GOS 1082030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118859805
Annotathon code: GOS_1082030
Sample :
  • GPS :9°9'52n; 79°50'10w
  • Panama Canal: Lake Gatun - Panama
  • Fresh Water (-2m, 28.6°C, 0.1-0.8 microns)
Authors
Team : BioCell2009
Username : CANO-CHARDIN
Annotated on : 2010-01-16 19:18:42
  • Alexandra Cano
  • Camille Chardin

Synopsis

  • Taxonomy: Candidatus Pelagibacter ubique HTCC1002 (NCBI info)
    Rank: no rank - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 314261
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1091118859805 GOS_1082030 Genomic DNA
TTCTTGATTTTTTTTATCAAGCTCAGCTTCGATTAACTCGAGAGAAGTTCCTGCTTTGACTTTAATATAAAGTTCTTCAGGAAAATATTCGATAATTCCA
CTTAAATTTTTTAAATGTAAAGATTTAGCACATTGAATCAGTCTACCAATTGATTTTGTATTCTGTCCTTTAATTTCAATTGGAATTTCTTGTGAGTTAC
AATCTTTTATAAAGTCAACAACTTCACTTTCGCTTGTTGGCGAATAAATTTCAGACATTAAAATCTTGGAATATCTTTAAATTTTATATCTCCCTTATGA
ACATGCATCTTTCCGCTCTCTGCACAACGATGTAAAATTGGATAAACTTTTCCAGGATTCAAAAGAGATTTGTCGTCAAATGCTTGCTTAATATGAAGTT
GCTGTTGAATATCTTCATCGTTAAACATTTCACACATTAAATCTCTTTTCTCTATTCCAACTCCATGTTCGCCGGTAAGAACACCACCTACTTTTACACA
ATATTTTAAAATATCCGCTCCAAATTTCTCAGCTCTTTTTAATTCACTTTTTATATTTGAATCAAACATAATTAATGGATGTAAATTTCCATCACCGGCA
TGAAAACAATTTGCAACTCTTAAGCCATGCTTTTGTGAAAGTTTAGTAATTTCTCTTAAAACTTCCGGTAATTTTTTTCGAGGAATAGTTCCGTCCATAC
ATAAATAATCTGGCGACATATCACCAATTGCTGGAAATGCCGCTTTTCTTCCAAGCCAAAATCTTAATCTCTCTTCATCATTTTTACTGATGCGTAAATA
GGTTGCTTTATTTTTCTTTGCGATATCTTCAACTTTTTTTATTAGAACGTTCACTTCACTTTCGGTTCCATCTAACTCAACAATTAAAATCGCTTCAACA
TCCCTAGGATAACCTGCTTTAGAATAATCATCTGTTGCTTTAATCAAAGGTTTATCCATTAC

Translation

[1 - 702/962]   indirect strand
>GOS_1082030 Translation [1-702   indirect strand]
VMDKPLIKATDDYSKAGYPRDVEAILIVELDGTESEVNVLIKKVEDIAKKNKATYLRISKNDEERLRFWLGRKAAFPAIGDMSPDYLCMDGTIPRKKLPE
VLREITKLSQKHGLRVANCFHAGDGNLHPLIMFDSNIKSELKRAEKFGADILKYCVKVGGVLTGEHGVGIEKRDLMCEMFNDEDIQQQLHIKQAFDDKSL
LNPGKVYPILHRCAESGKMHVHKGDIKFKDIPRF

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Notre séquence comporte plusieurs ORFs mais un seul (le plus long) va retenir notre attention. Notre ORF est codant pour un domaine protéique correspondant à une FAD oxydase, cette hypothèse est confirmée par les différents blast. Les fiches des homologues de notre séquence indiquent qu'il s'agit d'une activité catalytique, en effet nous avons ici une enzyme et plus particulièrement une sous-unité d'enzyme qui interviendrait dans l'organisation et la biogenèse des compartiments cellulaires.

Le blastp nous permet de savoir que notre séquence appartiendrait à un organisme du groupe des alpha-proteobactéries. Notre groupe extérieur correspond donc aux beta-protéobactéries et aux gamma-protéobactéries. Nos arbres phylogénétiques nous le confirment. De plus, dans les arbres phylogénétiques, notres séquence est classée avec des alpha-protéobactéries appelées Candidatus Pelagibacter. Notre séquence provient certainement d'une de ces bactéries.

ORF finding

PROTOCOLE:


a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'

b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


ANALYSE DES RÉSULTATS:


Notre séquence comporte 3 ORFs : un dans le sens direct et deux dans le sens indirect. Ces trois ORF sont de longueurs différentes, on considère donc le plus long qui correspond à l'ORF numéro 1 dans le cadre de lecture 1 du sens indirect.

Notre ORF semble incomplet en 5' car il ne commence pas par une méthionine néanmoins il comporte un codon STOP à la fin donc on peut penser qu'il est complet en 3'.


Les différents blast nous permettent de confirmer qu'on se trouve dans le bon cadre de lecture.

RÉSULTATS BRUTS:

a) Sens direct :

Results for 962 residue sequence "GOS_1082030 ADN génomique (Panama Canal: Lake Gatun)" starting "TTCTTGATTT"

>ORF number 1 in reading frame 1 on the direct strand extends from base 409 to base 603. 
ATATCTTCATCGTTAAACATTTCACACATTAAATCTCTTTTCTCTATTCCAACTCCATGT 
TCGCCGGTAAGAACACCACCTACTTTTACACAATATTTTAAAATATCCGCTCCAAATTTC 
TCAGCTCTTTTTAATTCACTTTTTATATTTGAATCAAACATAATTAATGGATGTAAATTT 
CCATCACCGGCATGA 
>Translation of ORF number 1 in reading frame 1 on the direct strand. 
ISSSLNISHIKSLFSIPTPCSPVRTPPTFTQYFKISAPNFSALFNSLFIFESNIINGCKF 
PSPA* 

No ORFs were found in reading frame 2. 

