GOS 1086010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092351624729
Annotathon code: GOS_1086010
Sample :
  • GPS :1°23'21n; 91°49'1w
  • Galapagos Islands: Wolf Island - Ecuador
  • Coastal (-1.7m, 21.8°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : juan
Annotated on : 2010-01-17 14:45:20
  • GUEYRAUD Justine
  • PALOMO Andjy

Synopsis

  • Taxonomy: Candidatus Pelagibacter ubique (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198252
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1092351624729 GOS_1086010 Genomic DNA
TCGTTCAGTATTTTTAATAATATACTCTGAAATTTTCGGATTTATTTCTATTTGTTTGTCAGAAAAAAATTTAGAGATTATTACTGTTAATAAATCATCT
GTAGGCAATTCTATGCCTAGATTCATAAAACTGTTAGCTCTTGATCTTAAATCTTTAAGATCAAATTTAATATCCTTTATTGGAAGAAAAGAGTTTATAA
CTATATAGGTATCTAATTGCTTGGAAGAATTTAATATCGAATAAAAAGTTTTTTCATTTATATTTTTTTCATAATTATCTATTATTAAACAGTTTAATTT
TTCAAATTTTGATATTGTCTCATCAGTTATATTCTCAGCGTTCAATATTTCAACGGAATTAATTTTTTTTTTTAAAATATTAGATAAATGAGTTTTGCCA
CAACCTGTTGGACCAAAAATATTTACCCATTTGTCAGGCCAATTTGGCCAACTCTCAATTAATTGATATGCAGAAAAATTATTACTCGAAACATAATAAT
CTTGTTCATAATATTTTGTTTTAAAAGGAAATTTAAATACTAATTGACTCATTAGATAATTTTAAGTTGCCATTGCCCTGCAATCATTTTTAAATCAATT
TTTTCATCTTTAAGCTTACTTATGATCTTATTAATTTTACCAAGATATTTGATCTTAATAATTACATAATCTTTATTGAGTTCTTGAACATAAAAATTAT
CAATTAAATCTATTTTGTTTAATCTATTGCTAAATTCAACTAAATTACTTTTTTTATTTAGTAGAATTTCTACATTCAAAAAAGA

Translation

[225 - 785/785]   indirect strand
>GOS_1086010 Translation [225-785   indirect strand]
NYLMSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKKKINSVEILNAENITDETISKFEKLNCLIIDNYEKN
INEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Notre séquence génomique provient des iles Galapagos.

Elle comporte un orf sur le brin indirect de la base 225 a 785. C'est une séquence codante qui correspond à une protéine de 187 aa. Elle a un domaine protéique qui débute au 13e aa et finit au 186e.


Lorsqu'on regarde les homologies taxonomiques on note la présence d'un grand nombre de protéines d'initiation de la réplication chromosomique venant de multiples organismes differents. On observe une majorité de alpha protéos bactéries.Dans notre arbre phylogénétique on a sélectionné les alphaprotéobactéries comme groupe d'étude, et les gamma et beta protéobactéries comme groupe extérieur. L'arbre confirme la parenté de notre séquence avec les alphaprotéobactéries.Notre séquence provient certainement d'une alphaprotéobactérie.


Nous avons choisi de mettre comme processus biologique qu'il s'agit d'un processus métabolique d'ADN car aucune autre suggestion ne correspond à la fonction du domaine protéique trouvé qui est une protéine impliquée dans l'initiation de la réplication de l'ADN. Il s'agit d'une ATPase, elle se lie à l'ATP, c'est pour cela que nous avons choisi la fonction moléculaire "DNA binding".



Nous n'avons trouvé aucun nom de gene correspondant au notre.

ORF finding

PROTOCOLE:

SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


ANALYSE DES RÉSULTATS:

On a choisi l'ORF sur le brin indirect,qui s'étend de la base 225 à 785 car les autres orfs contienent tous un codon stop.



RÉSULTATS BRUTS:

ORF Finder results
Results for 785 residue sequence "Untitled" starting "TCGTTCAGTA"

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 234.
TCTTTTTTGAATGTAGAAATTCTACTAAATAAAAAAAGTAATTTAGTTGAATTTAGCAAT
AGATTAAACAAAATAGATTTAATTGATAATTTTTATGTTCAAGAACTCAATAAAGATTAT
GTAATTATTAAGATCAAATATCTTGGTAAAATTAATAAGATCATAAGTAAGCTTAAAGAT
GAAAAAATTGATTTAAAAATGATTGCAGGGCAATGGCAACTTAAAATTATCTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SFLNVEILLNKKSNLVEFSNRLNKIDLIDNFYVQELNKDYVIIKIKYLGKINKIISKLKD
EKIDLKMIAGQWQLKII*


No ORFs were found in reading frame 2.


>ORF number 1 in reading frame 3 on the reverse strand extends from base 225 to base 785.
AATTATCTAATGAGTCAATTAGTATTTAAATTTCCTTTTAAAACAAAATATTATGAACAA
GATTATTATGTTTCGAGTAATAATTTTTCTGCATATCAATTAATTGAGAGTTGGCCAAAT
TGGCCTGACAAATGGGTAAATATTTTTGGTCCAACAGGTTGTGGCAAAACTCATTTATCT
AATATTTTAAAAAAAAAAATTAATTCCGTTGAAATATTGAACGCTGAGAATATAACTGAT
GAGACAATATCAAAATTTGAAAAATTAAACTGTTTAATAATAGATAATTATGAAAAAAAT
ATAAATGAAAAAACTTTTTATTCGATATTAAATTCTTCCAAGCAATTAGATACCTATATA
GTTATAAACTCTTTTCTTCCAATAAAGGATATTAAATTTGATCTTAAAGATTTAAGATCA
AGAGCTAACAGTTTTATGAATCTAGGCATAGAATTGCCTACAGATGATTTATTAACAGTA
ATAATCTCTAAATTTTTTTCTGACAAACAAATAGAAATAAATCCGAAAATTTCAGAGTAT
ATTATTAAAAATACTGAACGA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
NYLMSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLS
NILKKKINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYI
VINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEY
IIKNTER


Sur le brin direct : 



No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 208.
CGTTCAGTATTTTTAATAATATACTCTGAAATTTTCGGATTTATTTCTATTTGTTTGTCA
GAAAAAAATTTAGAGATTATTACTGTTAATAAATCATCTGTAGGCAATTCTATGCCTAGA
TTCATAAAACTGTTAGCTCTTGATCTTAAATCTTTAAGATCAAATTTAATATCCTTTATT
GGAAGAAAAGAGTTTATAACTATATAG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
RSVFLIIYSEIFGFISICLSEKNLEIITVNKSSVGNSMPRFIKLLALDLKSLRSNLISFI
GRKEFITI*

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:

Phylogény.fr / Muscle / CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


ANALYSE DES RÉSULTATS:


Notre domaine protéique s'étend de la base 13 à la base 186 et on observe un nombre important d'homologies à ce niveau.

RÉSULTATS BRUTS:
CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Gammapro1       -------------------MSEQLSLNLNIKQSASISDF-SGPGWVSIIDVVRQMHVGLL
Alphapro20      ----------------MNGRETQLSLNFPYDPIFQFEDLVVTESNRMAFQLIDHWPNWSL
Alphapro4       -----------------MSAGVQLPLDLPWRPALGREHFLVAACNASAVALVEAWPHWPA
Alphapro6       ----------------MAETPRQLPLELPHEAALSRDDYLVGGSNRAAFELLERWPDWPS
Alphapro10      ------------MTAQRTDPPRQLPLDLGHGTGYSRDELVVSGTNNQAAALVDRWPDWPS
Alphapro12      MAAAAARSRVADVTAQRTDPPRQLPLDLGHGTGYSRDELVVSGTNSQAAALVDRWPDWPS
Alphapro16      ----------------MREAPRQIPLNLEHQPGYHREDMIVTGSNRAAVDLIDRWPNWLS
Alphapro22      ----------------MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLS
Alphapro14      -------------------MPRQLAFELGHRPAFGREDFLVAPPNEAAVALIDAWPDWPD
Alphapro8       --------------MAGRPPSRQLAFTLPHAESFSRDDFLEGPANAAALSLIESWPEWPN
Alphapro18      --------------MPMPTPPRQLALDLPHAESLSRDDYLEGPSNAQALALIDRWPDWTN
Alphapro2       -------------MDIKMKNLNQLLLDFNYEQNFKDDDFYVGKSNFYAFEMINKWPKWEK
ma_s_quenc      -----------------NYLMSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPD
Gammapro2       --------------------MQQLPLDIELHSDATFANFMVGE-NQLLLQKLEAICQGES
Betaprot1       --------------------MNQLILDFPAAPP-SFDTFLGQGNR----ELLQVLREQHE
Gammapro3       -------------------MAQQIPLHFAVDPLQTFEAYWAGPNAEAAEAARRSARGEGD
                                      *: : :                                

Gammapro1       TQLYLYGERDTGKTHLLNAICESF--RDIDQSV---------IYL-SLRELI--NANMDA                                                                                               
Alphapro20      PIAVLVGKEGSGKTHFSNIWLQKA-------DA---------FRI-QHNEI----DQAVT
Alphapro4       PAACIHGPTGAGKTHLAQVFATRA-------AA---------VVL-DPAVIL--GTDPLT
Alphapro6       PVVVLAGPVGAGKTHLVRAFQDET-------GA---------VVL-PAAELT--PHSVQT
Alphapro10      PVVVLAGPAGSGKTHLAAIWRARA-------NA---------VAV-DARRI---GDSIAG
Alphapro12      PVVVLAGPAGSGKTHLAAIWRAHA-------NA---------VAV-DAGRI---GDSIAN
Alphapro16      PVTILAGPTGSGKTHLAEIWRAGT-------GA---------LLV-DPTNIT--EEAVNG
Alphapro22      PVTILAGPTGAGKTHLAEIWRSGT-------DA---------LLL-DPSNIT--EEAVNS
Alphapro14      RVVALSGPEGSGKTHLAEVWRNAA-------GA---------VSL-APSALA--GADVPA
Alphapro8       RIMLLAGPEGCGKSHLAAIWAERA-------GA---------RSI-SAQGLT--AATVPM
Alphapro18      RVMMLVGPEGCGKSHLAAIWAAEA-------GA---------RIV-GAHALT--PQDVPG
Alphapro2       NFLNINGEKFSGKSHLVNIFLKKF-------NG---------IRI-DVNSLN--DENIKS
ma_s_quenc      KWVNIFGPTGCGKTHLSNILKKKI-------NS---------VEILNAENIT--DETISK
Gammapro2       DFIYIYSEQGHGRSHLLQALTHAY-------SEQNPDKLIAYLPL-ENSMLV--PQMLDG
Betaprot1       PFVYVWGPAGAGKSHLLQAWAAQA-------EA---------AGL-SARYLNAANEPLHE
Gammapro3       TLLYLWGDTGLGKTHLVNAACREAFHNGRSAAC---------LPL-ALIGEC--GPAVLE
                    : .    *.:*:                            :               

Gammapro1       MVLSSLENTTVIALDDMDAIQGHPEWQEAVFHLINLSQ-----EYGNKIIFASRLPVKAL
Alphapro20      M----ASLGRSFLIEDI-GAGEINE--TELFHLINSIKQANLDARQATLLMTARTLPSAW
Alphapro4       L----FEGGRAAVIEDA-DRAGLPE--ATLFHLLNAAR-----QRGGSLLLTALSPPARW
Alphapro6       L----VAAP-ACVIEDA--HLGIDN--TALFHLLNAAR-----QAGKTVLITSRTWPASW
Alphapro10      L----GARP--ALIDDV-DAGAVDE--QGLFHLINAVR-----GAGSTLLLTARRFPSAW
Alphapro12      L----GARP--ALIDDV-DAGAVDE--QGLFHLINAVR-----GAGSTLLLTARRFPAAW
Alphapro16      A----AEYP--VLIDDI-GAAPFDE--TGLFHLINSVRQNAAQGLGPSLLMTSRLWPANW
Alphapro22      A----AERP--VLIDNI-GAEAFDE--TGLFHLINSVRQHAAQGPGPSLLMTSRLWPANW
Alphapro14      L----VAAR-TIILEDLAAPDAAAE--RALFHLVNLVR-----EEGAFLLITARVPLSRL
Alphapro8       A----LTTG-ALVVEDL-NPKTFDE--LALFHLMNLAR-----EEAAFVLMTARVTPAAI
Alphapro18      A----LATG-ALVVEHL-EPGYFDE--RAVFHLLNLAR-----ETNAFVLMTARAAPASF
Alphapro2       I----KPYQ-NIVLEDL--NLNINE--KLIYSLFNIID-----QDNKFLIVTSMKPISEI
ma_s_quenc      F----EKLN-CLIIDNY--EKNINE--KTFYSILNSSK-----QLDTYIVINSFLPIKDI
Gammapro2       L----VAFD-CVSLDGIEKVIADKEWQTAIFNLYNQLK-----EQGKSFLITGLNAPSQL
Betaprot1       M----PPAGCHLALDQIDSLDADGQ--AELFNFCNHIRQ----SRQGALLIGASVPPPRL
Gammapro3       G----MENQNLVCLDDIDTIAGRDDWERQLFGLFNAMR-----DAGNTLLITATAPPAEL
                             ::         :    .: : *             .:. .       

Gammapro1       NFELRDLLSRLARAATFQLPTGSDRLDRQLILESVLRRRHWHFDPRIIDYLLNEGPHRIG
Alphapro20      NLKLNDLKSRLNSVMFVEINQPDDALLTAVAFK-LFSDRQLIVHPDTVYYLVSRCERSLF
Alphapro4       GVHLADLRSRLAALPAEGLCEPDDELMAAVLLK-LFSDRGLDVAPGAIGYLLPRMERSFA
Alphapro6       KISLADLQSRLRAATPVEILEPDDDLLRRVLVK-LFADRQIAVDQGVVDYLVVRMERSLE
Alphapro10      GVSLPDLASRLKAAATVEIHEPDDLLLAGVITK-LFADRQVEVEPHVVQYLVRRIERSLA
Alphapro12      GVSLPDLASRLKAAATVEIHEPDDLLLAGVITK-LFADRQVEVEPHVVQYLVRRIERSLA
Alphapro16      NVKLPDLASRLKAATVVEISEPDDLLLSGVIHK-LFADRQVSVEPHVVAYLVSRIERSLL
Alphapro22      NVKLPDLASRLKAATVVEIAEPDDMLLSGVIHK-LFADRQVSVEPHVVSYLVSRMERSLL
Alphapro14      PLALPDLASRLKAVPQAELGPPDDALLAGILVK-LFDDRQLRVAPAVIAWLAARIERSVR
Alphapro8       EIGLRDLRSRLRAVPVVTLMPPDDHLLRALIVK-FSADRQMNIDEAIVSFIATRTERSVA
Alphapro18      EVELRDAGSRLRAIPVVSVEPPDDQLLRALLVK-FCADRQMAVDESVVSYLATRIERSFA
Alphapro2       NFELEDLRSRTKNCLFANIQNPDDELMFALILK-NLSDRQITLDKKLINFIIKRIERSYG
ma_s_quenc      KFDLKDLRSRANSFMNLGIELPTDDLLTVIISK-FFSDKQIEINPKISEYIIKNTER---
Gammapro2       ALELKDLKSRLSAMFIYNIKPLNDEEKLILLQR-KAEEKGLELSNEVAHYLLARQQRDLP
Betaprot1       AVR-EDLRTRMGYCLVYEIKPLSDEEKIAALVE-AARRRQIRISPDIFRYLLHHWRRDIG
Gammapro3       PVALPDLKTRLAWGLVLRLHPLTDEHKLAALER-RAGMLGLDLSPRVGRFLLSHCRRDMA
                 .   *  :*        :    *                  .      ::     .   

Gammapro1       AMLAILNELQPLFSNMERTPLNKVSKAKIQDAMNIIDNLTLNFELADFDEIAENENFLDF
Alphapro20      SLKRVIDSVDQLALQRKR----KITRAIIAEVLNRRNP----------------------
Alphapro4       AARDLVVHADALALREGR----AVTVPLLRQLLATPDRADR-------------------
Alphapro6       VAMRAVEAIDQEALAGRV----KITKPLAGRVLENVHKGQ--------------------
Alphapro10      TAMRVVERLDRTALERKM----PITRALAAETVSAMDEGQREFEI---------------
Alphapro12      TAMRVVERLDRIALERKM----PITRALAAETVSVMDEGQGEFEI---------------
Alphapro16      SAIQIVDKLDRAALEQKS----RITRTLAAQVLAGSEQPER-------------------
Alphapro22      SAIQIVDRLDRAALEQKS----RITRALAAQILADMGQAG--------------------
Alphapro14      AARDAVAELDRASLSGKR----PITVPLAAEILGTQDEMKF-------------------
Alphapro8       AARLAVEQLDAESLRLGR----PVTRALAAELLRNHD-----------------------
Alphapro18      AARDAVEQLDAEALRLRR----PVTRALAAALFRGQGVLPL-------------------
Alphapro2       KIFEFIYKIDKISLKKKK----SIDFKIINEALEE-------------------------
ma_s_quenc      ------------------------------------------------------------
Gammapro2       TLLGILDKLDQASLQAKR----KLTIPFIKEVLGL-------------------------
Betaprot1       SLMAMLDALDRHALASHR----PITLPLLKQLLQQDI-----------------------
Gammapro3       SLQALLEELDHASLAAKR----RLTVPFIKGYLEDIA

Protein Domains

PROTOCOLE:

Interpro / Translation CRC64: CA2FE50F1D2598EC LENGTH: 187 aa.


ANALYSE DES RÉSULTATS:

Nous avons trouvé un domaine protéique, ou plutôt une famille protéique correspondant à la famille des bactéries DNA A.

RÉSULTATS BRUTS:
Translation	CA2FE50F1D2598EC	187	HMMPfam	PF00308	Bac_DnaA	13	186	0.00083	T	20-Oct-2009	IPR013317	Chromosomal replication control, initiator (DnaA)/regulator (Hda)	
Translation	CA2FE50F1D2598EC	187	Gene3D	G3DSA:3.40.50.300	no description	10	152	4e-08	T	20-Oct-2009	NULL	NULL	
Translation	CA2FE50F1D2598EC	187	superfamily	SSF52540	P-loop containing nucleoside triphosphate hydrolases	11	185	1.6e-11	T	20-Oct-2009	NULL	NULL	

Phylogeny

PROTOCOLE:


Phylogény.fr / A la carte / Alignement Muscle / Phylogeny Bio NJ ou Phy ML / Tree Rendering

TreeDyn.



ANALYSE DES RÉSULTATS :

Dans les deux arbres, notre séquence est entourée d'alphaprotéobactéries, notre groupe étude est bien distinct du groupe extérieur, on peut emettre l'hypothese que notre séquence provient d'une alphaprotéobactérie, plus précisément d'une Candidatus Pelagibacter ubique.

RÉSULTATS BRUTS:                                                                                                    -------0.5-----
 fait avec Phyl
 +----------------------------------------------Gammapro1_gi_257455388_ref_ZP_05620623.1_regulatory_inactivation
 |
 |                          +---------------------------Gammapro2_gi_256822898_ref_YP_003146861.1_DnaA_regulatory_inacti
 |                +---------+
 |                |         +-------------------Gammapro3_gi_53803270_ref_YP_114933.1_DnaA_domain-containing_pro
 |    +-----------+
 |    |           |
 |    |           +----------Betaprot1_gi_225023936_ref_ZP_03713128.1_hypothetical_protein_EI
 |    |
 +----+                           +------------------Alphapro2_gi_91762153_ref_ZP_01264118.1_probable_ATPase_involved
      |                +----------+
      |                |          +-----------------ma_s_quence
      |                |
      +----------------+  +---------------Alphapro4_gi_83593498_ref_YP_427250.1_regulatory_inactivation_of
                       |  |
                       |  |          +--------Alphapro14_gi_154253765_ref_YP_001414589.1_chromosomal_replicati
                       |  |          |
                       +--+      +---+
                          |      |   |       +-------Alphapro8_gi_75675787_ref_YP_318208.1_hypothetical_protein_Nwi_1
                          |      |   +-------+
                          |      |           +----Alphapro18_gi_209885461_ref_YP_002289318.1_chromosomal_replicati
                          +------+
                                 | +--------------Alphapro20_gi_240850719_ref_YP_002972119.1_hypothetical_protein
                                 | |
                                 +-+ +---------Alphapro6_gi_118590150_ref_ZP_01547553.1_hypothetical_protein_SI
                                   | |
                                   | |       +Alphapro10_gi_13476596_ref_NP_108166.1_hypothetical_protein_mlr7
                                   +-+   +---+
                                     |   |   |
                                     |   |   +Alphapro12_gi_260463359_ref_ZP_05811560.1_conserved_hypothetical
                                     +---+
                                         |   +Alphapro16_gi_153009901_ref_YP_001371116.1_hypothetical_protein
                                         +---+
                                             +--Alphapro22_gi_163842986_ref_YP_001627390.1_hypothetical_protein


fait avec BioNJ
                                                                                                         ----0.2--
 
 +---------------------------------------------Gammapro1_gi_257455388_ref_ZP_05620623.1_regulatory_inactivation
 |
 |                              +-----------Alphapro14_gi_154253765_ref_YP_001414589.1_chromosomal_replicati
 |                              |
 |                           +--+        +--------Alphapro8_gi_75675787_ref_YP_318208.1_hypothetical_protein_Nwi_1
 |                           |  +--------+
 |                           |           |
 |                           |           +-------Alphapro18_gi_209885461_ref_YP_002289318.1_chromosomal_replicati
 |                      +----+
 |                      |    | +-----------------Alphapro20_gi_240850719_ref_YP_002972119.1_hypothetical_protein
 |                      |    | |
 |                      |    +-+ +-----------Alphapro6_gi_118590150_ref_ZP_01547553.1_hypothetical_protein_SI
 |                      |      | |
 |                      |      | |       +Alphapro10_gi_13476596_ref_NP_108166.1_hypothetical_protein_mlr7
 |                      |      +-+  +----+
 |                +-----+        |  |    +Alphapro12_gi_260463359_ref_ZP_05811560.1_conserved_hypothetical
 |                |     |        +--+
 |                |     |           |
 |                |     |           |    +-Alphapro16_gi_153009901_ref_YP_001371116.1_hypothetical_protein
 |                |     |           +----+
 |    +-----------+     |                +-Alphapro22_gi_163842986_ref_YP_001627390.1_hypothetical_protein
 |    |           |     |
 |    |           |     +-----------------Alphapro4_gi_83593498_ref_YP_427250.1_regulatory_inactivation_of
 |    |           |
 |    |           |     +---------------------------Alphapro2_gi_91762153_ref_ZP_01264118.1_probable_ATPase_involved
 +----+           +-----+
      |                 +---------------------ma_s_quence
      |
      |
      |             +-------------------------------Gammapro2_gi_256822898_ref_YP_003146861.1_DnaA_regulatory_inacti
      +-------------+
                    |     +------------------Betaprot1_gi_225023936_ref_ZP_03713128.1_hypothetical_protein_EI
                    +-----+
                          +-----------------------------Gammapro3_gi_53803270_ref_YP_114933.1_DnaA_domain-containing_pro

Taxonomy report

PROTOCOLE:

NCBI / blast p / taxonomy report / >GOS_1086010 Traduction [225-785 sens indirect]


ANALYSE DES RÉSULTATS:


On observe une majorité de alpha protéos bactéries avec des scores élevés, ce sera donc notre groupe d'étude. Nous prendrons les gamma et béta bactéries comme groupe extérieur.




RÉSULTATS BRUTS:

séquences choisies comme groupe d'étude et groupe extérieur:

>Alphapro2 gi|91762153|ref|ZP_01264118.1| probable ATPase involved in DNA replication initiation [Candidatus Pelagibacter ubique HTCC1002] >gi|91717955|gb|EAS84605.1| probable ATPase involved in DNA replication initiation [Candidatus Pelagibacter ubique HTCC1002]
MDIKMKNLNQLLLDFNYEQNFKDDDFYVGKSNFYAFEMINKWPKWEKNFLNINGEKFSGKSHLVNIFLKKFNGIRIDVNS
LNDENIKSIKPYQNIVLEDLNLNINEKLIYSLFNIIDQDNKFLIVTSMKPISEINFELEDLRSRTKNCLFANIQNPDDEL
MFALILKNLSDRQITLDKKLINFIIKRIERSYGKIFEFIYKIDKISLKKKKSIDFKIINEALEE

>Alphapro4 gi|83593498|ref|YP_427250.1| regulatory inactivation of DnaA Hda protein [Rhodospirillum rubrum ATCC 11170] >gi|83576412|gb|ABC22963.1| regulatory inactivation of DnaA Hda protein [Rhodospirillum rubrum ATCC 11170]
MSAGVQLPLDLPWRPALGREHFLVAACNASAVALVEAWPHWPAPAACIHGPTGAGKTHLAQVFATRAAAVVLDPAVILGT
DPLTLFEGGRAAVIEDADRAGLPEATLFHLLNAARQRGGSLLLTALSPPARWGVHLADLRSRLAALPAEGLCEPDDELMA
AVLLKLFSDRGLDVAPGAIGYLLPRMERSFAAARDLVVHADALALREGRAVTVPLLRQLLATPDRADR

>Alphapro6 gi|118590150|ref|ZP_01547553.1| hypothetical protein SIAM614_11568 [Stappia aggregata IAM 12614] >gi|118437122|gb|EAV43760.1| hypothetical protein SIAM614_11568 [Stappia aggregata IAM 12614]
MAETPRQLPLELPHEAALSRDDYLVGGSNRAAFELLERWPDWPSPVVVLAGPVGAGKTHLVRAFQDETGAVVLPAAELTP
HSVQTLVAAPACVIEDAHLGIDNTALFHLLNAARQAGKTVLITSRTWPASWKISLADLQSRLRAATPVEILEPDDDLLRR
VLVKLFADRQIAVDQGVVDYLVVRMERSLEVAMRAVEAIDQEALAGRVKITKPLAGRVLENVHKGQ

>Alphapro8 gi|75675787|ref|YP_318208.1| hypothetical protein Nwi_1595 [Nitrobacter winogradskyi Nb-255] >gi|74420657|gb|ABA04856.1| regulatory inactivation of DnaA Hda protein [Nitrobacter winogradskyi Nb-255]
MAGRPPSRQLAFTLPHAESFSRDDFLEGPANAAALSLIESWPEWPNRIMLLAGPEGCGKSHLAAIWAERAGARSISAQGL
TAATVPMALTTGALVVEDLNPKTFDELALFHLMNLAREEAAFVLMTARVTPAAIEIGLRDLRSRLRAVPVVTLMPPDDHL
LRALIVKFSADRQMNIDEAIVSFIATRTERSVAAARLAVEQLDAESLRLGRPVTRALAAELLRNHD

>Alphapro10 gi|13476596|ref|NP_108166.1| hypothetical protein mlr7968 [Mesorhizobium loti MAFF303099] >gi|14027358|dbj|BAB53627.1| mlr7968 [Mesorhizobium loti MAFF303099]
MTAQRTDPPRQLPLDLGHGTGYSRDELVVSGTNNQAAALVDRWPDWPSPVVVLAGPAGSGKTHLAAIWRARANAVAVDAR
RIGDSIAGLGARPALIDDVDAGAVDEQGLFHLINAVRGAGSTLLLTARRFPSAWGVSLPDLASRLKAAATVEIHEPDDLL
LAGVITKLFADRQVEVEPHVVQYLVRRIERSLATAMRVVERLDRTALERKMPITRALAAETVSAMDEGQREFEI

>Alphapro12 gi|260463359|ref|ZP_05811560.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] >gi|259030949|gb|EEW32224.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075]
MAAAAARSRVADVTAQRTDPPRQLPLDLGHGTGYSRDELVVSGTNSQAAALVDRWPDWPSPVVVLAGPAGSGKTHLAAIW
RAHANAVAVDAGRIGDSIANLGARPALIDDVDAGAVDEQGLFHLINAVRGAGSTLLLTARRFPAAWGVSLPDLASRLKAA
ATVEIHEPDDLLLAGVITKLFADRQVEVEPHVVQYLVRRIERSLATAMRVVERLDRIALERKMPITRALAAETVSVMDEG
QGEFEI

>Alphapro14 gi|154253765|ref|YP_001414589.1| chromosomal replication initiator DnaA [Parvibaculum lavamentivorans DS-1] >gi|154157715|gb|ABS64932.1| Chromosomal replication initiator DnaA [Parvibaculum lavamentivorans DS-1]
MPRQLAFELGHRPAFGREDFLVAPPNEAAVALIDAWPDWPDRVVALSGPEGSGKTHLAEVWRNAAGAVSLAPSALAGADV
PALVAARTIILEDLAAPDAAAERALFHLVNLVREEGAFLLITARVPLSRLPLALPDLASRLKAVPQAELGPPDDALLAGI
LVKLFDDRQLRVAPAVIAWLAARIERSVRAARDAVAELDRASLSGKRPITVPLAAEILGTQDEMKF

>Alphapro16 gi|153009901|ref|YP_001371116.1| hypothetical protein Oant_2574 [Ochrobactrum anthropi ATCC 49188] >gi|151561789|gb|ABS15287.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
MREAPRQIPLNLEHQPGYHREDMIVTGSNRAAVDLIDRWPNWLSPVTILAGPTGSGKTHLAEIWRAGTGALLVDPTNITE
EAVNGAAEYPVLIDDIGAAPFDETGLFHLINSVRQNAAQGLGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEISEPDD
LLLSGVIHKLFADRQVSVEPHVVAYLVSRIERSLLSAIQIVDKLDRAALEQKSRITRTLAAQVLAGSEQPER

>Alphapro18 gi|209885461|ref|YP_002289318.1| chromosomal replication initiator, DnaA [Oligotropha carboxidovorans OM5] >gi|209873657|gb|ACI93453.1| chromosomal replication initiator, DnaA [Oligotropha carboxidovorans OM5]
MPMPTPPRQLALDLPHAESLSRDDYLEGPSNAQALALIDRWPDWTNRVMMLVGPEGCGKSHLAAIWAAEAGARIVGAHAL
TPQDVPGALATGALVVEHLEPGYFDERAVFHLLNLARETNAFVLMTARAAPASFEVELRDAGSRLRAIPVVSVEPPDDQL
LRALLVKFCADRQMAVDESVVSYLATRIERSFAAARDAVEQLDAEALRLRRPVTRALAAALFRGQGVLPL

>Alphapro20 gi|240850719|ref|YP_002972119.1| hypothetical protein Bgr_11870 [Bartonella grahamii as4aup] >gi|240267842|gb|ACS51430.1| hypothetical protein Bgr_11870 [Bartonella grahamii as4aup]
MNGRETQLSLNFPYDPIFQFEDLVVTESNRMAFQLIDHWPNWSLPIAVLVGKEGSGKTHFSNIWLQKADAFRIQHNEIDQ
AVTMASLGRSFLIEDIGAGEINETELFHLINSIKQANLDARQATLLMTARTLPSAWNLKLNDLKSRLNSVMFVEINQPDD
ALLTAVAFKLFSDRQLIVHPDTVYYLVSRCERSLFSLKRVIDSVDQLALQRKRKITRAIIAEVLNRRNP

>Alphapro22 gi|163842986|ref|YP_001627390.1| hypothetical protein BSUIS_A0745 [Brucella suis ATCC 23445] >gi|163673709|gb|ABY37820.1| Hypothetical protein BSUIS_A0745 [Brucella suis ATCC 23445]
MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLLDPSNITE
EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHAAQGPGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD
MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG

