637059.1|  heme exporter protein [Salmonella enteric...  56.2    1e-06 Gene info
ref|YP_001335737.1|  heme ABC transporter membrane protein [Kl...  56.2    1e-06 Gene info
ref|YP_217244.1|  heme ABC exporter [Salmonella enterica subsp...  56.2    1e-06 Gene info
ref|ZP_01785964.1|  heme exporter protein C [Haemophilus influ...  56.2    1e-06
ref|YP_411907.1|  heme exporter protein CcmC [Nitrosospira mul...  56.2    1e-06 Gene info
ref|YP_003182922.1|  cytochrome c assembly protein [Eggerthell...  56.2    1e-06
ref|ZP_05116666.1|  heme exporter protein CcmC [Labrenzia alex...  56.2    1e-06
ref|ZP_05126237.1|  heme exporter protein CcmC [gamma proteoba...  56.2    1e-06
ref|ZP_00201980.1|  COG0755: ABC-type transport system involve...  56.2    1e-06
ref|YP_001293006.1|  heme exporter protein C [Haemophilus infl...  56.2    1e-06 Gene info
ref|ZP_01788191.1|  heme exporter protein C [Haemophilus influ...  56.2    1e-06
ref|ZP_05743137.1|  heme exporter protein CcmC [Silicibacter s...  56.2    1e-06
ref|YP_180538.1|  Heme exporter protein C [Ehrlichia ruminanti...  56.2    1e-06 Gene info
ref|NP_889341.1|  putative heme export protein [Bordetella bro...  56.2    1e-06 Gene info
ref|ZP_01075349.1|  Cytochrome c-type biogenesis protein CcmC ...  56.2    1e-06
ref|ZP_05118982.1|  heme exporter protein C [Vibrio parahaemol...  55.8    1e-06
ref|YP_001436977.1|  hypothetical protein ESA_00871 [Enterobac...  55.8    1e-06 Gene info
ref|YP_732367.1|  heme exporter protein CcmC [Shewanella sp. M...  55.8    1e-06 Gene info
ref|ZP_02164449.1|  putative heme exporter c (cytochrome c-typ...  55.8    1e-06
ref|YP_867879.1|  heme exporter protein CcmC [Shewanella sp. A...  55.8    1e-06 Gene info
ref|NP_884913.1|  putative heme export protein [Bordetella par...  55.8    1e-06 Gene info
ref|YP_001569704.1|  hypothetical protein SARI_00638 [Salmonel...  55.8    1e-06 Gene info
ref|YP_001219444.1|  heme exporter membrane protein CcmC [Cand...  55.8    1e-06 Gene info
ref|YP_001364460.1|  heme exporter protein CcmC [Shewanella ba...  55.8    1e-06 Gene info
ref|ZP_03788036.1|  heme exporter protein CcmC [Wolbachia endo...  55.8    1e-06
ref|ZP_01625240.1|  heme exporter protein CcmC [marine gamma p...  55.8    1e-06
ref|ZP_01064434.1|  heme exporter protein C [Vibrio sp. MED222...  55.8    1e-06
ref|ZP_04657808.1|  heme exporter protein [Salmonella enterica...  55.8    1e-06
ref|YP_002147210.1|  heme exporter protein C [Salmonella enter...  55.8    1e-06 Gene info
ref|YP_001586998.1|  hypothetical protein SPAB_00740 [Salmonel...  55.8    1e-06 Gene info
ref|NP_715901.1|  heme exporter protein CcmC [Shewanella oneid...  55.8    1e-06 Gene info
ref|ZP_03074563.1|  ABC superfamily [Salmonella enterica subsp...  55.8    1e-06
ref|ZP_00156933.1|  COG0755: ABC-type transport system involve...  55.8    1e-06
ref|NP_439248.1|  heme exporter protein C [Haemophilus influen...  55.8    2e-06 GeoGene info
ref|ZP_05843198.1|  heme exporter protein CcmC [Rhodobacter sp...  55.8    2e-06
ref|YP_001476021.1|  heme exporter protein CcmC [Shewanella se...  55.8    2e-06 Gene info
ref|ZP_04466235.1|  heme exporter protein C [Haemophilus influ...  55.8    2e-06
ref|YP_496665.1|  heme exporter protein CcmC [Novosphingobium ...  55.5    2e-06 Gene info
ref|YP_001342251.1|  heme exporter protein CcmC [Marinomonas s...  55.5    2e-06 Gene info
ref|YP_002796081.1|  CcmC [Laribacter hongkongensis HLHK9] >gb...  55.5    2e-06 Gene info
ref|YP_748878.1|  heme exporter protein CcmC [Shewanella frigi...  55.5    2e-06 Gene info
ref|ZP_05069236.1|  heme exporter protein [Candidatus Pelagiba...  55.5    2e-06
ref|ZP_01897092.1|  heme chaperone heme-lyase [Moritella sp. P...  55.5    2e-06
ref|ZP_01813147.1|  heme exporter protein C [Vibrionales bacte...  55.5    2e-06
ref|ZP_00991035.1|  heme exporter protein C [Vibrio splendidus...  55.5    2e-06
ref|YP_002046307.1|  ABC superfamily [Salmonella enterica subs...  55.5    2e-06 Gene info
ref|YP_002216323.1|  ABC family protein [Salmonella enterica s...  55.5    2e-06 Gene info
ref|ZP_03224329.1|  ABC family protein [Salmonella enterica su...  55.5    2e-06
ref|YP_002648216.1|  Heme exporter protein C [Erwinia pyrifoli...  55.5    2e-06 Gene info
ref|YP_002311384.1|  Cytochrome c-type biogenesis protein CcmC...  55.5    2e-06 Gene info
ref|YP_001975265.1|  heme exporter protein CcmC [Wolbachia end...  55.1    2e-06 Gene info
ref|YP_001141217.1|  heme chaperone heme-lyase [Aeromonas salm...  55.1    2e-06 Gene info
ref|YP_002551047.1|  ABC transporter membrane spanning protein...  55.1    2e-06 Gene info
ref|ZP_04700147.1|  heme exporter protein C [Rickettsia endosy...  55.1    2e-06
ref|NP_461195.1|  heme exporter protein [Salmonella typhimuriu...  55.1    2e-06 Gene info
ref|YP_001763006.1|  heme exporter protein CcmC [Shewanella wo...  55.1    2e-06 Gene info
ref|YP_867391.1|  heme exporter protein CcmC [Magnetococcus sp...  55.1    2e-06 Gene info
ref|ZP_04620197.1|  Heme exporter protein C [Yersinia aldovae ...  55.1    2e-06
ref|ZP_03162631.1|  ABC family protein [Salmonella enterica su...  55.1    2e-06
ref|YP_903874.1|  heme exporter protein CcmC [Candidatus Ruthi...  55.1    2e-06 Gene info
ref|YP_855934.1|  heme exporter protein C [Aeromonas hydrophil...  55.1    2e-06 Gene info
ref|YP_002238090.1|  heme exporter protein C [Klebsiella pneum...  55.1    2e-06 Gene info
ref|ZP_04957538.1|  heme exporter protein CcmC [gamma proteoba...  55.1    2e-06
ref|YP_539007.1|  cytochrome c biogenesis C [Physcomitrella pa...  55.1    2e-06 Gene info
ref|ZP_05337982.1|  heme exporter protein CcmC [Sideroxydans l...  55.1    2e-06
ref|YP_001048629.1|  heme exporter protein CcmC [Shewanella ba...  55.1    3e-06 Gene info
ref|YP_825485.1|  cytochrome c assembly protein [Solibacter us...  54.7    3e-06 Gene info
ref|ZP_02004174.1|  Cytochrome c assembly protein [Beggiatoa s...  54.7    3e-06
ref|ZP_06033907.1|  cytochrome c-type biogenesis protein CcmC ...  54.7    3e-06
ref|YP_113432.1|  heme exporter protein CcmC [Methylococcus ca...  54.7    3e-06 Gene info
ref|ZP_05716212.1|  heme exporter protein C [Vibrio mimicus VM...  54.7    3e-06
gb|EEY98578.1|  cytochrome c-type biogenesis protein CcmC [Vib...  54.7    3e-06
ref|ZP_05730639.1|  heme exporter protein CcmC [Pantoea sp. At...  54.7    3e-06
ref|ZP_01866408.1|  heme exporter protein C [Vibrio shilonii A...  54.7    3e-06
ref|ZP_03729618.1|  cytochrome c assembly protein [Dethiobacte...  54.7    3e-06
ref|ZP_02144179.1|  heme exporter protein CcmC [Phaeobacter ga...  54.7    3e-06
ref|YP_002227171.1|  heme exporter protein C2 [Salmonella ente...  54.3    3e-06 Gene info
ref|NP_798600.1|  heme exporter protein C [Vibrio parahaemolyt...  54.3    3e-06 Gene info
ref|ZP_02901825.1|  heme exporter protein C [Escherichia alber...  54.3    4e-06
ref|YP_001613489.1|  heme exporter protein C [Sorangium cellul...  54.3    4e-06 Gene info
ref|ZP_04921881.1|  heme exporter protein CcmC [Vibrio sp. Ex2...  54.3    4e-06
ref|ZP_01258838.1|  heme exporter protein C [Vibrio alginolyti...  54.3    4e-06
ref|ZP_02195771.1|  heme exporter protein C [Vibrio sp. AND4] ...  54.3    4e-06
ref|ZP_02062104.1|  heme exporter protein CcmC [Rickettsiella ...  54.3    4e-06
ref|ZP_05078120.1|  heme exporter protein CcmC [Rhodobacterale...  54.3    4e-06
ref|ZP_05840303.1|  cytochrome c assembly protein [Ferroglobus...  54.3    4e-06
ref|NP_054466.1|  ABC transporter subunit [Marchantia polymorp...  54.3    4e-06 Gene info
ref|ZP_01304824.1|  heme exporter protein CcmC [Sphingomonas s...  54.3    4e-06
ref|YP_001419009.1|  heme exporter protein CcmC [Xanthobacter ...  53.9    5e-06 Gene info
ref|ZP_01987079.1|  heme exporter protein C [Vibrio harveyi HY...  53.9    5e-06
ref|ZP_05885317.1|  cytochrome c-type biogenesis protein CcmC ...  53.9    5e-06
ref|YP_001900404.1|  heme exporter protein CcmC [Ralstonia pic...  53.9    5e-06 Gene info
ref|ZP_02139394.1|  heme exporter protein [Roseobacter litoral...  53.9    5e-06
ref|ZP_00961469.1|  ABC heme exporter, inner membrane subunit ...  53.9    6e-06
ref|ZP_01792125.1|  heme exporter protein C [Haemophilus influ...  53.5    6e-06
ref|ZP_01264551.1|  heme exporter protein [Candidatus Pelagiba...  53.5    6e-06
ref|YP_001533196.1|  heme exporter protein CcmC [Dinoroseobact...  53.5    7e-06 Gene info
ref|YP_682792.1|  heme exporter protein [Roseobacter denitrifi...  53.5    7e-06 Gene info
ref|ZP_06054174.1|  cytochrome c-type biogenesis protein CcmC ...  53.5    7e-06
ref|YP_265711.1|  heme exporter protein [Candidatus Pelagibact...  53.5    7e-06 Gene info
ref|ZP_01001085.1|  ABC heme exporter, inner membrane subunit ...  53.5    7e-06
ref|ZP_01132718.1|  heme exporter protein C (Cytochrome c-type...  53.5    8e-06