No ORFs were found in reading frame 3. 


b) Sens indirect :

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 705.
GTAATGGATAAACCTTTGATTAAAGCAACAGATGATTATTCTAAAGCAGGTTATCCTAGG
GATGTTGAAGCGATTTTAATTGTTGAGTTAGATGGAACCGAAAGTGAAGTGAACGTTCTA
ATAAAAAAAGTTGAAGATATCGCAAAGAAAAATAAAGCAACCTATTTACGCATCAGTAAA
AATGATGAAGAGAGATTAAGATTTTGGCTTGGAAGAAAAGCGGCATTTCCAGCAATTGGT
GATATGTCGCCAGATTATTTATGTATGGACGGAACTATTCCTCGAAAAAAATTACCGGAA
GTTTTAAGAGAAATTACTAAACTTTCACAAAAGCATGGCTTAAGAGTTGCAAATTGTTTT
CATGCCGGTGATGGAAATTTACATCCATTAATTATGTTTGATTCAAATATAAAAAGTGAA
TTAAAAAGAGCTGAGAAATTTGGAGCGGATATTTTAAAATATTGTGTAAAAGTAGGTGGT
GTTCTTACCGGCGAACATGGAGTTGGAATAGAGAAAAGAGATTTAATGTGTGAAATGTTT
AACGATGAAGATATTCAACAGCAACTTCATATTAAGCAAGCATTTGACGACAAATCTCTT
TTGAATCCTGGAAAAGTTTATCCAATTTTACATCGTTGTGCAGAGAGCGGAAAGATGCAT
GTTCATAAGGGAGATATAAAATTTAAAGATATTCCAAGATTTTAA
>Translation of ORF number 1 in reading frame 1 on the reverse strand.
VMDKPLIKATDDYSKAGYPRDVEAILIVELDGTESEVNVLIKKVEDIAKKNKATYLRISK
NDEERLRFWLGRKAAFPAIGDMSPDYLCMDGTIPRKKLPEVLREITKLSQKHGLRVANCF
HAGDGNLHPLIMFDSNIKSELKRAEKFGADILKYCVKVGGVLTGEHGVGIEKRDLMCEMF
NDEDIQQQLHIKQAFDDKSLLNPGKVYPILHRCAESGKMHVHKGDIKFKDIPRF*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 687 to base 962.
AGATATTCCAAGATTTTAATGTCTGAAATTTATTCGCCAACAAGCGAAAGTGAAGTTGTT
GACTTTATAAAAGATTGTAACTCACAAGAAATTCCAATTGAAATTAAAGGACAGAATACA
AAATCAATTGGTAGACTGATTCAATGTGCTAAATCTTTACATTTAAAAAATTTAAGTGGA
ATTATCGAATATTTTCCTGAAGAACTTTATATTAAAGTCAAAGCAGGAACTTCTCTCGAG
TTAATCGAAGCTGAGCTTGATAAAAAAAATCAAGAA
>Translation of ORF number 1 in reading frame 3 on the reverse strand.
RYSKILMSEIYSPTSESEVVDFIKDCNSQEIPIEIKGQNTKSIGRLIQCAKSLHLKNLSG
IIEYFPEELYIKVKAGTSLELIEAELDKKNQE

Multiple Alignement

PROTOCOLE:


EBI / Programme T-Coffee / Parametres par defaut/ Sortie format clustal.


Les séquences qui ont servi à l'alignement sont récupérées à partir du blastp. Ce sont les suivantes :


>Alphapro1 Candidatus Pelagibacter ubique HTCC1002/Alphaproteobacteria/ref|ZP_01264560.1| gi|91762595|ref|ZP_01264560.1| (S)-2-hydroxy-acid oxidase [Candidatus Pelagibacter ubique HTCC1002]

MSELVLPKIDKATINKKEYIFKNLAKIINPENVLSHADDIKPYETDALAAYTQTPLTVVMPENTEEVSNILKFCHKENIK

VVPRGAGTGLSGGALPLNDAILLSLGKFNKIIEIDFENKCVVTQPGVTNLGITHAVQHKNFYYAPDPSSQLACSIGGNVA

ENSGGVHSLKYGTTTNNILGVEMVMMDGTVCRVGGKTLDQEGYDLMGLICGSEGLLGVITEVTVKILKNPQVVKAALIGF

PTIEEGGNAASEIISSGIVPAGMEIMDKALIEATDNFSKAGYPRDAELLLIVELDGTESEVDELLKQVRSICEKNNCSSL

KLSKNEKERLSFWAGRKAAFPACGAMAPDYYCMDGSIPRGKLAEALLEIKRLSEKYELPVANCFHAGDGNLHPLIMFDGS

DKEQLRKTEEFGAEILKTCVRLGGVITGEHGVGVEKRELMCEMFNNTDIQQQLDIKKSLDEKNLLNPGKVYPILRKCAEE

GRVHVHRNEEKFPDLPRF


>Alphapro2 Candidatus Pelagibacter ubique HTCC1062/Alphaproteobacteria/ref|YP_265702.1| gi|71082983|ref|YP_265702.1| (S)-2-hydroxy-acid oxidase [Candidatus Pelagibacter ubique HTCC1062]