>Gammapro1 gi|257455388|ref|ZP_05620623.1| regulatory inactivation of DnaA Hda protein [Enhydrobacter aerosaccus SK60] >gi|257447350|gb|EEV22358.1| regulatory inactivation of DnaA Hda protein [Enhydrobacter aerosaccus SK60]
MSEQLSLNLNIKQSASISDFSGPGWVSIIDVVRQMHVGLLTQLYLYGERDTGKTHLLNAICESFRDIDQSVIYLSLRELI
NANMDAMVLSSLENTTVIALDDMDAIQGHPEWQEAVFHLINLSQEYGNKIIFASRLPVKALNFELRDLLSRLARAATFQL
PTGSDRLDRQLILESVLRRRHWHFDPRIIDYLLNEGPHRIGAMLAILNELQPLFSNMERTPLNKVSKAKIQDAMNIIDNL
TLNFELADFDEIAENENFLDF

>Betaprot1 gi|225023936|ref|ZP_03713128.1| hypothetical protein EIKCOROL_00802 [Eikenella corrodens ATCC 23834] >gi|224942961|gb|EEG24170.1| hypothetical protein EIKCOROL_00802 [Eikenella corrodens ATCC 23834]
MNQLILDFPAAPPSFDTFLGQGNRELLQVLREQHEPFVYVWGPAGAGKSHLLQAWAAQAEAAGLSARYLNAANEPLHEMP
PAGCHLALDQIDSLDADGQAELFNFCNHIRQSRQGALLIGASVPPPRLAVREDLRTRMGYCLVYEIKPLSDEEKIAALVE
AARRRQIRISPDIFRYLLHHWRRDIGSLMAMLDALDRHALASHRPITLPLLKQLLQQDI

>Gammapro2 gi|256822898|ref|YP_003146861.1| DnaA regulatory inactivator Hda [Kangiella koreensis DSM 16069] >gi|256796437|gb|ACV27093.1| DnaA regulatory inactivator Hda [Kangiella koreensis DSM 16069]
MQQLPLDIELHSDATFANFMVGENQLLLQKLEAICQGESDFIYIYSEQGHGRSHLLQALTHAYSEQNPDKLIAYLPLENS
MLVPQMLDGLVAFDCVSLDGIEKVIADKEWQTAIFNLYNQLKEQGKSFLITGLNAPSQLALELKDLKSRLSAMFIYNIKP
LNDEEKLILLQRKAEEKGLELSNEVAHYLLARQQRDLPTLLGILDKLDQASLQAKRKLTIPFIKEVLGL

>Gammapro3 gi|53803270|ref|YP_114933.1| DnaA domain-containing protein [Methylococcus capsulatus str. Bath] >gi|53757031|gb|AAU91322.1| DnaA domain protein [Methylococcus capsulatus str. Bath]
MAQQIPLHFAVDPLQTFEAYWAGPNAEAAEAARRSARGEGDTLLYLWGDTGLGKTHLVNAACREAFHNGRSAACLPLALI
GECGPAVLEGMENQNLVCLDDIDTIAGRDDWERQLFGLFNAMRDAGNTLLITATAPPAELPVALPDLKTRLAWGLVLRLH
PLTDEHKLAALERRAGMLGLDLSPRVGRFLLSHCRRDMASLQALLEELDHASLAAKRRLTVPFIKGYLEDIA

>Gammapro4 gi|219871632|ref|YP_002476007.1| chromosomal replication initiator protein [Haemophilus parasuis SH0165] >gi|219691836|gb|ACL33059.1| chromosomal replication initiator protein [Haemophilus parasuis SH0165]
MSSLWSDCLTHLQAKVSPTDYSTWLRPLQASATSSELVLYAHNQFVATWVKDKFLGEIVTLARSLSKNEQLQVEMRVGIK
PAKQAVTSVTPTATPPQETQATALRSGLTETLTFDNFVQGKSNQLAKAVAQQVASNPGESHCNPFSLYGGTGLGKTHLLH
AIGNEILKQNPNARVVYIHSERFVQDMVKAIKANTIENFKKFYRSLDVLMIDDIQFFANKEATQEEFFHTFNSLFERSKQ
IIVTSDVFPKNIENIEERIRSRLSWGVNAAIEPPELETRVAILMKKAEERGIELSEDVAFFLGQKLRTNVRELEGALNRA
IAWSNFTSRQITIDAVREALKDLIASYDHLITIENIQKTVAEYYNIKMADLKSKSRTRSVARPRQMAMALAKELTNHSLP
EIGREFGGRDHTTVMHACKTINELRDTDNSIQEDYTNLTRKLSS