gb|ABV58324.1|  heme exporter protein CcmC [Wolbachia endosymb...  53.1    8e-06
sp|P29961.1|CCMC_RHOCA  RecName: Full=Heme exporter protein C;...  53.1    9e-06
ref|ZP_01741285.1|  heme exporter protein CcmC [Rhodobacterale...  53.1    9e-06
ref|ZP_06055653.1|  heme exporter protein [alpha proteobacteri...  52.8    1e-05
ref|ZP_01307222.1|  ABC-type transport system involved in cyto...  52.8    1e-05
ref|YP_002287577.1|  heme exporter protein CcmC [Oligotropha c...  52.8    1e-05 Gene info
ref|ZP_00544979.1|  Cytochrome c-type biogenesis protein CcmC ...  52.8    1e-05
ref|ZP_05404459.1|  cytochrome c-type biogenesis protein, heme...  52.8    1e-05
ref|ZP_04615177.1|  Heme exporter protein C [Yersinia ruckeri ...  52.8    1e-05
ref|ZP_01167364.1|  heme exporter protein CcmC [Oceanospirillu...  52.8    1e-05
ref|YP_001092319.1|  heme exporter protein CcmC [Shewanella lo...  52.8    1e-05 Gene info
ref|YP_002299195.1|  cytochrome c-type biogenesis protein CcmC...  52.8    1e-05 Gene info
ref|ZP_05620938.1|  heme exporter protein CcmC [Enhydrobacter ...  52.8    1e-05
ref|ZP_01057038.1|  heme exporter protein CcmC [Roseobacter sp...  52.4    1e-05
ref|YP_564569.1|  heme exporter protein CcmC [Shewanella denit...  52.4    2e-05 Gene info
ref|ZP_06017317.1|  heme ABC superfamily ATP binding cassette ...  52.0    2e-05
ref|YP_003146168.1|  heme exporter protein CcmC [Kangiella kor...  52.0    2e-05 Gene info
ref|ZP_01224447.1|  heme exporter protein CcmC [marine gamma p...  52.0    2e-05
ref|ZP_05085627.1|  heme exporter protein CcmC [Pseudovibrio s...  52.0    2e-05
gb|AAC63583.1|  CCMC [Pseudomonas putida GB-1]                     52.0    2e-05
ref|YP_287190.1|  cytochrome c-type biogenesis protein CcmC [D...  52.0    2e-05 Gene info
ref|YP_303312.1|  cytochrome c-type biogenesis protein CcmC [E...  52.0    2e-05 Gene info
ref|ZP_01017201.1|  heme exporter protein C (ABC transporter p...  52.0    2e-05
ref|ZP_05787281.1|  heme exporter protein CcmC [Silicibacter l...  52.0    2e-05
ref|YP_001281056.1|  heme exporter protein CcmC [Psychrobacter...  51.6    2e-05 Gene info
ref|ZP_05780476.1|  heme exporter protein CcmC [Citreicella sp...  51.6    2e-05
ref|YP_002524467.1|  Heme exporter protein CcmC [Rhodobacter s...  51.6    3e-05 Gene info
ref|YP_001042337.1|  heme exporter protein CcmC [Rhodobacter s...  51.2    3e-05 Gene info
ref|YP_351851.1|  ABC heme exporter, inner membrane subunit Cc...  51.2    3e-05 Gene info
ref|YP_192049.1|  Heme exporter protein C [Gluconobacter oxyda...  51.2    3e-05 Gene info
ref|YP_003211336.1|  Heme exporter protein C [Cronobacter turi...  51.2    3e-05 Gene info
ref|YP_002982387.1|  heme exporter protein CcmC [Ralstonia pic...  51.2    3e-05 Gene info
ref|YP_001166672.1|  heme exporter protein CcmC [Rhodobacter s...  51.2    4e-05 Gene info
ref|ZP_01755220.1|  ABC heme exporter, inner membrane subunit ...  50.8    5e-05
ref|ZP_01128516.1|  Cytochrome c-type biogenesis protein CcmC ...  50.4    5e-05
ref|YP_717174.1|  cytochrome c biogenesis ccmC [Brassica napus...  50.4    5e-05 Gene info
ref|ZP_01735958.1|  heme exporter protein CcmC [Marinobacter s...  50.4    6e-05
ref|ZP_05090448.1|  heme exporter protein CcmC [Ruegeria sp. R...  50.1    7e-05
ref|ZP_05099650.1|  heme exporter protein [Roseobacter sp. GAI...  50.1    7e-05
ref|YP_510591.1|  heme exporter protein CcmC [Jannaschia sp. C...  50.1    7e-05 Gene info
ref|YP_265109.1|  heme exporter, subunit CcmC [Psychrobacter a...  50.1    7e-05 Gene info
ref|YP_581372.1|  heme exporter protein CcmC [Psychrobacter cr...  50.1    8e-05 Gene info
ref|ZP_01446194.1|  ABC heme exporter, inner membrane subunit ...  50.1    8e-05
ref|NP_637577.1|  ABC transporter heme permease [Xanthomonas c...  50.1    8e-05 Gene info
ref|YP_003002274.1|  cytochrome c biogenesis protein [Aureoumb...  49.7    9e-05 Gene info
ref|ZP_05075419.1|  heme exporter protein [Rhodobacterales bac...  49.7    9e-05
ref|ZP_01751740.1|  ABC heme exporter, inner membrane subunit ...  49.7    9e-05
sp|P92527.4|CCMC_ARATH  RecName: Full=Putative cytochrome c bi...  49.7    1e-04
ref|ZP_05050236.1|  heme exporter protein CcmC [Octadecabacter...  49.7    1e-04
ref|YP_002000559.1|  cytochrome c biogenesis C [Oryza sativa J...  49.7    1e-04 Gene info
ref|YP_001434638.1|  cytochrome c assembly protein [Ignicoccus...  49.3    1e-04 Gene info
ref|ZP_01004691.1|  ABC heme exporter, inner membrane subunit ...  49.3    1e-04
gb|ABD36062.1|  cytochrome c biogenesis C [Beta vulgaris subsp...  49.3    1e-04
ref|ZP_01912543.1|  cytochrome c assembly protein [Plesiocysti...  48.9    1e-04
ref|YP_001903364.1|  ABC transporter heme permease CcmC (c-typ...  48.5    2e-04 Gene info
ref|ZP_00955493.1|  ABC heme exporter, inner membrane subunit ...  48.5    2e-04
ref|ZP_00962927.1|  ABC heme exporter, inner membrane subunit ...  48.5    2e-04
ref|ZP_04830534.1|  heme exporter protein CcmC [Gallionella fe...  48.5    2e-04
ref|YP_001996161.1|  cytochrome c assembly protein [Chloroherp...  48.1    3e-04 Gene info
ref|YP_003276019.1|  cytochrome c biogenesis C [Pleurozia purp...  47.8    3e-04 Gene info
ref|YP_626380.2|  cytochrome c biogenesis protein [Beta vulgar...  47.8    4e-04 Gene info
emb|CAA96495.1|  hypothetical protein [Paracoccus denitrifican...  47.8    4e-04
ref|ZP_05065119.1|  heme exporter protein [Octadecabacter anta...  47.8    4e-04
gb|AAS13480.1|  heme exporter protein C [Gluconacetobacter dia...  47.8    4e-04
ref|YP_915208.1|  heme exporter protein CcmC [Paracoccus denit...  47.8    4e-04 Gene info
ref|YP_002277281.1|  heme exporter protein CcmC [Gluconacetoba...  47.8    4e-04 Gene info
dbj|BAH22354.1|  cytochrome c maturation [Raphanus sativus]        47.4    4e-04
ref|YP_980828.1|  heme exporter protein CcmC [Polaromonas naph...  47.4    4e-04 Gene info
ref|ZP_05134208.1|  ABC transporter heme permease [Stenotropho...  47.4    5e-04
ref|YP_616565.1|  heme exporter protein CcmC [Sphingopyxis ala...  47.4    5e-04 Gene info
ref|ZP_05277793.1|  Cytochrome c-type biogenesis protein (ccmC...  47.4    5e-04
ref|YP_504792.1|  heme exporter protein CcmC [Anaplasma phagoc...  47.4    5e-04 Gene info
ref|YP_001275121.1|  cytochrome c assembly protein [Roseiflexu...  47.0    6e-04 Gene info
ref|YP_002029084.1|  heme exporter protein CcmC [Stenotrophomo...  47.0    6e-04 Gene info
ref|YP_729110.1|  ABC transporter permease [Ralstonia eutropha...  47.0    6e-04 Gene info
ref|YP_153565.1|  heme exporter protein C [Anaplasma marginale...  47.0    6e-04 Gene info
ref|YP_001973000.1|  putative heme exporter protein ccmC [Sten...  47.0    6e-04 Gene info
ref|NP_565344.1|  cytochrome c biogenesis protein, putative [A...  47.0    6e-04 UniGene infoGene info
ref|YP_002762109.1|  heme exporter protein CcmC [Gemmatimonas ...  47.0    7e-04 Gene info
ref|ZP_05276905.1|  Cytochrome c-type biogenesis protein (ccmC...  47.0    7e-04
ref|ZP_03968629.1|  heme exporter protein C [Sphingobacterium ...  47.0    7e-04
emb|CAA54967.1|  unnamed protein product [Oenothera berteroana]    47.0    7e-04
ref|ZP_05124275.1|  heme exporter protein CcmC [Rhodobacterace...  46.6    7e-04
ref|NP_943697.1|  subunit of ABC transporter for cytochrome c1...  46.6    8e-04 Gene info
ref|ZP_01748393.1|  heme exporter protein CcmC [Sagittula stel...  46.6    8e-04
ref|YP_003267756.1|  cytochrome c assembly protein [Haliangium...  46.6    8e-04 Gene info
gb|AAW30264.1|  cytochrome c biogenesis ccmC [Agave attenuata]     46.6    8e-04
ref|YP_173360.1|  cytochrome c maturation protein CcmC [Nicoti...  46.6    8e-04 Gene info
ref|NP_085546.2|  cytochrome c biogenesis orf256 [Arabidopsis ...  46.6    9e-04 UniGene infoGene info
ref|YP_136008.1|  heme exporter protein C [Haloarcula marismor...  46.6    9e-04 Gene info
ref|YP_001434471.1|  cytochrome c assembly protein [Roseiflexu...  46.6    0.001 Gene info
ref|ZP_05040775.1|  heme exporter protein CcmC [Alcanivorax sp...  46.2    0.001
ref|NP_146940.1|  heme exporter protein C [Aeropyrum pernix K1...  46.2    0.001 Gene info
gb|ABS50608.1|  cytochrome c biogenesis orf256 [Arabidopsis th...  46.2    0.001
ref|ZP_02154214.1|  heme exporter protein [Oceanibulbus indoli...  46.2    0.001
ref|YP_762188.1|  heme exporter protein CcmC [Hyphomonas neptu...  46.2    0.001 Gene info
ref|ZP_01155654.1|  ABC heme exporter, inner membrane subunit ...  46.2    0.001
ref|YP_758077.1|  heme exporter protein CcmC [Maricaulis maris...  46.2    0.001 Gene info
ref|YP_527340.1|  heme exporter protein CcmC [Saccharophagus d...  46.2    0.001 Gene info
ref|ZP_05342057.1|  heme exporter protein CcmC [Thalassiobium ...  45.8    0.001
ref|YP_001603669.1|  putative heme exporter protein C [Glucona...  45.8    0.001 Gene info