MSELVLPKIDKATINKKEYIFKNLAKIINPENVLSHADDIKPYETDALAAYTQTPLAVVMPENTEEVSNILKFCHKENIK

VVPRGAGTGLSGGALPLNDAILLSLGKFNKIIEIDFENKCVVTQPGVTNLGITHAVQHKNFYYAPDPSSQLACSIGGNVA

ENSGGVHSLKYGTTTNNILGVEMVMMDGTVCRVGGKTLDQEGYDLMGLICGSEGLLGVITEVTVKILKNPQVVKAALIGF

PTIEEGGNAASEIISSGIVPAGMEIMDKALIEATDNFSKAGYPRDAELLLIVELDGTESEVDELLKQVRSICEKNNCSSL

KLSKNEKERLSFWAGRKAAFPACGAMAPDYYCMDGSIPRGKLAEALLEIKRLSEKYKLPVANCFHAGDGNLHPLIMFDGS

DKEQLRKTEEFGAEILKTCVRLGGVITGEHGVGVEKRELMCEMFNNTDIQQQLDIKKSLDEKNLLNPGKVYPILRKCAEE

GRVHVHRNEEKFPDLPRF


>Alphapro3 Ochrobactrum/Alphaproteobacteria/ref|ZP_04681851.1| gi|239833523|ref|ZP_04681851.1| D-lactate dehydrogenase (cytochrome) [Ochrobactrum intermedium LMG 3301]

MVEENMSGLIMPEPDASVMQKREQIVADLRGIVPGEGVVDAINAMRVFESDGLTAHRSLPLVVVLPETVDQVARVLRYCH

DNNVRVVPRGAGTSLSGGSMPLQDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSI

GGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEVIRLGGKHLDSEGYDLLGLMTGSEGLLGVVTEITVRILQKPETARA

VMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPVEVDYLIGRVEALALRN

GSTTCILSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRDLSEKYGLRVANVFHAGDGNLHPLI

LYDANIPGELEAAENFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNEIDLDQQMRVKCAFDAKHLLNPGKVFPQLR

RCAELGRMHVHRGELAFPDIPRF


>Alphapro4 Methylocella silvestris BL2/Alphaproteobacteria/ref|YP_002362004.1| gi|217977857|ref|YP_002362004.1| FAD linked oxidase domain protein [Methylocella silvestris BL2]

MKALDVDQTIMARRREIVAALRAIIPGEAVIDAEIGRRPYESDGFTAYANLPLVVVLPSTTAELQAVLRYCYANAIKVVP

RGAGTSLSGGALPLQDGVLISMMKFNKIKEIDFENRCAVVEPGVTNAAISRAVDHRGFYYAPDPSSQIACSIGGNVAENS

GGVHCLKYGLTTNNVLGVEMALMDGEIVRLGGAFLDAEGYDFLSLVVGSEGMLGVVTEVTVRLLRKPESARALMIAFDSS

EAGGACVADVIAAGIIPGGMEMMDRPAIHAAEDFVHAGYPRDAEAMLIVELDGPPVEVNHLVGLVEAIALKRGATQCRIS

NSEAERLAFWAGRKAAFPAVGRLSPDYLCMDGTIPRKQLPRVLAGIAELSEKHKLRVANVFHAGDGNLHPLILYDANKPG

ELQAAEDFGSDILRLCVEVGGVLTGEHGVGVEKRDLMPVMFNEIDLDQQIGIKCAFDEKMLLNPGKMFPTLHRCAEMGRM

HVHQGQLPFPELPRF


>Alphapro5 Brucella abortus/Alphaproteobacteria/ref|ZP_04595682.1| gi|237816690|ref|ZP_04595682.1| (S)-2-hydroxy-acid oxidase chain D [Brucella abortus str. 2308 A]

MRACPEKQSAQGLGRALRQKAPAVEEEMSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFETDGLTAHRQ

LPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNLGIT

KAVEHEGFYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSE

GLLGVVTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVE

LDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALS

EKYGLRVANVFHAGDGNLHPLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLDQQM

RVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF


>Alphapro6 Mesorhizobium sp. BNC1/Alphaproteobacteria/ref|YP_672933.1| gi|110632725|ref|YP_672933.1| FAD linked oxidase-like [Mesorhizobium sp. BNC1]

MSGALLPKPDMATLAKRDEIVADMRIIVPGEGVVEAESAMRAFESDGLTAYRQLPLVVVLPETVAQVSRILKYCDERNIR

VVPRGSGTSLSGGALPLQDAVLLVMSRFNRILEIDFANRAVVTQPGVTNLGITHAVEHEGFYYAPDPSSQIACSIGGNVA

ENSGGVHCLKYGLTANNILGIQMVLMNGDVIRLGGKHLDSDGYDLMGLMTGSEGLLGVVTEVTVRILKKPETARALLIGF

PSSEQAGQCVADIIGAGIIPGGMEMMDRPAIHAAESFVNAGYPLDVEALLIVELDGPQAEVHHLIESVDAIARKNGCTTN

RVSNSDEERLSFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPRVLSGMRELSEKYGLGVANVFHAGDGNLHPLILYDAN

KPGELERAEGFGADILRLCVQVGGVLTGEHGVGVEKRDLMPEMFSEEDLNQQIRVKCAFDPNHLLNPGKVFPQLHRCAEL

GRMHIHRGQMPFPDLERF


>Alphapro7 Brucella melitensis 16M/Alphaproteobacteria/ref|NP_542042.1| gi|17989409|ref|NP_542042.1| (S)-2-hydroxy-acid oxidase chain D [Brucella melitensis 16M]