Lineage Report

root
. cellular organisms
. . Bacteria                       [bacteria]
. . . Proteobacteria                 [proteobacteria]
. . . . Alphaproteobacteria            [a-proteobacteria]
. . . . . Rickettsiales                  [a-proteobacteria]
. . . . . . Candidatus Pelagibacter ubique [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 -------------------------  126 1 hit  [a-proteobacteria]       probable ATPase involved in DNA replication initiation [Can
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 .........................  125 1 hit  [a-proteobacteria]       ATPase involved in DNA replication initiation [Candidatus P
. . . . . . Orientia tsutsugamushi str. Ikeda ---------------------------------   83 1 hit  [a-proteobacteria]       hypothetical protein OTT_1627 [Orientia tsutsugamushi str. 
. . . . . . Orientia tsutsugamushi str. Boryong ...............................   81 1 hit  [a-proteobacteria]       hypothetical protein OTBS_0856 [Orientia tsutsugamushi str.
. . . . . . Anaplasma marginale str. St. Maries ...............................   77 1 hit  [a-proteobacteria]       hypothetical protein AM296 [Anaplasma marginale str. St. Ma
. . . . . . Anaplasma marginale str. Florida ..................................   77 1 hit  [a-proteobacteria]       hypothetical protein AM296 [Anaplasma marginale str. St. Ma
. . . . . . Anaplasma marginale str. Puerto Rico ..............................   77 1 hit  [a-proteobacteria]       hypothetical protein AM296 [Anaplasma marginale str. St. Ma
. . . . . . Anaplasma marginale str. Virginia .................................   77 1 hit  [a-proteobacteria]       hypothetical protein AM296 [Anaplasma marginale str. St. Ma
. . . . . . Wolbachia endosymbiont strain TRS of Brugia malayi ................   77 1 hit  [a-proteobacteria]       DNA replication initiation ATPase [Wolbachia endosymbiont s
. . . . . . Anaplasma marginale str. Mississippi ..............................   76 1 hit  [a-proteobacteria]       hypothetical protein AmarM_01237 [Anaplasma marginale str. 
. . . . . . Ehrlichia chaffeensis str. Sapulpa ................................   74 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Ehrl
. . . . . . Ehrlichia chaffeensis str. Arkansas ...............................   74 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Ehrl
. . . . . . Ehrlichia ruminantium str. Welgevonden ............................   74 2 hits [a-proteobacteria]       hypothetical protein Erum1920 [Ehrlichia ruminantium str. W
. . . . . . Ehrlichia ruminantium str. Gardel .................................   73 1 hit  [a-proteobacteria]       hypothetical protein ERGA_CDS_01880 [Ehrlichia ruminantium 
. . . . . . Rickettsia rickettsii str. 'Sheila Smith' .........................   73 1 hit  [a-proteobacteria]       hypothetical protein A1G_05380 [Rickettsia rickettsii str. 
. . . . . . Rickettsia rickettsii str. Iowa ...................................   73 1 hit  [a-proteobacteria]       hypothetical protein A1G_05380 [Rickettsia rickettsii str. 
. . . . . . Ehrlichia canis str. Jake .........................................   73 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Ehrl
. . . . . . Rickettsia akari str. Hartford ....................................   73 1 hit  [a-proteobacteria]       hypothetical protein A1C_04965 [Rickettsia akari str. Hartf
. . . . . . Rickettsia felis URRWXCal2 ........................................   72 1 hit  [a-proteobacteria]       hypothetical protein RF_0400 [Rickettsia felis URRWXCal2]
. . . . . . Rickettsia peacockii str. Rustic ..................................   72 1 hit  [a-proteobacteria]       hypothetical protein RPR_07330 [Rickettsia peacockii str. R
. . . . . . Rickettsia sibirica 246 ...........................................   72 1 hit  [a-proteobacteria]       hypothetical protein [Rickettsia sibirica 246]
. . . . . . Rickettsia conorii str. Malish 7 ..................................   72 1 hit  [a-proteobacteria]       hypothetical protein RC0979 [Rickettsia conorii str. Malish
. . . . . . Rickettsia africae ESF-5 ..........................................   72 1 hit  [a-proteobacteria]       hypothetical protein RC0979 [Rickettsia conorii str. Malish
. . . . . . Rickettsia canadensis str. McKiel .................................   72 1 hit  [a-proteobacteria]       hypothetical protein A1E_01590 [Rickettsia canadensis str. 
. . . . . . Wolbachia endosymbiont of Drosophila melanogaster .................   72 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Wolbachia endosymbiont of Drosophila simulans .....................   72 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Wolbachia endosymbiont of Drosophila ananassae ....................   72 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 .   72 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Wolbachia sp. wRi .................................................   72 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Rickettsia prowazekii str. Madrid E ...............................   71 1 hit  [a-proteobacteria]       hypothetical protein RP631 [Rickettsia prowazekii str. Madr
. . . . . . Rickettsia endosymbiont of Ixodes scapularis ......................   70 1 hit  [a-proteobacteria]       chromosomal replication initiator protein DnaA [Rickettsia 
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ..............   69 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB ..............   69 1 hit  [a-proteobacteria]       chromosomal DNA replication initiator-related protein [Wolb
. . . . . . Rickettsia massiliae MTU5 .........................................   68 1 hit  [a-proteobacteria]       hypothetical protein RMA_1009 [Rickettsia massiliae MTU5]
. . . . . . Anaplasma phagocytophilum HZ ......................................   68 1 hit  [a-proteobacteria]       hypothetical protein APH_0994 [Anaplasma phagocytophilum HZ]
. . . . . . Rickettsia typhi str. Wilmington ..................................   66 1 hit  [a-proteobacteria]       hypothetical protein RT0622 [Rickettsia typhi str. Wilmingt
. . . . . . Rickettsia bellii RML369-C ........................................   57 1 hit  [a-proteobacteria]       hypothetical protein RBE_0536 [Rickettsia bellii RML369-C] 
. . . . . . Rickettsia bellii OSU 85-389 ......................................   57 1 hit  [a-proteobacteria]       hypothetical protein RBE_0536 [Rickettsia bellii RML369-C] 
. . . . . . Neorickettsia sennetsu str. Miyayama ..............................   56 1 hit  [a-proteobacteria]       hypothetical protein NSE_0190 [Neorickettsia sennetsu str. 
. . . . . Rhodospirillum rubrum ATCC 11170 ------------------------------------  124 1 hit  [a-proteobacteria]       regulatory inactivation of DnaA Hda protein [Rhodospirillum
. . . . . Labrenzia aggregata IAM 12614 .......................................  118 1 hit  [a-proteobacteria]       hypothetical protein SIAM614_11568 [Stappia aggregata IAM 1
. . . . . Labrenzia alexandrii DFL-11 .........................................  117 1 hit  [a-proteobacteria]       hypothetical protein SADFL11_5141 [Labrenzia alexandrii DFL
. . . . . Nitrobacter winogradskyi Nb-255 .....................................  117 1 hit  [a-proteobacteria]       hypothetical protein Nwi_1595 [Nitrobacter winogradskyi Nb-
. . . . . Hyphomicrobium denitrificans ATCC 51888 .............................  116 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Hyphomicrobium den
. . . . . Nitrobacter hamburgensis X14 ........................................  113 1 hit  [a-proteobacteria]       hypothetical protein Nham_2116 [Nitrobacter hamburgensis X1
. . . . . Mesorhizobium loti MAFF303099 .......................................  112 1 hit  [a-proteobacteria]       hypothetical protein mlr7968 [Mesorhizobium loti MAFF303099]
. . . . . Mesorhizobium opportunistum WSM2075 .................................  111 1 hit  [a-proteobacteria]       conserved hypothetical protein [Mesorhizobium opportunistum
. . . . . Nitrobacter sp. Nb-311A .............................................  110 1 hit  [a-proteobacteria]       hypothetical protein NB311A_18728 [Nitrobacter sp. Nb-311A]
. . . . . Methylobacterium sp. 4-46 ...........................................  110 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium sp
. . . . . Rhodopseudomonas palustris BisB18 ...................................  109 1 hit  [a-proteobacteria]       hypothetical protein RPC_2328 [Rhodopseudomonas palustris B
. . . . . Methylobacterium radiotolerans JCM 2831 .............................  109 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium ra
. . . . . Methylobacterium populi BJ001 .......................................  108 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium po
. . . . . Methylobacterium extorquens DM4 .....................................  108 1 hit  [a-proteobacteria]       hypothetical protein METDI2832 [Methylobacterium extorquens
. . . . . Methylobacterium extorquens PA1 .....................................  108 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium ex
. . . . . Methylobacterium extorquens AM1 .....................................  108 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium ex
. . . . . Methylobacterium chloromethanicum CM4 ...............................  108 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylobacterium ch
. . . . . Rhodopseudomonas palustris HaA2 .....................................  107 1 hit  [a-proteobacteria]       hypothetical protein RPB_2491 [Rhodopseudomonas palustris H
. . . . . Methylobacterium nodulans ORS 2060 ..................................  105 1 hit  [a-proteobacteria]       Chromosomal replication initiator DnaA [Methylobacterium no
. . . . . Parvibaculum lavamentivorans DS-1 ...................................  103 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Parvibaculum lavame
. . . . . Rhodopseudomonas palustris BisB5 ....................................  103 1 hit  [a-proteobacteria]       hypothetical protein RPD_2953 [Rhodopseudomonas palustris B
. . . . . Ochrobactrum anthropi ATCC 49188 ....................................  102 1 hit  [a-proteobacteria]       hypothetical protein Oant_2574 [Ochrobactrum anthropi ATCC 
. . . . . Bartonella tribocorum CIP 105476 ....................................  101 1 hit  [a-proteobacteria]       hypothetical protein Btr_1339 [Bartonella tribocorum CIP 10
. . . . . Rhodopseudomonas palustris BisA53 ...................................  101 1 hit  [a-proteobacteria]       hypothetical protein RPE_3282 [Rhodopseudomonas palustris B
. . . . . Oligotropha carboxidovorans OM5 .....................................  100 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Oligotropha carbox
. . . . . Bartonella grahamii as4aup ..........................................  100 1 hit  [a-proteobacteria]       hypothetical protein Bgr_11870 [Bartonella grahamii as4aup]
. . . . . Brucella suis ATCC 23445 ............................................  100 1 hit  [a-proteobacteria]       hypothetical protein BSUIS_A0745 [Brucella suis ATCC 23445]
. . . . . Agrobacterium vitis S4 ..............................................  100 1 hit  [a-proteobacteria]       hypothetical protein Avi_1578 [Agrobacterium vitis S4]
. . . . . Ochrobactrum intermedium LMG 3301 ...................................   99 1 hit  [a-proteobacteria]       Hypothetical protein, conserved [Ochrobactrum intermedium L
. . . . . Brucella melitensis bv. 3 str. Ether ................................   99 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 3 str. Eth
. . . . . Bartonella bacilliformis KC583 ......................................   99 1 hit  [a-proteobacteria]       hypothetical protein BARBAKC583_0767 [Bartonella bacillifor
. . . . . Rhodopseudomonas palustris TIE-1 ....................................   99 1 hit  [a-proteobacteria]       conserved hypothetical protein [Rhodopseudomonas palustris 
. . . . . Brucella suis 1330 ..................................................   98 1 hit  [a-proteobacteria]       hypothetical protein BR0714 [Brucella suis 1330]
. . . . . Brucella melitensis bv. 1 str. 16M ..................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella suis bv. 4 str. 40 .........................................   98 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella abortus bv. 3 str. Tulya ...................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella ceti M13/05/1 ..............................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella ceti B1/94 .................................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella pinnipedialis M163/99/10 ...................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella pinnipedialis B2/94 ........................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella ceti M644/93/1 .............................................   98 2 hits [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M
. . . . . Brucella ceti str. Cudo .............................................   98 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella ceti str. Cudo]
. . . . . Brucella ovis ATCC 25840 ............................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella canis ATCC 23365 ...........................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella melitensis ATCC 23457 ......................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella abortus bv. 6 str. 870 .....................................   98 2 hits [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella abortus bv. 2 str. 86/8/59 .................................   98 2 hits [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella suis bv. 3 str. 686 ........................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella sp. 83/13 ..................................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella abortus bv. 4 str. 292 .....................................   98 2 hits [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella pinnipedialis M292/94/1 ....................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella melitensis bv. 1 str. Rev.1 ................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella ceti M490/95/1 .............................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella abortus bv. 9 str. C68 .....................................   98 2 hits [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella melitensis bv. 2 str. 63/9 .................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella microti CCM 4915 ...........................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Brucella sp. F5/99 ..................................................   98 1 hit  [a-proteobacteria]       hypothetical protein BMEI1238 [Brucella melitensis 16M] >gi
. . . . . Rhodospirillum centenum SW ..........................................   97 1 hit  [a-proteobacteria]       hypothetical protein RC1_1547 [Rhodospirillum centenum SW]
. . . . . Brucella suis bv. 5 str. 513 ........................................   97 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella suis bv. 5 str. 513]
. . . . . Aurantimonas manganoxydans SI85-9A1 .................................   97 1 hit  [a-proteobacteria]       conserved hypothetical protein [Aurantimonas manganoxydans 
. . . . . Bradyrhizobium sp. BTAi1 ............................................   96 1 hit  [a-proteobacteria]       regulatory inactivation of DnaA Hda protein [Bradyrhizobium
. . . . . Rhodobacterales bacterium HTCC2255 ..................................   96 1 hit  [a-proteobacteria]       hypothetical protein OM2255_07405 [alpha proteobacterium HT
. . . . . Chelativorans sp. BNC1 ..............................................   96 1 hit  [a-proteobacteria]       hypothetical protein Meso_1963 [Mesorhizobium sp. BNC1]
. . . . . Brucella neotomae 5K33 ..............................................   96 2 hits [a-proteobacteria]       conserved hypothetical protein [Brucella neotomae 5K33]
. . . . . Sinorhizobium medicae WSM419 ........................................   96 1 hit  [a-proteobacteria]       hypothetical protein Smed_0794 [Sinorhizobium medicae WSM41
. . . . . Rhodobacter sphaeroides 2.4.1 .......................................   96 1 hit  [a-proteobacteria]       hypothetical protein RSP_0780 [Rhodobacter sphaeroides 2.4.
. . . . . Rhodobacter sphaeroides ATCC 17025 ..................................   96 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Rhodobacter sphaer
. . . . . Rhodobacter sphaeroides ATCC 17029 ..................................   95 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Rhodobacter sphaer
. . . . . Rhodobacter sphaeroides KD131 .......................................   95 1 hit  [a-proteobacteria]       Chromosomal replication initiator, DnaA [Rhodobacter sphaer
. . . . . Candidatus Liberibacter asiaticus str. psy62 ........................   95 1 hit  [a-proteobacteria]       hypothetical protein CLIBASIA_02270 [Candidatus Liberibacte
. . . . . Sinorhizobium meliloti 1021 .........................................   95 1 hit  [a-proteobacteria]       hypothetical protein SMc00617 [Sinorhizobium meliloti 1021]
. . . . . Pseudovibrio sp. JE062 ..............................................   95 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Pseudovibrio sp. JE062]
. . . . . Azorhizobium caulinodans ORS 571 ....................................   95 1 hit  [a-proteobacteria]       hypothetical protein AZC_0939 [Azorhizobium caulinodans ORS
. . . . . Rhodopseudomonas palustris CGA009 ...................................   93 1 hit  [a-proteobacteria]       hypothetical protein RPA3049 [Rhodopseudomonas palustris CG
. . . . . Rhizobium sp. NGR234 ................................................   93 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Rhizobium sp. NGR2
. . . . . Bradyrhizobium sp. ORS278 ...........................................   93 1 hit  [a-proteobacteria]       hypothetical protein BRADO3342 [Bradyrhizobium sp. ORS278]
. . . . . Roseobacter litoralis Och 149 .......................................   93 1 hit  [a-proteobacteria]       hypothetical protein RLO149_17493 [Roseobacter litoralis Oc
. . . . . Octadecabacter antarcticus 307 ......................................   93 1 hit  [a-proteobacteria]       chromosomal replication initiator protein DnaA [Octadecabac
. . . . . Roseobacter denitrificans OCh 114 ...................................   93 1 hit  [a-proteobacteria]       hypothetical protein RD1_2043 [Roseobacter denitrificans OC
. . . . . Thalassiobium sp. R2A62 .............................................   92 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Thalassiobium sp. 
. . . . . Roseovarius sp. TM1035 ..............................................   92 1 hit  [a-proteobacteria]       Chromosomal replication initiator, DnaA [Roseovarius sp. TM
. . . . . Bartonella henselae str. Houston-1 ..................................   92 1 hit  [a-proteobacteria]       hypothetical protein BH09540 [Bartonella henselae str. Hous
. . . . . Bartonella quintana str. Toulouse ...................................   92 1 hit  [a-proteobacteria]       hypothetical protein BQ07360 [Bartonella quintana str. Toul
. . . . . Brucella abortus str. 2308 A ........................................   92 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella abortus str. 2308 A] >gi|
. . . . . Brucella melitensis biovar Abortus 2308 .............................   92 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis biovar Abortus
. . . . . Brucella abortus S19 ................................................   92 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis biovar Abortus
. . . . . Brucella abortus NCTC 8038 ..........................................   92 1 hit  [a-proteobacteria]       ATP/GTP-binding protein [Brucella melitensis biovar Abortus
. . . . . Roseobacter sp. CCS2 ................................................   92 1 hit  [a-proteobacteria]       hypothetical protein RCCS2_14724 [Roseobacter sp. CCS2]
. . . . . Jannaschia sp. CCS1 .................................................   91 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Jannaschia sp. CCS
. . . . . alpha proteobacterium BAL199 ........................................   91 1 hit  [a-proteobacteria]       hypothetical protein BAL199_23699 [alpha proteobacterium BA
. . . . . Gluconacetobacter diazotrophicus PAl 5 ..............................   90 2 hits [a-proteobacteria]       putative DNA replication [Gluconacetobacter diazotrophicus 
. . . . . Agrobacterium tumefaciens str. C58 ..................................   90 1 hit  [a-proteobacteria]       hypothetical protein Atu1143 [Agrobacterium tumefaciens str
. . . . . Sagittula stellata E-37 .............................................   90 1 hit  [a-proteobacteria]       hypothetical protein SSE37_08803 [Sagittula stellata E-37]
. . . . . Octadecabacter antarcticus 238 ......................................   90 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Octadecabacter ant
. . . . . Ruegeria sp. TM1040 .................................................   89 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Silicibacter sp. T
. . . . . Roseovarius sp. 217 .................................................   88 1 hit  [a-proteobacteria]       hypothetical protein ROS217_23637 [Roseovarius sp. 217]
. . . . . Bradyrhizobium japonicum USDA 110 ...................................   87 1 hit  [a-proteobacteria]       hypothetical protein bll4123 [Bradyrhizobium japonicum USDA
. . . . . Agrobacterium radiobacter K84 .......................................   87 1 hit  [a-proteobacteria]       DNA replication initiation ATPase protein [Agrobacterium ra
. . . . . Rhodobacterales bacterium HTCC2150 ..................................   87 1 hit  [a-proteobacteria]       hypothetical protein RB2150_05703 [Rhodobacterales bacteriu
. . . . . Beijerinckia indica subsp. indica ATCC 9039 .........................   87 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Beijerinckia indica
. . . . . Silicibacter sp. TrichCH4B ..........................................   86 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Silicibacter sp. T
. . . . . Citreicella sp. SE45 ................................................   86 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Citreicella sp. SE
. . . . . Silicibacter lacuscaerulensis ITI-1157 ..............................   85 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Silicibacter lacus
. . . . . Roseobacter sp. GAI101 ..............................................   85 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Roseobacter sp. GA
. . . . . Rhizobium etli CIAT 652 .............................................   85 1 hit  [a-proteobacteria]       hypothetical protein RHECIAT_CH0001558 [Rhizobium etli CIAT
. . . . . Rhizobium etli Kim 5 ................................................   85 1 hit  [a-proteobacteria]       hypothetical protein RetlK5_25345 [Rhizobium etli Kim 5]
. . . . . Oceanicola batsensis HTCC2597 .......................................   84 1 hit  [a-proteobacteria]       hypothetical protein OB2597_15345 [Oceanicola batsensis HTC
. . . . . Roseobacter sp. SK209-2-6 ...........................................   84 1 hit  [a-proteobacteria]       hypothetical protein RSK20926_22364 [Roseobacter sp. SK209-
. . . . . Rhizobium etli GR56 .................................................   84 1 hit  [a-proteobacteria]       hypothetical protein RetlG_30801 [Rhizobium etli GR56]
. . . . . Roseobacter sp. AzwK-3b .............................................   82 1 hit  [a-proteobacteria]       prolyl-tRNA synthetase [Roseobacter sp. AzwK-3b]
. . . . . Methylocella silvestris BL2 .........................................   82 1 hit  [a-proteobacteria]       chromosomal replication initiator DnaA [Methylocella silves
. . . . . Fulvimarina pelagi HTCC2506 .........................................   82 1 hit  [a-proteobacteria]       hypothetical protein FP2506_07946 [Fulvimarina pelagi HTCC2
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ........................   82 1 hit  [a-proteobacteria]       hypothetical protein Rleg_1243 [Rhizobium leguminosarum bv.
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ........................   82 1 hit  [a-proteobacteria]       hypothetical protein Rleg2_1097 [Rhizobium leguminosarum bv
. . . . . Rhizobium etli CFN 42 ...............................................   82 1 hit  [a-proteobacteria]       hypothetical protein RHE_CH01490 [Rhizobium etli CFN 42]
. . . . . Xanthobacter autotrophicus Py2 ......................................   82 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Xanthobacter autot
. . . . . Rhizobium leguminosarum bv. viciae 3841 .............................   81 1 hit  [a-proteobacteria]       hypothetical protein RL1598 [Rhizobium leguminosarum bv. vi
. . . . . Rhodobacter sp. SW2 .................................................   81 1 hit  [a-proteobacteria]       conserved hypothetical protein [Rhodobacter sp. SW2]
. . . . . Roseovarius nubinhibens ISM .........................................   81 1 hit  [a-proteobacteria]       hypothetical protein ISM_00520 [Roseovarius nubinhibens ISM]
. . . . . Roseobacter sp. MED193 ..............................................   81 1 hit  [a-proteobacteria]       hypothetical protein MED193_21806 [Roseobacter sp. MED193]
. . . . . Rhodobacterales bacterium HTCC2654 ..................................   80 1 hit  [a-proteobacteria]       hypothetical protein RB2654_08417 [Rhodobacterales bacteriu
. . . . . Rhodobacterales bacterium Y4I .......................................   80 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Rhodobacterales ba
. . . . . Sulfitobacter sp. NAS-14.1 ..........................................   80 1 hit  [a-proteobacteria]       hypothetical protein NAS141_17079 [Sulfitobacter sp. NAS-14
. . . . . Sulfitobacter sp. EE-36 .............................................   80 1 hit  [a-proteobacteria]       hypothetical protein EE36_11853 [Sulfitobacter sp. EE-36]
. . . . . Phenylobacterium zucineum HLK1 ......................................   80 1 hit  [a-proteobacteria]       DnaA-related protein [Phenylobacterium zucineum HLK1]
. . . . . Ruegeria pomeroyi DSS-3 .............................................   80 1 hit  [a-proteobacteria]       hypothetical protein SPO1118 [Ruegeria pomeroyi DSS-3]
. . . . . Rhodobacterales bacterium HTCC2083 ..................................   79 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Rhodobacterales ba
. . . . . Loktanella vestfoldensis SKA53 ......................................   78 1 hit  [a-proteobacteria]       hypothetical protein SKA53_01706 [Loktanella vestfoldensis 
. . . . . Oceanicola granulosus HTCC2516 ......................................   78 1 hit  [a-proteobacteria]       hypothetical protein OG2516_02718 [Oceanicola granulosus HT
. . . . . Roseovarius sp. HTCC2601 ............................................   78 1 hit  [a-proteobacteria]       hypothetical protein R2601_19280 [Roseovarius sp. HTCC2601]
. . . . . Magnetospirillum magnetotacticum MS-1 ...............................   77 1 hit  [a-proteobacteria]       COG0593: ATPase involved in DNA replication initiation [Mag
. . . . . Paracoccus denitrificans PD1222 .....................................   77 1 hit  [a-proteobacteria]       hypothetical protein Pden_1301 [Paracoccus denitrificans PD
. . . . . Oceanicaulis alexandrii HTCC2633 ....................................   75 1 hit  [a-proteobacteria]       hypothetical protein OA2633_01079 [Oceanicaulis alexandrii 
. . . . . Hoeflea phototrophica DFL-43 ........................................   75 1 hit  [a-proteobacteria]       hypothetical protein HPDFL43_05395 [Hoeflea phototrophica D
. . . . . Dinoroseobacter shibae DFL 12 .......................................   73 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Dinoroseobacter sh
. . . . . Brevundimonas sp. BAL3 ..............................................   72 1 hit  [a-proteobacteria]       chromosomal replication initiator protein DnaA [Brevundimon
. . . . . Ruegeria sp. R11 ....................................................   71 1 hit  [a-proteobacteria]       chromosomal replication initiator, DnaA [Ruegeria sp. R11]
. . . . . Maricaulis maris MCS10 ..............................................   71 1 hit  [a-proteobacteria]       regulatory inactivation of DnaA Hda protein [Maricaulis mar
. . . . . Granulibacter bethesdensis CGDNIH1 ..................................   70 1 hit  [a-proteobacteria]       dnaA-related protein [Granulibacter bethesdensis CGDNIH1]
. . . . . Caulobacter sp. K31 .................................................   70 1 hit  [a-proteobacteria]       DnaA-related protein [Caulobacter sp. K31]
. . . . . Phaeobacter gallaeciensis BS107 .....................................   68 1 hit  [a-proteobacteria]       Chromosomal replication initiator, DnaA [Phaeobacter gallae
. . . . . Phaeobacter gallaeciensis 2.10 ......................................   68 1 hit  [a-proteobacteria]       hypothetical protein RG210_13706 [Phaeobacter gallaeciensis
. . . . . Caulobacter crescentus CB15 .........................................   67 1 hit  [a-proteobacteria]       DnaA-related protein [Caulobacter crescentus CB15] >gi|2212
. . . . . Caulobacter crescentus NA1000 .......................................   67 1 hit  [a-proteobacteria]       DnaA-related protein [Caulobacter crescentus CB15] >gi|2212
. . . . . Magnetospirillum magneticum AMB-1 ...................................   65 1 hit  [a-proteobacteria]       ATPase involved in DNA replication initiation [Magnetospiri
. . . . . Sphingomonas wittichii RW1 ..........................................   65 1 hit  [a-proteobacteria]       ATPase involved in DNA replication initiation [Sphingomonas
. . . . . Oceanibulbus indolifex HEL-45 .......................................   62 1 hit  [a-proteobacteria]       hypothetical protein OIHEL45_10313 [Oceanibulbus indolifex 
. . . . . Gluconobacter oxydans 621H ..........................................   62 1 hit  [a-proteobacteria]       DnaA-related protein [Gluconobacter oxydans 621H]
. . . . . Rhizobium etli 8C-3 .................................................   60 1 hit  [a-proteobacteria]       hypothetical protein Retl8_04315 [Rhizobium etli 8C-3]
. . . . . Acetobacter pasteurianus IFO 3283-01 ................................   57 1 hit  [a-proteobacteria]       chromosomal replication initiator protein DnaA-related prot
. . . . . Sphingopyxis alaskensis RB2256 ......................................   53 1 hit  [a-proteobacteria]       ATPase involved in DNA replication initiation [Sphingopyxis
. . . . . Sphingomonas sp. SKA58 ..............................................   52 1 hit  [a-proteobacteria]       ATPase [Sphingomonas sp. SKA58]
. . . . . Asticcacaulis excentricus CB 48 .....................................   52 1 hit  [a-proteobacteria]       Chromosomal replication initiator DnaA [Asticcacaulis excen
. . . . . Zymomonas mobilis subsp. mobilis ZM4 ................................   50 1 hit  [a-proteobacteria]       ATPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|241761267
. . . . . Zymomonas mobilis subsp. mobilis ATCC 10988 .........................   50 1 hit  [a-proteobacteria]       ATPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|241761267
. . . . . Zymomonas mobilis subsp. mobilis NCIB 11163 .........................   50 1 hit  [a-proteobacteria]       ATPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|241761267
. . . . . Acidiphilium cryptum JF-5 ...........................................   46 1 hit  [a-proteobacteria]       ATPase involved in DNA replication initiation-like protein 
. . . . . Hirschia baltica ATCC 49814 .........................................   38 1 hit  [a-proteobacteria]       ATPase-like protein involved in DNA replication initiation 
. . . . Geobacter metallireducens GS-15 ---------------------------------------   55 1 hit  [d-proteobacteria]       regulatory inactivation of DnaA Hda protein [Geobacter meta
. . . . Geobacter bemidjiensis Bem ............................................   53 2 hits [d-proteobacteria]       Chromosomal replication initiator DnaA [Geobacter bemidjien
. . . . Geobacter sp. FRC-32 ..................................................   49 1 hit  [d-proteobacteria]       Chromosomal replication initiator DnaA [Geobacter sp. FRC-3
. . . . Geobacter sp. M21 .....................................................   48 2 hits [d-proteobacteria]       Chromosomal replication initiator DnaA [Geobacter sp. M21]
. . . . Geobacter uraniireducens Rf4 ..........................................   45 1 hit  [d-proteobacteria]       chromosomal replication initiator, DnaA [Geobacter uraniire
. . . . Enhydrobacter aerosaccus SK60 .........................................   45 1 hit  [g-proteobacteria]       regulatory inactivation of DnaA Hda protein [Enhydrobacter 
. . . . Eikenella corrodens ATCC 23834 ........................................   44 1 hit  [b-proteobacteria]       hypothetical protein EIKCOROL_00802 [Eikenella corrodens AT
. . . . Nitrosococcus oceani ATCC 19707 .......................................   43 1 hit  [g-proteobacteria]       chromosomal replication initiator protein DnaA [Nitrosococc
. . . . Nitrosococcus oceani AFC27 ............................................   43 1 hit  [g-proteobacteria]       chromosomal replication initiator protein DnaA [Nitrosococc
. . . . Geobacter sp. M18 .....................................................   43 2 hits [d-proteobacteria]       Chromosomal replication initiator DnaA [Geobacter sp. M18]
. . . . Kangiella koreensis DSM 16069 .........................................   43 1 hit  [g-proteobacteria]       DnaA regulatory inactivator Hda [Kangiella koreensis DSM 16
. . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) .....................   43 1 hit  [enterobacteria]         chromosomal replication initiator protein DnaA [Buchnera ap
. . . . Pelobacter propionicus DSM 2379 .......................................   43 1 hit  [d-proteobacteria]       chromosomal replication initiator, DnaA [Pelobacter propion
. . . . Campylobacter gracilis RM3268 .........................................   42 1 hit  [e-proteobacteria]       chromosomal replication initiator protein DnaA [Campylobact
. . . . Methylococcus capsulatus str. Bath ....................................   42 1 hit  [g-proteobacteria]       DnaA domain-containing protein [Methylococcus capsulatus st
. . . . Haemophilus parasuis SH0165 ...........................................   42 1 hit  [g-proteobacteria]       chromosomal replication initiator protein [Haemophilus para
. . . . gamma proteobacterium NOR51-B .........................................   42 1 hit  [g-proteobacteria]       DnaA regulatory inactivator Hda [gamma proteobacterium NOR5
. . . . Haemophilus parasuis 29755 ............................................   42 1 hit  [g-proteobacteria]       DNA polymerase III subunit beta [Haemophilus parasuis 29755]
. . . . Caminibacter mediatlanticus TB-2 ......................................   41 1 hit  [e-proteobacteria]       chromosomal replication initiation protein [Caminibacter me
. . . . Geobacter lovleyi SZ ..................................................   41 1 hit  [d-proteobacteria]       Chromosomal replication initiator DnaA [Geobacter lovleyi S
. . . . Nautilia profundicola AmH .............................................   41 1 hit  [e-proteobacteria]       chromosomal replication initiator protein DnaA [Nautilia pr
. . . . Geobacter sulfurreducens PCA ..........................................   41 2 hits [d-proteobacteria]       chromosomal replication initiator protein DnaA, truncation 
. . . . Neisseria cinerea ATCC 14685 ..........................................   41 1 hit  [b-proteobacteria]       DnaA regulatory inactivator Hda [Neisseria cinerea ATCC 146
. . . . Aliivibrio salmonicida LFI1238 ........................................   41 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Aliivibrio salm
. . . . Anaeromyxobacter dehalogenans 2CP-C ...................................   40 1 hit  [d-proteobacteria]       chromosomal replication initiator protein DnaA [Anaeromyxob
. . . . Helicobacter canadensis MIT 98-5491 ...................................   40 2 hits [e-proteobacteria]       chromosomal replication initiation protein [Helicobacter ca
. . . . Anaeromyxobacter dehalogenans 2CP-1 ...................................   40 1 hit  [d-proteobacteria]       chromosomal replication initiator protein DnaA [Anaeromyxob
. . . . Anaeromyxobacter sp. K ................................................   40 1 hit  [d-proteobacteria]       chromosomal replication initiator protein DnaA [Anaeromyxob
. . . . Limnobacter sp. MED105 ................................................   40 2 hits [b-proteobacteria]       hypothetical protein LMED105_15843 [Limnobacter sp. MED105]
. . . . Candidatus Vesicomyosocius okutanii HA ................................   40 1 hit  [g-proteobacteria]       DnaA family protein [Candidatus Vesicomyosocius okutanii HA]
. . . . Reinekea blandensis MED297 ............................................   40 1 hit  [g-proteobacteria]       hypothetical protein MED297_16968 [Reinekea sp. MED297]
. . . . Oxalobacter formigenes HOxBLS .........................................   40 1 hit  [b-proteobacteria]       chromosomal replication initiator protein dnaA [Oxalobacter
. . . . Acinetobacter radioresistens SK82 .....................................   40 1 hit  [g-proteobacteria]       DnaA regulatory inactivator Hda [Acinetobacter radioresiste
. . . . Proteus mirabilis HI4320 ..............................................   40 1 hit  [enterobacteria]         chromosomal replication initiator protein [Proteus mirabili
. . . . Proteus mirabilis ATCC 29906 ..........................................   40 1 hit  [enterobacteria]         chromosomal replication initiator protein [Proteus mirabili
. . . . Proteus penneri ATCC 35198 ............................................   40 1 hit  [enterobacteria]         hypothetical protein PROPEN_00780 [Proteus penneri ATCC 351
. . . . Shewanella sediminis HAW-EB3 ..........................................   39 1 hit  [g-proteobacteria]       DNA replication initiation factor [Shewanella sediminis HAW
. . . . Lawsonia intracellularis PHE/MN1-00 ...................................   39 1 hit  [d-proteobacteria]       recombination factor protein RarA [Lawsonia intracellularis
. . . . Shewanella frigidimarina NCIMB 400 ....................................   39 1 hit  [g-proteobacteria]       DNA replication initiation factor [Shewanella frigidimarina
. . . . Bermanella marisrubri .................................................   39 1 hit  [g-proteobacteria]       hypothetical protein RED65_08829 [Oceanobacter sp. RED65]
. . . . Sulfurospirillum deleyianum DSM 6946 ..................................   39 1 hit  [e-proteobacteria]       chromosomal replication initiator protein DnaA [Sulfurospir
. . . . Mariprofundus ferrooxydans PV-1 .......................................   38 1 hit  [proteobacteria]         chromosomal replication initiator protein dnaA [Mariprofund
. . . . gamma proteobacterium HTCC5015 ........................................   38 1 hit  [g-proteobacteria]       DnaA regulatory inactivator Hda [gamma proteobacterium HTCC
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ........................   38 1 hit  [enterobacteria]         chromosomal replication initiation protein [Photorhabdus lu
. . . . Pasteurella dagmatis ATCC 43325 .......................................   38 1 hit  [g-proteobacteria]       ribosomal subunit interface protein [Pasteurella dagmatis A
. . . . Photorhabdus asymbiotica ..............................................   38 1 hit  [enterobacteria]         chromosomal replication initiator protein dnaA [Photorhabdu
. . . . Mannheimia succiniciproducens MBEL55E .................................   38 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Mannheimia succ
. . . . Vibrio splendidus 12B01 ...............................................   38 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio splendid
. . . . Haemophilus ducreyi 35000HP ...........................................   38 1 hit  [g-proteobacteria]       chromosomal replication initiator protein [Haemophilus ducr
. . . . Vibrionales bacterium SWAT-3 ..........................................   38 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrionales bac
. . . . Vibrio vulnificus YJ016 ...............................................   38 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio vulnific
. . . . Providencia rettgeri DSM 1131 .........................................   38 1 hit  [enterobacteria]         hypothetical protein PROVRETT_01866 [Providencia rettgeri D
. . . . Haemophilus influenzae PittGG .........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae PittAA .........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae PittEE .........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Neisseria gonorrhoeae FA 1090 .........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae NCCP11945 .......................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae 35/02 ...........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae DGI18 ...........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae FA6140 ..........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae MS11 ............................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae PID18 ...........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae PID24-1 .........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae PID332 ..........................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae SK-92-679 .......................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae SK-93-1035 ......................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae 1291 ............................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Neisseria gonorrhoeae DGI2 ............................................   37 1 hit  [b-proteobacteria]       hypothetical protein NGO0841 [Neisseria gonorrhoeae FA 1090
. . . . Vibrio parahaemolyticus Peru-466 ......................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio parahaem
. . . . Haemophilus influenzae R2846 ..........................................   37 1 hit  [g-proteobacteria]       COG0593: ATPase involved in DNA replication initiation [Hae
. . . . Haemophilus influenzae 22.4-21 ........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae NT127 ..........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiator protein DnaA [Haemophilus
. . . . Providencia stuartii ATCC 25827 .......................................   37 1 hit  [enterobacteria]         hypothetical protein PROSTU_00415 [Providencia stuartii ATC
. . . . Syntrophus aciditrophicus SB ..........................................   37 1 hit  [d-proteobacteria]       chromosomal replication initiator protein [Syntrophus acidi
. . . . Providencia rustigianii DSM 4541 ......................................   37 1 hit  [enterobacteria]         chromosomal replication initiation protein [Providencia rus
. . . . Vibrio sp. MED222 .....................................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio sp. MED2
. . . . Vibrio splendidus LGP32 ...............................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio sp. MED2
. . . . Haemophilus influenzae PittHH .........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae 3655 ...........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Vibrio fischeri ES114 .................................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio fischeri
. . . . Haemophilus influenzae Rd KW20 ........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae RdAW ...........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Haemophilus influenzae 7P49H1 .........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Vibrio coralliilyticus ATCC BAA-450 ...................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiator protein dnaA [Vibrio cora
. . . . Vibrio vulnificus CMCP6 ...............................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio vulnific
. . . . Vibrio harveyi ATCC BAA-1116 ..........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio harveyi 
. . . . Vibrio parahaemolyticus RIMD 2210633 ..................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio parahaem
. . . . Vibrio parahaemolyticus AN-5034 .......................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio parahaem
. . . . Haemophilus influenzae R3021 ..........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Haemophilus inf
. . . . Providencia alcalifaciens DSM 30120 ...................................   37 1 hit  [enterobacteria]         hypothetical protein PROVALCAL_03707 [Providencia alcalifac
. . . . Pseudoalteromonas tunicata D2 .........................................   37 1 hit  [g-proteobacteria]       DNA replication initiator protein [Pseudoalteromonas tunica
. . . . Neisseria sicca ATCC 29256 ............................................   37 1 hit  [b-proteobacteria]       DnaA regulatory inactivator Hda [Neisseria sicca ATCC 29256]
. . . . Vibrio orientalis CIP 102891 ..........................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiator protein dnaA [Vibrio orie
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 .....................   37 1 hit  [enterobacteria]         ABC transporter related [Pectobacterium carotovorum subsp. 
. . . . Oxalobacter formigenes OXCC13 .........................................   37 1 hit  [b-proteobacteria]       chromosomal replication initiator protein dnaA [Oxalobacter
. . . . Vibrio alginolyticus 12G01 ............................................   37 1 hit  [g-proteobacteria]       chromosomal replication initiation protein [Vibrio alginoly
. . . candidate division TM7 genomosp. GTL1 -----------------------------------   57 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [candidate d
. . . Symbiobacterium thermophilum IAM 14863 ..................................   51 1 hit  [firmicutes]             chromosomal replication initiation protein [Symbiobacterium
. . . candidate division TM7 single-cell isolate TM7c .........................   51 2 hits [bacteria]               chromosomal replication initiation protein [candidate divis
. . . Clostridium methylpentosum DSM 5476 .....................................   50 1 hit  [firmicutes]             hypothetical protein CLOSTMETH_00672 [Clostridium methylpen
. . . Clostridium difficile 630 ...............................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-32g58 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-66c26 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile CIP 107932 ........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-63q42 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile ATCC 43255 ........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-76w55 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-97b34 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-37x79 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile QCD-23m63 .........................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Clostridium difficile CD196 .............................................   49 1 hit  [firmicutes]             chromosomal replication initiator protein [Clostridium diff
. . . Anaerofustis stercorihominis DSM 17244 ..................................   48 1 hit  [firmicutes]             hypothetical protein ANASTE_01761 [Anaerofustis stercorihom
. . . Rothia mucilaginosa ATCC 25296 ..........................................   48 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Rothia muci
. . . Coprothermobacter proteolyticus DSM 5265 ................................   48 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Coprothermo
. . . Dehalococcoides sp. VS ..................................................   47 1 hit  [GNS bacteria]           Chromosomal replication initiator, DnaA [Dehalococcoides sp
. . . Clostridium hiranonis DSM 13275 .........................................   46 1 hit  [firmicutes]             hypothetical protein CLOHIR_02105 [Clostridium hiranonis DS
. . . Actinomyces odontolyticus ATCC 17982 ....................................   46 2 hits [high GC Gram+]          hypothetical protein ACTODO_00733 [Actinomyces odontolyticu
. . . Staphylococcus epidermidis RP62A ........................................   45 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus epidermidis ATCC 12228 ...................................   45 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus epidermidis BCM-HMP0060 ..................................   45 1 hit  [firmicutes]             replication initiation protein DnaA [Staphylococcus epiderm