ref|YP_692592.1|  Heme exporter protein C [Alcanivorax borkume...  45.8    0.001 Gene info
ref|XP_001422474.1|  plastid-localized, cytochrome c assembly ...  45.8    0.001 Gene info
ref|YP_435498.1|  ABC-type transport system involved in cytoch...  45.8    0.002 Gene info
ref|ZP_05899466.1|  heme exporter protein C [Selenomonas sputi...  45.8    0.002
ref|ZP_02072079.1|  hypothetical protein BACUNI_03523 [Bactero...  45.4    0.002
ref|YP_002608188.1|  cytochrome c biogenesis C [Carica papaya]...  45.4    0.002 Gene info
ref|NP_044790.1|  ABC transporter subunit C [Reclinomonas amer...  45.4    0.002 Gene info
ref|YP_003187426.1|  heme exporter protein C [Acetobacter past...  45.4    0.002 Gene info
ref|YP_159007.1|  heme exporter, permease [Aromatoleum aromati...  45.4    0.002 Gene info
ref|ZP_03736249.1|  cytochrome c-type biogenesis protein CcmC ...  45.1    0.002
ref|ZP_04606878.1|  cytochrome c assembly protein [Micromonosp...  45.1    0.002
ref|YP_001545485.1|  cytochrome c assembly protein [Herpetosip...  45.1    0.003 Gene info
ref|ZP_01115589.1|  ABC-type transport system involved in cyto...  44.7    0.003
ref|YP_002890962.1|  heme exporter protein CcmC [Thauera sp. M...  44.7    0.003 Gene info
ref|ZP_00680899.1|  Cytochrome c-type biogenesis protein CcmC ...  44.7    0.003
ref|ZP_04487113.1|  ABC-type transport system involved in cyto...  44.7    0.003
ref|XP_002333596.1|  predicted protein [Populus trichocarpa] >...  44.7    0.003 UniGene infoGene info
emb|CAB43024.1|  cytochrome c biogenesis protein [Pisum sativum]   44.3    0.004
dbj|BAD66748.1|  orf496 [Beta vulgaris subsp. vulgaris]            44.3    0.004
ref|YP_935435.1|  heme exporter protein C [Azoarcus sp. BH72] ...  43.9    0.005 Gene info
ref|ZP_04029104.1|  cytochrome c-type biogenesis protein CcsB ...  43.9    0.006
ref|YP_167538.1|  heme exporter protein CcmC [Ruegeria pomeroy...  43.5    0.006 Gene info
ref|ZP_02537363.1|  Putative heme exporter protein C [Endorift...  43.1    0.009
ref|NP_299736.1|  heme ABC transporter membrane protein [Xylel...  43.1    0.009 Gene info
ref|ZP_00652510.1|  Cytochrome c-type biogenesis protein CcmC ...  43.1    0.009
ref|YP_588332.1|  cytochrome c biogenesis C [Zea mays subsp. m...  43.1    0.010 Gene info
ref|ZP_03388570.1|  cytochrome c-type biogenesis protein CcsB ...  43.1    0.010
ref|NP_779672.1|  heme ABC transporter membrane protein [Xylel...  43.1    0.010 Gene info
ref|NP_070804.1|  heme exporter protein C (helC) [Archaeoglobu...  42.7    0.010 Gene info
ref|YP_959226.1|  heme exporter protein CcmC [Marinobacter aqu...  42.7    0.010 Gene info
ref|YP_003193931.1|  Cytochrome c assembly protein [Robiginita...  42.7    0.011
ref|YP_055041.1|  putative cytochrome c biogenesis protein [Pr...  42.7    0.011 Gene info
ref|NP_059382.1|  c1 cytochrome ABC transporter subunit [Cyani...  42.7    0.013 Gene info
ref|YP_001539278.1|  cytochrome c assembly protein [Salinispor...  42.4    0.015 Gene info
ref|NP_642010.1|  cytochrome C-type biogenesis protein [Xantho...  42.4    0.016 Gene info
ref|YP_001412683.1|  heme exporter protein CcmC [Parvibaculum ...  42.4    0.016 Gene info
ref|ZP_01894370.1|  Cytochrome c-type biogenesis protein CcmC ...  42.4    0.017
ref|ZP_02243723.1|  heme exporter protein C; cytochrome C-type...  42.0    0.018
ref|YP_001277875.1|  cytochrome c assembly protein [Roseiflexu...  42.0    0.018 Gene info
gb|ABA99229.1|  Cytochrome c biosynthesis ccmC-like mitochondr...  42.0    0.019
gb|AAW30272.1|  cytochrome c biogenesis ccmC [Eschscholzia cal...  42.0    0.019
ref|YP_001251703.1|  heme exporter protein CcmC [Legionella pn...  42.0    0.020 Gene info
ref|ZP_03015939.1|  hypothetical protein BACINT_03538 [Bactero...  42.0    0.020
gb|AAM00394.1|AF386079_4  CcmC [Legionella pneumophila]            42.0    0.021
ref|NP_560868.1|  transport protein, putative [Pyrobaculum aer...  42.0    0.021 Gene info
gb|AAW30268.1|  cytochrome c biogenesis ccmC [Philodendron oxy...  42.0    0.021
gb|AAW30267.1|  cytochrome c biogenesis ccmC [Mahonia bealei]      42.0    0.022
ref|YP_126248.1|  heme exporter protein CcmC [Legionella pneum...  42.0    0.022 Gene info
ref|YP_398410.1|  orf240 [Triticum aestivum] >ref|YP_514640.1|...  42.0    0.022 Gene info
ref|ZP_03678509.1|  hypothetical protein BACCELL_02859 [Bacter...  42.0    0.022
ref|YP_123248.1|  heme exporter protein CcmC [Legionella pneum...  42.0    0.023 Gene info
ref|YP_798701.1|  ABC transporter permease [Leptospira borgpet...  41.6    0.024 Gene info
ref|YP_003155804.1|  cytochrome c-type biogenesis protein CcsB...  41.6    0.024 Gene info
ref|YP_800129.1|  ABC transporter permease [Leptospira borgpet...  41.6    0.024 Gene info
ref|YP_679828.1|  ABC transporter permease [Cytophaga hutchins...  41.6    0.025 Gene info
gb|AAW30273.1|  cytochrome c biogenesis ccmC [Lonicera sp. Ber...  41.6    0.025
ref|YP_094893.1|  heme exporter protein CcmC [Legionella pneum...  41.6    0.025 Gene info
ref|ZP_05761732.1|  cytochrome c biogenesis protein ccsA [Bact...  41.6    0.027
ref|ZP_04544099.1|  cytochrome c biogenesis protein ccsA [Bact...  41.6    0.028
ref|ZP_05110514.1|  heme exporter protein CcmC [Legionella dra...  41.6    0.029
ref|YP_002608367.1|  cytochrome c biogenesis C [Vitis vinifera...  41.6    0.029 Gene info
ref|ZP_04549837.1|  cytochrome c biogenesis protein ccsA [Bact...  41.6    0.030
ref|ZP_02066805.1|  hypothetical protein BACOVA_03806 [Bactero...  41.2    0.031
ref|ZP_03860224.1|  cytochrome c-type biogenesis protein CcsB ...  41.2    0.035
ref|NP_713695.1|  Heme exporter protein A [Leptospira interrog...  41.2    0.035 Gene info
ref|YP_201645.1|  heme exporter protein C; cytochrome C-type b...  41.2    0.036 Gene info
ref|ZP_03458124.1|  hypothetical protein BACEGG_00897 [Bactero...  40.8    0.042
ref|YP_000661.1|  heme exporter protein C [Leptospira interrog...  40.8    0.046 Gene info
ref|NP_682405.1|  c-type cytochrome synthesis protein [Thermos...  40.8    0.047 Gene info
ref|YP_885376.1|  cytochrome c-type biogenesis protein CcsB [M...  40.8    0.048 Gene info
ref|NP_637032.1|  heme exporter protein C/cytochrome C-type bi...  40.4    0.053 Gene info
ref|NP_302558.1|  cytochrome C biogenesis protein [Mycobacteri...  40.4    0.054 Gene info
ref|ZP_05071860.1|  cytochrome c biogenesis protein [Campyloba...  40.4    0.057
gb|ABH04862.1|  cytochrome c biogenesis protein resC [Heliobac...  40.4    0.057
ref|YP_363446.1|  ABC transporter heme permease CcmC (c-type c...  40.4    0.057 Gene info
ref|YP_002048925.1|  possible heme transporter [Paulinella chr...  40.4    0.059 Gene info
ref|YP_872014.1|  cytochrome c assembly protein [Acidothermus ...  40.4    0.059 Gene info
ref|ZP_04749936.1|  putative cytochrome c-type biogenesis prot...  40.4    0.059
ref|YP_001131333.1|  cytochrome c assembly protein [Mycobacter...  40.4    0.061 Gene info
emb|CAO46824.1|  unnamed protein product [Vitis vinifera]          40.0    0.067
ref|ZP_03690661.1|  cytochrome c-type biogenesis protein CcsB ...  40.0    0.068
ref|ZP_01718831.1|  heme exporter protein C, putative [Algorip...  40.0    0.068
gb|AAW30270.1|  cytochrome c biogenesis ccmC [Platanus occiden...  40.0    0.069
ref|ZP_00950613.1|  putative membrane protein [Croceibacter at...  40.0    0.073
ref|NP_924968.1|  c-type cytochrome biogenesis protein [Gloeob...  40.0    0.075 Gene info
ref|YP_001950752.1|  cytochrome c-type biogenesis protein CcsB...  40.0    0.075 Gene info
ref|ZP_02548989.1|  cytochrome C-type biogenesis protein ccsA ...  40.0    0.077
ref|YP_001110237.1|  cytochrome c assembly protein [Burkholder...  40.0    0.079 Gene info
ref|YP_684623.1|  cytochrome c assembly protein [uncultured me...  40.0    0.080 Gene info
ref|YP_001849187.1|  cytochrome C-type biogenesis protein, Ccs...  40.0    0.084 Gene info
ref|YP_904765.1|  cytochrome C-type biogenesis protein, CcsB [...  40.0    0.086 Gene info
gb|ABU41505.1|  CcsA [Heliophilum fasciatum]                       39.7    0.092
ref|YP_001917293.1|  cytochrome c assembly protein [Natranaero...  39.7    0.093 Gene info
ref|NP_811387.1|  cytochrome c biogenesis protein ccsA [Bacter...  39.7    0.093 Gene info
gb|AAW30269.1|  cytochrome c biogenesis ccmC [Piper betle]         39.7    0.095
emb|CAA10624.1|  Ycf5 protein [Skeletonema costatum]               39.7    0.10 
ref|ZP_04657895.1|  heme exporter protein C [Selenomonas flueg...  39.7    0.10 
ref|YP_637872.1|  cytochrome c assembly protein [Mycobacterium...  39.7    0.11  Gene info
ref|YP_393429.1|  cytochrome c assembly protein [Sulfurimonas ...  39.7    0.11  Gene info
ref|ZP_04471026.1|  cytochrome c-type biogenesis protein CcsB ...  39.7    0.11 
ref|ZP_05062361.1|  cytochrome c assembly protein [gamma prote...  39.7    0.11 