MFRRNCVKTGIQGGYGLRACPEKQSAQGLGRALRQKAPAVEEEMSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTV

NAMRVFETDGLTAHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYP

NRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKH

LDSEAYDLLGLMTGSEGLLGVVTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAEDF

VRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTI

PRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLHPLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKR

DLMPEMFNETDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF


>Alphapro8 Brucella/Alphaproteobacteria/ref|ZP_05173848.1| gi|254712037|ref|ZP_05173848.1| FAD binding domain protein [Brucella ceti M644/93/1]

MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFETDGLTAHRQLPLVVVLPETVEQVAQVLRYCHDNAIR

VVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGQVA

ENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGVVTEITVRILQKPETARAIMVGF

PSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTC

TLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLHPLILYDAN

NPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAEL

GRMHVSRGALAFPDLPRF


>Alphapro9 Rhodopseudomonas palustris CGA009/Alphaproteobacteria/ref|NP_946481.1| gi|39934205|ref|NP_946481.1| glycolate oxidase subunit GlcD [Rhodopseudomonas palustris CGA009]

MTILMPEPDQSVLARRDEIIAALRKIVPGEGVISSAAEMKPYESDGLMAYRQPPMVVVLPSTTKQVSEVLRYCHQNGIKV

VPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRAVVVEPGVTNLAISQAVDHAGFYYAPDPSSQIACSIGGNIAE

NSGGVHCLKYGMTTNNVLGCEIVLMTGEILKIGGKAAECAGYDLMGVITGSEGLLGVITEVTVRILRKPETARALMIGFQ

SVEAAGQCVADVISAGIIPGGMEMMDKPAIHAAEAFVHAGYPLDVEALLIIELDGPQVEVDELISRVEAIALGCGSTTCQ

ISTSEQQRLLFWSGRKAAFPAVGRISPDYLCMDGTIPRKQLPLVLRRMNEMSEKYGLRVANVFHAGDGNLHPLILYDANK

PGEQDAAEAFGADILKLCVEVGGVLTGEHGVGIEKRDLMPEMFSDIDLNQQQRLKCAFDSEGLLNPGKVFPTLHRCAELG

RMHVHKGQLPFPDIPRF


>Alphapro10 Aurantimonas sp. S185-9A1/Alphaproteobacteria/ref|ZP_01227859.1| gi|90419950|ref|ZP_01227859.1| glycolate oxidase, subunit glcD [Aurantimonas manganoxydans SI85-9A1]

MSVMMPKPSEAILGRRQSIVNALRAILPGEGVVDAANEMAVFESDGLTAYRQMPLVVVLPSTVEQVARVLQYCHANEIPV

VPRGSGTSLSGGALPLEDGVLLVLSKFNRVLEIDYDNRCAVVQPGVTNLGITKAVEGEGFYYAPDPSSQIACSIGGNVAE

NSGGVHCLKYGLTANNVLGIEFVTIEGEVVRLGGKHLEAEGYDFLGLMTGSEGLLGVVTEVTVRILQKPETARAVLIGFP

TSEQAGECVAAIIAKGIIPAGMEMMDRPAIHAAEDFVHAGYPRDVEALLIVELDGPGAEVDHLLAEVAAIADANGATVTK

VSNSEEERASFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPRVLAGMKAFSEKYDLRVANVFHAGDGNLHPLILYDANK

EGELHRAEEFGNDILRLCVEVGGVLTGEHGVGVEKRDLMPEMFSEDDLRHQQRVKCAFDDKHLLNPGKVFPQLHRCAELG

RMHVHKGQVAFPDLPRF


>Alphapro11 Rhodopseudomonas palustris BisB5/Alphaproteobacteria/ref|YP_571257.1| gi|91978598|ref|YP_571257.1| D-lactate dehydrogenase (cytochrome) [Rhodopseudomonas palustris BisB5]

MTILMPEPDQSVLARRDQIVAALRKIVPGEGVISSAAEMKPYESDGLMAYRQPPMVVVLPGTTQQVSEVLRYCHKHGIKV

VPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRAVVVEPGVTNLAISQAVDHAGFYYAPDPSSQIACSIGGNIAE

NSGGVHCLKYGMTTNNVLGCEIVLMTGEILRIGGKAAECAGYDLMGVITGSEGLLGVITEVTVRILRKPETARALMVGFT

DVEAAGRCVADIISAGIIPGGMEMMDRPAIHAAEAFVHAGYPLDVEALLIIELDGPQVEVDELITRVETIALGCGSTTCQ

ISTSEKERLLFWSGRKAAFPAVGRISPDYLCMDGTIPRAKLPQVLRRMTEMSEHYGLRVANVFHAGDGNLHPLILYDANQ

PGEMDKAEAFGADILRLCVEVGGVLTGEHGVGIEKRDLMPEMFSDIDLNQQQRLKCAFDSEGLLNPGKVFPTLHRCAELG

RMHVHGGKTAFPDIPRF


>Alphapro12 Fulvimarina pelagi HTCC2506/Alphaproteobacteria/ref|ZP_01438649.1| gi|114705746|ref|ZP_01438649.1| ATPase, E1-E2 type:FAD linked oxidase, C-terminal:FAD linked oxidase, N-terminal [Fulvimarina pelagi HTCC2506]