. . . Anaerostipes caccae DSM 14662 ...........................................   45 1 hit  [firmicutes]             hypothetical protein ANACAC_02781 [Anaerostipes caccae DSM 
. . . Staphylococcus epidermidis W23144 .......................................   45 1 hit  [firmicutes]             replication initiation protein DnaA [Staphylococcus epiderm
. . . Chlorobaculum parvum NCIB 8327 ..........................................   45 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Chlorobacul
. . . Anaerococcus hydrogenalis DSM 7454 ......................................   45 1 hit  [firmicutes]             hypothetical protein ANHYDRO_01958 [Anaerococcus hydrogenal
. . . Candidatus Cloacamonas acidaminovorans ..................................   45 1 hit  [bacteria]               chromosomal replication initiation protein [Candidatus Cloa
. . . Thermobaculum terrenum ATCC BAA-798 .....................................   45 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Thermobacul
. . . Sphaerobacter thermophilus DSM 20745 ....................................   44 2 hits [GNS bacteria]           chromosomal replication initiator protein DnaA [Sphaerobact
. . . Eubacterium eligens ATCC 27750 ..........................................   44 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Eubacterium
. . . Candidatus Solibacter usitatus Ellin6076 ................................   44 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Solibacter 
. . . Chlorobium tepidum TLS ..................................................   43 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Chlorobium 
. . . Corynebacterium amycolatum SK46 .........................................   43 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Corynebacte
. . . Porphyromonas uenonis 60-3 ..............................................   43 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Porphyromon
. . . Thermoanaerobacter tengcongensis MB4 ....................................   43 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Carboxydibrachium pacificum DSM 12653 ...................................   43 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Carboxydibr
. . . Dialister invisus DSM 15470 .............................................   43 1 hit  [firmicutes]             ATPase [Dialister invisus DSM 15470]
. . . Prevotella sp. oral taxon 472 str. F0295 ................................   43 1 hit  [CFB group bacteria]     conserved hypothetical protein [Prevotella sp. oral taxon 4
. . . Porphyromonas endodontalis ATCC 35406 ...................................   43 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Porphyromon
. . . Propionibacterium sp. oral taxon 191 str. F0233 .........................   43 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Porphyromon
. . . Meiothermus silvanus DSM 9946 ...........................................   43 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Meiothermus
. . . Chlorobium phaeobacteroides BS1 .........................................   42 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Chlorobium 
. . . Anaerococcus vaginalis ATCC 51170 .......................................   42 1 hit  [firmicutes]             ATPase involved in DNA replication initiation [Anaerococcus
. . . Blautia hansenii DSM 20583 ..............................................   42 1 hit  [firmicutes]             DNA replication initiator protein, ATPase [Blautia hansenii
. . . Frankia sp. CcI3 ........................................................   42 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Frankia sp.
. . . Rhodothermus marinus DSM 4252 ...........................................   42 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Rhodothermu
. . . Kordia algicida OT-1 ....................................................   42 1 hit  [CFB group bacteria]     chromosomal replication initiator protein [Kordia algicida 
. . . Clostridium phytofermentans ISDg ........................................   42 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Thermus aquaticus Y51MC23 ...............................................   42 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Thermus aqu
. . . Bacteroides sp. 2_1_7 ...................................................   42 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Bacteroides sp.
. . . Parabacteroides sp. D13 .................................................   42 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Bacteroides sp.
. . . Staphylococcus epidermidis M23864:W1 ....................................   42 1 hit  [firmicutes]             replication initiation protein DnaA [Staphylococcus epiderm
. . . Chlorobium phaeobacteroides DSM 266 .....................................   42 1 hit  [green sulfur bacteria]  chromosomal replication initiation protein [Chlorobium phae
. . . Parabacteroides distasonis ATCC 8503 ....................................   41 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Parabacteroides
. . . Clostridium perfringens B str. ATCC 3626 ................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Desulfotomaculum acetoxidans DSM 771 ....................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Desulfotoma
. . . Flavobacteriales bacterium ALC-1 ........................................   41 1 hit  [CFB group bacteria]     chromosomal replication initiator protein [Flavobacteriales
. . . Streptomyces pristinaespiralis ATCC 25486 ...............................   41 1 hit  [high GC Gram+]          chromosomal replication initiator protein dnaA [Streptomyce
. . . Prosthecochloris aestuarii DSM 271 ......................................   41 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Prosthecoch
. . . Staphylococcus capitis SK14 .............................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Staphylococ
. . . Streptomyces sp. SPB78 ..................................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces sp
. . . Leptospira borgpetersenii serovar Hardjo-bovis L550 .....................   41 1 hit  [spirochetes]            response regulator [Leptospira borgpetersenii serovar Hardj
. . . Leptospira borgpetersenii serovar Hardjo-bovis JB197 ....................   41 1 hit  [spirochetes]            response regulator [Leptospira borgpetersenii serovar Hardj
. . . Thermoanaerobacter pseudethanolicus ATCC 33223 ..........................   41 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Thermoanaerobacter sp. X514 .............................................   41 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Thermoanaerobacter brockii subsp. finnii Ako-1 ..........................   41 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Thermoanaerobacter sp. X513 .............................................   41 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Thermoanaerobacter sp. X561 .............................................   41 1 hit  [firmicutes]             chromosomal replication initiation protein [Thermoanaerobac
. . . Thermoanaerobacter ethanolicus CCSD1 ....................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Thermoanaer
. . . Streptomyces flavogriseus ATCC 33331 ....................................   41 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Streptomyce
. . . Streptomyces roseosporus NRRL 15998 .....................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces ro
. . . Streptomyces roseosporus NRRL 11379 .....................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces ro
. . . Streptomyces griseus subsp. griseus NBRC 13350 ..........................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces gr
. . . Thermoanaerobacter italicus Ab9 .........................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Thermoanaer
. . . Thermoanaerobacter mathranii subsp. mathranii str. A3 ...................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Thermoanaer
. . . Borrelia valaisiana VS116 ...............................................   41 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia va
. . . Thermus thermophilus HB8 ................................................   41 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Thermus the
. . . Streptomyces griseoflavus Tu4000 ........................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces gr
. . . Streptomyces viridochromogenes DSM 40736 ................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces vi
. . . Streptomyces lividans TK24 ..............................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces li
. . . Streptomyces ghanaensis ATCC 14672 ......................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces gh
. . . Streptomyces sp. Mg1 ....................................................   41 1 hit  [high GC Gram+]          chromosomal replication initiator protein dnaA [Streptomyce
. . . Streptomyces coelicolor A3(2) ...........................................   41 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Streptomyces coe
. . . Streptomyces avermitilis MA-4680 ........................................   41 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces av
. . . Cytophaga hutchinsonii ATCC 33406 .......................................   41 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Cytophaga h
. . . Bacillus coagulans 36D1 .................................................   41 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus co
. . . Thermus thermophilus HB27 ...............................................   41 1 hit  [bacteria]               chromosomal replication initiator protein dnaA [Thermus the
. . . Leptotrichia hofstadii F0254 ............................................   41 1 hit  [fusobacteria]           DNA replication initiator protein, ATPase [Leptotrichia hof
. . . Blautia hydrogenotrophica DSM 10507 .....................................   41 1 hit  [firmicutes]             hypothetical protein RUMHYD_03784 [Blautia hydrogenotrophic
. . . Bacillus selenitireducens MLS10 .........................................   40 1 hit  [firmicutes]             ATPase involved in DNA replication initiation-like protein 
. . . Chlamydia trachomatis D/UW-3/CX .........................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis A/HAR-13 ..........................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis B/Jali20/OT .......................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis B/TZ1A828/OT ......................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis 6276 ..............................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis 6276s .............................................   40 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Prevotella veroralis F0319 ..............................................   40 1 hit  [CFB group bacteria]     DNA replication initiator protein, ATPase [Prevotella veror
. . . Butyrivibrio crossotus DSM 2876 .........................................   40 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Butyrivibri
. . . Chloroherpeton thalassium ATCC 35110 ....................................   40 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Chloroherpe
. . . Clostridium perfringens str. 13 .........................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Clostridium perfringens ATCC 13124 ......................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Clostridium perfringens NCTC 8239 .......................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Clostridium perfringens C str. JGS1495 ..................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Clostridium perfringens D str. JGS1721 ..................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Brevibacillus brevis NBRC 100599 ........................................   40 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Brevibacill
. . . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ...........   40 1 hit  [CFB group bacteria]     chromosomal replication initiation protein DnaA [Candidatus
. . . Hydrogenivirga sp. 128-5-R1-1 ...........................................   40 1 hit  [aquificales]            chromosome replication initiator protein DnaA [Hydrogenivir
. . . Clostridium perfringens SM101 ...........................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium per
. . . Clostridium perfringens E str. JGS1987 ..................................   40 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Borrelia afzelii PKo ....................................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein [Borrelia afzelii
. . . Borrelia afzelii ACA-1 ..................................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein [Borrelia afzelii
. . . Bifidobacterium pseudocatenulatum DSM 20438 .............................   40 1 hit  [high GC Gram+]          hypothetical protein BIFPSEUDO_03996 [Bifidobacterium pseud
. . . Dyadobacter fermentans DSM 18053 ........................................   40 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Dyadobacter
. . . Streptomyces sp. C ......................................................   40 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces sp
. . . Streptomyces albus J1074 ................................................   40 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Streptomyces al
. . . Tropheryma whipplei str. Twist ..........................................   40 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Tropheryma whipp
. . . Tropheryma whipplei TW08/27 .............................................   40 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Tropheryma whipp
. . . Veillonella dispar ATCC 17748 ...........................................   40 1 hit  [firmicutes]             hypothetical protein VEIDISOL_00047 [Veillonella dispar ATC
. . . Bacillus sp. B14905 .....................................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus sp. B1
. . . Clostridium sp. SS2/1 ...................................................   40 1 hit  [firmicutes]             hypothetical protein CLOSS21_01381 [Clostridium sp. SS2/1]
. . . Thermomicrobium roseum DSM 5159 .........................................   40 1 hit  [GNS bacteria]           chromosomal replication initiator protein DnaA [Thermomicro
. . . Borrelia garinii PBr ....................................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia ga
. . . Moorella thermoacetica ATCC 39073 .......................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Moorella thermo
. . . Polaribacter sp. MED152 .................................................   40 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Polaribacte
. . . Bacillus cereus Rock3-28 ................................................   40 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Borrelia garinii PBi ....................................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein [Borrelia garinii
. . . Faecalibacterium prausnitzii A2-165 .....................................   40 1 hit  [firmicutes]             DNA replication initiator protein, ATPase [Faecalibacterium
. . . Capnocytophaga gingivalis ATCC 33624 ....................................   40 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Capnocytoph
. . . Syntrophomonas wolfei subsp. wolfei str. Goettingen .....................   40 1 hit  [firmicutes]             initiation of chromosome replication [Syntrophomonas wolfei
. . . Borrelia garinii Far04 ..................................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia ga
. . . Bacillus sp. NRRL B-14911 ...............................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus sp. NR
. . . Finegoldia magna ATCC 53516 .............................................   40 1 hit  [firmicutes]             replication initiation protein DnaA [Finegoldia magna ATCC 
. . . Pelotomaculum thermopropionicum SI ......................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Pelotomaculum t
. . . Treponema vincentii ATCC 35580 ..........................................   40 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Treponema v
. . . Bifidobacterium dentium ATCC 27678 ......................................   40 1 hit  [high GC Gram+]          hypothetical protein BIFDEN_00825 [Bifidobacterium dentium 
. . . Bacillus sp. SG-1 .......................................................   40 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus sp. SG
. . . Faecalibacterium prausnitzii M21/2 ......................................   40 1 hit  [firmicutes]             hypothetical protein FAEPRAM212_01776 [Faecalibacterium pra
. . . Salinispora tropica CNB-440 .............................................   40 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Salinispora
. . . Veillonella parvula DSM 2008 ............................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Veillonella
. . . Frankia alni ACN14a .....................................................   39 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Frankia alni ACN
. . . Algoriphagus sp. PR1 ....................................................   39 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Algoriphagu
. . . Geobacillus sp. G11MC16 .................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ...........   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Alicyclobac
. . . Alkaliphilus metalliredigens QYMF .......................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Alkaliphilus me
. . . Alicyclobacillus acidocaldarius LAA1 ....................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Alicyclobac
. . . Chlamydia trachomatis 70 ................................................   39 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis 70s ...............................................   39 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis D(s)2923 ..........................................   39 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Bifidobacterium catenulatum DSM 16992 ...................................   39 1 hit  [high GC Gram+]          hypothetical protein BIFCAT_00035 [Bifidobacterium catenula
. . . Flavobacteria bacterium BAL38 ...........................................   39 1 hit  [CFB group bacteria]     chromosomal replication initiator protein [Flavobacteria ba
. . . Exiguobacterium sibiricum 255-15 ........................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Exiguobacte
. . . Geobacillus kaustophilus HTA426 .........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Geobacillus kau
. . . Geobacillus sp. WCH70 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . Geobacillus thermodenitrificans NG80-2 ..................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Geobacillus the
. . . Geobacillus sp. Y412MC52 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . Geobacillus sp. Y412MC61 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . Bacillus thuringiensis str. Al Hakam ....................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus thurin
. . . Bacillus cereus G9842 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus ce
. . . Bacillus thuringiensis IBL 4222 .........................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus ce
. . . Bacillus thuringiensis IBL 200 ..........................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus ce
. . . Bacillus cereus ATCC 10876 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus ce
. . . Bacillus halodurans C-125 ...............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus halodu
. . . Pelodictyon phaeoclathratiforme BU-1 ....................................   39 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Pelodictyon
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ...................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Deinococcus geothermalis DSM 11300 ......................................   39 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Deinococcus
. . . Bacillus cereus ATCC 14579 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus AH1134 ..................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus B4264 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ..................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 ....................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus thuringiensis serovar pakistani str. T13001 ....................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus AH676 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus F65185 ..................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus Rock1-15 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus BDRD-Cer4 ...............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus BDRD-ST24 ...............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus m1550 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus 172560W .................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Chthoniobacter flavus Ellin428 ..........................................   39 1 hit  [verrucomicrobia]        chromosomal replication initiator protein DnaA [Chthoniobac
. . . Geobacillus sp. Y4.1MC1 .................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . marine actinobacterium PHSC20C1 .........................................   39 1 hit  [high GC Gram+]          chromosomal replication initiator protein [marine actinobac
. . . Anoxybacillus flavithermus WK1 ..........................................   39 1 hit  [firmicutes]             DNA replication initiation ATPase [Anoxybacillus flavitherm
. . . Clostridium leptum DSM 753 ..............................................   39 1 hit  [firmicutes]             hypothetical protein CLOLEP_01262 [Clostridium leptum DSM 7
. . . Bacillus thuringiensis serovar berliner ATCC 10792 ......................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 ................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Bacillus thuringiensis Bt407 ............................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Bacillus weihenstephanensis KBAB4 .......................................   39 2 hits [firmicutes]             chromosomal replication initiation protein [Bacillus weihen
. . . Bacillus mycoides DSM 2048 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus weihen
. . . Bacillus cereus AH603 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus weihen
. . . Bacillus cereus BDRD-ST196 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus weihen
. . . Bacillus cereus AH621 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus weihen
. . . Bacillus cereus AH1273 ..................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Bacillus cereus AH1272 ..................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Porphyromonas gingivalis W83 ............................................   39 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Porphyromonas g
. . . Porphyromonas gingivalis ATCC 33277 .....................................   39 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Porphyromonas g
. . . Staphylococcus aureus RF122 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus Mu50 ................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus N315 ................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus MW2 .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus MSSA476 .............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus COL .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 ......................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ...........................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus JH9 .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus JH1 .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus str. Newman .........................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus Mu3 .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 ......................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus TCH70 ...............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 .......................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus TCH130 ..............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus Mu50-omega ..........................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A9781 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A9763 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A9719 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A9299 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A8115 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A6300 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A6224 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A5948 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A5937 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Gemmatimonas aurantiaca T-27 ............................................   39 1 hit  [bacteria]               twitching mobility protein [Gemmatimonas aurantiaca T-27]
. . . Staphylococcus aureus subsp. aureus MRSA252 .............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus str. JKD6008 ........................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus str. JKD6009 ........................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus MN8 .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus TCH60 ...............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 55/2053 .............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 65-1322 .............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 68-397 ..............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus E1410 ...............................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M876 ................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Staphylococcus aureus A9635 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Acidimicrobium ferrooxidans DSM 10331 ...................................   39 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Acidimicrob
. . . Bacillus cereus AH1271 ..................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Bacillus cereus R309803 .................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Bacillus cereus MM3 .....................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Bacillus cereus Rock1-3 .................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Bacillus cereus Rock3-29 ................................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ce
. . . Clostridium novyi NT ....................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium nov
. . . Bacillus anthracis str. Ames ............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. 'Ames Ancestor' .................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. Sterne ..........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus thuringiensis serovar konkukian str. 97-27 .....................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus E33L ....................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A2012 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0488 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0442 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0193 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0465 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0389 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0174 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis Tsiankovskii-I .......................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus W .......................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus NVH0597-99 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus 03BB108 .................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus AH820 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. CDC 684 .........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 .....................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ......................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus Rock3-42 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus 95/8201 .................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus cereus BGSC 6E1 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A0248 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. CNEVA-9066 ......................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. A1055 ...........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. Western North America USA6153 ...................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. Kruger B ........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. Vollum ..........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus anthracis str. Australia 94 ....................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus anthra
. . . Bacillus pseudomycoides DSM 12442 .......................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ps
. . . Bacillus mycoides Rock3-17 ..............................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ps
. . . Bacillus mycoides Rock1-4 ...............................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus ps
. . . Leptotrichia buccalis DSM 1135 ..........................................   39 1 hit  [fusobacteria]           chromosomal replication initiator protein DnaA [Leptotrichi
. . . Bacillus cereus ATCC 10987 ..............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus H3081.97 ................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus AH187 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus Q1 ......................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus BDRD-ST26 ...............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus m1293 ...................................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ....................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Bacillus cereus ATCC 4342 ...............................................   39 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Bacillus cytotoxicus NVH 391-98 .........................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus cereus
. . . Bacillus cereus 03BB102 .................................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus ce
. . . Chlamydophila caviae GPIC ...............................................   39 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila c
. . . Borrelia turicatae 91E135 ...............................................   39 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia tu
. . . Listeria monocytogenes FSL R2-503 .......................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein dnaA [Listeria mo
. . . Chlorobium chlorochromatii CaD3 .........................................   39 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein, DnaA [Chlorobium
. . . Borrelia burgdorferi 72a ................................................   39 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia bu
. . . Borrelia burgdorferi CA-11.2a ...........................................   39 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia bu
. . . Borrelia burgdorferi 94a ................................................   39 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia bu
. . . Borrelia burgdorferi 118a ...............................................   39 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia bu
. . . Finegoldia magna ATCC 29328 .............................................   39 1 hit  [firmicutes]             chromosomal replication initiation protein [Finegoldia magn
. . . Clostridium botulinum D str. 1873 .......................................   39 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Chlamydia muridarum Nigg ................................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia murid
. . . Chlorobium limicola DSM 245 .............................................   38 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Chlorobium 
. . . Clostridium botulinum C str. Eklund .....................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 .................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Nocardiopsi
. . . Listeria monocytogenes str. 4b H7858 ....................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Listeria mo
. . . Listeria innocua Clip11262 ..............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria innocu
. . . Listeria welshimeri serovar 6b str. SLCC5334 ............................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria innocu
. . . Listeria monocytogenes EGD-e ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes str. 4b F2365 ....................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes HCC23 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes Finland 1988 .....................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL J1-194 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL N3-165 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes 10403S ...........................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL N1-017 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL J2-071 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes J0161 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes J2818 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes HPB2262 ..........................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes F6900 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL J2-064 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL J2-003 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes LO28 .............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL J1-175 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes FSL R2-561 .......................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Listeria monocy
. . . Listeria monocytogenes Clip80459 ........................................   38 1 hit  [firmicutes]             Chromosomal replication initiation protein DnaA [Listeria m
. . . Clostridium kluyveri DSM 555 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium klu
. . . Clostridium kluyveri NBRC 12016 .........................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium klu
. . . Bacillus thuringiensis serovar sotto str. T04001 ........................   38 1 hit  [firmicutes]             Chromosomal replication initiator protein dnaA [Bacillus th
. . . Ammonifex degensii KC4 ..................................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Ammonifex d
. . . Exiguobacterium sp. AT1b ................................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Exiguobacte
. . . Kineococcus radiotolerans SRS30216 ......................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Kineococcus
. . . Bifidobacterium adolescentis ATCC 15703 .................................   38 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Bifidobacterium
. . . Bifidobacterium adolescentis L2-32 ......................................   38 1 hit  [high GC Gram+]          chromosomal replication initiation protein [Bifidobacterium
. . . Robiginitalea biformata HTCC2501 ........................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Robiginitalea b
. . . Listeria grayi DSM 20601 ................................................   38 1 hit  [firmicutes]             DNA-directed DNA replication initiator protein [Listeria gr
. . . Deinococcus deserti VCD115 ..............................................   38 1 hit  [bacteria]               putative chromosomal replication initiator protein [Deinoco
. . . Listeria monocytogenes str. 1/2a F6854 ..................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Listeria mo
. . . Chlamydia trachomatis 434/Bu ............................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Chlamydia trachomatis L2b/UCH-1/proctitis ...............................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydia trach
. . . Clostridium bartlettii DSM 16795 ........................................   38 1 hit  [firmicutes]             hypothetical protein CLOBAR_00011 [Clostridium bartlettii D
. . . Borrelia duttonii Ly ....................................................   38 1 hit  [spirochetes]            chromosomal replication initiator protein [Borrelia duttoni
. . . Bacillus amyloliquefaciens FZB42 ........................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus amylol
. . . Eubacterium hallii DSM 3353 .............................................   38 1 hit  [firmicutes]             hypothetical protein EUBHAL_03125 [Eubacterium hallii DSM 3
. . . Borrelia recurrentis A1 .................................................   38 1 hit  [spirochetes]            chromosomal replication initiator protein [Borrelia recurre
. . . Bacillus subtilis subsp. subtilis str. 168 ..............................   38 2 hits [firmicutes]             chromosomal replication initiation protein [Bacillus subtil
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ........................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus subtil
. . . Bacillus subtilis subsp. subtilis str. JH642 ............................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus subtil
. . . Bacillus subtilis subsp. subtilis str. SMY ..............................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus subtil
. . . Staphylococcus hominis SK119 ............................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Staphylococ
. . . Bacillus coahuilensis m4-4 ..............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus coahui
. . . Candidatus Koribacter versatilis Ellin345 ...............................   38 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Candidatus 
. . . Sanguibacter keddieii DSM 10542 .........................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Sanguibacte
. . . Thermosipho africanus TCF52B ............................................   38 1 hit  [thermotogales]          chromosomal replication initiator protein DnaA [Thermosipho
. . . Croceibacter atlanticus HTCC2559 ........................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Croceibacter at
. . . Chlorobium phaeovibrioides DSM 265 ......................................   38 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein DnaA [Prosthecoch
. . . Bacillus pumilus ATCC 7061 ..............................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Bacillus pu
. . . Bacillus pumilus SAFR-032 ...............................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Bacillus pumilu
. . . Chloroflexus aggregans DSM 9485 .........................................   38 1 hit  [GNS bacteria]           chromosomal replication initiator protein DnaA [Chloroflexu
. . . Prevotella melaninogenica ATCC 25845 ....................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Prevotella 
. . . Treponema denticola ATCC 35405 ..........................................   38 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Treponema d
. . . Chlamydophila pneumoniae CWL029 .........................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila p
. . . Chlamydophila pneumoniae AR39 ...........................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila p
. . . Chlamydophila pneumoniae TW-183 .........................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila p
. . . Thermomonospora curvata DSM 43183 .......................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Thermomonos
. . . Acidobacterium capsulatum ATCC 51196 ....................................   38 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Acidobacter
. . . Corynebacterium jeikeium K411 ...........................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Corynebacterium 
. . . Bacteroides pectinophilus ATCC 43243 ....................................   38 1 hit  [CFB group bacteria]     hypothetical protein BACPEC_02270 [Bacteroides pectinophilu
. . . Chlamydophila pneumoniae J138 ...........................................   38 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila p
. . . Coprococcus eutactus ATCC 27759 .........................................   38 1 hit  [firmicutes]             hypothetical protein COPEUT_01140 [Coprococcus eutactus ATC
. . . Bacillus licheniformis ATCC 14580 .......................................   38 2 hits [firmicutes]             chromosomal replication initiation protein [Bacillus lichen
. . . Corynebacterium urealyticum DSM 7109 ....................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein [Corynebacterium 
. . . Chloroflexus aurantiacus J-10-fl ........................................   38 1 hit  [GNS bacteria]           chromosomal replication initiator protein DnaA [Chloroflexu
. . . Chloroflexus sp. Y-400-fl ...............................................   38 1 hit  [GNS bacteria]           chromosomal replication initiator protein DnaA [Chloroflexu
. . . Mitsuokella multacida DSM 20544 .........................................   38 1 hit  [firmicutes]             ATPase [Mitsuokella multacida DSM 20544]
. . . Staphylococcus haemolyticus JCSC1435 ....................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Staphylococcus 
. . . Candidatus Amoebophilus asiaticus 5a2 ...................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiator protein DnaA [Candidatus 
. . . Meiothermus ruber DSM 1279 ..............................................   38 1 hit  [bacteria]               chromosomal replication initiator protein DnaA [Meiothermus
. . . Geobacillus sp. Y412MC10 ................................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Geobacillus
. . . Jonesia denitrificans DSM 20603 .........................................   38 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Jonesia den
. . . Deinococcus radiodurans R1 ..............................................   38 1 hit  [bacteria]               chromosomal replication initiator protein [Deinococcus radi
. . . Anaerotruncus colihominis DSM 17241 .....................................   38 1 hit  [firmicutes]             hypothetical protein ANACOL_02189 [Anaerotruncus colihomini
. . . Bacteroides thetaiotaomicron VPI-5482 ...................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Bacteroides the
. . . Bacteroides sp. 1_1_6 ...................................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Bacteroides the
. . . Ruminococcus sp. 5_1_39BFAA .............................................   38 1 hit  [firmicutes]             conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FA
. . . Pelodictyon luteolum DSM 273 ............................................   38 1 hit  [green sulfur bacteria]  chromosomal replication initiator protein, DnaA [Pelodictyo
. . . Clostridium botulinum Bf ................................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Clostridium botulinum Ba4 str. 657 ......................................   38 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Clostridium tetani E88 ..................................................   38 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium tet
. . . Gramella forsetii KT0803 ................................................   38 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Gramella forset
. . . Gemmata obscuriglobus UQM 2246 ..........................................   38 1 hit  [planctomycetes]         cell division cycle protein 48-related protein [Gemmata obs
. . . Anaerococcus lactolyticus ATCC 51172 ....................................   38 1 hit  [firmicutes]             DNA-directed DNA replication initiator protein [Anaerococcu
. . . Dethiobacter alkaliphilus AHT 1 .........................................   37 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Dethiobacte
. . . Corynebacterium jeikeium ATCC 43734 .....................................   37 1 hit  [high GC Gram+]          replication initiator protein [Corynebacterium jeikeium ATC
. . . Parvimonas micra ATCC 33270 .............................................   37 1 hit  [firmicutes]             hypothetical protein PEPMIC_00562 [Parvimonas micra ATCC 33
. . . Bifidobacterium bifidum NCIMB 41171 .....................................   37 1 hit  [high GC Gram+]          ATPase for DNA replication initiation [Bifidobacterium bifi
. . . Flavobacteriales bacterium HTCC2170 .....................................   37 1 hit  [CFB group bacteria]     chromosomal replication initiation protein [Flavobacteriale
. . . Salinispora arenicola CNS-205 ...........................................   37 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Salinispora
. . . Kribbella flavida DSM 17836 .............................................   37 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Kribbella f
. . . Paenibacillus sp. oral taxon 786 str. D14 ...............................   37 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Paenibacill
. . . Abiotrophia defectiva ATCC 49176 ........................................   37 1 hit  [firmicutes]             hypothetical protein GCWU000182_02248 [Abiotrophia defectiv
. . . Chlamydophila abortus S26/3 .............................................   37 1 hit  [chlamydias]             chromosomal replication initiation protein [Chlamydophila a
. . . Halothermothrix orenii H 168 ............................................   37 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Halothermot
. . . Corynebacterium tuberculostearicum SK141 ................................   37 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Corynebacte
. . . Clostridium thermocellum ATCC 27405 .....................................   37 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium the
. . . Clostridium thermocellum DSM 2360 .......................................   37 1 hit  [firmicutes]             chromosomal replication initiator protein DnaA [Clostridium
. . . Propionibacterium acnes KPA171202 .......................................   37 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Propionibac
. . . Propionibacterium acnes SK137 ...........................................   37 1 hit  [high GC Gram+]          chromosomal replication initiator protein DnaA [Propionibac
. . . Clostridium sp. 7_2_43FAA ...............................................   37 1 hit  [firmicutes]             ABC transporter [Clostridium sp. 7_2_43FAA]
. . . Leptospira interrogans serovar Lai str. 56601 ...........................   37 1 hit  [spirochetes]            FIS family transcriptional regulator [Leptospira interrogan
. . . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ..........   37 1 hit  [spirochetes]            FIS family transcriptional regulator [Leptospira interrogan
. . . Roseburia intestinalis L1-82 ............................................   37 1 hit  [firmicutes]             DNA replication initiator protein, ATPase [Roseburia intest
. . . Clostridium botulinum F str. Langeland ..................................   37 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium bot
. . . Clostridium botulinum NCTC 2916 .........................................   37 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium bot
. . . Clostridium botulinum B1 str. Okra ......................................   37 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium bot
. . . Clostridium botulinum A2 str. Kyoto .....................................   37 1 hit  [firmicutes]             chromosomal replication initiation protein [Clostridium bot
. . . Borrelia spielmanii A14S ................................................   37 1 hit  [spirochetes]            chromosomal replication initiator protein DnaA [Borrelia sp
. . Tetrahymena thermophila ---------------------------------------------------   39 1 hit  [ciliates]               ABC transporter family protein [Tetrahymena thermophila]
. . Leishmania infantum JPCM5 .................................................   37 1 hit  [kinetoplastids]         hypothetical protein [Leishmania infantum]
. . Nematostella vectensis ....................................................   37 1 hit  [sea anemones]           predicted protein [Nematostella vectensis]
. Emiliania huxleyi virus 86 --------------------------------------------------   41 1 hit  [viruses]                hypothetical protein EhV122 [Emiliania huxleyi virus 86]