gb|AAW30265.1|  cytochrome c biogenesis ccmC [Calycanthus flor...  39.7    0.11 
ref|XP_002505617.1|  predicted protein [Micromonas sp. RCC299]...  39.7    0.11  Gene info
ref|YP_003141866.1|  cytochrome c assembly protein [Capnocytop...  39.7    0.11  Gene info
ref|ZP_05223926.1|  CcsB [Mycobacterium intracellulare ATCC 13...  39.7    0.11 
ref|YP_002771897.1|  probable cytochrome c biogenesis protein ...  39.7    0.11  Gene info
ref|ZP_03431388.1|  cytochrome C-type biogenesis protein ccsA ...  39.3    0.12 
ref|NP_334960.1|  cytochrome c assembly family protein [Mycoba...  39.3    0.12  Gene info
ref|NP_642642.1|  ABC transporter heme permease [Xanthomonas a...  39.3    0.12  Gene info
ref|ZP_05139929.1|  cytochrome C biogenesis protein ccsA [Myco...  39.3    0.12 
ref|ZP_03527420.1|  putative heme exporter protein c (cytochro...  39.3    0.12 
ref|YP_364255.1|  ABC transporter heme permease CcmC (c-type c...  39.3    0.12  Gene info
ref|YP_001101362.1|  putative transmembrane cytochrome C-type ...  39.3    0.13  Gene info
ref|YP_002982858.1|  cytochrome c-type biogenesis protein CcsB...  39.3    0.13  Gene info
ref|YP_001160903.1|  cytochrome c assembly protein [Salinispor...  39.3    0.13  Gene info
ref|NP_962959.1|  CcsB [Mycobacterium avium subsp. paratubercu...  39.3    0.13  Gene info
ref|YP_451051.1|  ABC transporter heme permease [Xanthomonas o...  39.3    0.13  Gene info
ref|YP_001900817.1|  cytochrome c-type biogenesis protein CcsB...  39.3    0.13  Gene info
ref|YP_883745.1|  cytochrome c-type biogenesis protein CcsB [M...  39.3    0.13  Gene info
ref|ZP_02243614.1|  ABC transporter heme permease [Xanthomonas...  39.3    0.13 
ref|YP_001936391.1|  cytochrome c biogenesis protein [Heterosi...  39.3    0.14  Gene info
ref|YP_002575387.1|  cytochrome c biogenesis protein [Campylob...  39.3    0.14  Gene info
ref|ZP_03392134.1|  cytochrome c assembly protein family membr...  38.9    0.16 
ref|ZP_01915762.1|  Putative heme export protein [Limnobacter ...  38.9    0.16 
ref|ZP_03655836.1|  cytochrome c biogenesis protein (ycf5) [He...  38.9    0.17 
ref|YP_377239.1|  heme transporter [Synechococcus sp. CC9902] ...  38.9    0.17  Gene info
ref|ZP_05987451.1|  putative cytochrome synthesis protein [Nei...  38.9    0.17 
ref|ZP_05710129.1|  cytochrome c-type biogenesis protein CcsB ...  38.9    0.17 
gb|AAW30274.1|  cytochrome c biogenesis ccmC [Nymphaea sp. Ber...  38.9    0.18 
ref|ZP_05918284.1|  CcmF/CycK/CcsA family cytochrome c biogene...  38.9    0.18 
ref|ZP_00994090.1|  putative cytochrome C assembly protein [Ja...  38.9    0.19 
ref|ZP_01467947.1|  possible heme transporter [Synechococcus s...  38.9    0.19 
ref|NP_628641.1|  cytochrome biogenesis related protein [Strep...  38.9    0.19  Gene info
ref|ZP_03681385.1|  hypothetical protein BACCELL_05760 [Bacter...  38.5    0.20 
ref|YP_001355064.1|  cytochrome c assembly family protein [Jan...  38.5    0.20  Gene info
ref|YP_277395.1|  cytochrome c biogenesis protein [Emiliania h...  38.5    0.20  Gene info
ref|ZP_04583393.1|  cytochrome c biogenesis protein [Helicobac...  38.5    0.21 
ref|ZP_05982833.1|  putative cytochrome synthesis protein [Nei...  38.5    0.21 
ref|ZP_03702311.1|  cytochrome c assembly protein [Flavobacter...  38.5    0.21 
ref|YP_874577.1|  cytochrome c biogenesis protein [Thalassiosi...  38.5    0.21  Gene info
ref|YP_001960435.1|  cytochrome c assembly protein [Chlorobium...  38.5    0.21  Gene info
ref|YP_001634562.1|  cytochrome c assembly protein [Chloroflex...  38.5    0.22  Gene info
ref|ZP_04757499.1|  putative membrane protein [Neisseria flave...  38.5    0.23 
ref|ZP_04420180.1|  ABC-type transport system involved in cyto...  38.5    0.23 
ref|YP_001248941.1|  heme exporter protein C [Orientia tsutsug...  38.5    0.24  Gene info
ref|YP_002463183.1|  cytochrome c assembly protein [Chloroflex...  38.5    0.24  Gene info
ref|YP_001680531.1|  cytochrome c assembly protein, ccsa [Heli...  38.5    0.24  Gene info
ref|YP_061319.1|  cytochrome C assembly protein [Leifsonia xyl...  38.5    0.24  Gene info
ref|ZP_04835572.1|  cytochrome c assembly membrane protein [Co...  38.5    0.25 
ref|ZP_00945210.1|  Heme export protein ResC / Apocytochrome h...  38.1    0.25 
ref|YP_001704701.1|  cytochrome c-type biogenesis protein CcsA...  38.1    0.26  Gene info
ref|NP_521106.1|  putative transmembrane cytochrome C-type bio...  38.1    0.26  Gene info
ref|YP_003093478.1|  cytochrome c assembly protein [Pedobacter...  38.1    0.26  Gene info
gb|AAW30266.1|  cytochrome c biogenesis ccmC [Liriodendron tul...  38.1    0.27 
ref|ZP_01960043.1|  hypothetical protein BACCAC_01653 [Bactero...  38.1    0.27 
ref|YP_948982.1|  putative cytochrome C assembly protein [Arth...  38.1    0.27  Gene info
ref|ZP_01882051.1|  possible ABC transport permease, cytochrom...  38.1    0.27 
gb|EEH52109.1|  predicted protein [Micromonas pusilla CCMP1545]    38.1    0.28 
ref|ZP_04809096.1|  cytochrome c biogenesis protein [Helicobac...  38.1    0.28 
ref|YP_002133226.1|  cytochrome c-type biogenesis protein CcsB...  38.1    0.28  Gene info
ref|YP_464025.1|  cytochrome c assembly protein [Anaeromyxobac...  38.1    0.28  Gene info
ref|ZP_01061768.1|  Cytochrome c assembly protein [Leeuwenhoek...  38.1    0.29 
ref|YP_001014626.1|  putative heme transporter [Prochlorococcu...  38.1    0.30  Gene info
ref|YP_001019631.1|  putative cytochrome c asssembly protein [...  38.1    0.30  Gene info
ref|NP_848976.1|  cytochrome c biogenesis protein [Cyanidiosch...  38.1    0.32  Gene info
ref|NP_053979.1|  cytochrome c biogenesis protein [Porphyra pu...  38.1    0.32  Gene info
ref|ZP_06004620.1|  cytochrome c assembly protein [Selenomonas...  38.1    0.32 
ref|ZP_03850476.1|  cytochrome c biogenesis protein [Chryseoba...  38.1    0.33 
ref|YP_861846.1|  cytochrome c assembly protein family membran...  37.7    0.34  Gene info
ref|NP_043583.1|  cytochrome c biogenesis protein [Odontella s...  37.7    0.35  Gene info
ref|ZP_03012391.1|  hypothetical protein BACCOP_04330 [Bactero...  37.7    0.35 
ref|YP_874484.1|  cytochrome c biogenesis protein [Phaeodactyl...  37.7    0.36  Gene info
ref|YP_074565.1|  cytochrome C biogenesis protein [Symbiobacte...  37.7    0.36  Gene info
ref|YP_001379932.1|  cytochrome c assembly protein [Anaeromyxo...  37.7    0.37  Gene info
ref|ZP_03917490.1|  cytochrome C assembly protein [Corynebacte...  37.7    0.37 
ref|ZP_01914863.1|  putative cytochrome c asssembly protein [L...  37.7    0.38 
ref|YP_001510367.1|  cytochrome c assembly protein [Frankia sp...  37.7    0.39  Gene info
ref|YP_001468360.1|  cytochrome c heme attachment protein [Ipo...  37.7    0.40  Gene info
ref|ZP_03720153.1|  hypothetical protein NEIFLAOT_02006 [Neiss...  37.7    0.40 
ref|YP_002536889.1|  cytochrome c-type biogenesis protein CcsB...  37.7    0.40  Gene info
ref|YP_951713.1|  cytochrome c assembly protein [Mycobacterium...  37.7    0.41  Gene info
ref|YP_003132206.1|  cytochrome c-type biogenesis protein CcsB...  37.7    0.41  Gene info
ref|YP_390320.1|  cytochrome c assembly protein [Thiomicrospir...  37.7    0.42  Gene info
ref|ZP_05499315.1|  cytochrome c-type biogenesis protein CcsB ...  37.4    0.43 
ref|YP_635797.1|  cytochrome c biogenesis protein [Chara vulga...  37.4    0.43  Gene info
ref|ZP_01072189.1|  cytochrome c biogenesis protein [Campyloba...  37.4    0.43 
ref|ZP_03209227.1|  hypothetical protein BACPLE_02892 [Bactero...  37.4    0.44 
ref|YP_001293509.1|  cytochrome c biogenesis protein [Rhodomon...  37.4    0.44  Gene info
ref|ZP_03709482.1|  hypothetical protein CORMATOL_00293 [Coryn...  37.4    0.44 
ref|ZP_01069663.1|  cytochrome c biogenesis protein [Campyloba...  37.4    0.44 
ref|YP_999754.1|  cytochrome c biogenesis protein [Campylobact...  37.4    0.45  Gene info
ref|YP_001134085.1|  cytochrome c assembly protein [Mycobacter...  37.4    0.45  Gene info
ref|ZP_04584979.1|  cytochrome c-type biogenesis protein CcsB ...  37.4    0.46 
ref|YP_003239824.1|  cytochrome c-type biogenesis protein CcsB...  37.4    0.47  Gene info
gb|AAY53771.1|  cytochrome C biogenesis [Campylobacter jejuni]     37.4    0.48 
ref|YP_935666.1|  cytochrome c assembly protein [Mycobacterium...  37.4    0.48  Gene info
ref|ZP_04332035.1|  cytochrome c-type biogenesis protein CcsB ...  37.4    0.48 
ref|ZP_02031973.1|  hypothetical protein PARMER_01981 [Parabac...  37.4    0.49 
ref|YP_974527.1|  hypothetical protein NMC0418 [Neisseria meni...  37.4    0.49  Gene info
ref|YP_003002111.1|  cytochrome c biogenesis protein [Aureococ...  37.4    0.50  Gene info
emb|CBA09101.1|  putative cytochrome c asssembly protein [Neis...  37.4    0.50 
ref|ZP_04720332.1|  putative cytochrome synthesis protein [Nei...  37.4    0.50 