MSIAMPKPSEAVLSRREEIVSALRVIVPGEGVVDATNEMKAFESDGLTAYRQLPLVVVLPDNVGQVSRVLKYCHENDIPV

VPRGAGTSLSGGALPLEDGVLLVLSKFNKVLDIDFDNRCAVVQPGVTNLGITKAVEHRGFYYAPDPSSQIACSIGGNIAE

NSGGVHCLKYGLTANNVLGIEFVTIEGEIVRLGGKHLDADGHYDMLGLMTGSEGLLGVVTEVTVRILQAPETARAVLIGF

PSSEQAGECVASIIAKGIIPGGMEMMDRPAIHAAEDFVNAGYPRDVEALLIVELDGPKAEVDHLLTEVEAIAGENGATTT

RVSQNEEERAAFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPKVLAGMKAMEKKYGLKCANVFHAGDGNLHPLVLYDAN

AGELERAEEFGNDILKLCVEVGGVLTGEHGVGVEKRDLMPEMFSETDMNHQQRVKCTFDAKHLLNPGKVFPQLHRCAELG

RMHVHKGEVAFPDLPRF


>Alphapro13 alpha proteobacterium BAL199/Alphaproteobacteria/ref|ZP_02187380.1| gi|163793405|ref|ZP_02187380.1| FAD linked oxidase-like protein [alpha proteobacterium BAL199]

MKMPEPDGAVLARRGEIVAALRAIVPGEGVIADDREMRPYESDGLTAYRQLPMVVVLPETTAQVAAILKYCQANGIKVVP

RGSGTSLSGGALPLADGVLLGLGKFNRILDIDYANRTVTAQPGVTNLGITHAVQDRGFYYAPDPSSQIACSIGGNVAENS

GGVHCLKYGLTTNNVLGVEMVTIDGEILRLGGKHLDSEGYDLLGVLTGSEGLLAVVTEVTVRILRKPATARALLVGFGNS

EEAGACVAAIVGAGIIPGGMEMMDGLAINAAEDFVHAGYPRDAGALLIVELDGPEVEVGFLIDRVREIAEAHGATSLRIS

QNEDERNAFWAGRKAAFPAVGRISPDYYCMDGTIPRRQLPEILSRMTRMSEQYGLRVANVFHAGDGNLHPLILFDANEPG

ELEKAEAFGSDILRACVELGGVLTGEHGVGVEKRDLMGTMFSEIDLAQQQRLKCAWDPNGLLNPGKVFPTLHRCAELGRM

HIQRGQLPFPDLPRF


>Alphapro14 Sphingomonas wittichii RW1/Alphaproteobacteria/ref|YP_001261496.1| gi|148553914|ref|YP_001261496.1| D-lactate dehydrogenase (cytochrome) [Sphingomonas wittichii RW1]

MTLRMPTPDEAVLARRAEIVAALRAIVPGEGVIDDADELRPYESDGLTAYRQPPMVVVLPETVDQVAAVLRWCHANGVRV

VPRGAGTSLSGGALPLADAVLLGMARFNRILAIDYADRIAVVQPGVTNLAITRAVEEEGFYYAPDPSSQIACTIGGNVAE

NSGGVHCLKYGLTTNNVLGVELVTIEGEVLRLGGRHLDPAGLDLLGVVVGSEGLLGVVTEVTVRILPRPETARAALIGFP

TVESAGQCVADVIAAGIIPAGMEMMDRPAIHAAEAFVQVGYPLDVEALLIVEMDGPAAECDHLVDEVARIADANGAVSLR

VSNDDAERLAFWAGRKAAFPAVGRIAPDYYCMDGTIPRRRLPEVLRRMSELAAHHGLGVANVFHAGDGNLHPLILYDAHK

PGDLERAEEFGNDILRLCVEVGGVLTGEHGVGVEKRDLMPEMFSDIDLKQQQRVKCAFDPASLLNPGKVFPTLHRCAELG

RMHVHGGALPFPDLPRF


>Alphapro15 Oligotropha/Alphaproteobacteria/ref|YP_002290252.1| gi|209886395|ref|YP_002290252.1| glycolate oxidase, subunit GlcD [Oligotropha carboxidovorans OM5]

MTIKMPAPDEGILARRDEIIAALREIVPGEGVIDSEREMMPYESDALTAYRQPPMVVVLPDTTEQVAQVLKYCYDNGIRV

VPRGNGTSLSGGSFPLADGVLLGLSKFKRVREIDFDNRVAVVEPGMTNLAVSEAVAHEGFYYAPDPSSQIACSIGGNIAE

NSGGVHSLKYGLTTNNVLGCEFVLITGEILRIGGRAPENDGYDLMGIITGSEGLLGVVTEITVRILKKPETARALMVGFA

EVEAAGECVARIIGAGIIPGGMEMMDKDAIHAAEAFVKAGYPLDVEALLIIELDGPSIEVDELIRRVEAIALDCRSTTCQ

ISNSEQERLLFWAGRKAAFPAVGRLSPDYLCMDGTIPRGKLPEALAGIRELGKKYGLRCANVFHAGDGNLHPLILYDANV

ADEMQRAEDFGADILRLCVKLGGVLSGEHGIGVEKRDLMPEMLSDIDLAHHQRIKCAFDAKGLLNPGKMFPTLHRCAELG

RMHVHGGKLPFPDIPRF


>Alphapro16 Bradyrhizobium sp. ORS278/Alphaproteobacteria/ref|YP_001207996.1| gi|146342948|ref|YP_001207996.1| glycolate oxidase, subunit GlcD [Bradyrhizobium sp. ORS278]