BLAST

PROTOCOLE:

NCBI BLAST / blast p / reference proteins / max targets sequence :500 / >GOS_1086010 Traduction [225-785 sens indirect]


ANALYSE DES RÉSULTATS:


Pas de saut de e-value, on note la présence d'un grand nombre de protéines d'initiation de la réplication chromosomique venant de multiples organismes differents. on fixe notre seuil à une e-value de 0.01 arbitrairement.


Nous avons choisi de faire un blast contre RefSeq car contre nr, il y avait beaucoup trop de résultats.

RESULTATS BRUTS:

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01264118.1|  probable ATPase involved in DNA replicatio...   126    6e-28
ref|YP_266143.1|  ATPase involved in DNA replication initiatio...   125    1e-27 Gene info
ref|YP_427250.1|  regulatory inactivation of DnaA Hda protein ...   124    4e-27 Gene info
ref|ZP_01547553.1|  hypothetical protein SIAM614_11568 [Stappi...   118    2e-25
ref|ZP_05117252.1|  hypothetical protein SADFL11_5141 [Labrenz...   117    3e-25
ref|YP_318208.1|  hypothetical protein Nwi_1595 [Nitrobacter w...   117    5e-25 Gene info
ref|ZP_05377859.1|  chromosomal replication initiator, DnaA [H...   116    1e-24
ref|YP_577373.1|  hypothetical protein Nham_2116 [Nitrobacter ...   113    7e-24 Gene info
ref|NP_108166.1|  hypothetical protein mlr7968 [Mesorhizobium ...   112    1e-23 Gene info
ref|ZP_05811560.1|  conserved hypothetical protein [Mesorhizob...   111    3e-23
ref|ZP_01048159.1|  hypothetical protein NB311A_18728 [Nitroba...   110    6e-23
ref|YP_001771920.1|  chromosomal replication initiator DnaA [M...   110    6e-23 Gene info
ref|YP_532201.1|  hypothetical protein RPC_2328 [Rhodopseudomo...   109    9e-23 Gene info
ref|YP_001753187.1|  chromosomal replication initiator DnaA [M...   109    1e-22 Gene info
ref|YP_001924724.1|  chromosomal replication initiator DnaA [M...   108    2e-22 Gene info
ref|YP_003068348.1|  hypothetical protein METDI2832 [Methyloba...   108    2e-22 Gene info
ref|YP_001639533.1|  chromosomal replication initiator DnaA [M...   108    2e-22 Gene info
ref|YP_002421113.1|  chromosomal replication initiator DnaA [M...   108    2e-22 Gene info
ref|YP_486107.1|  hypothetical protein RPB_2491 [Rhodopseudomo...   107    6e-22 Gene info
ref|YP_002500689.1|  Chromosomal replication initiator DnaA [M...   105    1e-21 Gene info
ref|YP_001414589.1|  chromosomal replication initiator DnaA [P...   103    5e-21 Gene info
ref|YP_570081.1|  hypothetical protein RPD_2953 [Rhodopseudomo...   103    5e-21 Gene info
ref|YP_001371116.1|  hypothetical protein Oant_2574 [Ochrobact...   102    1e-20 Gene info
ref|YP_001609696.1|  hypothetical protein Btr_1339 [Bartonella...   101    3e-20 Gene info
ref|YP_782195.1|  hypothetical protein RPE_3282 [Rhodopseudomo...   101    3e-20 Gene info
ref|YP_002289318.1|  chromosomal replication initiator, DnaA [...   100    5e-20 Gene info
ref|YP_002972119.1|  hypothetical protein Bgr_11870 [Bartonell...   100    5e-20 Gene info
ref|YP_001627390.1|  hypothetical protein BSUIS_A0745 [Brucell...   100    7e-20 Gene info
ref|YP_002549136.1|  hypothetical protein Avi_1578 [Agrobacter...   100    8e-20 Gene info
ref|ZP_04679877.1|  Hypothetical protein, conserved [Ochrobact...  99.8    9e-20
ref|ZP_05454116.1|  ATP/GTP-binding protein [Brucella melitens...  99.8    9e-20
ref|YP_989063.1|  hypothetical protein BARBAKC583_0767 [Barton...  99.8    1e-19 Gene info
ref|YP_001992435.1|  conserved hypothetical protein [Rhodopseu...  99.4    1e-19 Gene info
ref|NP_697728.1|  hypothetical protein BR0714 [Brucella suis 1...  99.0    2e-19 Gene info
ref|ZP_05834244.1|  ATP/GTP-binding protein [Brucella melitens...  98.6    2e-19
ref|ZP_03785248.1|  ATP/GTP-binding protein [Brucella ceti str...  98.6    2e-19
ref|NP_540155.1|  hypothetical protein BMEI1238 [Brucella meli...  98.6    2e-19 Gene info
ref|YP_002297763.1|  hypothetical protein RC1_1547 [Rhodospiri...  97.8    4e-19 Gene info
ref|ZP_05163323.1|  ATP/GTP-binding protein [Brucella suis bv....  97.4    5e-19
ref|ZP_01227434.1|  conserved hypothetical protein [Aurantimon...  97.1    6e-19
ref|YP_001239832.1|  regulatory inactivation of DnaA Hda prote...  96.7    8e-19 Gene info
ref|ZP_01447167.1|  hypothetical protein OM2255_07405 [alpha p...  96.7    8e-19
ref|YP_674521.1|  hypothetical protein Meso_1963 [Mesorhizobiu...  96.3    1e-18 Gene info
ref|ZP_05964027.1|  conserved hypothetical protein [Brucella n...  96.3    1e-18
ref|YP_001326485.1|  hypothetical protein Smed_0794 [Sinorhizo...  96.3    1e-18 Gene info
ref|YP_353858.1|  hypothetical protein RSP_0780 [Rhodobacter s...  96.3    1e-18 Gene info
ref|YP_001166610.1|  chromosomal replication initiator, DnaA [...  96.3    1e-18 Gene info
ref|ZP_05450997.1|  ATP/GTP-binding protein [Brucella neotomae...  96.3    1e-18
ref|YP_001044310.1|  chromosomal replication initiator, DnaA [...  95.9    1e-18 Gene info
ref|YP_002526502.1|  Chromosomal replication initiator, DnaA [...  95.9    1e-18 Gene info
ref|YP_003064980.1|  hypothetical protein CLIBASIA_02270 [Cand...  95.9    1e-18 Gene info
ref|NP_385292.1|  hypothetical protein SMc00617 [Sinorhizobium...  95.5    2e-18 Gene info
ref|ZP_05086729.1|  ATP/GTP-binding protein [Pseudovibrio sp. ...  95.1    2e-18
ref|YP_001523855.1|  hypothetical protein AZC_0939 [Azorhizobi...  95.1    2e-18 Gene info
ref|NP_948388.1|  hypothetical protein RPA3049 [Rhodopseudomon...  94.0    5e-18 Gene info
ref|YP_002825478.1|  chromosomal replication initiator, DnaA [...  93.6    7e-18 Gene info
ref|YP_001205367.1|  hypothetical protein BRADO3342 [Bradyrhiz...  93.6    7e-18 Gene info
ref|ZP_02140911.1|  hypothetical protein RLO149_17493 [Roseoba...  93.6    7e-18
ref|ZP_05054435.1|  chromosomal replication initiator protein ...  93.2    8e-18
ref|YP_682331.1|  hypothetical protein RD1_2043 [Roseobacter d...  93.2    9e-18 Gene info
ref|ZP_05341164.1|  chromosomal replication initiator, DnaA [T...  92.8    1e-17
ref|ZP_01879202.1|  Chromosomal replication initiator, DnaA [R...  92.8    1e-17
ref|YP_033749.1|  hypothetical protein BH09540 [Bartonella hen...  92.8    1e-17 Gene info
ref|YP_032365.1|  hypothetical protein BQ07360 [Bartonella qui...  92.8    1e-17 Gene info
ref|ZP_04594162.1|  ATP/GTP-binding protein [Brucella abortus ...  92.8    1e-17
ref|YP_414175.1|  ATP/GTP-binding protein [Brucella melitensis...  92.8    1e-17 Gene info
ref|ZP_01750886.1|  hypothetical protein RCCS2_14724 [Roseobac...  92.4    1e-17
ref|YP_508999.1|  chromosomal replication initiator, DnaA [Jan...  91.3    3e-17 Gene info
ref|ZP_02186823.1|  hypothetical protein BAL199_23699 [alpha p...  91.3    4e-17
ref|YP_001602256.1|  putative DNA replication [Gluconacetobact...  90.9    4e-17 Gene info
ref|NP_354161.1|  hypothetical protein Atu1143 [Agrobacterium ...  90.5    6e-17 Gene info
ref|ZP_01744729.1|  hypothetical protein SSE37_08803 [Sagittul...  90.1    6e-17
ref|ZP_05064458.1|  chromosomal replication initiator, DnaA [O...  90.1    7e-17
ref|YP_613851.1|  chromosomal replication initiator, DnaA [Sil...  89.4    1e-16 Gene info
ref|ZP_01034891.1|  hypothetical protein ROS217_23637 [Roseova...  89.0    1e-16
ref|NP_770763.1|  hypothetical protein bll4123 [Bradyrhizobium...  87.8    4e-16 Gene info
ref|YP_002544015.1|  DNA replication initiation ATPase protein...  87.8    4e-16 Gene info
ref|ZP_01741517.1|  hypothetical protein RB2150_05703 [Rhodoba...  87.4    4e-16
ref|YP_001832428.1|  chromosomal replication initiator DnaA [B...  87.0    6e-16 Gene info
ref|ZP_05740705.1|  chromosomal replication initiator, DnaA [S...  86.3    9e-16
ref|ZP_05780314.1|  chromosomal replication initiator, DnaA [C...  86.3    1e-15
ref|ZP_05784942.1|  chromosomal replication initiator, DnaA [S...  85.9    1e-15
ref|ZP_05101104.1|  chromosomal replication initiator, DnaA [R...  85.9    1e-15
ref|YP_001977714.1|  hypothetical protein RHECIAT_CH0001558 [R...  85.5    2e-15 Gene info
ref|ZP_03502669.1|  hypothetical protein RetlK5_25345 [Rhizobi...  85.1    2e-15
ref|ZP_00999761.1|  hypothetical protein OB2597_15345 [Oceanic...  84.7    3e-15
ref|ZP_01754885.1|  hypothetical protein RSK20926_22364 [Roseo...  84.7    3e-15
ref|ZP_03525121.1|  hypothetical protein RetlG_30801 [Rhizobiu...  84.3    4e-15
ref|YP_001938319.1|  hypothetical protein OTT_1627 [Orientia t...  83.2    8e-15 Gene info
ref|ZP_01902905.1|  prolyl-tRNA synthetase [Roseobacter sp. Az...  82.8    1e-14
ref|YP_002361291.1|  chromosomal replication initiator DnaA [M...  82.4    1e-14 Gene info
ref|ZP_01437760.1|  hypothetical protein FP2506_07946 [Fulvima...  82.4    1e-14
ref|YP_002975074.1|  hypothetical protein Rleg_1243 [Rhizobium...  82.4    1e-14 Gene info
ref|YP_002280617.1|  hypothetical protein Rleg2_1097 [Rhizobiu...  82.4    2e-14 Gene info
ref|YP_469020.1|  hypothetical protein RHE_CH01490 [Rhizobium ...  82.4    2e-14 Gene info
ref|YP_001418015.1|  chromosomal replication initiator, DnaA [...  82.0    2e-14 Gene info
ref|YP_767202.1|  hypothetical protein RL1598 [Rhizobium legum...  81.6    2e-14 Gene info
ref|ZP_05843891.1|  conserved hypothetical protein [Rhodobacte...  81.6    3e-14
ref|YP_001248575.1|  hypothetical protein OTBS_0856 [Orientia ...  81.6    3e-14 Gene info
ref|ZP_00958265.1|  hypothetical protein ISM_00520 [Roseovariu...  81.3    3e-14
ref|ZP_01057100.1|  hypothetical protein MED193_21806 [Roseoba...  81.3    3e-14
ref|ZP_01014108.1|  hypothetical protein RB2654_08417 [Rhodoba...  80.9    4e-14
ref|ZP_05077945.1|  chromosomal replication initiator, DnaA [R...  80.9    4e-14
ref|ZP_00962760.1|  hypothetical protein NAS141_17079 [Sulfito...  80.5    6e-14
ref|ZP_00955330.1|  hypothetical protein EE36_11853 [Sulfitoba...  80.5    6e-14
ref|YP_002130529.1|  DnaA-related protein [Phenylobacterium zu...  80.1    7e-14 Gene info
ref|YP_166369.1|  hypothetical protein SPO1118 [Ruegeria pomer...  80.1    8e-14 Gene info
ref|ZP_05073044.1|  chromosomal replication initiator, DnaA [R...  79.3    1e-13
ref|ZP_01002695.1|  hypothetical protein SKA53_01706 [Loktanel...  79.0    2e-13
ref|ZP_01157459.1|  hypothetical protein OG2516_02718 [Oceanic...  78.6    2e-13
ref|ZP_01443269.1|  hypothetical protein R2601_19280 [Roseovar...  78.2    3e-13
ref|ZP_00208394.1|  COG0593: ATPase involved in DNA replicatio...  77.8    4e-13
ref|YP_915102.1|  hypothetical protein Pden_1301 [Paracoccus d...  77.8    4e-13 Gene info
ref|YP_153645.1|  hypothetical protein AM296 [Anaplasma margin...  77.0    6e-13 Gene info
ref|YP_198561.1|  DNA replication initiation ATPase [Wolbachia...  77.0    7e-13 Gene info
ref|ZP_05276976.1|  hypothetical protein AmarM_01237 [Anaplasm...  76.6    7e-13
ref|ZP_00957811.1|  hypothetical protein OA2633_01079 [Oceanic...  75.9    2e-12
ref|ZP_02166259.1|  hypothetical protein HPDFL43_05395 [Hoefle...  75.5    2e-12
ref|ZP_00544945.1|  chromosomal DNA replication initiator-rela...  74.7    3e-12
ref|YP_180061.1|  hypothetical protein Erum1920 [Ehrlichia rum...  74.3    4e-12 Gene info
ref|YP_196114.1|  hypothetical protein ERGA_CDS_01880 [Ehrlich...  73.9    5e-12 Gene info
ref|YP_001495069.1|  hypothetical protein A1G_05380 [Rickettsi...  73.6    6e-12 Gene info
ref|YP_302842.1|  chromosomal DNA replication initiator-relate...  73.6    8e-12 Gene info
ref|YP_001532087.1|  chromosomal replication initiator, DnaA [...  73.6    8e-12 Gene info
ref|YP_001493755.1|  hypothetical protein A1C_04965 [Rickettsi...  73.2    9e-12 Gene info
ref|ZP_05033099.1|  chromosomal replication initiator protein ...  72.4    1e-11
ref|YP_246416.1|  hypothetical protein RF_0400 [Rickettsia fel...  72.4    1e-11 Gene info
ref|YP_002916944.1|  hypothetical protein RPR_07330 [Rickettsi...  72.0    2e-11 Gene info
ref|ZP_00142878.1|  hypothetical protein [Rickettsia sibirica ...  72.0    2e-11
ref|NP_360616.1|  hypothetical protein RC0979 [Rickettsia cono...  72.0    2e-11 Gene info
ref|YP_001492048.1|  hypothetical protein A1E_01590 [Rickettsi...  72.0    2e-11 Gene info
ref|NP_966862.1|  chromosomal DNA replication initiator-relate...  72.0    2e-11 Gene info
ref|NP_220996.1|  hypothetical protein RP631 [Rickettsia prowa...  71.6    3e-11 Gene info
ref|ZP_05089681.1|  chromosomal replication initiator, DnaA [R...  71.6    3e-11
ref|YP_756479.1|  regulatory inactivation of DnaA Hda protein ...  71.6    3e-11 Gene info
ref|ZP_04700094.1|  chromosomal replication initiator protein ...  70.5    6e-11
ref|YP_745855.1|  dnaA-related protein [Granulibacter bethesde...  70.5    6e-11 Gene info
ref|YP_001684177.1|  DnaA-related protein [Caulobacter sp. K31]    70.1    8e-11 Gene info
ref|YP_001975728.1|  chromosomal DNA replication initiator-rel...  69.3    1e-10 Gene info
ref|ZP_02144836.1|  Chromosomal replication initiator, DnaA [P...  68.9    2e-10
ref|YP_001499603.1|  hypothetical protein RMA_1009 [Rickettsia...  68.9    2e-10 Gene info
ref|ZP_02148293.1|  hypothetical protein RG210_13706 [Phaeobac...  68.6    3e-10
ref|YP_505556.1|  hypothetical protein APH_0994 [Anaplasma pha...  68.2    3e-10 Gene info
ref|NP_420519.1|  DnaA-related protein [Caulobacter crescentus...  67.0    7e-10 Gene info
ref|YP_067568.1|  hypothetical protein RT0622 [Rickettsia typh...  66.6    9e-10 Gene info
ref|YP_422206.1|  ATPase involved in DNA replication initiatio...  65.9    1e-09 Gene info
ref|YP_001260547.1|  ATPase involved in DNA replication initia...  65.9    2e-09 Gene info
ref|ZP_02153332.1|  hypothetical protein OIHEL45_10313 [Oceani...  62.4    2e-08
ref|YP_192329.1|  DnaA-related protein [Gluconobacter oxydans ...  62.4    2e-08 Gene info
ref|ZP_03509801.1|  hypothetical protein Retl8_04315 [Rhizobiu...  60.8    4e-08
ref|YP_003187406.1|  chromosomal replication initiator protein...  57.8    4e-07 Gene info
ref|ZP_01810846.1|  chromosomal replication initiator protein ...  57.4    5e-07
ref|YP_537706.1|  hypothetical protein RBE_0536 [Rickettsia be...  57.4    6e-07 Gene info
ref|YP_506085.1|  hypothetical protein NSE_0190 [Neorickettsia...  56.6    9e-07 Gene info
ref|YP_383714.1|  regulatory inactivation of DnaA Hda protein ...  55.5    2e-06 Gene info
ref|YP_616801.1|  ATPase involved in DNA replication initiatio...  53.5    7e-06 Gene info
ref|YP_002140109.1|  Chromosomal replication initiator DnaA [G...  53.5    8e-06 Gene info
ref|ZP_01304474.1|  ATPase [Sphingomonas sp. SKA58]                52.8    1e-05
ref|ZP_04772172.1|  Chromosomal replication initiator DnaA [As...  52.8    1e-05
ref|YP_073830.1|  chromosomal replication initiation protein [...  51.6    3e-05 Gene info
ref|ZP_02544196.1|  chromosomal replication initiation protein...  51.2    3e-05
ref|ZP_03705952.1|  hypothetical protein CLOSTMETH_00672 [Clos...  50.1    9e-05
ref|YP_162446.1|  ATPase [Zymomonas mobilis subsp. mobilis ZM4...  50.1    9e-05 Gene info
ref|YP_001086464.1|  chromosomal replication initiator protein...  49.7    1e-04 Gene info
ref|YP_002537777.1|  Chromosomal replication initiator DnaA [G...  49.3    1e-04 Gene info
ref|ZP_02862542.1|  hypothetical protein ANASTE_01761 [Anaerof...  48.9    2e-04
ref|ZP_02544284.1|  chromosomal replication initiator protein ...  48.5    2e-04
ref|YP_003020754.1|  Chromosomal replication initiator DnaA [G...  48.5    2e-04 Gene info
ref|ZP_05367563.1|  chromosomal replication initiator protein ...  48.5    3e-04
ref|YP_002246434.1|  chromosomal replication initiator protein...  48.1    3e-04 Gene info
ref|ZP_02204876.1|  Chromosomal replication initiator, DnaA [D...  47.4    6e-04
ref|YP_001235645.1|  ATPase involved in DNA replication initia...  47.0    6e-04 Gene info
ref|ZP_03294153.1|  hypothetical protein CLOHIR_02105 [Clostri...  47.0    8e-04
ref|ZP_02043881.1|  hypothetical protein ACTODO_00733 [Actinom...  46.2    0.001
ref|YP_001230186.1|  chromosomal replication initiator, DnaA [...  45.8    0.002 Gene info
ref|YP_190094.1|  chromosomal replication initiation protein [...  45.4    0.002 Gene info
ref|NP_763556.1|  chromosomal replication initiation protein [...  45.4    0.002 Gene info
ref|ZP_04825837.1|  replication initiation protein DnaA [Staph...  45.4    0.002
ref|ZP_02420170.1|  hypothetical protein ANACAC_02781 [Anaeros...  45.4    0.002
ref|ZP_05620623.1|  regulatory inactivation of DnaA Hda protei...  45.4    0.002
ref|ZP_04797700.1|  replication initiation protein DnaA [Staph...  45.1    0.002
ref|YP_001997630.1|  chromosomal replication initiator protein...  45.1    0.002 Gene info
ref|ZP_03305516.1|  hypothetical protein ANHYDRO_01958 [Anaero...  45.1    0.003
ref|YP_001740126.1|  chromosomal replication initiation protei...  45.1    0.003 Gene info
ref|ZP_03856479.1|  chromosomal replication initiator protein ...  45.1    0.003
ref|ZP_04497130.1|  chromosomal replication initiator protein ...  44.7    0.004
ref|ZP_03713128.1|  hypothetical protein EIKCOROL_00802 [Eiken...  44.7    0.004
ref|YP_002929494.1|  chromosomal replication initiator protein...  44.3    0.004 Gene info
ref|YP_821302.1|  chromosomal replication initiator protein Dn...  44.3    0.005 Gene info
ref|NP_660908.1|  chromosomal replication initiator protein Dn...  43.9    0.005 Gene info
ref|ZP_05313247.1|  Chromosomal replication initiator DnaA [Ge...  43.9    0.007
ref|ZP_03394440.1|  chromosomal replication initiator protein ...  43.5    0.007
ref|ZP_04054956.1|  chromosomal replication initiator protein ...  43.5    0.008
ref|YP_003146861.1|  DnaA regulatory inactivator Hda [Kangiell...  43.5    0.009 Gene info
ref|NP_621714.1|  chromosomal replication initiation protein [...  43.5    0.009 Gene info
ref|ZP_05092288.1|  chromosomal replication initiator protein ...  43.1    0.009
ref|NP_777651.1|  chromosomal replication initiator protein Dn...  43.1    0.010 Gene info
ref|ZP_05733873.1|  ATPase [Dialister invisus DSM 15470]           43.1    0.010
ref|YP_901985.1|  chromosomal replication initiator, DnaA [Pel...  43.1    0.010 Gene info
ref|ZP_05916223.1|  conserved hypothetical protein [Prevotella...  43.1    0.010
ref|ZP_04390413.1|  chromosomal replication initiator protein ...  43.1    0.011
ref|ZP_04036298.1|  chromosomal replication initiator protein ...  43.1    0.012
ref|YP_001958471.1|  chromosomal replication initiator protein...  42.7    0.012 Gene info
ref|ZP_05473305.1|  ATPase involved in DNA replication initiat...  42.7    0.012
ref|ZP_05854730.1|  DNA replication initiator protein, ATPase ...  42.7    0.014
ref|ZP_05626241.1|  chromosomal replication initiator protein ...  42.7    0.014
ref|ZP_04494376.1|  ABC-type antimicrobial peptide transport s...  42.7    0.014
ref|YP_479125.1|  chromosomal replication initiator protein Dn...  42.7    0.014 Gene info
ref|ZP_04423395.1|  chromosomal replication initiator protein ...  42.7    0.014
ref|YP_114933.1|  DnaA domain-containing protein [Methylococcu...  42.7    0.014 Gene info
ref|ZP_02162551.1|  chromosomal replication initiator protein ...  42.7    0.015
ref|YP_002476007.1|  chromosomal replication initiator protein...  42.4    0.016 Gene info
ref|YP_001557131.1|  chromosomal replication initiator protein...  42.4    0.016 Gene info
ref|ZP_03497736.1|  chromosomal replication initiator protein ...  42.4    0.017
ref|ZP_04958891.1|  DnaA regulatory inactivator Hda [gamma pro...  42.4    0.018
ref|ZP_02477661.1|  DNA polymerase III subunit beta [Haemophil...  42.4    0.018
ref|ZP_05288690.1|  chromosomal replication initiation protein...  42.4    0.018
ref|ZP_04818176.1|  replication initiation protein DnaA [Staph...  42.4    0.020
ref|YP_910502.1|  chromosomal replication initiation protein [...  42.4    0.020 Gene info
ref|YP_001301418.1|  chromosomal replication initiation protei...  42.0    0.021 Gene info
ref|ZP_02637629.2|  chromosomal replication initiator protein ...  42.0    0.021
ref|ZP_01871827.1|  chromosomal replication initiation protein...  42.0    0.022
ref|YP_001952410.1|  Chromosomal replication initiator DnaA [G...  42.0    0.025 Gene info
ref|YP_003189589.1|  chromosomal replication initiator protein...  42.0    0.026 Gene info
ref|ZP_02183050.1|  chromosomal replication initiator protein ...  41.6    0.026
ref|ZP_05009732.1|  chromosomal replication initiator protein ...  41.6    0.027
ref|YP_002014714.1|  chromosomal replication initiator protein...  41.6    0.028 Gene info
ref|YP_002606443.1|  chromosomal replication initiator protein...  41.6    0.030 Gene info
ref|NP_952131.1|  chromosomal replication initiator protein Dn...  41.6    0.030 Gene info
ref|ZP_03613530.1|  chromosomal replication initiator protein ...  41.6    0.031
ref|YP_293876.1|  hypothetical protein EhV122 [Emiliania huxle...  41.6    0.031 Gene info
ref|ZP_05488303.1|  chromosomal replication initiation protein...  41.6    0.032
ref|YP_799517.1|  response regulator [Leptospira borgpeterseni...  41.2    0.034 Gene info
ref|YP_001664010.1|  chromosomal replication initiation protei...  41.2    0.034 Gene info
ref|ZP_05492333.1|  chromosomal replication initiator protein ...  41.2    0.035
ref|ZP_05801527.1|  chromosomal replication initiator protein ...  41.2    0.035
ref|ZP_04694607.1|  chromosomal replication initiation protein...  41.2    0.035
ref|YP_001825212.1|  chromosomal replication initiation protei...  41.2    0.035 Gene info
ref|ZP_05334558.1|  chromosomal replication initiator protein ...  41.2    0.036
ref|ZP_03672298.1|  chromosomal replication initiator protein ...  41.2    0.037
ref|ZP_05982379.1|  DnaA regulatory inactivator Hda [Neisseria...  41.2    0.038
ref|YP_016331.1|  chromosomal replication initiator protein Dn...  41.2    0.039 Gene info
ref|YP_145239.1|  chromosomal replication initiator protein Dn...  41.2    0.040 Gene info
ref|ZP_05540153.1|  chromosomal replication initiation protein...  41.2    0.040
ref|ZP_05532760.1|...  41.2    0.040
ref|ZP_05525044.1|  chromosomal replication initiation protein...  41.2    0.040
ref|ZP_04687128.1|  chromosomal replication initiation protein...  41.2    0.040
ref|ZP_05000111.1|  chromosomal replication initiator protein ...  41.2    0.040
ref|NP_733620.1|  chromosomal replication initiator protein [S...  41.2    0.040 Gene info
ref|NP_825493.1|  chromosomal replication initiation protein [...  41.2    0.040 Gene info
ref|YP_679591.1|  chromosomal replication initiator protein Dn...  41.2    0.040 Gene info
ref|ZP_04431375.1|  chromosomal replication initiator protein ...  41.2    0.041
ref|YP_005577.1|  chromosomal replication initiator protein dn...  41.2    0.041 Gene info
ref|YP_002261571.1|  chromosomal replication initiation protei...  41.2    0.042 Gene info
ref|ZP_05902143.1|  DNA replication initiator protein, ATPase ...  41.2    0.043
ref|ZP_03784301.1|  hypothetical protein RUMHYD_03784 [Blautia...  41.2    0.044
ref|ZP_02172049.1|  ATPase involved in DNA replication initiat...  40.8    0.045
ref|YP_463216.1|  chromosomal replication initiator protein Dn...  40.8    0.045 Gene info
ref|NP_219755.1|  chromosomal replication initiation protein [...  40.8    0.046 Gene info
ref|ZP_05858618.1|  DNA replication initiator protein, ATPase ...  40.8    0.048
ref|ZP_05791505.1|  chromosomal replication initiator protein ...  40.8    0.048
ref|YP_001994920.1|  chromosomal replication initiator protein...  40.8    0.049 Gene info
ref|ZP_03656821.1|  chromosomal replication initiation protein...  40.8    0.049
ref|NP_560917.1|  chromosomal replication initiation protein [...  40.8    0.049 Gene info
ref|YP_002769482.1|  chromosomal replication initiator protein...  40.8    0.050 Gene info
ref|YP_002308675.1|  chromosomal replication initiation protei...  40.8    0.050 Gene info
ref|ZP_02177524.1|  chromosome replication initiator protein D...  40.8    0.050
ref|YP_002490428.1|  chromosomal replication initiator protein...  40.8    0.051 Gene info
ref|YP_697352.1|  chromosomal replication initiation protein [...  40.8    0.051 Gene info
ref|YP_002132373.1|  chromosomal replication initiator protein...  40.8    0.052 Gene info
ref|ZP_02633741.1|  chromosomal replication initiator protein ...  40.8    0.052
ref|ZP_01915944.1|  hypothetical protein LMED105_15843 [Limnob...  40.8    0.052
ref|YP_709882.1|  chromosomal replication initiator protein [B...  40.8    0.052 Gene info
ref|YP_001219106.1|  DnaA family protein [Candidatus Vesicomyo...  40.8    0.054 Gene info
ref|ZP_03743402.1|  hypothetical protein BIFPSEUDO_03996 [Bifi...  40.8    0.056
ref|YP_003084439.1|  chromosomal replication initiator protein...  40.4    0.060 Gene info
ref|ZP_05507713.1|  chromosomal replication initiation protein...  40.4    0.062
ref|ZP_04703311.1|  chromosomal replication initiation protein...  40.4    0.062
ref|NP_787129.1|  chromosomal replication initiator protein [T...  40.4    0.063 Gene info
ref|ZP_04598649.1|  hypothetical protein VEIDISOL_00047 [Veill...  40.4    0.067
ref|ZP_01724187.1|  chromosomal replication initiation protein...  40.4    0.070
ref|ZP_04577635.1|  chromosomal replication initiator protein ...  40.0    0.078
ref|ZP_02438917.1|  hypothetical protein CLOSS21_01381 [Clostr...  40.0    0.078
ref|YP_002522376.1|  chromosomal replication initiator protein...  40.0    0.081 Gene info
ref|ZP_03539219.1|  chromosomal replication initiator protein ...  40.0    0.082
ref|YP_428885.1|  chromosomal replication initiation protein [...  40.0    0.082 Gene info
ref|ZP_05108448.1|  chromosomal replication initiator protein ...  40.0    0.082
ref|ZP_05360646.1|  DnaA regulatory inactivator Hda [Acinetoba...  40.0    0.083
ref|ZP_04231609.1|  Chromosomal replication initiator protein ...  40.0    0.085
ref|YP_072879.1|  chromosomal replication initiator protein [B...  40.0    0.087 Gene info
ref|ZP_05613491.1|  DNA replication initiator protein, ATPase ...  40.0    0.088
ref|ZP_04056409.1|  chromosomal replication initiator protein ...  40.0    0.088
ref|YP_752731.1|  initiation of chromosome replication [Syntro...  40.0    0.088 Gene info
ref|ZP_03540070.1|  chromosomal replication initiator protein ...  40.0    0.090
ref|ZP_01173955.1|  chromosomal replication initiation protein...  40.0    0.090
ref|ZP_04019773.1|  replication initiation protein DnaA [Fineg...  40.0    0.091
ref|YP_001210551.1|  chromosomal replication initiation protei...  40.0    0.092 Gene info
ref|ZP_05621339.1|  chromosomal replication initiator protein ...  40.0    0.093
ref|ZP_02917541.1|  hypothetical protein BIFDEN_00825 [Bifidob...  40.0    0.094
ref|YP_002152822.1|  chromosomal replication initiator protein...  40.0    0.095 Gene info
ref|ZP_01860769.1|  chromosomal replication initiation protein...  40.0    0.096
ref|ZP_02091496.1|  hypothetical protein FAEPRAM212_01776 [Fae...  40.0    0.096
ref|ZP_03802438.1|  hypothetical protein PROPEN_00780 [Proteus...  40.0    0.097
ref|YP_001156864.1|  chromosomal replication initiator protein...  40.0    0.097 Gene info
ref|ZP_03855113.1|  chromosomal replication initiator protein ...  39.7    0.099
ref|YP_710300.1|  chromosomal replication initiator protein [F...  39.7    0.10  Gene info
ref|ZP_01719220.1|  chromosomal replication initiator protein ...  39.7    0.10 
ref|XP_001025889.1|  ABC transporter family protein [Tetrahyme...  39.7    0.10  Gene info
ref|ZP_03148590.1|  chromosomal replication initiator protein ...  39.7    0.11 
ref|YP_003183455.1|  chromosomal replication initiator protein...  39.7    0.11  Gene info
ref|YP_001474178.1|  DNA replication initiation factor [Shewan...  39.7    0.11  Gene info
ref|YP_001317903.1|  chromosomal replication initiation protei...  39.7    0.11  Gene info
ref|ZP_03495117.1|  chromosomal replication initiator protein ...  39.7    0.11 
ref|ZP_05380616.1|  chromosomal replication initiation protein...  39.7    0.11 
ref|YP_594392.1|  recombination factor protein RarA [Lawsonia ...  39.7    0.11  Gene info
ref|ZP_03323277.1|  hypothetical protein BIFCAT_00035 [Bifidob...  39.7    0.12 
ref|ZP_01734413.1|  chromosomal replication initiator protein ...  39.7    0.12 
ref|YP_001812506.1|  chromosomal replication initiator protein...  39.7    0.13  Gene info
ref|YP_145854.1|  chromosomal replication initiation protein [...  39.7    0.13  Gene info
ref|YP_002948209.1|  chromosomal replication initiator protein...  39.7    0.13  Gene info
ref|YP_001124133.1|  chromosomal replication initiation protei...  39.7    0.13  Gene info
ref|ZP_04391634.1|  chromosomal replication initiator protein ...  39.3    0.13 
ref|YP_892930.1|  chromosomal replication initiation protein [...  39.3    0.13  Gene info
ref|YP_002443553.1|  chromosomal replication initiator protein...  39.3    0.13  Gene info
ref|NP_240867.1|  chromosomal replication initiation protein [...  39.3    0.13  Gene info
ref|YP_002016977.1|  chromosomal replication initiator protein...  39.3    0.13  Gene info
ref|ZP_00741721.1|  Chromosomal replication initiator protein ...  39.3    0.13 
ref|YP_750439.1|  DNA replication initiation factor [Shewanell...  39.3    0.14  Gene info
ref|YP_603474.1|  chromosomal replication initiator protein Dn...  39.3    0.14  Gene info
ref|NP_829910.1|  chromosomal replication initiation protein [...  39.3    0.14  Gene info
ref|ZP_03129124.1|  chromosomal replication initiator protein ...  39.3    0.14 
ref|ZP_05373592.1|  chromosomal replication initiator protein ...  39.3    0.14 
ref|ZP_01129166.1|  chromosomal replication initiator protein ...  39.3    0.14 
ref|YP_002314370.1|  DNA replication initiation ATPase [Anoxyb...  39.3    0.14  Gene info
ref|ZP_02079817.1|  hypothetical protein CLOLEP_01262 [Clostri...  39.3    0.14 
ref|ZP_04105170.1|  Chromosomal replication initiator protein ...  39.3    0.14 
ref|YP_001642898.1|  chromosomal replication initiation protei...  39.3    0.14  Gene info
ref|ZP_04172412.1|  Chromosomal replication initiator protein ...  39.3    0.14 
ref|NP_904360.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|YP_415519.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|NP_370525.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|YP_039478.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|YP_003108649.1|  chromosomal replication initiator protein...  39.3    0.15  Gene info
ref|ZP_04189093.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|ZP_04292368.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|ZP_04303657.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|ZP_04248324.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|ZP_04230839.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|YP_879298.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|NP_842573.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|ZP_04154108.1|  Chromosomal replication initiator protein ...  39.3    0.15 
ref|YP_003162929.1|  chromosomal replication initiator protein...  39.3    0.15  Gene info
ref|NP_976329.1|  chromosomal replication initiation protein [...  39.3    0.15  Gene info
ref|ZP_04148803.1|  Chromosomal replication initiator protein ...  39.3    0.16 
ref|YP_001373372.1|  chromosomal replication initiation protei...  39.3    0.16  Gene info
ref|YP_002747436.1|  chromosomal replication initiator protein...  39.3    0.16  Gene info
ref|NP_829340.1|  chromosomal replication initiation protein [...  39.3    0.16  Gene info
ref|YP_945434.1|  chromosomal replication initiator protein Dn...  39.3    0.16  Gene info
ref|ZP_05241189.2|  chromosomal replication initiator protein ...  39.3    0.16 
ref|YP_378323.1|  chromosomal replication initiator protein, D...  39.3    0.16  Gene info
ref|ZP_03589579.1|  chromosomal replication initiator protein ...  39.3    0.16 
ref|ZP_04420675.1|  chromosomal replication initiator protein ...  39.3    0.16 
ref|YP_001691309.1|  chromosomal replication initiation protei...  39.3    0.16  Gene info
ref|ZP_04862148.1|  chromosomal replication initiator protein ...  39.3    0.17 
ref|NP_296898.1|  chromosomal replication initiation protein [...  38.9    0.17  Gene info
ref|YP_001942088.1|  chromosomal replication initiator protein...  38.9    0.17  Gene info
ref|ZP_02621912.1|  chromosomal replication initiator protein ...  38.9    0.17 
ref|ZP_04334688.1|  chromosomal replication initiator protein ...  38.9    0.17 
ref|ZP_00231000.1|  chromosomal replication initiator protein ...  38.9    0.17 
ref|NP_469348.1|  chromosomal replication initiation protein [...  38.9    0.17  Gene info
ref|NP_463534.1|  chromosomal replication initiation protein [...  38.9    0.17  Gene info
ref|ZP_01913640.1|  chromosomal replication initiation protein...  38.9    0.17 
ref|ZP_03671383.1|  chromosomal replication initiation protein...  38.9    0.18 
ref|YP_002756747.1|  Chromosomal replication initiation protei...  38.9    0.18  Gene info
ref|YP_001393436.1|  chromosomal replication initiation protei...  38.9    0.18  Gene info
ref|ZP_04129624.1|  Chromosomal replication initiator protein ...  38.9    0.18 
ref|YP_003060296.1|  ATPase-like protein involved in DNA repli...  38.9    0.19  Gene info
ref|YP_003238028.1|  chromosomal replication initiator protein...  38.9    0.20  Gene info
ref|ZP_05313291.1|  chromosomal replication initiator protein ...  38.9    0.20 
ref|YP_002886101.1|  chromosomal replication initiator protein...  38.9    0.20  Gene info
ref|YP_001359757.1|  chromosomal replication initiator protein...  38.9    0.20  Gene info
ref|YP_908864.1|  chromosomal replication initiation protein [...  38.9    0.20  Gene info
ref|YP_003196207.1|  chromosomal replication initiation protei...  38.9    0.20 
ref|ZP_04445037.1|  DNA-directed DNA replication initiator pro...  38.9    0.21 
ref|YP_002784551.1|  putative chromosomal replication initiato...  38.9    0.21  Gene info
ref|ZP_01453679.1|  chromosomal replication initiator protein ...  38.9    0.21 
ref|ZP_00234805.1|  chromosomal replication initiator protein ...  38.9    0.21 
ref|YP_001654579.1|  chromosomal replication initiation protei...  38.9    0.21  Gene info
ref|ZP_02210474.1|  hypothetical protein CLOBAR_00011 [Clostri...  38.9    0.21 
ref|YP_002222085.1|  chromosomal replication initiator protein...  38.9    0.22  Gene info
ref|YP_001419680.1|  chromosomal replication initiation protei...  38.9    0.22  Gene info
ref|ZP_03718030.1|  hypothetical protein EUBHAL_03125 [Eubacte...  38.5    0.22 
ref|YP_002222894.1|  chromosomal replication initiator protein...  38.5    0.22  Gene info
ref|NP_387882.1|  chromosomal replication initiation protein [...  38.5    0.22  Gene info
ref|ZP_04058879.1|  chromosomal replication initiator protein ...  38.5    0.22 
ref|ZP_03224732.1|  chromosomal replication initiation protein...  38.5    0.22 
ref|YP_589080.1|  chromosomal replication initiator protein Dn...  38.5    0.23  Gene info
ref|ZP_05818971.1|  chromosomal replication initiator protein ...  38.5    0.23 
ref|YP_002334070.1|  chromosomal replication initiator protein...  38.5    0.24  Gene info
ref|ZP_00951198.1|  chromosomal replication initiation protein...  38.5    0.24 
ref|YP_001129532.1|  chromosomal replication initiator protein...  38.5    0.24  Gene info
ref|ZP_03054932.1|  chromosomal replication initiator protein ...  38.5    0.25 
ref|YP_001485261.1|  chromosomal replication initiation protei...  38.5    0.25  Gene info
ref|YP_002461390.1|  chromosomal replication initiator protein...  38.5    0.25  Gene info
ref|ZP_04833456.1|  chromosomal replication initiator protein ...  38.5    0.26 
ref|YP_002136830.1|  chromosomal replication initiator protein...  38.5    0.26  Gene info
ref|YP_003019846.1|  chromosomal replication initiator protein...  38.5    0.26  Gene info
ref|NP_970618.1|  chromosomal replication initiator protein Dn...  38.5    0.27  Gene info
ref|NP_224514.1|  chromosomal replication initiation protein [...  38.5    0.27  Gene info
ref|ZP_04030244.1|  chromosomal replication initiator protein ...  38.5    0.27 
ref|YP_002755176.1|  chromosomal replication initiator protein...  38.5    0.28  Gene info
ref|YP_249768.1|  chromosomal replication initiator protein [C...  38.5    0.28  Gene info
ref|ZP_03463180.1|  hypothetical protein BACPEC_02270 [Bactero...  38.5    0.28 
ref|NP_300368.1|  chromosomal replication initiation protein [...  38.5    0.28  Gene info
ref|NP_927377.1|  chromosomal replication initiation protein [...  38.1    0.29  Gene info
ref|ZP_02206374.1|  hypothetical protein COPEUT_01140 [Coproco...  38.1    0.29 
ref|YP_077283.1|  chromosomal replication initiation protein [...  38.1    0.29  Gene info
ref|YP_001799395.1|  chromosomal replication initiator protein...  38.1    0.30  Gene info
ref|ZP_05919255.1|  ribosomal subunit interface protein [Paste...  38.1    0.30 
ref|YP_001633648.1|  chromosomal replication initiator protein...  38.1    0.30  Gene info
ref|ZP_05405230.1|  ATPase [Mitsuokella multacida DSM 20544]       38.1    0.31 
ref|YP_251916.1|  chromosomal replication initiation protein [...  38.1    0.31  Gene info
ref|YP_001957188.1|  chromosomal replication initiator protein...  38.1    0.32  Gene info
ref|ZP_04037866.1|  chromosomal replication initiator protein ...  38.1    0.32 
ref|YP_003240118.1|  chromosomal replication initiator protein...  38.1    0.32 
ref|YP_003159983.1|  chromosomal replication initiator protein...  38.1    0.33  Gene info
ref|YP_003038840.1|  chromosomal replication initiator protein...  38.1    0.33  Gene info
ref|YP_087677.1|  chromosomal replication initiation protein [...  38.1    0.33  Gene info
ref|NP_293728.1|  chromosomal replication initiator protein [D...  38.1    0.33  Gene info
ref|ZP_02442889.1|  hypothetical protein ANACOL_02189 [Anaerot...  38.1    0.33 
ref|ZP_00993215.1|  chromosomal replication initiation protein...  38.1    0.33 
ref|NP_873353.1|  chromosomal replication initiator protein [H...  38.1    0.33  Gene info
ref|ZP_01816693.1|  chromosomal replication initiation protein...  38.1    0.34 
ref|NP_811056.1|  chromosomal replication initiation protein [...  38.1    0.34  Gene info
ref|ZP_04858347.1|  conserved hypothetical protein [Ruminococc...  38.1    0.35 
ref|YP_376018.1|  chromosomal replication initiator protein, D...  38.1    0.35  Gene info
ref|ZP_02618391.1|  chromosomal replication initiator protein ...  38.1    0.35 
ref|NP_780810.2|  chromosomal replication initiation protein [...  38.1    0.35  Gene info
ref|YP_860675.1|  chromosomal replication initiation protein [...  38.1    0.35  Gene info
ref|YP_001647396.1|  ABC transporter related [Bacillus weihens...  38.1    0.36  Gene info
ref|NP_932804.1|  chromosomal replication initiation protein [...  38.1    0.37  Gene info
ref|ZP_03916073.1|  DNA-directed DNA replication initiator pro...  38.1    0.37 
ref|ZP_03638779.1|  hypothetical protein PROVRETT_01866 [Provi...  38.1    0.37 
ref|ZP_03734593.1|  chromosomal replication initiator protein ...  37.7    0.38 
ref|ZP_05847432.1|  replication initiator protein [Corynebacte...  37.7    0.39 
ref|YP_001292917.1|  chromosomal replication initiation protei...  37.7    0.39  Gene info
ref|ZP_02093807.1|  hypothetical protein PEPMIC_00562 [Parvimo...  37.7    0.40 
ref|ZP_01789880.1|  chromosomal replication initiation protein...  37.7    0.40 
ref|ZP_05905896.1|  chromosomal replication initiation protein...  37.7    0.40 
ref|ZP_03647274.1|  ATPase for DNA replication initiation [Bif...  37.7    0.40 
ref|ZP_00155715.2|  COG0593: ATPase involved in DNA replicatio...  37.7    0.40 
ref|ZP_01796250.1|  chromosomal replication initiation protein...  37.7    0.41 
ref|ZP_05849724.1|  chromosomal replication initiator protein ...  37.7    0.42 
ref|ZP_02958665.1|  hypothetical protein PROSTU_00415 [Provide...  37.7    0.42 
ref|YP_460048.1|  chromosomal replication initiator protein [S...  37.7    0.42  Gene info
ref|ZP_01105990.1|  chromosomal replication initiation protein...  37.7    0.42 
ref|ZP_05974386.1|  chromosomal replication initiation protein...  37.7    0.42 
ref|YP_001534928.1|  chromosomal replication initiator protein...  37.7    0.43  Gene info
ref|ZP_01065491.1|  chromosomal replication initiation protein...  37.7    0.43 
ref|ZP_01792960.1|  chromosomal replication initiation protein...  37.7    0.43 
ref|ZP_01788114.1|  chromosomal replication initiation protein...  37.7    0.44 
ref|YP_203392.1|  chromosomal replication initiation protein [...  37.7    0.44  Gene info
ref|NP_439156.1|  chromosomal replication initiation protein [...  37.7    0.44  GeoGene info
ref|ZP_04466163.1|  chromosomal replication initiation protein...  37.7    0.44 
ref|ZP_03861890.1|  chromosomal replication initiator protein ...  37.7    0.44 
ref|ZP_05883881.1|  chromosomal replication initiator protein ...  37.7    0.44 
ref|ZP_04851196.1|  chromosomal replication initiator protein ...  37.7    0.44 
ref|NP_759961.1|  chromosomal replication initiation protein [...  37.7    0.44  Gene info
ref|ZP_04452933.1|  hypothetical protein GCWU000182_02248 [Abi...  37.7    0.45 
ref|YP_001443684.1|  chromosomal replication initiation protei...  37.7    0.46  Gene info
ref|NP_796390.1|  chromosomal replication initiation protein [...  37.7    0.47  Gene info
ref|YP_219873.1|  chromosomal replication initiation protein [...  37.7    0.47  Gene info
ref|ZP_01785871.1|  chromosomal replication initiation protein...  37.7    0.48 
ref|YP_002507759.1|  chromosomal replication initiator protein...  37.7    0.48  Gene info
ref|ZP_05365133.1|  chromosomal replication initiator protein ...  37.7    0.49 
ref|YP_001038766.1|  chromosomal replication initiation protei...  37.7    0.49  Gene info
ref|ZP_03320740.1|  hypothetical protein PROVALCAL_03707 [Prov...  37.4    0.49 
ref|ZP_01135253.1|  DNA replication initiator protein [Pseudoa...  37.4    0.49 
ref|ZP_05428875.1|  chromosomal replication initiator protein ...  37.4    0.49 
ref|YP_054724.1|  chromosomal replication initiator protein Dn...  37.4    0.49  Gene info
ref|ZP_05131127.1|  ABC transporter [Clostridium sp. 7_2_43FAA]    37.4    0.50 
ref|NP_714908.1|  FIS family transcriptional regulator [Leptos...  37.4    0.51  Gene info
ref|ZP_05943214.1|  chromosomal replication initiator protein ...  37.4    0.51 
ref|ZP_04744343.2|  DNA replication initiator protein, ATPase ...  37.4    0.51 
ref|YP_001389370.1|  chromosomal replication initiation protei...  37.4    0.51  Gene info
ref|ZP_04579794.1|  chromosomal replication initiator protein ...  37.4    0.52 
ref|ZP_03675230.1|  chromosomal replication initiator protein ...  37.4    0.52 
ref|ZP_01262276.1|  chromosomal replication initiation protein...  37.4    0.52 
ref|YP_003248098.1|  chromosomal replication initiator protein...  37.4    0.53 
ref|ZP_03150313.1|  chromosomal replication initiator protein ...  37.4    0.54 
ref|ZP_03920689.1|  chromosomal replication initiation protein...  37.4    0.55 
ref|YP_001377205.1|  chromosomal replication initiator protein...  37.4    0.55  Gene info
ref|NP_690922.1|  chromosomal replication initiation protein [...  37.4    0.55  Gene info
ref|YP_002154781.1|  chromosomal replication initiator protein...  37.4    0.56  Gene info
ref|YP_515451.1|  chromosomal replication initiation protein [...  37.4    0.56  Gene info
ref|YP_001785336.1|  chromosomal replication initiator protein...  37.4    0.56  Gene info
ref|ZP_01119170.1|  chromosomal replication initiation protein...  37.4    0.56 
ref|YP_173505.1|  chromosomal replication initiation protein [...  37.4    0.57  Gene info
ref|ZP_04504935.1|  chromosomal replication initiator protein ...  37.4    0.57 
ref|ZP_01747128.1|  hypothetical protein SSE37_06629 [Sagittul...  37.4    0.57 