ref|YP_207276.1|  putative cytochrome synthesis protein [Neiss...  37.4    0.50  Gene info
ref|NP_569684.1|  cytochrome c biogenesis protein [Psilotum nu...  37.4    0.50  Gene info
ref|YP_002491868.1|  cytochrome c assembly protein [Anaeromyxo...  37.4    0.51  Gene info
ref|YP_002133721.1|  cytochrome c assembly protein [Anaeromyxo...  37.4    0.51  Gene info
ref|YP_465701.1|  cytochrome c assembly protein [Anaeromyxobac...  37.4    0.51  Gene info
emb|CBG70944.1|  putative cytochrome assembly protein [Strepto...  37.4    0.51 
ref|ZP_05311104.1|  cytochrome c-type biogenesis protein CcsB ...  37.4    0.51 
ref|YP_002006895.1|  putative CYTOCHROME C-TYPE BIOGENESIS TRA...  37.4    0.51  Gene info
ref|NP_274800.1|  putative cytochrome c-type biogenesis protei...  37.4    0.51  Gene info
ref|YP_727885.1|  ABC-type transporter, permease component: cy...  37.4    0.53  Gene info
ref|ZP_01106464.1|  Cytochrome c assembly protein [Flavobacter...  37.4    0.53 
ref|ZP_04735746.1|  putative cytochrome synthesis protein [Nei...  37.4    0.53 
ref|YP_003023298.1|  cytochrome c-type biogenesis protein CcsB...  37.4    0.53  Gene info
ref|YP_003240003.1|  cytochrome c-type biogenesis protein CcsB...  37.4    0.54  Gene info
ref|ZP_03475920.1|  hypothetical protein PRABACTJOHN_01584 [Pa...  37.4    0.54 
ref|YP_001598584.1|  cytochrome c-type biogenesis protein, put...  37.4    0.54  Gene info
ref|YP_001550882.1|  putative heme transporter [Prochlorococcu...  37.4    0.54  Gene info
ref|ZP_05539576.1|  cytochrome biogenesis related protein [Str...  37.4    0.55 
emb|CBA05634.1|  putative cytochrome c asssembly protein [Neis...  37.4    0.55 
ref|ZP_05045888.1|  cytochrome c-type biogenesis protein CcsB ...  37.4    0.56 
ref|YP_711265.1|  putative cytochrome C assembly protein [Fran...  37.4    0.56  Gene info
ref|YP_001942471.1|  cytochrome c assembly protein [Chlorobium...  37.4    0.56  Gene info
ref|YP_784607.1|  cytochrome c biogenesis protein [Bordetella ...  37.0    0.57  Gene info
ref|YP_001072772.1|  cytochrome c assembly protein [Mycobacter...  37.0    0.58  Gene info
ref|YP_537050.1|  cytochrome c biogenesis protein [Porphyra ye...  37.0    0.59  Gene info
ref|XP_002335419.1|  predicted protein [Populus trichocarpa] >...  37.0    0.60  Gene info
ref|NP_789692.1|  cytochrome biogenesis protein [Tropheryma wh...  37.0    0.61  Gene info
ref|YP_585423.1|  cytochrome c assembly protein [Ralstonia met...  37.0    0.61  Gene info
ref|YP_002327548.1|  protein involved in cytochrome c biogenes...  37.0    0.62  Gene info
ref|YP_001232564.1|  cytochrome c assembly protein [Geobacter ...  37.0    0.64  Gene info
ref|YP_969358.1|  cytochrome c assembly protein [Acidovorax av...  37.0    0.64  Gene info
ref|NP_787887.1|  cytochrome c-type biogenesis protein [Trophe...  37.0    0.64  Gene info
ref|YP_001937946.1|  heme exporter protein C [Orientia tsutsug...  37.0    0.65  Gene info
ref|YP_291366.1|  putative heme transporter [Prochlorococcus m...  37.0    0.65  Gene info
ref|YP_479626.1|  cytochrome c assembly protein [Frankia sp. C...  37.0    0.65  Gene info
ref|ZP_05624027.1|  cytochrome c biogenesis protein, CcmF/CycK...  37.0    0.68 
ref|ZP_05006319.1|  cytochrome C assembly protein [Streptomyce...  37.0    0.68 
ref|YP_001633534.1|  putative cytochrome c asssembly protein [...  37.0    0.68  Gene info
ref|ZP_01871459.1|  nrfi protein [Caminibacter mediatlanticus ...  37.0    0.68 
gb|AAA16391.1|  yejU [Escherichia coli]                            37.0    0.68 
ref|YP_002485134.1|  cytochrome c-type biogenesis protein CcsB...  37.0    0.70  Gene info
emb|CAJ72505.1|  similar to cytochrome c biogenesis protein re...  37.0    0.70 
ref|YP_465401.1|  cytochrome c assembly protein [Anaeromyxobac...  37.0    0.70  Gene info
ref|NP_214400.1|  cytochrome c biogenesis protein [Aquifex aeo...  37.0    0.70  Gene info
ref|YP_385843.1|  cytochrome c assembly protein [Geobacter met...  37.0    0.71  Gene info
ref|YP_001930313.1|  cytochrome c-type biogenesis protein CcsB...  37.0    0.72  Gene info
ref|YP_002140242.1|  cytochrome c-type biogenesis protein CcsB...  37.0    0.72  Gene info
ref|ZP_04853708.1|  cytochrome c-type biogenesis protein CcsB ...  37.0    0.72 
ref|ZP_03916916.1|  cytochrome c assembly protein [Anaerococcu...  37.0    0.73 
ref|YP_002797085.1|  NrfE [Laribacter hongkongensis HLHK9] >gb...  37.0    0.73  Gene info
gb|ABC25544.1|  cytochrome c biogenesis protein [Fucus vesicul...  37.0    0.73 
ref|YP_386170.1|  cytochrome c assembly protein [Geobacter met...  37.0    0.73  Gene info
ref|ZP_05757864.1|  cytochrome c biogenesis protein (ccsA) [Ba...  37.0    0.73 
ref|ZP_03932614.1|  cytochrome c biogenesis protein [Corynebac...  37.0    0.73 
ref|ZP_05533405.1|  cytochrome C assembly protein [Streptomyce...  36.6    0.77 
ref|YP_003150162.1|  cytochrome c-type biogenesis protein CcsB...  36.6    0.80  Gene info
ref|YP_891606.1|  CcmF/CcyK/CcsA family cytochrome c biogenesi...  36.6    0.80  Gene info
ref|YP_921733.1|  cytochrome c assembly protein [Nocardioides ...  36.6    0.80  Gene info
ref|YP_002000369.1|  heme attachment to plastid cytochrome c [...  36.6    0.81  Gene info
ref|ZP_02178213.1|  cytochrome c biogenesis protein [Hydrogeni...  36.6    0.81 
ref|YP_002883256.1|  cytochrome c-type biogenesis protein CcsB...  36.6    0.82  Gene info
ref|YP_002536762.1|  cytochrome c-type biogenesis protein CcsB...  36.6    0.84  Gene info
ref|YP_003160491.1|  cytochrome c-type biogenesis protein CcsB...  36.6    0.86  Gene info
gb|AAW30271.1|  cytochrome c biogenesis ccmC [Amborella tricho...  36.6    0.86 
ref|NP_810518.1|  cytochrome c biogenesis protein [Bacteroides...  36.6    0.86  Gene info
ref|ZP_01734501.1|  Cytochrome c assembly protein [Flavobacter...  36.6    0.87 
ref|NP_242445.1|  cytochrome c biogenesis [Bacillus halodurans...  36.6    0.87  Gene info
ref|YP_175330.1|  cytochrome c biogenesis protein ResC [Bacill...  36.6    0.88  Gene info
ref|YP_832765.1|  cytochrome c assembly protein [Arthrobacter ...  36.6    0.89  Gene info
ref|YP_002728058.1|  cytochrome c-type biogenesis protein CcsB...  36.6    0.91  Gene info
ref|YP_001430082.1|  cytochrome c biogenesis protein [Cuscuta ...  36.6    0.91  Gene info
ref|ZP_05515794.1|  cytochrome C assembly protein [Streptomyce...  36.6    0.93 
ref|ZP_05319190.1|  cytochrome c-type biogeneis protein CcsB [...  36.6    0.93 
ref|YP_002520002.1|  cytochrome c biogenesis protein [Ephedra ...  36.2    0.97  Gene info
ref|YP_297349.1|  cytochrome c assembly protein [Ralstonia eut...  36.2    0.97  Gene info
ref|NP_813341.1|  cytochrome c biogenesis protein (ccsA) [Bact...  36.2    0.99  Gene info
ref|YP_912249.1|  cytochrome c assembly protein [Chlorobium ph...  36.2    1.0   Gene info
ref|ZP_01891391.1|  Cytochrome c assembly protein [unidentifie...  36.2    1.0  
ref|YP_358470.1|  cytochrome c biogenesis protein [Pelobacter ...  36.2    1.0   Gene info
ref|YP_002492162.1|  cytochrome c assembly protein [Anaeromyxo...  36.2    1.0   Gene info
ref|YP_002765118.1|  cytochrome c biogenesis protein ResC [Rho...  36.2    1.1   Gene info
ref|ZP_05978546.1|  putative cytochrome c-type biogenesis prot...  36.2    1.1  
ref|YP_518461.1|  cytochrome c biogenesis protein CcsA [Desulf...  36.2    1.1   Gene info
ref|ZP_04384457.1|  cytochrome c-type biogenesis protein CcsB ...  36.2    1.1  
ref|YP_002459811.1|  cytochrome c-type biogenesis protein CcsB...  36.2    1.1   Gene info
ref|YP_001825711.1|  putative cytochrome c assembly protein [S...  36.2    1.1   Gene info
ref|YP_002134041.1|  cytochrome c assembly protein [Anaeromyxo...  36.2    1.1   Gene info
ref|YP_001531117.1|  cytochrome c assembly protein [Desulfococ...  36.2    1.1   Gene info
ref|YP_003272242.1|  cytochrome c-type biogenesis protein CcsB...  36.2    1.1   Gene info
ref|ZP_04601029.1|  hypothetical protein GCWU000324_00489 [Kin...  36.2    1.2  
ref|ZP_04686600.1|  cytochrome biogenesis related protein [Str...  36.2    1.2  
gb|ACQ90832.1|  heme attachment to plastid cytochrome c [Pedin...  36.2    1.2  
ref|YP_001821277.1|  cytochrome c assembly protein [Opitutus t...  36.2    1.2   Gene info
ref|ZP_01052724.1|  cytochrome c assembly protein [Polaribacte...  36.2    1.2   Gene info
ref|YP_002248888.1|  cytochrome c biogenesis protein, CcmF/Ccy...  36.2    1.3   Gene info
ref|YP_980906.1|  cytochrome c assembly protein [Polaromonas n...  35.8    1.3   Gene info
ref|ZP_05476674.1|  cytochrome c-type biogenesis protein CcsB ...  35.8    1.3  
ref|ZP_04694050.1|  putative cytochrome c assembly protein [St...  35.8    1.3  
ref|YP_001799631.1|  cytochrome c biogenesis protein [Coryneba...  35.8    1.3   Gene info
ref|ZP_01961234.1|  hypothetical protein BACCAC_02862 [Bactero...  35.8    1.3  