MAIMMPEADQAVLARRGDIVAALRAIVPGEGVIDSAAEMLPYESDGLMAYRQPPMVVVLPETTAQVSQVLRYCHGQGIKV

VPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRVVVTEPGVTNLAISQAVAHAGFYYAPDPSSQIACSIGGNVAE

NSGGVHCLKYGMTTNNVLGCELVLMNGEVLRIGGKCTENAGYDLMGLITGSEGLLGVVTEVTVRILQKPETARALMVGFT

QVEAAGECVARIIGAGIIPGGMEMMDKPAIHAAEAFVHAGYPLDVEALLIIELDGPGVEVDELISRVEAIANGCGSTTCR

ISTSEAERNLFWAGRKAAFPAVGRISPDYLCMDGTIPRGALPKALARIRELSEKYQLGCANVFHAGDGNLHPLILYDANK

PGEMERAEAFGADILRCCVELGGVLTGEHGVGIEKRDLMPDMFTEIDLNQQQRVKCAFDHLGLLNPGKVFPTLHRCAELG

RMHVHAGKLAFPDLPRF


>Alphapro17 Nitrobacter hamburgensis X14/Alphaproteobacteria/ref|YP_578399.1| gi|92118670|ref|YP_578399.1| FAD linked oxidase-like [Nitrobacter hamburgensis X14]

MPIMMPASDQLVLNRRDAIVADLRAIVPGEGVISSAAEMLPYESDALTAYRQPPMVVVLPETTEQVSRVLKYCFDNGIKV

VPRGSGTSLSGGALPLEDAVLLGLSKFKRIREIDFDNRVVVTEPGVTNLAISQAVAHAGFYYAPDPSSQIACSIGGNIAE

NSGGVHCLKYGMTTNNVLGCELVLMSGEILRIGGKTAESAGYDLMGIITGSEGLLGVVTEVTVRILRKPETARALLVGFP

QVEAAGECVARIIGAGIIPGGMEMMDKPAIHAAEAFVHADYPLDVEALLIIELDGSSIEVDELIKRVEAIALGCGSTTCR

ISGSEAERDLFWAGRKAAFPAVGRISPDYLCMDGTIPRGALPRALSRIRDLSEKYGLGVANVFHAGDGNLHPLILYDANK

PGEMDKAEAFGAEILCCCVELGGVLTGEHGVGIEKRDLMPYMFSEADLNQQQRLKCAFDARGLLNPGKVFPTLHRCAELG

RVHVHGGKLAFPDLPRF


>Gammapro1 Thioalkalivibrio/Gammaproteobacteria/ref|YP_002514104.1| gi|220935205|ref|YP_002514104.1| FAD linked oxidase domain protein [Thioalkalivibrio sp. HL-EbGR7]

MSADALRPANLEEPRAVSARERDALIRELLGVVPSQGVLHDDEDLRPYECDGLSAYRRKPMLVVLPETIEQVQQVLRLCQ

AHQVPVVARGAGTGLSGGAFPLANGVLLGLAKFNRILAIDPDNRCARVQPGVRNLAISEAAAAHGLYYAPDPSSQIACSI

GGNVAENAGGVHCLKYGLTVHNILELKVVTIDGELITLGGQSLDSPGYDLLALMTGSEGMLGVIVEITVKLLPRPERAQV

LLAAFDNVERAGEAVAAIIGSGIIPAGLEMMDNNSIRAAEDFVHAGYPVEAEAILLCELDGTNAEVSEDIMQVRELLIAQ

GATEVRTAGDDQERLRFWAGRKAAFPAVGRLSPDYYCMDGTIPRKNLGQVLRRIGEMSDEFGLRVANVFHAGDGNLHPLI

LYDADTPGQLERTEDFGGRILELCVEYGGTITGEHGVGIEKLNQMCTQFTPDALTQFHAVKAAFDPRGLLNPGKAVPTLH

RCAEFGAMHVHHGQLPHPDIPRF


>Gammapro2 Nitrosococcus oceani ATCC 19707/Gammaproteobacteria/ref|YP_342548.1| gi|77164023|ref|YP_342548.1| D-lactate dehydrogenase (cytochrome) [Nitrosococcus oceani ATCC 19707]

MSSPTHETFAHSIPKGKLVKAFSAFLSPETILFEEEDLRPYECDGLSAYRVLPWMVVLPETVEQVQKILQICHSWDIPVV

ARGAGTGLSGGALPLKNGVLLSLAKFNRILAIDPISRTARVQPGVRNLAISEAAAPAGLYYAPDPSSQIACTIGGNVAEN

SGGVHCLKYGLTVHNILGLKMLTMTGEEISLGGETLDSPGYDLLALMTGSEGLLGVIIEVTVRLLPLPERAQVILAAFDN

VAKAGAAVGGIISAGIIPGGLEMMDNLAIRAAEDFVHAGYPQEAAAILLCELDGTQAEVSHQIRKVRELLLSHGAIEIRT

ALDEQERAKLWQGRKAAFPAVGRLAPDYYCMDGTIPRNRLPQVLERINELSQEFNLPVANVFHAGDGNLHPLILYDANRP

GELERAEQLGANILELCVAVGGTITGEHGVGIEKINQMCIQFGTAELQQFHALKAAFDPKGLLNPGKAVPTLHRCAEFGA

MHVHQGKLPFPELDRF


>Gammapro3 Beggiatoa sp. PS/Gammaproteobacteria/ref|ZP_02002890.1| gi|153874819|ref|ZP_02002890.1| glycolate oxidase, subunit D [Beggiatoa sp. PS]