Alignments Select All Get selected sequences Distance tree of results Multiple alignment New

>ref|ZP_01264118.1| probable ATPase involved in DNA replication initiation [Candidatus Pelagibacter ubique HTCC1002] Length=224 Score = 126 bits (317), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 65/184 (35%), Positives = 110/184 (59%), Gaps = 1/184 (0%) Query 4 MSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNIL 63 ++QL+ F ++ + + D+YV +NF A+++I WP W ++NI G GK+HL NI Sbjct 8 LNQLLLDFNYEQNFKDDDFYVGKSNFYAFEMINKWPKWEKNFLNINGEKFSGKSHLVNIF 67 Query 64 KKKINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVIN 123 KK N + I + ++ DE I + +++++ NINEK YS+ N Q + ++++ Sbjct 68 LKKFNGIRI-DVNSLNDENIKSIKPYQNIVLEDLNLNINEKLIYSLFNIIDQDNKFLIVT 126 Query 124 SFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIK 183 S PI +I F+L+DLRSR + + I+ P D+L+ +I K SD+QI ++ K+ +IIK Sbjct 127 SMKPISEINFELEDLRSRTKNCLFANIQNPDDELMFALILKNLSDRQITLDKKLINFIIK 186 Query 184 NTER 187 ER Sbjct 187 RIER 190 >ref|YP_266143.1| Gene info ATPase involved in DNA replication initiation [Candidatus Pelagibacter ubique HTCC1062] Length=220 GENE ID: 3517911 SAR11_0721 | ATPase involved in DNA replication initiation [Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links) Score = 125 bits (314), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 65/184 (35%), Positives = 109/184 (59%), Gaps = 1/184 (0%) Query 4 MSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNIL 63 ++QL+ F ++ + + D+YV +NF A+++I WP W ++NI G GK+HL NI Sbjct 4 LNQLLLDFNYEQNFKDDDFYVGKSNFYAFEMINKWPKWEKNFLNINGEKFSGKSHLVNIF 63 Query 64 KKKINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVIN 123 KK N + I + ++ DE I + +++++ NINEK YS+ N Q + ++++ Sbjct 64 LKKFNGIRI-DVNSLNDENIKSIKPYQNIVLEDLNLNINEKLIYSLFNIIDQDNKFLIVT 122 Query 124 SFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIK 183 S PI +I F L+DLRSR + + I+ P D+L+ +I K SD+QI ++ K+ +IIK Sbjct 123 SMKPISEINFKLEDLRSRTKNCLFANIQNPDDELMFALILKNLSDRQITLDKKLINFIIK 182 Query 184 NTER 187 ER Sbjct 183 RIER 186 >ref|YP_427250.1| Gene info regulatory inactivation of DnaA Hda protein [Rhodospirillum rubrum ATCC 11170] Length=228 GENE ID: 3835590 Rru_A2163 | regulatory inactivation of DnaA Hda protein [Rhodospirillum rubrum ATCC 11170] Score = 124 bits (310), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 52/183 (28%), Positives = 97/183 (53%), Gaps = 1/183 (0%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL P++ + + V++ N SA L+E+WP+WP I GPTG GKTHL+ + Sbjct 6 QLPLDLPWRPALGREHFLVAACNASAVALVEAWPHWPAPAACIHGPTGAGKTHLAQVFAT 65 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEK-NINEKTFYSILNSSKQLDTYIVINS 124 + +V + A + + ++ FE +I++ ++ + E T + +LN+++Q +++ + Sbjct 66 RAAAVVLDPAVILGTDPLTLFEGGRAAVIEDADRAGLPEATLFHLLNAARQRGGSLLLTA 125 Query 125 FLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKN 184 P L DLRSR + G+ P D+L+ ++ K FSD+ +++ P Y++ Sbjct 126 LSPPARWGVHLADLRSRLAALPAEGLCEPDDELMAAVLLKLFSDRGLDVAPGAIGYLLPR 185 Query 185 TER 187 ER Sbjct 186 MER 188 >ref|ZP_01547553.1| hypothetical protein SIAM614_11568 [Stappia aggregata IAM 12614] Length=226 Score = 118 bits (295), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 54/182 (29%), Positives = 94/182 (51%), Gaps = 1/182 (0%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL + P + DY V +N +A++L+E WP+WP V + GP G GKTHL + Sbjct 7 QLPLELPHEAALSRDDYLVGGSNRAAFELLERWPDWPSPVVVLAGPVGAGKTHLVRAFQD 66 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVINSF 125 + +V +L A +T ++ +I++ I+ + +LN+++Q ++I S Sbjct 67 ETGAV-VLPAAELTPHSVQTLVAAPACVIEDAHLGIDNTALFHLLNAARQAGKTVLITSR 125 Query 126 LPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNT 185 K L DL+SR + + I P DDLL ++ K F+D+QI ++ + +Y++ Sbjct 126 TWPASWKISLADLQSRLRAATPVEILEPDDDLLRRVLVKLFADRQIAVDQGVVDYLVVRM 185 Query 186 ER 187 ER Sbjct 186 ER 187 >ref|ZP_05117252.1| hypothetical protein SADFL11_5141 [Labrenzia alexandrii DFL-11] Length=226 Score = 117 bits (294), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 51/182 (28%), Positives = 95/182 (52%), Gaps = 1/182 (0%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL P +DY V +N +A++L+E WP+WP + + GP G GKTHL + Sbjct 7 QLPLDLPHDAALGREDYLVGKSNQAAFELLERWPDWPSPVIILAGPVGSGKTHLVEAFRD 66 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVINSF 125 + + E++ A ++T+ +S ++++ + +N + +LN+++Q ++I S Sbjct 67 ETGA-EVIQARDLTEAGVSALVAAPACVVEDAHRGVNNTALFHLLNAARQAGKTVLITSR 125 Query 126 LPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNT 185 K L DL SR + + + P DDLL ++ K F+D+QI ++ + +Y++ Sbjct 126 TWPASWKISLPDLLSRLRAATPVEVLEPDDDLLRRVLVKLFADRQIGVDIGVVDYLVVRM 185 Query 186 ER 187 ER Sbjct 186 ER 187 >ref|YP_318208.1| Gene info hypothetical protein Nwi_1595 [Nitrobacter winogradskyi Nb-255] Length=226 GENE ID: 3675967 Nwi_1595 | hypothetical protein [Nitrobacter winogradskyi Nb-255] (10 or fewer PubMed links) Score = 117 bits (293), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 54/183 (29%), Positives = 98/183 (53%), Gaps = 2/183 (1%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL F P + D+ N +A LIESWP WP++ + + GP GCGK+HL+ I + Sbjct 9 QLAFTLPHAESFSRDDFLEGPANAAALSLIESWPEWPNRIMLLAGPEGCGKSHLAAIWAE 68 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNY-EKNINEKTFYSILNSSKQLDTYIVINS 124 + + I +A+ +T T+ L++++ K +E + ++N +++ ++++ + Sbjct 69 RAGARSI-SAQGLTAATVPMALTTGALVVEDLNPKTFDELALFHLMNLAREEAAFVLMTA 127 Query 125 FLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKN 184 + I+ L+DLRSR + + + P D LL +I KF +D+Q+ I+ I +I Sbjct 128 RVTPAAIEIGLRDLRSRLRAVPVVTLMPPDDHLLRALIVKFSADRQMNIDEAIVSFIATR 187 Query 185 TER 187 TER Sbjct 188 TER 190 >ref|ZP_05377859.1| chromosomal replication initiator, DnaA [Hyphomicrobium denitrificans ATCC 51888] Length=213 Score = 116 bits (290), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 53/177 (29%), Positives = 92/177 (51%), Gaps = 1/177 (0%) Query 11 FPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKKKINSV 70 P + +D+ VS +N +A LI+ WP+WP + GP G GKTHL+N+ + + + Sbjct 1 MPHRAAMGLEDFLVSDSNAAAVALIDRWPDWPIGAAILVGPRGSGKTHLANVWQLR-SEA 59 Query 71 EILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVINSFLPIKD 130 + A ++T E + +II+N E +E + +LN ++ +++ + D Sbjct 60 ALHPAASLTRENVPAVASAGAVIIENIETLTDEAALFHLLNLVREQRLQVLLTTDTAPGD 119 Query 131 IKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 +K L DL SR + IE P D LL ++ K F+D+Q+ + P I +Y++ ER Sbjct 120 LKIALPDLLSRLKALPLASIEAPDDALLRAVLVKLFADRQLSVEPHIVDYVLVRMER 176 >ref|YP_577373.1| Gene info hypothetical protein Nham_2116 [Nitrobacter hamburgensis X14] Length=226 GENE ID: 4031946 Nham_2116 | hypothetical protein [Nitrobacter hamburgensis X14] Score = 113 bits (282), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 51/183 (27%), Positives = 96/183 (52%), Gaps = 2/183 (1%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL F P D+ N +A LIESWP WP++ + + GP GCGK+HL+ I + Sbjct 9 QLAFVLPHAESLSRDDFLEGPANAAALSLIESWPEWPNRVMLLAGPEGCGKSHLATIWAE 68 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEKNI-NEKTFYSILNSSKQLDTYIVINS 124 + + I +A +T + L++++ + +E + ++N +++ ++++ + Sbjct 69 QAGARSI-SAHGLTAAAVPGALATGALVVEDINPHAFDELALFHLMNLAREDGAFVLMTA 127 Query 125 FLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKN 184 +P I+ L+DL+SR + + + P D LL +I KF +D+Q+ I+ + +I Sbjct 128 RVPPAAIEIGLRDLQSRLRAVPVVTLMPPDDQLLRALIIKFCADRQMSIDETVVHFIATR 187 Query 185 TER 187 TER Sbjct 188 TER 190 >ref|NP_108166.1| Gene info hypothetical protein mlr7968 [Mesorhizobium loti MAFF303099] Length=234 GENE ID: 1230818 mlr7968 | hypothetical protein [Mesorhizobium loti MAFF303099] (10 or fewer PubMed links) Score = 112 bits (280), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 54/182 (29%), Positives = 93/182 (51%), Gaps = 2/182 (1%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL T Y + VS N A L++ WP+WP V + GP G GKTHL+ I + Sbjct 11 QLPLDLGHGTGYSRDELVVSGTNNQAAALVDRWPDWPSPVVVLAGPAGSGKTHLAAIWRA 70 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVINSF 125 + N+V + +A I D +I+ LI D ++E+ + ++N+ + + +++ + Sbjct 71 RANAVAV-DARRIGD-SIAGLGARPALIDDVDAGAVDEQGLFHLINAVRGAGSTLLLTAR 128 Query 126 LPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNT 185 L DL SR + + I P D LL +I+K F+D+Q+E+ P + +Y+++ Sbjct 129 RFPSAWGVSLPDLASRLKAAATVEIHEPDDLLLAGVITKLFADRQVEVEPHVVQYLVRRI 188 Query 186 ER 187 ER Sbjct 189 ER 190 >ref|ZP_05811560.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length=246 Score = 111 bits (277), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 54/182 (29%), Positives = 92/182 (50%), Gaps = 2/182 (1%) Query 6 QLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVNIFGPTGCGKTHLSNILKK 65 QL T Y + VS N A L++ WP+WP V + GP G GKTHL+ I + Sbjct 23 QLPLDLGHGTGYSRDELVVSGTNSQAAALVDRWPDWPSPVVVLAGPAGSGKTHLAAIWRA 82 Query 66 KINSVEILNAENITDETISKFEKLNCLIIDNYEKNINEKTFYSILNSSKQLDTYIVINSF 125 N+V + +A I D +I+ LI D ++E+ + ++N+ + + +++ + Sbjct 83 HANAVAV-DAGRIGD-SIANLGARPALIDDVDAGAVDEQGLFHLINAVRGAGSTLLLTAR 140 Query 126 LPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNT 185 L DL SR + + I P D LL +I+K F+D+Q+E+ P + +Y+++ Sbjct 141 RFPAAWGVSLPDLASRLKAAATVEIHEPDDLLLAGVITKLFADRQVEVEPHVVQYLVRRI 200 Query 186 ER 187 ER Sbjct 201 ER 202 




blastp fait avec swissprot:


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q67TK7.1|DNAA_SYMTH  RecName: Full=Chromosomal replication ...  51.6    2e-06
sp|Q5HJZ9.1|DNAA_STAEQ  RecName: Full=Chromosomal replication ...  45.4    2e-04 Gene info
sp|Q8CQK7.1|DNAA_STAES  RecName: Full=Chromosomal replication ...  45.4    2e-04 Gene info
sp|Q8KGG6.1|DNAA_CHLTE  RecName: Full=Chromosomal replication ...  43.9    5e-04
sp|Q8RDL6.1|DNAA_THETN  RecName: Full=Chromosomal replication ...  43.5    8e-04
sp|P59567.1|DNAA_BUCBP  RecName: Full=Chromosomal replication ...  43.1    9e-04
sp|A9KPP1.1|DNAA_CLOPH  RecName: Full=Chromosomal replication ...  42.4    0.001 Gene info
sp|B9L735.1|DNAA_NAUPA  RecName: Full=Chromosomal replication ...  41.6    0.003
sp|B0KAG0.1|DNAA_THEP3  RecName: Full=Chromosomal replication ...  41.2    0.003 Gene info
sp|B1VPF0.1|DNAA_STRGG  RecName: Full=Chromosomal replication ...  41.2    0.003
sp|Q9ZH75.1|DNAA_STRCH  RecName: Full=Chromosomal replication ...  41.2    0.003
sp|Q74GG6.1|DNAA_GEOSL  RecName: Full=Chromosomal replication ...  41.2    0.003
sp|Q9X9D5.1|DNAA_THET8  RecName: Full=Chromosomal replication ...  41.2    0.004 Gene info
sp|P27902.1|DNAA_STRCO  RecName: Full=Chromosomal replication ...  41.2    0.004
sp|Q9ZH76.1|DNAA_STRRE  RecName: Full=Chromosomal replication ...  41.2    0.004
sp|Q82FD8.1|DNAA_STRAW  RecName: Full=Chromosomal replication ...  41.2    0.004
sp|Q72H87.2|DNAA_THET2  RecName: Full=Chromosomal replication ...  41.2    0.004
sp|B6EP46.1|DNAA_ALISL  RecName: Full=Chromosomal replication ...  41.2    0.004 Gene info
sp|O84252.1|DNAA1_CHLTR  RecName: Full=Chromosomal replication...  40.8    0.004
sp|Q8XPG2.1|DNAA_CLOPE  RecName: Full=Chromosomal replication ...  40.8    0.004
sp|Q0SWX6.1|DNAA_CLOPS  RecName: Full=Chromosomal replication ...  40.8    0.005 Gene info
sp|Q0SN72.1|DNAA_BORAP  RecName: Full=Chromosomal replication ...  40.8    0.005 Gene info
sp|Q83N52.1|DNAA_TROWT  RecName: Full=Chromosomal replication ...  40.4    0.006 Gene info
sp|B9L0U6.1|DNAA_THERP  RecName: Full=Chromosomal replication ...  40.0    0.007
sp|Q661I4.1|DNAA_BORGA  RecName: Full=Chromosomal replication ...  40.0    0.008
sp|P22837.1|DNAA_PROMI  RecName: Full=Chromosomal replication ...  40.0    0.008
sp|A6TJ76.1|DNAA_ALKMQ  RecName: Full=Chromosomal replication ...  39.7    0.010 Gene info
sp|B1YGB2.1|DNAA_EXIS2  RecName: Full=Chromosomal replication ...  39.7    0.011 Gene info
sp|Q5L3Z2.1|DNAA_GEOKA  RecName: Full=Chromosomal replication ...  39.7    0.011
sp|C5D327.1|DNAA_GEOSW  RecName: Full=Chromosomal replication ...  39.7    0.011
sp|A4IJ84.1|DNAA_GEOTN  RecName: Full=Chromosomal replication ...  39.7    0.011 Gene info
sp|B7IS20.1|DNAA_BACC2  RecName: Full=Chromosomal replication ...  39.3    0.012 Gene info
sp|Q9RCA2.1|DNAA_BACHD  RecName: Full=Chromosomal replication ...  39.3    0.012
sp|Q81JD5.1|DNAA_BACCR  RecName: Full=Chromosomal replication ...  39.3    0.012 Gene info
sp|B7GFK8.1|DNAA_ANOFW  RecName: Full=Chromosomal replication ...  39.3    0.012 Gene info
sp|A9VM90.1|DNAA_BACWK  RecName: Full=Chromosomal replication ...  39.3    0.013 Gene info
sp|Q7MXZ1.1|DNAA_PORGI  RecName: Full=Chromosomal replication ...  39.3    0.013
sp|Q2YUP1.1|DNAA_STAAB  RecName: Full=Chromosomal replication ...  39.3    0.013 Gene info
sp|Q6GD89.1|DNAA_STAAS  RecName: Full=Chromosomal replication ...  39.3    0.013 Gene info
sp|Q6GKU4.1|DNAA_STAAR  RecName: Full=Chromosomal replication ...  39.3    0.013 Gene info
sp|A0Q3U6.1|DNAA_CLONN  RecName: Full=Chromosomal replication ...  39.3    0.013 Gene info
sp|Q81W35.1|DNAA_BACAN  RecName: Full=Chromosomal replication ...  39.3    0.013
sp|Q73FK5.1|DNAA_BACC1  RecName: Full=Chromosomal replication ...  39.3    0.014 Gene info
sp|A7GJR9.1|DNAA_BACCN  RecName: Full=Chromosomal replication ...  39.3    0.014 Gene info
sp|C1ES08.1|DNAA_BACC3  RecName: Full=Chromosomal replication ...  39.3    0.014
sp|Q823E6.1|DNAA2_CHLCV  RecName: Full=Chromosomal replication...  39.3    0.014
sp|A1QZM2.1|DNAA_BORT9  RecName: Full=Chromosomal replication ...  39.3    0.014
sp|Q9PKE4.1|DNAA1_CHLMU  RecName: Full=Chromosomal replication...  38.9    0.015
sp|Q92FV2.1|DNAA_LISIN  RecName: Full=Chromosomal replication ...  38.9    0.015
sp|Q8YAW2.1|DNAA_LISMO  RecName: Full=Chromosomal replication ...  38.9    0.015
sp|C1L2Z8.1|DNAA_LISMC  RecName: Full=Chromosomal replication ...  38.9    0.016
sp|A5N457.1|DNAA_CLOK5  RecName: Full=Chromosomal replication ...  38.9    0.016 Gene info
sp|C4KZZ3.1|DNAA_EXISA  RecName: Full=Chromosomal replication ...  38.9    0.018
sp|A6W3V4.1|DNAA_KINRD  RecName: Full=Chromosomal replication ...  38.9    0.018 Gene info
sp|C1CXJ1.1|DNAA_DEIDV  RecName: Full=Chromosomal replication ...  38.9    0.018
sp|B5RLZ3.1|DNAA_BORDL  RecName: Full=Chromosomal replication ...  38.9    0.019 Gene info
sp|A7Z0C3.1|DNAA_BACA2  RecName: Full=Chromosomal replication ...  38.9    0.019 Gene info
sp|B5RRN9.1|DNAA_BORRA  RecName: Full=Chromosomal replication ...  38.5    0.019 Gene info
sp|P05648.1|DNAA_BACSU  RecName: Full=Chromosomal replication ...  38.5    0.020
sp|B7IF65.1|DNAA_THEAB  RecName: Full=Chromosomal replication ...  38.5    0.021 Gene info
sp|A8F8Y4.1|DNAA_BACP2  RecName: Full=Chromosomal replication ...  38.5    0.022 Gene info
sp|B8GBK7.1|DNAA_CHLAD  RecName: Full=Chromosomal replication ...  38.5    0.022
sp|B5E7P6.1|DNAA_GEOBB  RecName: Full=Chromosomal replication ...  38.5    0.023 Gene info
sp|C6E7Q5.1|DNAA_GEOSM  RecName: Full=Chromosomal replication ...  38.5    0.023
sp|Q9RYE7.2|DNAA_DEIRA  RecName: Full=Chromosomal replication ...  38.5    0.024
sp|O87546.1|DNAA_TREDE  RecName: Full=Chromosomal replication ...  38.5    0.024
sp|Q9Z8M9.1|DNAA1_CHLPN  RecName: Full=Chromosomal replication...  38.5    0.024
sp|Q4JYF7.1|DNAA_CORJK  RecName: Full=Chromosomal replication ...  38.5    0.024 Gene info
sp|Q7NAD3.1|DNAA_PHOLL  RecName: Full=Chromosomal replication ...  38.1    0.025
sp|Q65PM2.1|DNAA_BACLD  RecName: Full=Chromosomal replication ...  38.1    0.026 Gene info
sp|A9WAN1.1|DNAA_CHLAA  RecName: Full=Chromosomal replication ...  38.1    0.027 Gene info
sp|Q4LAL5.1|DNAA_STAHJ  RecName: Full=Chromosomal replication ...  38.1    0.028 Gene info
sp|Q65VB8.1|DNAA_MANSM  RecName: Full=Chromosomal replication ...  38.1    0.029 Gene info
sp|Q7VMW1.1|DNAA_HAEDU  RecName: Full=Chromosomal replication ...  38.1    0.030
sp|Q8A5U5.1|DNAA_BACTN  RecName: Full=Chromosomal replication ...  38.1    0.030
sp|C3KXQ7.1|DNAA_CLOB6  RecName: Full=Chromosomal replication ...  38.1    0.031 Gene info
sp|Q7MQJ7.1|DNAA_VIBVY  RecName: Full=Chromosomal replication ...  38.1    0.032 Gene info
sp|Q8DDI9.2|DNAA_VIBVU  RecName: Full=Chromosomal replication ...  37.7    0.034
sp|B1JD70.1|RUVB_PSEPW  RecName: Full=Holliday junction ATP-de...  37.7    0.037
sp|B7VGI4.1|DNAA_VIBSL  RecName: Full=Chromosomal replication ...  37.7    0.038
sp|Q5E8Z2.1|DNAA_VIBF1  RecName: Full=Chromosomal replication ...  37.7    0.039 Gene info
sp|P43742.1|DNAA_HAEIN  RecName: Full=Chromosomal replication ...  37.7    0.039
sp|P49996.1|DNAA_VIBHA  RecName: Full=Chromosomal replication ...  37.7    0.040
sp|A7N1E9.1|DNAA_VIBHB  RecName: Full=Chromosomal replication ...  37.7    0.041 Gene info
sp|Q87TQ7.1|DNAA_VIBPA  RecName: Full=Chromosomal replication ...  37.7    0.041
sp|A3DHZ4.1|DNAA_CLOTH  RecName: Full=Chromosomal replication ...  37.7    0.043 Gene info
sp|Q6ABL5.1|DNAA_PROAC  RecName: Full=Chromosomal replication ...  37.4    0.044
sp|A7G9B0.1|DNAA_CLOBL  RecName: Full=Chromosomal replication ...  37.4    0.045 Gene info
sp|A3M7W1.2|RUVB_ACIBT  RecName: Full=Holliday junction ATP-de...  37.4    0.048
sp|Q6F991.1|RUVB_ACIAD  RecName: Full=Holliday junction ATP-de...  37.4    0.048 Gene info
sp|Q8EU88.1|DNAA_OCEIH  RecName: Full=Chromosomal replication ...  37.4    0.048
sp|B1L1K6.1|DNAA_CLOBM  RecName: Full=Chromosomal replication ...  37.4    0.050 Gene info
sp|Q5WM31.1|DNAA_BACSK  RecName: Full=Chromosomal replication ...  37.4    0.050 Gene info
sp|Q47K71.1|DNAA_DECAR  RecName: Full=Chromosomal replication ...  37.4    0.051 Gene info
sp|Q6NKL7.1|DNAA_CORDI  RecName: Full=Chromosomal replication ...  37.4    0.053
sp|A4J0F0.1|DNAA_DESRM  RecName: Full=Chromosomal replication ...  37.4    0.053 Gene info
sp|Q9KVX6.2|DNAA_VIBCH  RecName: Full=Chromosomal replication ...  37.4    0.053
sp|P33768.1|DNAA_BORBU  RecName: Full=Chromosomal replication ...  37.4    0.053
sp|B2A2Y6.1|DNAA_NATTJ  RecName: Full=Chromosomal replication ...  37.4    0.056 Gene info
sp|B0KTJ2.1|RUVB_PSEPG  RecName: Full=Holliday junction ATP-de...  37.0    0.057 Gene info
sp|B7J203.1|DNAA_BORBZ  RecName: Full=Chromosomal replication ...  37.0    0.057 Gene info
sp|Q48AS7.1|DNAA_COLP3  RecName: Full=Chromosomal replication ...  37.0    0.059 Gene info
sp|Q4A180.1|DNAA_STAS1  RecName: Full=Chromosomal replication ...  37.0    0.062 Gene info
sp|B8GUJ4.1|RUVB_THISH  RecName: Full=Holliday junction ATP-de...  37.0    0.064
sp|B8I3R2.1|DNAA_CLOCE  RecName: Full=Chromosomal replication ...  37.0    0.066
sp|Q2NX49.1|DNAA_SODGM  RecName: Full=Chromosomal replication ...  37.0    0.067 Gene info
sp|B9DPX4.1|DNAA_STACT  RecName: Full=Chromosomal replication ...  37.0    0.069 Gene info
sp|C3JYS7.1|RUVB_PSEFS  RecName: Full=Holliday junction ATP-de...  37.0    0.069
sp|Q72WD6.1|DNAA_LEPIC  RecName: Full=Chromosomal replication ...  37.0    0.069
sp|Q1QCY5.2|RUVB_PSYCK  RecName: Full=Holliday junction ATP-de...  37.0    0.072
sp|Q3K7W0.1|RUVB_PSEPF  RecName: Full=Holliday junction ATP-de...  37.0    0.072 Gene info
sp|A7FPR6.1|DNAA_CLOB1  RecName: Full=Chromosomal replication ...  36.6    0.074 Gene info
sp|A1JT80.1|DNAA_YERE8  RecName: Full=Chromosomal replication ...  36.6    0.075 Gene info
sp|Q9CLQ4.1|DNAA_PASMU  RecName: Full=Chromosomal replication ...  36.6    0.076
sp|A4XAH9.1|CLPX_SALTO  RecName: Full=ATP-dependent Clp protea...  36.6    0.078 Gene info
sp|B9E8Z7.1|DNAA_MACCJ  RecName: Full=Chromosomal replication ...  36.6    0.079
sp|A1K1B4.1|DNAA_AZOSB  RecName: Full=Chromosomal replication ...  36.6    0.079 Gene info
sp|Q8Z9U7.1|DNAA_YERPE  RecName: Full=Chromosomal replication ...  36.6    0.079
sp|A8M1K7.1|CLPX_SALAI  RecName: Full=ATP-dependent Clp protea...  36.6    0.081 Gene info
sp|Q6FG21.1|DNAA_ACIAD  RecName: Full=Chromosomal replication ...  36.6    0.082 Gene info
sp|A0KEC3.1|DNAA_AERHH  RecName: Full=Chromosomal replication ...  36.6    0.084 Gene info
sp|Q1I6E9.1|RUVB_PSEE4  RecName: Full=Holliday junction ATP-de...  36.6    0.084 Gene info
sp|Q4K7D9.1|RUVB_PSEF5  RecName: Full=Holliday junction ATP-de...  36.6    0.084 Gene info
sp|P29440.3|DNAA_SERMA  RecName: Full=Chromosomal replication ...  36.6    0.085
sp|B2UX43.1|DNAA_CLOBA  RecName: Full=Chromosomal replication ...  36.6    0.086 Gene info
sp|A8G7Q2.1|DNAA_SERP5  RecName: Full=Chromosomal replication ...  36.6    0.086 Gene info
sp|A4XRS1.1|RUVB_PSEMY  RecName: Full=Holliday junction ATP-de...  36.6    0.088 Gene info
sp|Q82Y84.1|DNAA_NITEU  RecName: Full=Chromosomal replication ...  36.6    0.088
sp|A5WFF6.1|RUVB_PSYWF  RecName: Full=Holliday junction ATP-de...  36.6    0.089 Gene info
sp|B2THB4.1|DNAA_CLOBB  RecName: Full=Chromosomal replication ...  36.6    0.091 Gene info
sp|A6LPB1.1|DNAA_CLOB8  RecName: Full=Chromosomal replication ...  36.6    0.092 Gene info
sp|Q0AK27.1|DNAA_NITEC  RecName: Full=Chromosomal replication ...  36.6    0.093 Gene info
sp|Q3JES3.1|RUVB_NITOC  RecName: Full=Holliday junction ATP-de...  36.2    0.097 Gene info
sp|A8MEA0.1|DNAA_ALKOO  RecName: Full=Chromosomal replication ...  36.2    0.099 Gene info
sp|A4SH46.1|DNAA_AERS4  RecName: Full=Chromosomal replication ...  36.2    0.10  Gene info
sp|Q97N35.1|DNAA_CLOAB  RecName: Full=Chromosomal replication ...  36.2    0.11 
sp|Q1GXK1.1|DNAA_METFK  RecName: Full=Chromosomal replication ...  36.2    0.11  Gene info
sp|A6GYW8.1|DNAA_FLAPJ  RecName: Full=Chromosomal replication ...  36.2    0.11  Gene info
sp|A4VNA3.1|RUVB_PSEU5  RecName: Full=Holliday junction ATP-de...  36.2    0.11  Gene info
sp|B2TWQ1.1|RUVB_SHIB3  RecName: Full=Holliday junction ATP-de...  36.2    0.11 
sp|B2VCE3.1|DNAA_ERWT9  RecName: Full=Chromosomal replication ...  36.2    0.11 
sp|B6YXR2.1|PSMR_THEON  RecName: Full=Proteasome-activating nu...  36.2    0.12  Gene info
sp|B2S0D9.1|DNAA_BORHD  RecName: Full=Chromosomal replication ...  36.2    0.12  Gene info
sp|B1IYP2.1|DNAA_ECOLC  RecName: Full=Chromosomal replication ...  36.2    0.12  Gene info
sp|Q5P4P0.1|DNAA_AZOSE  RecName: Full=Chromosomal replication ...  36.2    0.13  Gene info
sp|A5VZU7.1|RUVB_PSEP1  RecName: Full=Holliday junction ATP-de...  36.2    0.13  Gene info
sp|Q51426.2|RUVB_PSEAE  RecName: Full=Holliday junction ATP-de...  36.2    0.13 
sp|Q88NJ0.1|RUVB_PSEPK  RecName: Full=Holliday junction ATP-de...  35.8    0.13  Gene info
sp|Q31UV5.1|DNAA_SHIBS  RecName: Full=Chromosomal replication ...  35.8    0.13  Gene info
sp|P03004.2|DNAA_ECOLI  RecName: Full=Chromosomal replication ...  35.8    0.13 
sp|Q329B6.1|DNAA_SHIDS  RecName: Full=Chromosomal replication ...  35.8    0.13  Gene info
sp|Q8XBZ3.1|DNAA_ECO57  RecName: Full=Chromosomal replication ...  35.8    0.13 
sp|C1DRF8.1|RUVB_AZOVD  RecName: Full=Holliday junction ATP-de...  35.8    0.13  Gene info
sp|C5BHC5.1|DNAA_EDWI9  RecName: Full=Chromosomal replication ...  35.8    0.14 
sp|A6VA05.1|RUVB_PSEA7  RecName: Full=Holliday junction ATP-de...  35.8    0.14  Gene info
sp|Q57I00.1|DNAA_SALCH  RecName: Full=Chromosomal replication ...  35.8    0.14 
sp|B5RFY7.1|DNAA_SALG2  RecName: Full=Chromosomal replication ...  35.8    0.14  Gene info
sp|Q8Z2N6.1|DNAA_SALTI  RecName: Full=Chromosomal replication ...  35.8    0.15 
sp|B5FN10.1|DNAA_SALDC  RecName: Full=Chromosomal replication ...  35.8    0.15  Gene info
sp|P35891.2|DNAA_SALTY  RecName: Full=Chromosomal replication ...  35.8    0.15 
sp|Q48FC5.1|RUVB_PSE14  RecName: Full=Holliday junction ATP-de...  35.8    0.15  Gene info
sp|C3PE72.1|DNAA_CORA7  RecName: Full=Chromosomal replication ...  35.8    0.15 
sp|A5CR08.1|CLPX_CLAM3  RecName: Full=ATP-dependent Clp protea...  35.8    0.15  Gene info
sp|Q39ZS3.1|DNAA_GEOMG  RecName: Full=Chromosomal replication ...  35.8    0.15  Gene info
sp|Q4ZWL1.1|RUVB_PSEU2  RecName: Full=Holliday junction ATP-de...  35.8    0.15  Gene info
sp|C6DGH7.1|DNAA_PECCP  RecName: Full=Chromosomal replication ...  35.8    0.16 
sp|A6LIY2.1|DNAA_THEM4  RecName: Full=Chromosomal replication ...  35.8    0.16  Gene info
sp|Q87Y35.2|RUVB_PSESM  RecName: Full=Holliday junction ATP-de...  35.8    0.16 
sp|A6VK86.1|DNAA_ACTSZ  RecName: Full=Chromosomal replication ...  35.8    0.16  Gene info
sp|Q83KR5.1|RUVB_SHIFL  RecName: Full=Holliday junction ATP-de...  35.8    0.16 
sp|B0RAS4.1|CLPX_CLAMS  RecName: Full=ATP-dependent Clp protea...  35.4    0.16  Gene info
sp|P0A812.1|RUVB_ECOLI  RecName: Full=Holliday junction ATP-de...  35.4    0.16 
sp|A5CLT3.1|DNAA_CLAM3  RecName: Full=Chromosomal replication ...  35.4    0.17  Gene info
sp|C4L755.1|DNAA_TOLAT  RecName: Full=Chromosomal replication ...  35.4    0.17 
sp|Q3Z2L8.1|RUVB_SHISS  RecName: Full=Holliday junction ATP-de...  35.4    0.17  Gene info
sp|Q6CYR4.1|DNAA_ERWCT  RecName: Full=Chromosomal replication ...  35.4    0.17 
sp|Q5QY39.1|DNAA_IDILO  RecName: Full=Chromosomal replication ...  35.4    0.17 
sp|B5XQ05.1|RUVB_KLEP3  RecName: Full=Holliday junction ATP-de...  35.4    0.17  Gene info
sp|A6TB30.1|RUVB_KLEP7  RecName: Full=Holliday junction ATP-de...  35.4    0.17  Gene info
sp|Q8FGR3.1|RUVB_ECOL6  RecName: Full=Holliday junction ATP-de...  35.4    0.17 
sp|P66756.1|RUVB_SALTI  RecName: Full=Holliday junction ATP-de...  35.4    0.17 
sp|A4WBL8.1|RUVB_ENT38  RecName: Full=Holliday junction ATP-de...  35.4    0.18  Gene info
sp|B0RH69.1|DNAA_CLAMS  RecName: Full=Chromosomal replication ...  35.4    0.18  Gene info
sp|B5XT51.1|DNAA_KLEP3  RecName: Full=Chromosomal replication ...  35.4    0.18  Gene info
sp|O57940.1|PSMR_PYRHO  RecName: Full=Proteasome-activating nu...  35.4    0.18 
sp|Q9V287.1|PSMR_PYRAB  RecName: Full=Proteasome-activating nu...  35.4    0.18 
sp|Q57NA3.1|RUVB_SALCH  RecName: Full=Holliday junction ATP-de...  35.4    0.19 
sp|P34028.1|DNAA_SPICI  RecName: Full=Chromosomal replication ...  35.4    0.19 
sp|A9MND7.1|RUVB_SALAR  RecName: Full=Holliday junction ATP-de...  35.4    0.19  Gene info
sp|A8AFI1.1|RUVB_CITK8  RecName: Full=Holliday junction ATP-de...  35.4    0.19  Gene info
sp|Q47U23.1|DNAA_THEFY  RecName: Full=Chromosomal replication ...  35.4    0.19  Gene info
sp|Q3ICT8.1|HMUV_PSEHT  RecName: Full=Hemin import ATP-binding...  35.4    0.20  Gene info
sp|Q7ZZ25.2|ATD1A_DANRE  RecName: Full=ATPase family AAA domai...  35.4    0.20  Gene info
sp|A0RLX8.1|DNAA_CAMFF  RecName: Full=Chromosomal replication ...  35.4    0.20  Gene info
sp|A7MEA3.1|RUVB_ENTS8  RecName: Full=Holliday junction ATP-de...  35.4    0.20  Gene info
sp|A1U1B9.1|RUVB_MARAV  RecName: Full=Holliday junction ATP-de...  35.4    0.20  Gene info
sp|A1TUY9.1|RUVB_ACIAC  RecName: Full=Holliday junction ATP-de...  35.0    0.22  Gene info
sp|A4SZQ9.1|MIAA_POLSQ  RecName: Full=tRNA Delta(2)-isopenteny...  35.0    0.22 
sp|Q609L0.1|RUVB_METCA  RecName: Full=Holliday junction ATP-de...  35.0    0.22 
sp|Q6MC93.1|DNAA1_PARUW  RecName: Full=Chromosomal replication...  35.0    0.22  Gene info
sp|Q04WF7.1|DNAA_LEPBJ  RecName: Full=Chromosomal replication ...  35.0    0.23  Gene info
sp|B7GUX5.1|DNAA_ACIB3  RecName: Full=Chromosomal replication ...  35.0    0.23  Gene info
sp|O66659.1|DNAA_AQUAE  RecName: Full=Chromosomal replication ...  35.0    0.23 
sp|A3M0Q4.2|DNAA_ACIBT  RecName: Full=Chromosomal replication ...  35.0    0.23 
sp|B0VMK0.1|DNAA_ACIBS  RecName: Full=Chromosomal replication ...  35.0    0.23  Gene info
sp|Q6AFZ6.1|CLPX_LEIXX  RecName: Full=ATP-dependent Clp protea...  35.0    0.24 
sp|A1WZ65.1|RUVB_HALHL  RecName: Full=Holliday junction ATP-de...  35.0    0.24  Gene info
sp|Q5QYU5.1|RUVB_IDILO  RecName: Full=Holliday junction ATP-de...  35.0    0.25 
sp|Q4FTT9.1|RUVB_PSYA2  RecName: Full=Holliday junction ATP-de...  35.0    0.26  Gene info
sp|A9QYX2.1|RUVB_YERPG  RecName: Full=Holliday junction ATP-de...  35.0    0.26 
sp|A7GVR3.1|DNAA_CAMC5  RecName: Full=Chromosomal replication ...  35.0    0.26  Gene info
sp|C6DFF2.1|RUVB_PECCP  RecName: Full=Holliday junction ATP-de...  35.0    0.27 
sp|B2VJ95.1|RUVB_ERWT9  RecName: Full=Holliday junction ATP-de...  35.0    0.27 
sp|A8GFI7.1|RUVB_SERP5  RecName: Full=Holliday junction ATP-de...  35.0    0.27  Gene info
sp|C5BQT4.1|RUVB_TERTT  RecName: Full=Holliday junction ATP-de...  35.0    0.28 
sp|C4K7I4.1|RUVB_HAMD5  RecName: Full=Holliday junction ATP-de...  34.7    0.28 
sp|Q6D4A2.1|RUVB_ERWCT  RecName: Full=Holliday junction ATP-de...  34.7    0.28 
sp|A5GDX1.1|DNAA_GEOUR  RecName: Full=Chromosomal replication ...  34.7    0.29  Gene info
sp|Q8ZEU5.1|RUVB_YERPE  RecName: Full=Holliday junction ATP-de...  34.7    0.29 
sp|A1JRJ5.1|RUVB_YERE8  RecName: Full=Holliday junction ATP-de...  34.7    0.30  Gene info
sp|Q124Q6.1|RUVB_POLSJ  RecName: Full=Holliday junction ATP-de...  34.7    0.32  Gene info
sp|B4RTT8.1|RUVB_ALTMD  RecName: Full=Holliday junction ATP-de...  34.7    0.32 
sp|A0JXL2.1|CLPX_ARTS2  RecName: Full=ATP-dependent Clp protea...  34.7    0.32  Gene info
sp|P54815.2|MSP1_CAEEL  RecName: Full=Protein MSP1 homolog         34.7    0.33  Gene info
sp|B2TUS6.1|DNAA_SHIB3  RecName: Full=Chromosomal replication ...  34.7    0.34  Gene info
sp|A9WUW1.1|CLPX_RENSM  RecName: Full=ATP-dependent Clp protea...  34.7    0.35  Gene info
sp|B8HA33.1|CLPX_ARTCA  RecName: Full=ATP-dependent Clp protea...  34.7    0.35 
sp|A1VJK5.1|RUVB_POLNA  RecName: Full=Holliday junction ATP-de...  34.7    0.35  Gene info
sp|Q5X0L8.1|DNAA_LEGPL  RecName: Full=Chromosomal replication ...  34.7    0.36  Gene info
sp|C5B9T2.1|RUVB_EDWI9  RecName: Full=Holliday junction ATP-de...  34.7    0.36 
sp|Q0VRJ7.1|RUVB_ALCBS  RecName: Full=Holliday junction ATP-de...  34.3    0.37  Gene info
sp|B4ETP8.1|RUVB_PROMH  RecName: Full=Holliday junction ATP-de...  34.3    0.38 
sp|A8GWV0.1|TRUB_RICB8  RecName: Full=tRNA pseudouridine synth...  34.3    0.38  Gene info
sp|Q6AHN6.1|DNAA_LEIXX  RecName: Full=Chromosomal replication ...  34.3    0.39 
sp|Q2Y5G5.1|RUVB_NITMU  RecName: Full=Holliday junction ATP-de...  34.3    0.40  Gene info
sp|B0S1C3.1|MIAA_FINM2  RecName: Full=tRNA Delta(2)-isopenteny...  34.3    0.41 
sp|A9AH73.1|RUVB_BURM1  RecName: Full=Holliday junction ATP-de...  34.3    0.41 
sp|Q0KFR8.1|DNAA_RALEH  RecName: Full=Chromosomal replication ...  34.3    0.41  Gene info
sp|Q1RIG2.1|TRUB_RICBR  RecName: Full=tRNA pseudouridine synth...  34.3    0.41  Gene info
sp|Q39XN6.1|RUVB_GEOMG  RecName: Full=Holliday junction ATP-de...  34.3    0.41  Gene info
sp|Q6A7F1.1|CLPX_PROAC  RecName: Full=ATP-dependent Clp protea...  34.3    0.41 
sp|Q8U4H3.1|PSMR_PYRFU  RecName: Full=Proteasome-activating nu...  34.3    0.41 
sp|Q971J4.1|SYA_SULTO  RecName: Full=Alanyl-tRNA synthetase; A...  34.3    0.42 
sp|A1TCB3.1|CLPX_MYCVP  RecName: Full=ATP-dependent Clp protea...  34.3    0.42  Gene info
sp|Q220I3.1|RUVB_RHOFD  RecName: Full=Holliday junction ATP-de...  34.3    0.42  Gene info
sp|C1A1N6.1|CLPX_RHOE4  RecName: Full=ATP-dependent Clp protea...  34.3    0.42 
sp|A0R196.1|CLPX_MYCS2  RecName: Full=ATP-dependent Clp protea...  34.3    0.42  Gene info
sp|Q0SGZ3.1|CLPX_RHOSR  RecName: Full=ATP-dependent Clp protea...  34.3    0.43  Gene info
sp|B2JJ97.1|DNAA_BURP8  RecName: Full=Chromosomal replication ...  34.3    0.43  Gene info
sp|Q9CBY6.1|CLPX_MYCLE  RecName: Full=ATP-dependent Clp protea...  34.3    0.44 
sp|A4T2N8.1|CLPX_MYCGI  RecName: Full=ATP-dependent Clp protea...  34.3    0.44  Gene info
sp|Q3SGT3.1|RUVB_THIDA  RecName: Full=Holliday junction ATP-de...  34.3    0.44  Gene info
sp|Q6D734.1|FBPC1_ERWCT  RecName: Full=Fe(3+) ions import ATP-...  34.3    0.45 
sp|B2HNG2.1|CLPX_MYCMM  RecName: Full=ATP-dependent Clp protea...  34.3    0.45 
sp|Q1B601.1|CLPX_MYCSS  RecName: Full=ATP-dependent Clp protea...  34.3    0.46  Gene info
sp|B4EES7.1|RUVB_BURCJ  RecName: Full=Holliday junction ATP-de...  34.3    0.46 
sp|B1MMV6.1|CLPX_MYCA9  RecName: Full=ATP-dependent Clp protea...  34.3    0.46 
sp|Q5Z061.1|CLPX_NOCFA  RecName: Full=ATP-dependent Clp protea...  34.3    0.46 
sp|A1KLF3.1|CLPX_MYCBP  RecName: Full=ATP-dependent Clp protea...  34.3    0.46  Gene info
sp|A0PU31.1|CLPX_MYCUA  RecName: Full=ATP-dependent Clp protea...  34.3    0.47  Gene info
sp|Q0BI83.1|RUVB_BURCM  RecName: Full=Holliday junction ATP-de...  34.3    0.48  Gene info
sp|Q39JJ1.1|RUVB_BURS3  RecName: Full=Holliday junction ATP-de...  34.3    0.48  Gene info
sp|Q9I7C5.1|DNAA_PSEAE  RecName: Full=Chromosomal replication ...  33.9    0.48 
sp|A1AJX2.1|DNAA_PELPD  RecName: Full=Chromosomal replication ...  33.9    0.48  Gene info
sp|Q73XN1.1|CLPX_MYCPA  RecName: Full=ATP-dependent Clp protea...  33.9    0.49 
sp|Q7N8B9.1|FBPC_PHOLL  RecName: Full=Fe(3+) ions import ATP-b...  33.9    0.49 
sp|P0A528.1|CLPX_MYCTU  RecName: Full=ATP-dependent Clp protea...  33.9    0.49 
sp|A1WC30.1|RUVB_ACISJ  RecName: Full=Holliday junction ATP-de...  33.9    0.49  Gene info
sp|B1YTD9.1|RUVB_BURA4  RecName: Full=Holliday junction ATP-de...  33.9    0.50 
sp|Q650B4.1|RUVB_BACFR  RecName: Full=Holliday junction ATP-de...  33.9    0.50 
sp|B3PB59.1|RUVB_CELJU  RecName: Full=Holliday junction ATP-de...  33.9    0.50 
sp|B1KCX3.1|DNAA_SHEWM  RecName: Full=Chromosomal replication ...  33.9    0.50  Gene info
sp|B9DNE4.1|RUVB_STACT  RecName: Full=Holliday junction ATP-de...  33.9    0.51  Gene info
sp|A4SJ26.1|RUVB_AERS4  RecName: Full=Holliday junction ATP-de...  33.9    0.52  Gene info
sp|Q5NG44.1|RUVB_FRATT  RecName: Full=Holliday junction ATP-de...  33.9    0.52 
sp|B7VMI4.1|RUVB_VIBSL  RecName: Full=Holliday junction ATP-de...  33.9    0.52 
sp|B0TAK8.1|DNAA_HELMI  RecName: Full=Chromosomal replication ...  33.9    0.53  Gene info
sp|A9NGL4.1|MIAA_ACHLI  RecName: Full=tRNA Delta(2)-isopenteny...  33.9    0.53 
sp|Q5JHS5.1|PSMR_PYRKO  RecName: Full=Proteasome-activating nu...  33.9    0.53  Gene info
sp|Q6MRS1.1|DNAA_BDEBA  RecName: Full=Chromosomal replication ...  33.9    0.53 
sp|A0KPA2.1|RUVB_AERHH  RecName: Full=Holliday junction ATP-de...  33.9    0.54  Gene info
sp|B2SGL0.1|RUVB_FRATM  RecName: Full=Holliday junction ATP-de...  33.9    0.54 
sp|C5A6P8.1|PSMR_THEGJ  RecName: Full=Proteasome-activating nu...  33.9    0.56 
sp|Q7N547.1|RUVB_PHOLL  RecName: Full=Holliday junction ATP-de...  33.9    0.57 
sp|Q0AJA3.1|RUVB_NITEC  RecName: Full=Holliday junction ATP-de...  33.9    0.57  Gene info
sp|Q2SCL3.1|RUVB_HAHCH  RecName: Full=Holliday junction ATP-de...  33.9    0.58  Gene info
sp|Q8G6K0.1|DNAA_BIFLO  RecName: Full=Chromosomal replication ...  33.9    0.58 
sp|B0S907.1|DNAA_LEPBA  RecName: Full=Chromosomal replication ...  33.9    0.59  Gene info
sp|A6WDT9.1|CLPX_KINRD  RecName: Full=ATP-dependent Clp protea...  33.9    0.59  Gene info
sp|Q7VH57.1|DNAA_HELHP  RecName: Full=Chromosomal replication ...  33.9    0.60 
sp|Q89TQ9.2|MODC1_BRAJA  RecName: Full=Molybdenum import ATP-b...  33.9    0.60 
sp|C4LBN0.1|RUVB_TOLAT  RecName: Full=Holliday junction ATP-de...  33.9    0.61 
sp|B7GSF9.1|DNAA_BIFLI  RecName: Full=Chromosomal replication ...  33.5    0.63 
sp|A1U0A9.1|MACB_MARAV  RecName: Full=Macrolide export ATP-bin...  33.5    0.65  Gene info
sp|B8FFL8.1|DNAA_DESAA  RecName: Full=Chromosomal replication ...  33.5    0.65  Gene info
sp|A9B496.1|DNAA_HERA2  RecName: Full=Chromosomal replication ...  33.5    0.65  Gene info
sp|Q2STL6.1|DNAA_BURTA  RecName: Full=Chromosomal replication ...  33.5    0.65  Gene info
sp|A1S6N8.1|RUVB_SHEAM  RecName: Full=Holliday junction ATP-de...  33.5    0.65  Gene info
sp|Q39L82.1|DNAA_BURS3  RecName: Full=Chromosomal replication ...  33.5    0.66  Gene info
sp|C1D9W9.1|RUVB_LARHH  RecName: Full=Holliday junction ATP-de...  33.5    0.67 
sp|A1SME0.1|CLPX_NOCSJ  RecName: Full=ATP-dependent Clp protea...  33.5    0.69  Gene info
sp|B0U0B6.1|RUVB_FRAP2  RecName: Full=Holliday junction ATP-de...  33.5    0.69  Gene info
sp|Q147F0.1|DNAA_BURXL  RecName: Full=Chromosomal replication ...  33.5    0.69  Gene info
sp|Q2SZ55.1|RUVB_BURTA  RecName: Full=Holliday junction ATP-de...  33.5    0.69  Gene info
sp|Q483C4.1|RUVB_COLP3  RecName: Full=Holliday junction ATP-de...  33.5    0.69  Gene info
sp|A2SBM4.1|DNAA_METPP  RecName: Full=Chromosomal replication ...  33.5    0.70  Gene info
sp|Q13UC0.1|RUVB_BURXL  RecName: Full=Holliday junction ATP-de...  33.5    0.70  Gene info
sp|A1WQ68.1|RUVB_VEREI  RecName: Full=Holliday junction ATP-de...  33.5    0.71  Gene info
sp|Q9KLQ5.1|FBPC_VIBCH  RecName: Full=Fe(3+) ions import ATP-b...  33.5    0.71 
sp|Q87D00.1|RUVB_XYLFT  RecName: Full=Holliday junction ATP-de...  33.5    0.72  Gene info
sp|O29953.1|CYSC_ARCFU  RecName: Full=Probable adenylyl-sulfat...  33.5    0.73 
sp|B0U2E3.1|RUVB_XYLFM  RecName: Full=Holliday junction ATP-de...  33.5    0.73 
sp|A6LG11.1|RUVB_PARD8  RecName: Full=Holliday junction ATP-de...  33.5    0.75  Gene info
sp|A1SSV6.1|RUVB_PSYIN  RecName: Full=Holliday junction ATP-de...  33.5    0.75  Gene info
sp|B2AH72.1|RUVB_CUPTR  RecName: Full=Holliday junction ATP-de...  33.5    0.75 
sp|B2SZ75.1|DNAA_BURPP  RecName: Full=Chromosomal replication ...  33.5    0.75  Gene info
sp|P21173.1|DNAA_MICLU  RecName: Full=Chromosomal replication ...  33.5    0.75 
sp|A0K2M8.1|DNAA_BURCH  RecName: Full=Chromosomal replication ...  33.5    0.76  Gene info
sp|Q9PC79.1|RUVB_XYLFA  RecName: Full=Holliday junction ATP-de...  33.5    0.76 
sp|B4E7D1.1|DNAA_BURCJ  RecName: Full=Chromosomal replication ...  33.5    0.76  Gene info
sp|Q0BJW1.1|DNAA_BURCM  RecName: Full=Chromosomal replication ...  33.5    0.76  Gene info
sp|Q1LSI9.1|DNAA_RALME  RecName: Full=Chromosomal replication ...  33.5    0.76  Gene info
sp|Q4KKT0.1|DNAA_PSEF5  RecName: Full=Chromosomal replication ...  33.5    0.78  Gene info
sp|Q8R5Z6.1|MIAA_FUSNN  RecName: Full=tRNA Delta(2)-isopenteny...  33.5    0.78 
sp|C1B7S7.1|DNAA_RHOOB  RecName: Full=Chromosomal replication ...  33.5    0.78 
sp|P55500.1|Y4IQ_RHISN  RecName: Full=Putative insertion seque...  33.5    0.78  Gene info
sp|B2AFZ7.1|DNAA_CUPTR  RecName: Full=Chromosomal replication ...  33.5    0.79  Gene info
sp|Q1I2G4.1|DNAA_PSEE4  RecName: Full=Chromosomal replication ...  33.5    0.79  Gene info
sp|B1J3Y2.1|DNAA_PSEPW  RecName: Full=Chromosomal replication ...  33.5    0.80  Gene info
sp|P46507.1|PRS6B_MANSE  RecName: Full=26S protease regulatory...  33.5    0.80 
sp|C1DFU2.1|DNAA_AZOVD  RecName: Full=Chromosomal replication ...  33.5    0.80  Gene info
sp|B1K0Y8.1|DNAA_BURCC  RecName: Full=Chromosomal replication ...  33.5    0.81  Gene info
sp|A5VWB8.1|DNAA_PSEP1  RecName: Full=Chromosomal replication ...  33.1    0.82  Gene info
sp|A3MZ06.2|RUVB_ACTP2  RecName: Full=Holliday junction ATP-de...  33.1    0.82 
sp|A4J9S6.1|DNAA_BURVG  RecName: Full=Chromosomal replication ...  33.1    0.83  Gene info
sp|A3MH48.1|DNAA_BURM7  RecName: Full=Chromosomal replication ...  33.1    0.84  Gene info
sp|B2SYK2.1|RUVB_BURPP  RecName: Full=Holliday junction ATP-de...  33.1    0.84 
sp|Q63YW5.1|DNAA_BURPS  RecName: Full=Chromosomal replication ...  33.1    0.84 
sp|P0A116.1|DNAA_PSEPK  RecName: Full=Chromosomal replication ...  33.1    0.85  Gene info
sp|A1V7D9.1|DNAA_BURMS  RecName: Full=Chromosomal replication ...  33.1    0.85  Gene info
sp|B0KEU9.1|DNAA_PSEPG  RecName: Full=Chromosomal replication ...  33.1    0.87  Gene info
sp|Q0KEC4.1|RUVB_RALEH  RecName: Full=Holliday junction ATP-de...  33.1    0.87  Gene info
sp|Q03F27.1|CLPX_PEDPA  RecName: Full=ATP-dependent Clp protea...  33.1    0.88  Gene info
sp|Q2KVY2.1|RUVB_BORA1  RecName: Full=Holliday junction ATP-de...  33.1    0.88  Gene info
sp|Q7NBU2.1|MIAA_MYCGA  RecName: Full=tRNA Delta(2)-isopenteny...  33.1    0.88 
sp|B6EGJ4.1|RUVB_ALISL  RecName: Full=Holliday junction ATP-de...  33.1    0.89  Gene info
sp|A9NE65.1|DNAA_ACHLI  RecName: Full=Chromosomal replication ...  33.1    0.89  Gene info
sp|Q475R8.1|RUVB_RALEJ  RecName: Full=Holliday junction ATP-de...  33.1    0.90  Gene info
sp|Q4L6Y6.1|RUVB_STAHJ  RecName: Full=Holliday junction ATP-de...  33.1    0.90  Gene info
sp|Q8Y236.1|RUVB_RALSO  RecName: Full=Holliday junction ATP-de...  33.1    0.91 
sp|Q3KKG1.1|DNAA_PSEPF  RecName: Full=Chromosomal replication ...  33.1    0.92  Gene info
sp|Q9KHU8.1|DNAA_ACHLA  RecName: Full=Chromosomal replication ...  33.1    0.92 
sp|Q7MJ78.1|RUVB_VIBVY  RecName: Full=Holliday junction ATP-de...  33.1    0.93  Gene info
sp|A5F760.1|RUVB_VIBC3  RecName: Full=Holliday junction ATP-de...  33.1    0.95  Gene info
sp|A6KZW5.1|RUVB_BACV8  RecName: Full=Holliday junction ATP-de...  33.1    0.97  Gene info
sp|A5UAH8.1|RUVB_HAEIE  RecName: Full=Holliday junction ATP-de...  33.1    0.97  Gene info
sp|A9AI97.1|DNAA_BURM1  RecName: Full=Chromosomal replication ...  33.1    0.97  Gene info
sp|P44631.1|RUVB_HAEIN  RecName: Full=Holliday junction ATP-de...  33.1    0.97 
sp|Q9KR02.1|RUVB_VIBCH  RecName: Full=Holliday junction ATP-de...  33.1    0.97 
sp|Q7VKV5.1|RUVB_HAEDU  RecName: Full=Holliday junction ATP-de...  33.1    0.98 
sp|B2UCF1.1|DNAA_RALPJ  RecName: Full=Chromosomal replication ...  33.1    1.00  Gene info
sp|A0LSV2.1|CLPX_ACIC1  RecName: Full=ATP-dependent Clp protea...  33.1    1.00  Gene info
sp|Q0I0Y7.1|DNAA_HAES1  RecName: Full=Chromosomal replication ...  33.1    1.0   Gene info
sp|Q65UP0.1|RUVB_MANSM  RecName: Full=Holliday junction ATP-de...  33.1    1.0   Gene info
sp|A6VQA3.1|RUVB_ACTSZ  RecName: Full=Holliday junction ATP-de...  33.1    1.0   Gene info
sp|B9M7S1.1|DNAA_GEOSF  RecName: Full=Chromosomal replication ...  32.7    1.1  
sp|A9BUG8.1|RUVB_DELAS  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q7WGB3.1|RUVB_BORBR  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q8XTV4.1|DNAA_RALSO  RecName: Full=Chromosomal replication ...  32.7    1.1  
sp|C5CM03.1|RUVB_VARPS  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q7VTT6.1|RUVB_BORPE  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q7W4T6.1|RUVB_BORPA  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q602N0.1|DNAA_METCA  RecName: Full=Chromosomal replication ...  32.7    1.1  
sp|B1Y8E2.1|RUVB_LEPCP  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|Q87QU7.1|RUVB_VIBPA  RecName: Full=Holliday junction ATP-de...  32.7    1.1  
sp|C0ZLE1.1|DNAA_RHOE4  RecName: Full=Chromosomal replication ...  32.7    1.1  
sp|Q0SAG7.1|DNAA_RHOSR  RecName: Full=Chromosomal replication ...  32.7    1.1   Gene info
sp|Q5E699.1|RUVB_VIBF1  RecName: Full=Holliday junction ATP-de...  32.7    1.1   Gene info
sp|B2UFL1.1|RUVB_RALPJ  RecName: Full=Holliday junction ATP-de...  32.7    1.2  
sp|Q82XP4.1|RUVB_NITEU  RecName: Full=Holliday junction ATP-de...  32.7    1.2  
sp|B1Y547.1|DNAA_LEPCP  RecName: Full=Chromosomal replication ...  32.7    1.2   Gene info
sp|Q7V2A3.1|CLPB_PROMP  RecName: Full=Chaperone protein clpB       32.7    1.2   Gene info
sp|B5FCQ2.1|RUVB_VIBFM  RecName: Full=Holliday junction ATP-de...  32.7    1.2   Gene info
sp|P37009.3|FBPC_ECOLI  RecName: Full=Fe(3+) ions import ATP-b...  32.7    1.2  
sp|A9HVA1.1|DNAA_BORPD  RecName: Full=Chromosomal replication ...  32.7    1.3   Gene info
sp|Q7VSE0.1|DNAA_BORPE  RecName: Full=Chromosomal replication ...  32.7    1.3  
sp|Q7WDJ9.1|DNAA_BORBR  RecName: Full=Chromosomal replication ...  32.7    1.3  
sp|Q7AH43.2|FBPC_ECO57  RecName: Full=Fe(3+) ions import ATP-b...  32.7    1.3  
sp|Q2KTI9.1|DNAA_BORA1  RecName: Full=Chromosomal replication ...  32.7    1.3   Gene info
sp|A8FJG5.1|DNAA_CAMJ8  RecName: Full=Chromosomal replication ...  32.7    1.4   Gene info
sp|Q6LW50.1|DNAA_PHOPR  RecName: Full=Chromosomal replication ...  32.7    1.4  
sp|A7N1I0.1|RUVB_VIBHB  RecName: Full=Holliday junction ATP-de...  32.3    1.4   Gene info
sp|Q5WWK4.1|RUVB_LEGPL  RecName: Full=Holliday junction ATP-de...  32.3    1.4   Gene info
sp|Q8A2M0.1|RUVB_BACTN  RecName: Full=Holliday junction ATP-de...  32.3    1.4  
sp|Q03QN7.1|CLPX_LACBA  RecName: Full=ATP-dependent Clp protea...  32.3    1.4   Gene info
sp|Q83BE0.1|RUVB_COXBU  RecName: Full=Holliday junction ATP-de...  32.3    1.4  
sp|Q5ZV64.2|RUVB_LEGPH  RecName: Full=Holliday junction ATP-de...  32.3    1.5  
sp|Q07844.1|RIX7_YEAST  RecName: Full=Ribosome biogenesis ATPa...  32.3    1.5   Gene info
sp|B6IYU2.1|RUVB_COXB2  RecName: Full=Holliday junction ATP-de...  32.3    1.5   Gene info
sp|Q5X4Y6.1|RUVB_LEGPA  RecName: Full=Holliday junction ATP-de...  32.3    1.5   Gene info
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G famil...  32.3    1.6   Gene info
sp|Q64PL4.1|DNAA_BACFR  RecName: Full=Chromosomal replication ...  32.3    1.6  
sp|Q3IIJ2.1|RUVB_PSEHT  RecName: Full=Holliday junction ATP-de...  32.3    1.6   Gene info
sp|Q9FH83.3|WRK52_ARATH  RecName: Full=Probable WRKY transcrip...  32.3    1.7   Gene info
sp|Q2S2F9.1|MIAA_SALRD  RecName: Full=tRNA Delta(2)-isopenteny...  32.3    1.7  
sp|Q31H83.1|RUVB_THICR  RecName: Full=Holliday junction ATP-de...  32.3    1.7   Gene info
sp|Q6LKD4.2|FBPC_PHOPR  RecName: Full=Fe(3+) ions import ATP-b...  32.3    1.7  
sp|A5UMF4.1|RFCL_METS3  RecName: Full=Replication factor C lar...  32.3    1.8   Gene info
sp|A1S1G9.1|DNAA_SHEAM  RecName: Full=Chromosomal replication ...  32.3    1.8   Gene info
sp|B1HRH3.1|MIAA_LYSSC  RecName: Full=tRNA Delta(2)-isopenteny...  32.0    1.8  
sp|Q48QK0.1|DNAA_PSE14  RecName: Full=Chromosomal replication ...  32.0    1.8   Gene info
sp|Q88BK3.1|DNAA_PSESM  RecName: Full=Chromosomal replication ...  32.0    1.9  
sp|Q500U7.1|DNAA_PSEU2  RecName: Full=Chromosomal replication ...  32.0    1.9   Gene info
sp|A4Y1A4.1|DNAA_SHEPC  RecName: Full=Chromosomal replication ...  32.0    1.9   Gene info
sp|Q9PJB0.1|DNAA_CAMJE  RecName: Full=Chromosomal replication ...  32.0    1.9  
sp|O06980.1|YVCR_BACSU  RecName: Full=Uncharacterized ABC tran...  32.0    1.9  
sp|A2SCK0.1|RUVB_METPP  RecName: Full=Holliday junction ATP-de...  32.0    1.9   Gene info
sp|B8CH71.1|DNAA_SHEPW  RecName: Full=Chromosomal replication ...  32.0    1.9   Gene info
sp|Q5HXF5.1|DNAA_CAMJR  RecName: Full=Chromosomal replication ...  32.0    1.9   Gene info
sp|A8EQT0.1|DNAA_ARCB4  RecName: Full=Chromosomal replication ...  32.0    2.0   Gene info
sp|Q0RPH1.1|CLPX_FRAAA  RecName: Full=ATP-dependent Clp protea...  32.0    2.0   Gene info
sp|Q8DWN9.1|DNAA_STRMU  RecName: Full=Chromosomal replication ...  32.0    2.0  
sp|A1VX79.1|DNAA_CAMJJ  RecName: Full=Chromosomal replication ...  32.0    2.0   Gene info
sp|A7H194.1|DNAA_CAMJD  RecName: Full=Chromosomal replication ...  32.0    2.1   Gene info
sp|Q31JS5.1|DNAA_THICR  RecName: Full=Chromosomal replication ...  32.0    2.1   Gene info
sp|Q505J9.1|ATAD1_RAT  RecName: Full=ATPase family AAA domain-...  32.0    2.1   Gene info
sp|C3MA45.1|CLPX_RHISN  RecName: Full=ATP-dependent Clp protea...  32.0    2.1   Gene info
sp|A8F5R0.1|RUVB_THELT  RecName: Full=Holliday junction ATP-de...  32.0    2.1   Gene info
sp|Q0HPD4.1|DNAA_SHESM  RecName: Full=Chromosomal replication ...  32.0    2.1   Gene info
sp|Q2JDQ7.1|CLPX_FRASC  RecName: Full=ATP-dependent Clp protea...  32.0    2.1   Gene info
sp|Q8EKT2.1|DNAA_SHEON  RecName: Full=Chromosomal replication ...  32.0    2.1  
sp|A6U7U8.1|CLPX_SINMW  RecName: Full=ATP-dependent Clp protea...  32.0    2.1   Gene info
sp|Q8NBU5.1|ATAD1_HUMAN  RecName: Full=ATPase family AAA domai...  32.0    2.1   Gene info
sp|Q92QQ2.1|CLPX_RHIME  RecName: Full=ATP-dependent Clp protea...  32.0    2.1  
sp|Q15RN6.1|RUVB_PSEA6  RecName: Full=Holliday junction ATP-de...  32.0    2.1   Gene info
sp|P45171.2|POTA_HAEIN  RecName: Full=Spermidine/putrescine im...  32.0    2.2  
sp|Q8EBR4.1|TRUD_SHEON  RecName: Full=tRNA pseudouridine synth...  32.0    2.2  
sp|A3CYH5.1|DNAA_SHEB5  RecName: Full=Chromosomal replication ...  32.0    2.2   Gene info
sp|Q0I0U8.1|DNAA_SHESR  RecName: Full=Chromosomal replication ...  32.0    2.2   Gene info
sp|Q9BH05.1|THNS1_MACFA  RecName: Full=Threonine synthase-like...  32.0    2.2  
sp|Q4QK57.2|POTA_HAEI8  RecName: Full=Spermidine/putrescine im...  32.0    2.2  
sp|B5ZY09.1|CLPX_RHILW  RecName: Full=ATP-dependent Clp protea...  32.0    2.2  
sp|Q08A51.1|DNAA_SHEFN  RecName: Full=Chromosomal replication ...  32.0    2.2   Gene info
sp|Q2P9M1.1|DNAA_XANOM  RecName: Full=Chromosomal replication ...  32.0    2.2   Gene info
sp|Q5R5P3.1|THNS1_PONAB  RecName: Full=Threonine synthase-like...  32.0    2.2   Gene info
sp|Q9JZ86.1|RUVB_NEIMB  RecName: Full=Holliday junction ATP-de...  32.0    2.2  
sp|A3DJK5.1|CBIO2_CLOTH  RecName: Full=Cobalt import ATP-bindi...  32.0    2.2   Gene info
sp|Q2K9U6.1|CLPX_RHIEC  RecName: Full=ATP-dependent Clp protea...  32.0    2.2   Gene info
sp|B3E468.1|RUVB_GEOLS  RecName: Full=Holliday junction ATP-de...  32.0    2.3  
sp|Q5H715.1|DNAA_XANOR  RecName: Full=Chromosomal replication ...  32.0    2.3  
sp|A8L1X0.1|CLPX_FRASN  RecName: Full=ATP-dependent Clp protea...  32.0    2.3  
sp|B8IMW6.1|HSLU_METNO  RecName: Full=ATP-dependent hsl protea...  32.0    2.3   Gene info
sp|Q1MIM6.1|CLPX_RHIL3  RecName: Full=ATP-dependent Clp protea...  32.0    2.3   Gene info
sp|Q6G1B5.1|AROE_BARQU  RecName: Full=Shikimate dehydrogenase      32.0    2.3  
sp|A6X117.1|CLPX_OCHA4  RecName: Full=ATP-dependent Clp protea...  32.0    2.3   Gene info
sp|Q8UFY5.1|CLPX_AGRT5  RecName: Full=ATP-dependent Clp protea...  31.6    2.4   Gene info
sp|Q9KAC3.1|MIAA_BACHD  RecName: Full=tRNA Delta(2)-isopenteny...  31.6    2.4  
sp|O26342.1|RFCL_METTH  RecName: Full=Replication factor C lar...  31.6    2.4   Gene info
sp|C5BXF8.1|CLPX_BEUC1  RecName: Full=ATP-dependent Clp protea...  31.6    2.4  
sp|B0B0A5.1|DNAA_PSEFS  RecName: Full=Chromosomal replication ...  31.6    2.4  
sp|B3CQC6.1|CLPX_ORITI  RecName: Full=ATP-dependent Clp protea...  31.6    2.4  
sp|B0UFH4.1|HSLU_METS4  RecName: Full=ATP-dependent hsl protea...  31.6    2.5  
sp|A5CDP2.1|CLPX_ORITB  RecName: Full=ATP-dependent Clp protea...  31.6    2.5   Gene info
sp|Q5LXJ3.1|CBIO2_STRT1  RecName: Full=Cobalt import ATP-bindi...  31.6    2.5   Gene info
sp|B9JVD6.1|CLPX_AGRVS  RecName: Full=ATP-dependent Clp protea...  31.6    2.5  
sp|A9M5C1.1|CLPX_BRUC2  RecName: Full=ATP-dependent Clp protea...  31.6    2.5   Gene info
sp|A9ISA8.1|CLPX_BART1  RecName: Full=ATP-dependent Clp protea...  31.6    2.5   Gene info
sp|A6STW2.1|DNAA_JANMA  RecName: Full=Chromosomal replication ...  31.6    2.5   Gene info
sp|Q8YHC7.1|CLPX_BRUME  RecName: Full=ATP-dependent Clp protea...  31.6    2.5  
sp|B2S5W0.1|CLPX_BRUA1  RecName: Full=ATP-dependent Clp protea...  31.6    2.6  
sp|B5EAH3.1|RUVB_GEOBB  RecName: Full=Holliday junction ATP-de...  31.6    2.6   Gene info
sp|Q49Y79.1|RUVB_STAS1  RecName: Full=Holliday junction ATP-de...  31.6    2.6   Gene info
sp|A0R7K1.1|DNAA_MYCS2  RecName: Full=Chromosomal replication ...  31.6    2.6   Gene info
sp|Q3BZT1.1|DNAA_XANC5  RecName: Full=Chromosomal replication ...  31.6    2.6   Gene info
sp|A5VQN3.1|CLPX_BRUO2  RecName: Full=ATP-dependent Clp protea...  31.6    2.6   Gene info
sp|A3Q8S6.1|DNAA_SHELP  RecName: Full=Chromosomal replication ...  31.6    2.6   Gene info
sp|A8FP46.1|DNAA_SHESH  RecName: Full=Chromosomal replication ...  31.6    2.7   Gene info
sp|Q12TC8.1|DNAA_SHEDO  RecName: Full=Chromosomal replication ...  31.6    2.7   Gene info
sp|Q8G0I5.1|CLPX_BRUSU  RecName: Full=ATP-dependent Clp protea...  31.6    2.7  
sp|B0TLA4.1|DNAA_SHEHH  RecName: Full=Chromosomal replication ...  31.6    2.7   Gene info
sp|B2ICL8.1|HSLU_BEII9  RecName: Full=ATP-dependent hsl protea...  31.6    2.7  
sp|A1USA8.1|CLPX_BARBK  RecName: Full=ATP-dependent Clp protea...  31.6    2.7   Gene info
sp|P0C6Y0.1|R1AB_CVMJH  RecName: Full=Replicase polyprotein 1a...  31.6    2.7  
sp|C6E1S8.1|RUVB_GEOSM  RecName: Full=Holliday junction ATP-de...  31.6    2.8  
sp|A4G154.1|DNAA_HERAR  RecName: Full=Chromosomal replication ...  31.6    2.8   Gene info
sp|Q97FT7.1|CLPX_CLOAB  RecName: Full=ATP-dependent Clp protea...  31.6    2.8  
sp|B7GIA2.1|MIAA_ANOFW  RecName: Full=tRNA Delta(2)-isopenteny...  31.6    2.8   Gene info
sp|B5YGT9.1|DNAA_THEYD  RecName: Full=Chromosomal replication ...  31.6    2.8  
sp|Q6G3Z2.1|CLPX_BARHE  RecName: Full=ATP-dependent Clp protea...  31.6    2.8  
sp|A1ARF8.1|RUVB_PELPD  RecName: Full=Holliday junction ATP-de...  31.6    2.8   Gene info
sp|A8GYE3.1|DNAA_SHEPA  RecName: Full=Chromosomal replication ...  31.6    2.9   Gene info
sp|Q6G177.1|CLPX_BARQU  RecName: Full=ATP-dependent Clp protea...  31.6    2.9  
sp|Q8IYQ7.2|THNS1_HUMAN  RecName: Full=Threonine synthase-like...  31.6    3.0   Gene info
sp|Q83FD8.1|DNAA_COXBU  RecName: Full=Chromosomal replication ...  31.6    3.0  
sp|Q65UE1.1|POTA_MANSM  RecName: Full=Spermidine/putrescine im...  31.6    3.0   Gene info
sp|Q8PRG2.1|DNAA_XANAC  RecName: Full=Chromosomal replication ...  31.6    3.1  
sp|B5YK93.1|MIAA_THEYD  RecName: Full=tRNA Delta(2)-isopenteny...  31.2    3.1   Gene info
sp|Q8PEH5.1|DNAA_XANCP  RecName: Full=Chromosomal replication ...  31.2    3.1  
sp|Q6MIK8.1|COAE_BDEBA  RecName: Full=Dephospho-CoA kinase; Al...  31.2    3.2  
sp|B2RKS4.1|MIAA1_PORG3  RecName: Full=tRNA Delta(2)-isopenten...  31.2    3.2  