ref|YP_002016503.1|  cytochrome c assembly protein [Prosthecoc...  35.8    1.3   Gene info
ref|YP_002229435.1|  putative cytochrome c biogenesis protein ...  35.8    1.4   Gene info
ref|YP_002600969.1|  heme attachment to plastid cytochrome c [...  35.8    1.4   Gene info
ref|YP_622596.1|  cytochrome c assembly protein [Burkholderia ...  35.8    1.4   Gene info
ref|YP_002489138.1|  cytochrome c-type biogenesis protein CcsB...  35.8    1.4   Gene info
ref|ZP_02465037.1|  cytochrome c assembly family protein [Burk...  35.8    1.4  
ref|YP_001763663.1|  cytochrome c-type biogenesis protein CcsB...  35.8    1.4   Gene info
ref|YP_099550.1|  cytochrome c biogenesis protein [Bacteroides...  35.8    1.5   Gene info
ref|YP_834029.1|  cytochrome c assembly protein [Burkholderia ...  35.8    1.5   Gene info
ref|YP_002910197.1|  Cytochrome c assembly family protein [Bur...  35.8    1.5   Gene info
ref|ZP_04367075.1|  ABC-type transport system involved in cyto...  35.8    1.5  
ref|YP_443538.1|  cytochrome c assembly family protein [Burkho...  35.8    1.5   Gene info
ref|ZP_05082413.1|  cytochrome c assembly protein [beta proteo...  35.8    1.5  
gb|ACX99574.1|  cytochrome c-type biogenesis protein [Helicoba...  35.8    1.5  
ref|ZP_04702745.1|  cytochrome C assembly protein [Streptomyce...  35.8    1.5  
ref|ZP_03574638.1|  cytochrome C assembly protein [Burkholderi...  35.8    1.5  
ref|YP_001910544.1|  cytochrome c-type biogenesis protein [Hel...  35.8    1.5   Gene info
ref|YP_002907158.1|  cytochrome c biogenesis protein [Coryneba...  35.8    1.6   Gene info
ref|ZP_03439895.1|  hypothetical protein HP9810_890g28 [Helico...  35.8    1.6  
ref|YP_001578475.1|  cytochrome c-type biogenesis protein CcsB...  35.8    1.6   Gene info
ref|YP_367727.1|  cytochrome c assembly protein [Burkholderia ...  35.8    1.6   Gene info
ref|NP_223720.1|  putative cytochrome C-type biogenesis protei...  35.8    1.6   Gene info
ref|YP_001068000.1|  cytochrome C assembly protein [Burkholder...  35.8    1.6   Gene info
gb|ACX98175.1|  biogenesis protein [Helicobacter pylori 51]        35.8    1.6  
ref|ZP_02357298.1|  cytochrome c assembly family protein [Burk...  35.8    1.6  
ref|ZP_01117790.1|  Cytochrome c assembly protein [Polaribacte...  35.8    1.6  
ref|ZP_02413289.1|  cytochrome c assembly family protein [Burk...  35.8    1.6  
ref|YP_001516053.1|  cytochrome c-type biogenesis protein CcsA...  35.8    1.6   Gene info
ref|YP_001118212.1|  cytochrome c assembly protein [Burkholder...  35.8    1.6   Gene info
ref|YP_003057736.1|  Cytochrome c biogenesis protein; putative...  35.8    1.6   Gene info
ref|ZP_02404779.1|  cytochrome c assembly family protein [Burk...  35.8    1.6  
ref|ZP_02364403.1|  cytochrome c assembly family protein [Burk...  35.8    1.6  
ref|YP_109773.1|  putative cytochrome C biogenesis protein [Bu...  35.8    1.6   Gene info
ref|ZP_02491790.1|  cytochrome c assembly family protein [Burk...  35.8    1.6  
ref|ZP_02893632.1|  cytochrome c-type biogenesis protein CcsB ...  35.8    1.6  
ref|ZP_01085630.1|  possible heme transporter [Synechococcus s...  35.8    1.6  
ref|YP_002301675.1|  cytochrome C-type biogenesis protein [Hel...  35.4    1.6   Gene info
ref|ZP_02499940.1|  cytochrome c assembly family protein [Burk...  35.4    1.6  
ref|YP_701997.1|  cytochrome c assembly membrane protein [Rhod...  35.4    1.6   Gene info
ref|ZP_01252689.1|  Cytochrome c assembly protein [Psychroflex...  35.4    1.6  
ref|YP_002778898.1|  putative cytochrome c biogenesis protein ...  35.4    1.7   Gene info
ref|YP_772195.1|  cytochrome c assembly protein [Burkholderia ...  35.4    1.7   Gene info
ref|ZP_05802233.1|  cytochrome c-type biogenesis protein CcsB ...  35.4    1.7  
ref|YP_104133.1|  cytochrome c assembly family protein [Burkho...  35.4    1.7   Gene info
ref|YP_001807027.1|  cytochrome c-type biogenesis protein CcsB...  35.4    1.7   Gene info
ref|YP_001060716.1|  cytochrome C assembly protein [Burkholder...  35.4    1.7   Gene info
ref|ZP_04968055.1|  cytochrome C assembly protein [Burkholderi...  35.4    1.7  
ref|YP_001876623.1|  cytochrome c heme attachment protein [Wel...  35.4    1.8   Gene info
ref|YP_829222.1|  cytochrome c assembly protein [Arthrobacter ...  35.4    1.8   Gene info
ref|YP_001897223.1|  cytochrome c-type biogenesis protein CcsB...  35.4    1.8   Gene info
ref|YP_730498.1|  cytochrome c assembly protein [Synechococcus...  35.4    1.8   Gene info
ref|ZP_02182583.1|  hypothetical protein FBALC1_07148 [Flavoba...  35.4    1.8  
ref|YP_003118743.1|  cytochrome c-type biogenesis protein CcsB...  35.4    1.8   Gene info
ref|ZP_03271903.1|  cytochrome c-type biogenesis protein CcsB ...  35.4    1.8  
ref|YP_636348.1|  cytochrome c biogenesis protein [Eucalyptus ...  35.4    1.8   Gene info
ref|ZP_03609584.1|  cytochrome c biogenesis protein, CcmF/CycK...  35.4    1.8  
ref|ZP_02886857.1|  cytochrome c-type biogenesis protein CcsB ...  35.4    1.8  
ref|YP_335105.1|  cytochrome c assembly family protein [Burkho...  35.4    1.8   Gene info
ref|ZP_03640954.1|  hypothetical protein PROVRETT_04066 [Provi...  35.4    1.9  
ref|YP_002720161.1|  ccsA [Jatropha curcas] >gb|ACN72739.1| cc...  35.4    1.9   Gene info
ref|ZP_01624524.1|  Cytochrome c assembly protein [Lyngbya sp....  35.4    1.9  
ref|YP_560637.1|  cytochrome c assembly protein [Burkholderia ...  35.4    1.9   Gene info
ref|ZP_04058513.1|  cytochrome c assembly protein family membr...  35.4    1.9  
ref|YP_001742034.1|  putative cytochrome assembly protein [Art...  35.4    1.9   Gene info
ref|YP_538991.1|  cytochrome c biogenesis protein [Gossypium h...  35.4    1.9   Gene info
ref|NP_954323.1|  CcmF/CcyK/CcsA family cytochrome c biogenesi...  35.4    1.9   Gene info
ref|NP_951672.1|  CcmF/CcyK/CcsA family cytochrome c biogenesi...  35.4    1.9   Gene info
ref|YP_913235.1|  c-type cytochrome synthesis [Gossypium barba...  35.4    2.0   Gene info
ref|YP_547628.1|  cytochrome c assembly protein [Polaromonas s...  35.4    2.0   Gene info
ref|ZP_05291685.1|  Cytochrome c-type biogenesis protein CcsA/...  35.4    2.0  
ref|ZP_03729612.1|  cytochrome c-type biogenesis protein CcsB ...  35.4    2.0  
ref|YP_001466554.1|  cytochrome C assembly protein [Campylobac...  35.4    2.0   Gene info
ref|YP_784529.1|  cytochrome c heme attachment protein [Piper ...  35.4    2.0   Gene info
ref|NP_882431.1|  putative cytochrome c asssembly protein [Bor...  35.4    2.0   Gene info
ref|NP_886620.1|  putative cytochrome c asssembly protein [Bor...  35.4    2.0   Gene info
ref|ZP_02330237.1|  cytochrome c biogenesis protein [Paenibaci...  35.4    2.1  
gb|AAT79760.1|  c-type cytochrome synthesis protein [Gracilari...  35.4    2.1   Gene info
ref|YP_001490230.1|  cytochrome c biogenesis protein [Arcobact...  35.4    2.1   Gene info
ref|ZP_04946803.1|  ABC-type transport system involved in cyto...  35.4    2.1  
ref|ZP_04760923.1|  cytochrome c-type biogenesis protein CcsB ...  35.0    2.2  
ref|YP_063685.2|  cytochrome c biogenesis protein [Gracilaria ...  35.0    2.2   Gene info
ref|ZP_04939890.1|  Cytochrome c assembly protein [Burkholderi...  35.0    2.2  
ref|NP_043267.1|  cytochrome c biogenesis protein [Cyanophora ...  35.0    2.2   Gene info
ref|ZP_05281447.1|  putative cytochrome C biogenesis-related p...  35.0    2.2  
ref|ZP_03015432.1|  hypothetical protein BACINT_03022 [Bactero...  35.0    2.2  
ref|YP_003047734.1|  cytochrome c-type biogenesis protein CcsB...  35.0    2.3   Gene info
gb|ABU88224.1|  heme attachment to plastid cytochrome c protei...  35.0    2.3  
ref|ZP_03701284.1|  cytochrome c assembly protein [Flavobacter...  35.0    2.4  
ref|YP_001225026.1|  ABC-type transport system involved in cyt...  35.0    2.4   Gene info
ref|NP_882160.1|  putative cytochrome c asssembly protein [Bor...  35.0    2.4   Gene info
ref|ZP_01313492.1|  cytochrome c assembly protein [Desulfuromo...  35.0    2.4  
ref|YP_003200328.1|  cytochrome c-type biogenesis protein CcsB...  35.0    2.5  
gb|ABU88289.1|  heme attachment to plastid cytochrome c protei...  35.0    2.5  
ref|YP_001137382.1|  hypothetical protein cgR_0512 [Corynebact...  35.0    2.6   Gene info
ref|NP_599689.1|  cytochrome C assembly protein [Corynebacteri...  35.0    2.6   Gene info
ref|ZP_03269804.1|  cytochrome c-type biogenesis protein CcsB ...  35.0    2.6  
ref|YP_397269.1|  putative heme transporter [Prochlorococcus m...  35.0    2.6   Gene info
ref|ZP_03642358.1|  hypothetical protein BACCOPRO_00709 [Bacte...  35.0    2.7  
ref|ZP_03423681.1|  cytochrome C-type biogenesis protein ccsA ...  35.0    2.7  
ref|NP_907171.1|  NRFI protein [Wolinella succinogenes DSM 174...  35.0    2.7   Gene info
ref|ZP_01124022.1|  possible heme transporter [Synechococcus s...  35.0    2.7  