MSNRQARQNQLANAFHQFLPTHSVLIHEEELRPYECDGLSAYRKMPLIVVLPKTIEQIQNILQVCREQDVPIVCRGAGTS

LSGGALPLNDGVLLSVAKFNRILEIDPVNRTARVQPGVRNLAISQSVAPYGLYYAPDPSSQIACSIGGNVSENAGGVHCL

KYGLTVHNVLQVTFLTIDGELITLGSSGLDGPGYDLLAVLTGSEGMLGVIVEITVKLLPKPPQVQVLLAAFNNIEDAGTA

VAKIIGAGIIPAGLEMMDNPAIRAAEDFIHAGYPKEAEAILLCELDGNNAEEVSEQVAQVSDLLQSCHATEVRVAKDEQE

RQKIWAGRKSAFPAVGRISPDYYCMDGTIPRKQLPYVLNKIKELSKTYDLQVANVFHAGDGNLHPLILYDANQPGELERA

EEFGGRILEVCVEVGGTITGEHGVGIEKINQMCVQFNSSELEQFHALKQAFDPNKLLNPGKAIPTLARCVEFGAMHVHGG

QLPFSGIERF


>Gammapro4 Pseudomonas syringae pv./Gammaproteobacteria/ref|ZP_05638796.1| gi|257484755|ref|ZP_05638796.1| glycolate oxidase subunit GlcD [Pseudomonas syringae pv. tabaci ATCC 11528]

MNILYDERIDGVLPAVDKQQLLHEIRRQLPDLDILHRAEELRPYECDGLSAYRTTPMLVVLPRHVEEVQTLLKLCHAHRV

PVVARGAGTGLSGGALPLEKGVLLVMARFNQILAIDPAARLARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACSIGGNV

AENAGGVHCLKYGLTVHNLLKVEILTVEGEPMTLGSDTLDSPGFDLLALFTGSEGMLGVITEVTVKLLPRPQVAKVLLAA

FDSVEKAGGAVADIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVDAEAILLCELDGVEADVHADCERVREVLTLAGATE

VRQAKDEAERVRFWAGRKNAFPAVGRLSPDYYCMDGTIPRRELPRVLRSIKELSAQYGLRVANVFHAGDGNMHPLILFDA

NQPGELERAEALGGKILELCVEVGGSITGEHGVGREKINQMCAQFNSDELTFFHAIKAAFDASGLLNPGKNIPTLHRCAE

FGAMHIHAGQLPFPELERF


>Gammapro5 Sideroxydans/Gammaproteobacteria/ref|ZP_05339883.1| gi|255260529|ref|ZP_05339883.1| FAD linked oxidase domain protein [Sideroxydans lithotrophicus ES-1]

MPHQPEKTVARNAGLIKALRDFLPPESVLDQREQLRPFECDGLSVYRQLPMVVVLPETIAQVQGIMRLCHAQDIPVVARG

AGTGLSGGALPLANGVLLSLAKFRNILHIDPHNAMATVQPGVRNLAISEAAAAYGLYYAPDPSSQIACTIGGNVAENSGG

VHCLKYGLTVHNILMLKVVTAEGELLTIGAETLDAPGYDLLALMTGSEGMLGIIVEVTVKLLARPERAQVVLAAFDDVVK

AGEAVGAIIAAGIIPAGLEMMDRLAIQAAEDFVHAGYPRDAEAILLCELDGTNAEVSEYIMTMRRILTDSGATEVRTAVD

EAERQLFWKGRKSAFPAVGRISPDYYCMDGTIPRRQLPHVLRRISEMSEEYGLAVANVFHAGDGNLHPLILFDANKEGEL

HRAEELGQGILQLCVEVGGTITGEHGVGMEKIDQMCIQFRSAELAQFHAVKAAFDPSGLLNPGKAVPTLQRCAEFGAMHV

HHGKLSHPELERF


>Betaprot1 Burkholderia phymatum STM815/Betaproteobacteria/ref|YP_001861763.1| gi|186470445|ref|YP_001861763.1| glycolate oxidase, subunit GlcD [Burkholderia phymatum STM815]

MSYAYDERIDGPLPSHDKSALVAELQRLVPGMQLLHDREDLRPFECDGLAAYRTTPMMVALPDSIEQVQALLKFAAARNV

PVVARGAGTGLSGGALPLEQGILLVMARFNRILHIDPEASIARVQPGVRNLAISQAAAIHGLYYAPDPSSQIACSIGGNV

AENAGGVHCLKYGLTVHNILKLEVMTIDGERLTIGSEALDSPGFDLLALLTGSEGMLGIVTEVTVKLLTRPQSAKVLLAS

FDDVEKAGAAVAQIIGAGVIPGGLEMMDNLAIRAAEDFIHAGYPVDAQAILLCELDGAESDVQEDCDRVGALLREAGATD

IRIAKDEAERQRFWAGRKNAFPAVGRISPDYYCMDGTIPRRELARVLRGIAALSNEYGLRVANVFHAGDGNMHPLILFDA

NSPGEMERAETLGAKILELCVEVGGSITGEHGVGREKINQMCVQFSSEELKLFHSLKAAFDPDGLLNPGKNIPTLHRCAE

FGAMHIHRGKLPFPDLERF


>Gammapro6 Escherichia coli B str. REL606/Gammaproteobacteria/ref|YP_003046034.1| gi|254162926|ref|YP_003046034.1| glycolate oxidase subunit, FAD-linked [Escherichia coli B str. REL606]

MSILYEERLDGALPDVDRTSVLMALREHVPGLEILHTEEEIIPYECDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRLRV

PVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACSIGGNV

AENAGGVHCLKYGLTVHNLLKIEVQTLNGEALTLGSDALDSPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLAS

FDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVESDVQEDCERVNDILLKAGATD

VRLAQDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMHPLILFDA

NEPGEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTLHAVKAAFDPDGLLNPGKNIPTLHRCAE

FGAMHVHHGHLPFPELERF








ANALYSE DES RÉSULTATS:


Notre alignement multiple nous montre que notre séquence s'aligne avec ses homologues sur à peu près la moitié de la séquence (sur sa fin) et on obtient un score significatif de 90.