Alignments Select All Get selected sequences Distance tree of results Multiple alignment New

>sp|Q67TK7.1|DNAA_SYMTH RecName: Full=Chromosomal replication initiator protein dnaA Length=458 Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 22/161 (13%) Query 48 IFGPTGCGKTHLSNILKKKI------NSVEILNAENITDETI------------SKFEKL 89 I+G G GKTHL + + + V ++ E T+E I +++ K+ Sbjct 159 IYGGVGLGKTHLMHAIGHYVLQHNPTAKVAYVSTETFTNEFIMAIQKGSTTAFQNRYRKV 218 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L+ID+ + K ++ FY N+ ++ + IVI+S P K+I LRSR Sbjct 219 DVLLIDDIQFLAGKEATQEEFYHTFNAIREANKQIVISSDRPPKEIPTLEDRLRSRFEWG 278 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTE 186 + I+ P + T I+ K + I++ +++ YI N E Sbjct 279 LICDIQPPDLETRTAILRKKAQSEGIQVPDEVTNYIATNIE 319 >sp|Q5HJZ9.1|DNAA_STAEQ Gene info RecName: Full=Chromosomal replication initiator protein dnaA Length=451 GENE ID: 3240513 dnaA | chromosomal replication initiation protein [Staphylococcus epidermidis RP62A] (10 or fewer PubMed links) Score = 45.4 bits (106), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 22/156 (14%) Query 48 IFGPTGCGKTHL-----SNILKKKINSVEI-LNAENITDETI------------SKFEKL 89 I+G G GKTHL ++L K N+ I ++E T+E I K+ K+ Sbjct 152 IYGGVGLGKTHLMHAIGHHVLSNKPNAKVIYTSSEKFTNEFIKSIRDNETEAFREKYRKI 211 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L+ID+ + K ++ F+ N Q + IVI+S P K+I LRSR Sbjct 212 DVLLIDDIQFIQNKEQTQEEFFHTFNELHQNNKQIVISSDRPPKEIAKLEDRLRSRFEWG 271 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYI 181 + + I P + I+ K ++ ++I P+ YI Sbjct 272 LIVDITPPDYETRMAILQKKIEEENLDIPPEALNYI 307 >sp|Q8CQK7.1|DNAA_STAES Gene info RecName: Full=Chromosomal replication initiator protein dnaA Length=451 GENE ID: 1056816 dnaA | chromosomal replication initiation protein [Staphylococcus epidermidis ATCC 12228] (10 or fewer PubMed links) Score = 45.4 bits (106), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 22/156 (14%) Query 48 IFGPTGCGKTHL-----SNILKKKINSVEI-LNAENITDETI------------SKFEKL 89 I+G G GKTHL ++L K N+ I ++E T+E I K+ K+ Sbjct 152 IYGGVGLGKTHLMHAIGHHVLSNKPNAKVIYTSSEKFTNEFIKSIRDNETEAFREKYRKI 211 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L+ID+ + K ++ F+ N Q + IVI+S P K+I LRSR Sbjct 212 DVLLIDDIQFIQNKEQTQEEFFHTFNELHQNNKQIVISSDRPPKEIAKLEDRLRSRFEWG 271 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYI 181 + + I P + I+ K ++ ++I P+ YI Sbjct 272 LIVDITPPDYETRMAILQKKIEEENLDIPPEALNYI 307 >sp|Q8KGG6.1|DNAA_CHLTE RecName: Full=Chromosomal replication initiator protein dnaA Length=493 Score = 43.9 bits (102), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 40/159 (25%), Positives = 77/159 (48%), Gaps = 22/159 (13%) Query 48 IFGPTGCGKTHL-----SNILKKKIN-----------SVEILNA-ENITDETISKFEK-L 89 I+G G GKTH+ +++L+ +I +++ +NA +N + S F + + Sbjct 193 IYGGVGLGKTHMMQAIGNSVLENRITDAVLYVSSEKFAIDFVNAIQNGNIQEFSAFYRNI 252 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + LIID+ + K ++ + I N+ Q + I++++ PIK+IK L SR N Sbjct 253 DVLIIDDIQFFAGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKEIKGIEDRLISRFNWG 312 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKN 184 ++ I+ P + II + ++P + E+I N Sbjct 313 LSTDIQAPDYETRKAIIQSKLKQSGVSLDPVVIEFIATN 351 >sp|Q8RDL6.1|DNAA_THETN RecName: Full=Chromosomal replication initiator protein dnaA Length=443 Score = 43.5 bits (101), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 31/204 (15%) Query 3 LMSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHL 59 L+S L K+ F T + V ++N A+ + P K N I+G G GKTHL Sbjct 104 LLSTLNPKYTFDT------FVVGNSNKLAHAACLAVAQSPAKAYNPLFIYGGVGLGKTHL 157 Query 60 SNILKKKINS------VEILNAENITDETIS------------KFEKLNCLIIDNYE--- 98 + + IN + + +E T+E ++ K+ ++ L+ID+ + Sbjct 158 MHAIGHFINKNHAGYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIA 217 Query 99 -KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDL 157 K ++ F+ N+ + + IVI+S P K+I + LRSR + I+ P + Sbjct 218 NKERTQEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYET 277 Query 158 LTVIISKFFSDKQIEINPKISEYI 181 I+ K + + I ++ Y+ Sbjct 278 RVAILKKKAQSENLNIPDEVLAYV 301 >sp|P59567.1|DNAA_BUCBP RecName: Full=Chromosomal replication initiator protein dnaA Length=457 Score = 43.1 bits (100), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 56/211 (26%), Positives = 107/211 (50%), Gaps = 34/211 (16%) Query 4 MSQLVFKFPFKTKYYEQDYYVSSNNFSAYQLIESWPNWPDK-WVN---IFGPTGCGKTHL 59 +S +++ T Y Q++ +N A++ I + P K + N ++G +G GKTHL Sbjct 112 LSNIIYSSEINTNYTFQNFTKGQSNQLAFKTIYKIAHNPGKNYFNPLFLYGKSGLGKTHL 171 Query 60 ----SNILKKKINSVEI--LNAEN--------ITDETISKFEK----LNCLIIDN----- 96 +N + K N+++I +N+EN + + TI +F+K +N L+ID+ Sbjct 172 LHAVANTILKYKNTIKIIYINSENFIQNMITSLKNNTIEEFKKYYRSVNTLLIDDIQFFA 231 Query 97 YEKNINEKTFYSI---LNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELP 153 Y+K+ E+ F++I LN ++Q+ I+ + P K + + L+SR + + I+ P Sbjct 232 YKKHSQEELFHTINALLNRNQQI---IITSDQFPQKIHGIETR-LKSRFECGLTIRIDPP 287 Query 154 TDDLLTVIISKFFSDKQIEINPKISEYIIKN 184 + T I+ K I ++ K++ +I KN Sbjct 288 DLNTRTKILIKKSHIYDINLSYKVAFFIAKN 318 >sp|A9KPP1.1|DNAA_CLOPH Gene info RecName: Full=Chromosomal replication initiator protein dnaA Length=453 GENE ID: 5742482 Cphy_0001 | chromosomal replication initiator protein DnaA [Clostridium phytofermentans ISDg] Score = 42.4 bits (98), Expect = 0.001, Method: Compositional matrix adjust. Identities = 50/196 (25%), Positives = 87/196 (44%), Gaps = 27/196 (13%) Query 16 KYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHLSN-----ILKKKI 67 +Y + V +NN A+ + P + N I+G G GKTHL + IL++ Sbjct 116 RYTFDTFVVGANNNLAHAASLAVAESPAEIYNPLFIYGGVGLGKTHLMHSIAHYILEQNP 175 Query 68 NS-VEILNAENITDETIS--------------KFEKLNCLIIDNYE----KNINEKTFYS 108 NS V + +E T+E I K+ ++ L+ID+ + K ++ F+ Sbjct 176 NSKVLYVTSEKFTNELIESIRNADTTPTEFREKYRNIDVLLIDDIQFIIGKERTQEEFFH 235 Query 109 ILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSD 168 N+ + I+I+S P KDI + LRSR + + I+ P + I+ K Sbjct 236 TFNTLHESKKQIIISSDKPPKDILTLEERLRSRFEWGLTVDIQSPDYETRMAILKKKEEL 295 Query 169 KQIEINPKISEYIIKN 184 + I+ ++ +YI N Sbjct 296 DCLTIDDEVMKYIASN 311 >sp|B9L735.1|DNAA_NAUPA RecName: Full=Chromosomal replication initiator protein dnaA Length=436 Score = 41.6 bits (96), Expect = 0.003, Method: Compositional matrix adjust. Identities = 56/189 (29%), Positives = 85/189 (44%), Gaps = 24/189 (12%) Query 16 KYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHL----SNILKKKIN 68 +Y + + V +N AY +S P K N I+G G GKTHL N LK +N Sbjct 102 EYTFESFIVGPSNQFAYTAAKSVAENPGKNYNPLFIYGGVGLGKTHLLQAIGNYLKSSLN 161 Query 69 -----SVEILN--AENITDETISKFEK--LNC--LIIDNYE----KNINEKTFYSILNSS 113 S + +N ENI +T +F + NC L+ID+ + K ++ F+ N Sbjct 162 VLYVTSEQFMNEFTENIRMKTPERFHEKYRNCDVLLIDDVQFFAGKERTQEEFFHTFNEL 221 Query 114 KQLDTYIVINSFLPIKDIKFDLKD-LRSRANSFMNLGIELPTDDLLTVIISKFFSDKQIE 172 I + + P K + +DL D LRSR + + + I+ P + II K I Sbjct 222 YNQKKQICLTADRPPKKL-YDLVDRLRSRFEAGLIVDIQPPELETKIEIIRKKCELNGIY 280 Query 173 INPKISEYI 181 + +I EYI Sbjct 281 LPEEIIEYI 289 >sp|B0KAG0.1|DNAA_THEP3 Gene info RecName: Full=Chromosomal replication initiator protein dnaA sp|B0K0W8.1|DNAA_THEPX Gene info RecName: Full=Chromosomal replication initiator protein dnaA Length=443 GENE ID: 5873697 dnaA | chromosomal replication initiation protein [Thermoanaerobacter pseudethanolicus ATCC 33223] Score = 41.2 bits (95), Expect = 0.003, Method: Compositional matrix adjust. Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 25/191 (13%) Query 16 KYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHLSNILKKKINS--- 69 KY + V ++N A+ + P K N I+G G GKTHL + + IN Sbjct 111 KYTFDTFVVGNSNKLAHAACLAVAQAPAKAYNPLFIYGGVGLGKTHLMHAIGHFINKHQS 170 Query 70 ---VEILNAENITDETIS------------KFEKLNCLIIDNYE----KNINEKTFYSIL 110 + + +E T+E ++ K+ ++ L+ID+ + K ++ F+ Sbjct 171 GYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIAKKERTQEEFFHTF 230 Query 111 NSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQ 170 N+ + + IVI+S P K+I + LRSR + I+ P + I+ K + Sbjct 231 NTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRIAILKKKAQTEN 290 Query 171 IEINPKISEYI 181 + I ++ Y+ Sbjct 291 LNIPDEVLAYV 301 >sp|B1VPF0.1|DNAA_STRGG RecName: Full=Chromosomal replication initiator protein dnaA Length=622 Score = 41.2 bits (95), Expect = 0.003, Method: Composition-based stats. Identities = 35/162 (21%), Positives = 71/162 (43%), Gaps = 22/162 (13%) Query 48 IFGPTGCGKTHLSNILKKKINS------VEILNAENITDETIS------------KFEKL 89 I+G +G GKTHL + + S V +++E T+E I+ ++ + Sbjct 321 IYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDTFRKRYRDV 380 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L++D+ + K ++ F+ N+ + IV++S P K + LR+R Sbjct 381 DILLVDDIQFLASKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWG 440 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 + ++ P + I+ K +Q+ P++ E+I R Sbjct 441 LTTDVQPPELETRIAILRKKAVQEQLNAPPEVLEFIASRISR 482 >sp|Q9ZH75.1|DNAA_STRCH RecName: Full=Chromosomal replication initiator protein dnaA Length=624 Score = 41.2 bits (95), Expect = 0.003, Method: Composition-based stats. Identities = 35/162 (21%), Positives = 71/162 (43%), Gaps = 22/162 (13%) Query 48 IFGPTGCGKTHLSNILKKKINS------VEILNAENITDETIS------------KFEKL 89 I+G +G GKTHL + + S V +++E T+E I+ ++ + Sbjct 323 IYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDTFRKRYRDV 382 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L++D+ + K ++ F+ N+ + IV++S P K + LR+R Sbjct 383 DILLVDDIQFLASKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWG 442 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 + ++ P + I+ K +Q+ P++ E+I R Sbjct 443 LTTDVQPPELETRIAILRKKAVQEQLNAPPEVLEFIASRISR 484 >sp|Q74GG6.1|DNAA_GEOSL RecName: Full=Chromosomal replication initiator protein dnaA Length=445 Score = 41.2 bits (95), Expect = 0.003, Method: Compositional matrix adjust. Identities = 46/174 (26%), Positives = 72/174 (41%), Gaps = 25/174 (14%) Query 16 KYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHLSNILKKKINSV-- 70 KY + +N A+ +S N P N I+G G GKTHL N + + SV Sbjct 113 KYTFDTFVCGGSNQFAHAAAQSVANSPAGKYNPLFIYGGVGLGKTHLLNAIGNHVLSVNR 172 Query 71 --------------EILNAENI--TDETISKFEKLNCLIIDNYE----KNINEKTFYSIL 110 E++N D+ +KF K++ L+ID+ + K ++ F+ Sbjct 173 KARICFYTSEKFMNELINCLRYQKMDQFRNKFRKMDILLIDDIQFIAGKERTQEEFFHTF 232 Query 111 NSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISK 164 NS + IV+ S KDI + LRSR + I+ P + I+ K Sbjct 233 NSLYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQAPDTETKVAILRK 286 >sp|Q9X9D5.1|DNAA_THET8 Gene info RecName: Full=Chromosomal replication initiator protein dnaA Length=436 GENE ID: 3169856 dnaA | chromosomal replication initiation protein [Thermus thermophilus HB8] (10 or fewer PubMed links) Score = 41.2 bits (95), Expect = 0.004, Method: Compositional matrix adjust. Identities = 43/195 (22%), Positives = 80/195 (41%), Gaps = 25/195 (12%) Query 16 KYYEQDYYVSSNNFSAYQLIESWPNWPDKWVN---IFGPTGCGKTHLSNILKKKIN---- 68 KY +++ V NN A+ + P + N I+G G GKTHL + + + Sbjct 105 KYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFP 164 Query 69 --SVEILNAENITDETI------------SKFEKLNCLIIDNYE----KNINEKTFYSIL 110 +E ++ E T+E I ++ ++ L++D+ + K ++ F+ Sbjct 165 HLRIEYVSTETFTNELINAIREDRMTEFRERYRSVDLLLVDDVQFIAGKERTQEEFFHTF 224 Query 111 NSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSFMNLGIELPTDDLLTVIISKFFSDKQ 170 N+ + I+++S P KDI LRSR + I+ P + I+ + Sbjct 225 NALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRG 284 Query 171 IEINPKISEYIIKNT 185 + I EYI + Sbjct 285 LRIPEDALEYIARQV 299 >sp|P27902.1|DNAA_STRCO RecName: Full=Chromosomal replication initiator protein dnaA Length=656 Score = 41.2 bits (95), Expect = 0.004, Method: Composition-based stats. Identities = 35/162 (21%), Positives = 72/162 (44%), Gaps = 22/162 (13%) Query 48 IFGPTGCGKTHLSNILKKKINS------VEILNAENITDETIS------------KFEKL 89 I+G +G GKTHL + + S V +++E T+E I+ ++ ++ Sbjct 355 IYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDSFRKRYREM 414 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L++D+ + K ++ F+ N+ + IV++S P K + LR+R Sbjct 415 DILLVDDIQFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWG 474 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 + ++ P + I+ K +Q+ P++ E+I R Sbjct 475 LITDVQPPELETRIAILRKKAVQEQLNAPPEVLEFIASRISR 516 >sp|Q9ZH76.1|DNAA_STRRE RecName: Full=Chromosomal replication initiator protein dnaA Length=643 Score = 41.2 bits (95), Expect = 0.004, Method: Composition-based stats. Identities = 35/162 (21%), Positives = 72/162 (44%), Gaps = 22/162 (13%) Query 48 IFGPTGCGKTHLSNILKKKINS------VEILNAENITDETIS------------KFEKL 89 I+G +G GKTHL + + S V +++E T+E I+ ++ ++ Sbjct 342 IYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDSFRKRYREM 401 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L++D+ + K ++ F+ N+ + IV++S P K + LR+R Sbjct 402 DILLVDDIQFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWG 461 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 + ++ P + I+ K +Q+ P++ E+I R Sbjct 462 LITDVQPPELETRIAILRKKAVQEQLNAPPEVLEFIASRISR 503 >sp|Q82FD8.1|DNAA_STRAW RecName: Full=Chromosomal replication initiator protein dnaA Length=653 Score = 41.2 bits (95), Expect = 0.004, Method: Composition-based stats. Identities = 35/162 (21%), Positives = 72/162 (44%), Gaps = 22/162 (13%) Query 48 IFGPTGCGKTHLSNILKKKINS------VEILNAENITDETIS------------KFEKL 89 I+G +G GKTHL + + S V +++E T+E I+ ++ ++ Sbjct 352 IYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDSFRKRYREM 411 Query 90 NCLIIDNYE----KNINEKTFYSILNSSKQLDTYIVINSFLPIKDIKFDLKDLRSRANSF 145 + L++D+ + K ++ F+ N+ + IV++S P K + LR+R Sbjct 412 DILLVDDIQFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWG 471 Query 146 MNLGIELPTDDLLTVIISKFFSDKQIEINPKISEYIIKNTER 187 + ++ P + I+ K +Q+ P++ E+I R Sbjct 472 LITDVQPPELETRIAILRKKAVQEQLNAPPEVLEFIASRISR 513