ref|ZP_01080173.1|  possible heme transporter [Synechococcus s...  35.0    2.7  
ref|YP_003050028.1|  cytochrome c-type biogenesis protein CcsB...  35.0    2.8   Gene info
ref|YP_001013679.1|  ABC transporter [Hyperthermus butylicus D...  34.7    2.8   Gene info
ref|ZP_03393145.1|  cytochrome c-type biogenesis protein CcsB ...  34.7    2.9  
gb|ABE11202.1|  putative heme transporter [uncultured Prochlor...  34.7    2.9  
ref|ZP_05364059.1|  cytochrome c biogenesis protein, CcmF/CycK...  34.7    2.9  
ref|YP_665605.1|  cytochrome c biogenesis protein [Populus alb...  34.7    2.9   Gene info
ref|YP_544346.1|  cytochrome c assembly protein [Methylobacill...  34.7    2.9   Gene info
ref|YP_001229150.1|  cytochrome c assembly protein [Geobacter ...  34.7    2.9   Gene info
emb|CAB96962.1|  magnesium-chelatase subunit chlI [Gnetum gnemon]  34.7    3.0  
ref|YP_001109556.1|  cytochrome c biogenesis protein [Populus ...  34.7    3.0   Gene info
ref|YP_001718485.1|  cytochrome c biogenesis protein [Manihot ...  34.7    3.0   Gene info
ref|ZP_02380126.1|  Cytochrome c assembly protein [Burkholderi...  34.7    3.0  
ref|ZP_05025048.1|  cytochrome c-type biogenesis protein CcsB ...  34.7    3.1  
ref|YP_589828.1|  cytochrome c assembly protein [Candidatus Ko...  34.7    3.1   Gene info
ref|YP_001484060.1|  putative heme transporter [Prochlorococcu...  34.7    3.1   Gene info
ref|YP_001221312.1|  putative cytochrome C-type biogenesis pro...  34.7    3.2   Gene info
ref|YP_003121221.1|  cytochrome c assembly protein [Chitinopha...  34.7    3.2   Gene info
ref|ZP_05138852.1|  cytochrome c-type biogenesis protein CcsB ...  34.7    3.2  
ref|ZP_04492445.1|  ABC-type transport system involved in cyto...  34.7    3.2  
ref|ZP_03890849.1|  cytochrome c-type biogenesis protein CcsB ...  34.7    3.2  
ref|NP_737075.1|  putative cytochrome c biogenesis protein [Co...  34.7    3.2   Gene info
ref|YP_001091049.1|  putative heme transporter [Prochlorococcu...  34.7    3.3   Gene info
ref|YP_001009218.1|  putative heme transporter [Prochlorococcu...  34.7    3.3   Gene info
ref|YP_431032.1|  cytochrome c assembly protein [Moorella ther...  34.7    3.3   Gene info
ref|YP_002731212.1|  cytochrome c biogenesis protein, CcmF/Cyc...  34.7    3.3   Gene info
ref|YP_002221110.1|  cytochrome c-type biogenesis protein CcsB...  34.7    3.4   Gene info
ref|ZP_01471963.1|  possible heme transporter [Synechococcus s...  34.7    3.4  
ref|YP_003104355.1|  cytochrome c-type biogenesis protein CcsB...  34.7    3.4   Gene info
ref|YP_002539243.1|  cytochrome c assembly protein [Geobacter ...  34.7    3.4   Gene info
ref|ZP_01313987.1|  cytochrome c assembly protein [Desulfuromo...  34.7    3.5  
ref|ZP_05751396.1|  cytochrome c biogenesis protein [Corynebac...  34.7    3.5  
ref|ZP_04056004.1|  cytochrome c biogenesis protein [Porphyrom...  34.7    3.5  
ref|YP_002121713.1|  cytochrome c-type biogenesis protein CcsB...  34.7    3.5   Gene info
ref|ZP_04482621.1|  cytochrome c-type biogenesis protein CcsB ...  34.7    3.6  
ref|YP_003195744.1|  Cytochrome c assembly protein [Robiginita...  34.7    3.6  
ref|NP_908253.1|  cytochrome c biogenesis protein (ycf5) [Woli...  34.7    3.6   Gene info
ref|YP_001434411.1|  cytochrome c assembly protein [Roseiflexu...  34.3    3.8   Gene info
ref|ZP_04026347.1|  cytochrome c-type biogenesis protein CcsB ...  34.3    3.8  
ref|YP_002943050.1|  cytochrome c-type biogenesis protein CcsB...  34.3    3.8   Gene info
ref|ZP_03302970.1|  hypothetical protein BACDOR_04376 [Bactero...  34.3    3.8  
gb|AAC68693.1|  putative cytochrome c-type maturation protein ...  34.3    3.9  
ref|ZP_01202380.1|  putative transmembrane cytochrome c biogen...  34.3    3.9  
ref|ZP_04541369.1|  cytochrome c biogenesis protein [Bacteroid...  34.3    3.9  
ref|ZP_04557679.1|  cytochrome c biogenesis protein [Bacteroid...  34.3    3.9  
ref|NP_050696.1|  cytochrome c biogenesis protein [Guillardia ...  34.3    3.9   Gene info
ref|ZP_00374659.1|  heme exporter protein CcmC [Wolbachia endo...  34.3    3.9  
ref|YP_001300041.1|  cytochrome c biogenesis protein [Bacteroi...  34.3    4.0   Gene info
ref|ZP_00517496.1|  Cytochrome c assembly protein [Crocosphaer...  34.3    4.1  
ref|YP_720548.1|  cytochrome c assembly protein [Trichodesmium...  34.3    4.1   Gene info
ref|YP_002427475.1|  cytochrome c-type biogenesis protein ResC...  34.3    4.1   Gene info
ref|ZP_02907540.1|  cytochrome c-type biogenesis protein CcsB ...  34.3    4.1  
ref|NP_051108.1|  cytochrome c biogenesis protein [Arabidopsis...  34.3    4.1   UniGene infoGene info
ref|YP_001711236.1|  putative cytochrome biogenesis protein [C...  34.3    4.2   Gene info
ref|YP_001408628.1|  outer membrane lipoprotein MapA [Campylob...  34.3    4.2   Gene info
ref|YP_476348.1|  cytochrome c assembly protein [Synechococcus...  34.3    4.3   Gene info
ref|YP_002137231.1|  cytochrome c-type biogenesis protein CcsB...  34.3    4.4   Gene info
ref|NP_953932.1|  CcmF/CcyK/CcsA family cytochrome c biogenesi...  34.3    4.4   Gene info
ref|ZP_03008744.1|  hypothetical protein BACCOP_00593 [Bactero...  34.3    4.5  
ref|NP_066334.1|  ABC transporter subunit [Malawimonas jakobif...  34.3    4.5   Gene info
ref|YP_002519739.1|  cytochrome c biogenesis protein [Gnetum p...  34.3    4.5   Gene info
ref|YP_290757.1|  CcsB [Thermobifida fusca YX] >gb|AAZ56734.1|...  34.3    4.6   Gene info
ref|YP_474686.1|  cytochrome c assembly protein [Synechococcus...  34.3    4.6   Gene info
ref|YP_001123336.1|  hypothetical protein BaveCp072 [Barbarea ...  34.3    4.7   Gene info
ref|YP_664313.1|  cytochrome c biogenesis protein [Helicobacte...  34.3    4.7   Gene info
ref|ZP_05037998.1|  cytochrome c-type biogenesis protein CcsB ...  34.3    4.7  
ref|YP_001231265.1|  cytochrome c assembly protein [Geobacter ...  34.3    4.7   Gene info
ref|ZP_03128043.1|  cytochrome c assembly protein [Chthoniobac...  34.3    4.8  
ref|YP_001869189.1|  cytochrome c assembly protein [Nostoc pun...  34.3    4.8   Gene info
ref|NP_050913.1|  cytochrome c biogenesis protein [Nephroselmi...  33.9    4.9   Gene info
ref|ZP_05839734.1|  cytochrome c assembly protein [Ferroglobus...  33.9    4.9  
ref|YP_001625844.1|  apocytochrome heme-lyase [Renibacterium s...  33.9    4.9   Gene info
ref|NP_904058.1|  cytochrome C-type biogenesis transmembrane p...  33.9    5.0   Gene info
ref|ZP_04419950.1|  ABC-type transport system involved in cyto...  33.9    5.0  
ref|ZP_03154372.1|  cytochrome c-type biogenesis protein CcsB ...  33.9    5.0  
ref|YP_001859023.1|  cytochrome c-type biogenesis protein CcsB...  33.9    5.1   Gene info
ref|YP_764404.1|  heme attachment to plastid cytochrome c [Sti...  33.9    5.1   Gene info
ref|NP_207176.1|  cytochrome c biogenesis protein (ycf5) [Heli...  33.9    5.2   Gene info
ref|ZP_03699140.1|  cytochrome c-type biogenesis protein CcsB ...  33.9    5.3  
ref|YP_743681.1|  cytochrome c assembly protein [Alkalilimnico...  33.9    5.3   Gene info
ref|ZP_05972564.1|  rod shape-determining protein MreD [Provid...  33.9    5.3  
ref|YP_065417.1|  cytochrome c biogenesis protein (CcsA) [Desu...  33.9    5.3   Gene info
ref|ZP_04419939.1|  ABC-type transport system involved in cyto...  33.9    5.4  
ref|YP_001801916.1|  cytochrome c assembly protein [Cyanothece...  33.9    5.4   Gene info
ref|ZP_01290005.1|  Cytochrome c assembly protein [delta prote...  33.9    5.4  
ref|ZP_00368013.1|  cytochrome c biogenesis protein (ycf5) [Ca...  33.9    5.4  
ref|YP_001227516.1|  ABC-type transport system involved in cyt...  33.9    5.4   Gene info
ref|YP_002266638.1|  cytochrome c-type biogenesis protein [Hel...  33.9    5.5   Gene info
ref|YP_001123164.1|  cytochrome c biogenesis protein [Olimarab...  33.9    5.7   Gene info
ref|YP_627755.1|  cytochrome c-type biogenesis protein [Helico...  33.9    5.7   Gene info
ref|ZP_05292139.1|  Cytochrome c-type biogenesis protein CcsA/...  33.9    5.8  
ref|YP_171719.1|  c-type cytochrome synthesis protein [Synecho...  33.9    5.9   Gene info
ref|YP_001320727.1|  cytochrome c assembly protein [Alkaliphil...  33.9    5.9   Gene info
ref|YP_002430437.1|  cytochrome c-type biogenesis protein CcsB...  33.5    6.3   Gene info
ref|ZP_03530964.1|  cytochrome C-type biogenesis protein, CcsB...  33.5    6.4  
ref|YP_001917291.1|  cytochrome c-type biogenesis protein CcsB...  33.5    6.4   Gene info
ref|YP_001661422.1|  cytochrome c biogenesis C [Cycas taitunge...  33.5    6.4   Gene info
ref|NP_825978.1|  cytochrome C assembly protein [Streptomyces ...  33.5    6.4   Gene info
ref|YP_001566601.1|  cytochrome c-type biogenesis protein CcsB...  33.5    6.5   Gene info
ref|ZP_03545174.1|  cytochrome c-type biogenesis protein CcsB ...  33.5    6.5  


 Les 10 premiers alignments issus de Nr:


>ref|YP_003321982.1|  cytochrome c assembly protein [Thermobaculum terrenum ATCC BAA-798]
 gb|ACZ41160.1|  cytochrome c assembly protein [Thermobaculum terrenum ATCC BAA-798]
Length=239

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (60%), Gaps = 8/127 (6%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  W W+PR+ TTL+L+ +Y+GY +LR     +Q+ A   A++GI+ F+++PI+
Sbjct  113  WGKPVWGTWWSWDPRMTTTLILWFIYLGYLMLRAYAPSKQQGARYAAVLGIVGFVDVPIV  172

Query  61   FASVNFWAAEIQSHPQL----GMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEV-LKKK  115
            + S  +W      HPQ     G    P  +L  F+ SLL+FT L I++L+++  + L + 
Sbjct  173  YMSTKWWRT---LHPQQVVEPGQVSMPPEMLQAFMVSLLAFTLLFIWILIIRTRIALIED  229

Query  116  DIEDRYV  122
            ++E R +
Sbjct  230  ELEIRSI  236


>ref|YP_387968.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio desulfuricans 
subsp. desulfuricans str. G20]
 gb|ABB38273.1| Gene info cytochrome c-type biogenesis protein CcmC [Desulfovibrio desulfuricans 
subsp. desulfuricans str. G20]
Length=230

 GENE ID: 3756066 Dde_1474 | cytochrome c-type biogenesis protein CcmC
[Desulfovibrio desulfuricans subsp. desulfuricans str. G20]

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 5/119 (4%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W    WG  W W+PRL TTLV++ VY GY +LR++GL R+R A+VCA++GI+AF+++P++
Sbjct  104  WGRHSWGVWWTWDPRLTTTLVMWFVYAGYLMLRSMGLARERRAVVCAVLGIVAFIDVPLV  163

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKKDIED  119
            F S   W +    HP +  ++   G L P + +      L    L   +  ++ + + D
Sbjct  164  FFSARLWRS---IHPSVFASR--GGGLEPEMLTTAVVCVLCFGFLWYALTAIRTRQLAD  217


>ref|ZP_02170570.1|  cytochrome c assembly protein [Bacillus selenitireducens MLS10]
 gb|EDP82481.1|  cytochrome c assembly protein [Bacillus selenitireducens MLS10]
Length=239

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 5/116 (4%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA   W   W WEPRL TTL+LF +YIGY ++RN+ +  QR A + ++ GII+F+N+PI+
Sbjct  108  WARSAWNTWWTWEPRLTTTLILFFMYIGYIMIRNLDMEWQRKARLASVFGIISFINVPIV  167

Query  61   FASVNFWAAEIQSHPQLGMNKQ---PSGILNPFLFSLLSFTSLMIFMLLLKIEVLK  113
            + S+ +W + +  HP +         + +L   +FS+ +FT L + +L   ++V K
Sbjct  168  YMSIRWWESNL--HPVVVGQGGGGLETSMLITLIFSVFTFTCLFVVLLQRGLQVEK  221


>ref|YP_002522425.1| Gene info heme exporter protein C [Thermomicrobium roseum DSM 5159]
 gb|ACM05961.1| Gene info heme exporter protein C [Thermomicrobium roseum DSM 5159]
Length=239

 GENE ID: 7356381 trd_1217 | heme exporter protein C
[Thermomicrobium roseum DSM 5159] (10 or fewer PubMed links)

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 8/121 (6%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  PIWG  W W+ RL TTL+L+ +Y+GYF+LR      +R A   A++GI+ F++IPII
Sbjct  109  WGRPIWGTWWTWDARLTTTLILWFIYLGYFLLRAYVADPERGARYAAVLGIVGFVDIPII  168

Query  61   FASVNFWAAEIQSHPQLGMNKQ-----PSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKK  115
              SV +W      HPQ  + +      P  +L   + +L++F  L +F+L +K  +   +
Sbjct  169  HMSVRWWR---TLHPQPIVVRSEGPAMPPEMLVTMIVTLVAFCILYVFLLAVKYRIETTR  225

Query  116  D  116
            D
Sbjct  226  D  226


>ref|YP_002480937.1| Gene info cytochrome c assembly protein [Desulfovibrio desulfuricans subsp. 
desulfuricans str. ATCC 27774]
 gb|ACL50259.1| Gene info cytochrome c assembly protein [Desulfovibrio desulfuricans subsp. 
desulfuricans str. ATCC 27774]
Length=230

 GENE ID: 7286084 Ddes_2365 | cytochrome c assembly protein
[Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 70/125 (56%), Gaps = 10/125 (8%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA   WG  W W+PRL TTL+++ VY GY +LR + L  QR  +VCA++G++AFL++P++
Sbjct  100  WARRSWGVWWTWDPRLTTTLIMWFVYAGYLVLRGLDLPPQRRNMVCAVVGVVAFLDVPLV  159

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNP-----FLFSLLSFTSLMIFMLLLKIEVLKKK  115
            F S   W +    HP +  +K+  G L P      +  +LSF  L   ++ L+   L   
Sbjct  160  FLSARIWRS---IHPSVFASKE--GGLEPEMRLTVIACVLSFGLLWAGLVWLRKRQLDLA  214

Query  116  DIEDR  120
               DR
Sbjct  215  ARLDR  219


>ref|YP_923152.1| Gene info cytochrome c assembly protein [Nocardioides sp. JS614]
 gb|ABL81465.1| Gene info cytochrome c assembly protein [Nocardioides sp. JS614]
Length=254

 GENE ID: 4599861 Noca_1955 | cytochrome c assembly protein
[Nocardioides sp. JS614]

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W  P+WG  W W+PRL TT+VL L+Y+GY  +R V     R A   A+IG+I F+++PI+
Sbjct  109  WGRPVWGTWWTWDPRLTTTVVLLLIYLGYLSVRRVADSPSRRAHWSAVIGVIGFIDVPIV  168

Query  61   FASVNFWAAEIQSHP--QLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKKD  116
              SV +W +  Q     + G      G+L   L   ++F+ +  +++ +++ V + +D
Sbjct  169  HMSVVWWRSLHQEATVVRAGAPTMDPGMLATLLLGAVAFSIVYGYLMAVRMRVGRLED  226


>ref|YP_360214.1| Gene info putative heme exporter protein CcmC [Carboxydothermus hydrogenoformans 
Z-2901]
 gb|ABB15911.1| Gene info putative heme exporter protein CcmC [Carboxydothermus hydrogenoformans 
Z-2901]
Length=221

 GENE ID: 3728022 CHY_1382 | putative heme exporter protein CcmC
[Carboxydothermus hydrogenoformans Z-2901] (10 or fewer PubMed links)

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 16/132 (12%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA  +W   W W+P+L T ++++ +Y+ Y +LR      ++ A   AI GII FL++P++
Sbjct  90   WAKTVWNAWWTWDPKLTTAIIMWFIYLAYVVLRLAAGEEEKTARFAAIFGIIGFLDVPLV  149

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNP-----FLFSLLSFTSLMIFML-------LLK  108
            FA+  +W  +   HP +  N  PSG L+P     F  SL +FT+L I++L       LL 
Sbjct  150  FAAGRWW--QKTFHPIIFNN--PSGGLDPAMKPAFFISLFAFTALYIYLLVKSARINLLH  205

Query  109  IEVLKKKDIEDR  120
             E+ + KDI + 
Sbjct  206  RELNRLKDIVNE  217


>ref|ZP_03311797.1|  hypothetical protein DESPIG_01714 [Desulfovibrio piger ATCC 29098]
 gb|EEB33385.1|  hypothetical protein DESPIG_01714 [Desulfovibrio piger ATCC 29098]
Length=228

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 56/89 (62%), Gaps = 5/89 (5%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA   WG  W W+PRL TTLV++ +Y GY +LR + L  QR  ++CA++G++AFL++P++
Sbjct  102  WARRSWGVWWTWDPRLTTTLVMWFIYAGYLVLRGLDLPPQRKRMICAVVGVVAFLDVPLV  161

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNP  89
            F S   W +    HP +  +K   G L P
Sbjct  162  FLSARLWRS---IHPAVFASK--GGGLEP  185


>ref|YP_002437533.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris str. 'Miyazaki 
F']
 gb|ACL10065.1| Gene info cytochrome c assembly protein [Desulfovibrio vulgaris str. 'Miyazaki 
F']
Length=228

 GENE ID: 7175075 DvMF_3129 | cytochrome c assembly protein
[Desulfovibrio vulgaris str. 'Miyazaki F']

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 55/89 (61%), Gaps = 5/89 (5%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            W    WG  W W+PRL TTLV++ VY GY +LR + L R+R+  V A++GI+AFL++P++
Sbjct  102  WGRHSWGVWWTWDPRLTTTLVMWFVYAGYLVLRTLDLPRERLGTVSAVVGIVAFLDVPLV  161

Query  61   FASVNFWAAEIQSHPQLGMNKQPSGILNP  89
            F S   W +    HP +  +K   G L P
Sbjct  162  FLSARLWRS---IHPAVFASK--GGGLEP  185


>ref|NP_294071.1| Gene info cytochrome c-type biogenesis protein, heme exporter protein C 
[Deinococcus radiodurans R1]
 gb|AAF09930.1|AE001895_2 Gene info cytochrome c-type biogenesis protein, heme exporter protein C 
[Deinococcus radiodurans R1]
Length=236

 GENE ID: 1799373 DR_0348 | cytochrome c-type biogenesis protein, heme exporter
protein C [Deinococcus radiodurans R1] (10 or fewer PubMed links)

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 6/121 (4%)

Query  1    WATPIWGQPWVWEPRLITTLVLFLVYIGYFILRNVGLYRQRVALVCAIIGIIAFLNIPII  60
            WA P WG  W W+PRL TT V  L+Y+GYFI+R +     R A V A++GI+  L IP+ 
Sbjct  97   WAKPTWGTYWTWDPRLTTTAVGLLIYLGYFIIRGLIDDPHRRARVAAVLGIVGTLYIPVN  156

Query  61   FASVNFW-----AAEIQSHPQLGMNKQPSGILNPFLFSLLSFTSLMIFMLLLKIEVLKKK  115
            + SV +W      A ++   +L +   P  +L  F   L +FT L  F++ L+  + K++
Sbjct  157  YMSVYWWRSIHQTATVKILGKLELAADPR-MLQAFFTMLAAFTVLYFFLVRLRGILAKRE  215

Query  116  D  116
            +
Sbjct  216  E  216