On pense qu'il y a un domaine conservé dans notre séquence car il s'aligne avec toutes les séquences auxquelles on la compare.



RÉSULTATS BRUTS:

CLUSTAL FORMAT for T-COFFEE Version_8.06 [http://www.tcoffee.org] [MODE:  ], CPU=0.85 sec, SCORE=90, Nseq=25, Len=550 

Alphapro1       M-------------------------------------------SE-----LVLPKID-K
Alphapro10      M-------------------------------------------S------VMMPKPS-E
Alphapro11      M-------------------------------------------T------ILMPEPD-Q
Alphapro12      M-------------------------------------------S------IAMPKPS-E
Alphapro13      M-------------------------------------------K--------MPEPD-G
Alphapro14      M-------------------------------------------T------LRMPTPD-E
Alphapro15      M-------------------------------------------T------IKMPAPD-E
Alphapro16      M-------------------------------------------A------IMMPEAD-Q
Alphapro17      M-------------------------------------------P------IMMPASD-Q
Alphapro2       M-------------------------------------------SE-----LVLPKID-K
Alphapro3       MVEE--------------------------------------NMSG-----LIMPEPD-A
Alphapro4       M-------------------------------------------K------AL--DVD-Q
Alphapro5       MRAC----------------PEKQSAQGLGRALRQKAPAVEEEMSG-----LIMPEPD-A
Alphapro6       M-------------------------------------------SG-----ALLPKPD-M
Alphapro7       MFRRNCVKTGIQGGYGLRACPEKQSAQGLGRALRQKAPAVEEEMSG-----LIMPEPD-A
Alphapro8       M-------------------------------------------SG-----LIMPEPD-A
Alphapro9       M-------------------------------------------T------ILMPEPD-Q
Betaprot1       M-------------------------------------------SYA------YDERIDG
GOS_1082030     ------------------------------------------------------------
Gammapro1       M-------------------------------------------SADALRPANLEEPR-A
Gammapro2       M-------------------------------------------SSP------THETF-A
Gammapro3       M-------------------------------------------SN--------------
Gammapro4       M-------------------------------------------NIL------YDERIDG
Gammapro5       M-----------------------------------------------------PHQP-E
Gammapro6       M-------------------------------------------SIL------YEERLDG
                                                                            

Alphapro1       ATI-NKKEYIFKNLAKIINPENVLSHADDIKPYETDALAAYTQTPLTVVMPENTEEVSNI
Alphapro10      AIL-GRRQSIVNALRAILPGEGVVDAANEMAVFESDGLTAYRQMPLVVVLPSTVEQVARV
Alphapro11      SVL-ARRDQIVAALRKIVPGEGVISSAAEMKPYESDGLMAYRQPPMVVVLPGTTQQVSEV
Alphapro12      AVL-SRREEIVSALRVIVPGEGVVDATNEMKAFESDGLTAYRQLPLVVVLPDNVGQVSRV
Alphapro13      AVL-ARRGEIVAALRAIVPGEGVIADDREMRPYESDGLTAYRQLPMVVVLPETTAQVAAI
Alphapro14      AVL-ARRAEIVAALRAIVPGEGVIDDADELRPYESDGLTAYRQPPMVVVLPETVDQVAAV
Alphapro15      GIL-ARRDEIIAALREIVPGEGVIDSEREMMPYESDALTAYRQPPMVVVLPDTTEQVAQV
Alphapro16      AVL-ARRGDIVAALRAIVPGEGVIDSAAEMLPYESDGLMAYRQPPMVVVLPETTAQVSQV
Alphapro17      LVL-NRRDAIVADLRAIVPGEGVISSAAEMLPYESDALTAYRQPPMVVVLPETTEQVSRV
Alphapro2       ATI-NKKEYIFKNLAKIINPENVLSHADDIKPYETDALAAYTQTPLAVVMPENTEEVSNI
Alphapro3       SVM-QKREQIVADLRGIVPGEGVVDAINAMRVFESDGLTAHRSLPLVVVLPETVDQVARV
Alphapro4       TIM-ARRREIVAALRAIIPGEAVIDAEIGRRPYESDGFTAYANLPLVVVLPSTTAELQAV
Alphapro5       GVL-QRREQIVADLRVIVPGEGVVDTVNAMRVFETDGLTAHRQLPLVVVLPETVEQVAQV
Alphapro6       ATL-AKRDEIVADMRIIVPGEGVVEAESAMRAFESDGLTAYRQLPLVVVLPETVAQVSRI
Alphapro7       GVL-QRREQIVADLRVIVPGEGVVDTVNAMRVFETDGLTAHRQLPLVVVLPETVEQVAQV
Alphapro8       GVL-QRREQIVADLRVIVPGEGVVDTVNAMRVFETDGLTAHRQLPLVVVLPETVEQVAQV
Alphapro9       SVL-ARRDEIIAALRKIVPGEGVISSAAEMKPYESDGLMAYRQPPMVVVLPSTTKQVSEV
Betaprot1       PLPSHDKSALVAELQRLVPGMQLLHDREDLRPFECDGLAAYRTTPMMVALPDSIEQVQAL
GOS_1082030     ------------------------------------------------------------
Gammapro1       VSA-RERDALIRELLGVVPSQGVLHDDEDLRPYECDGLSAYRRKPMLVVLPETIEQVQQV
Gammapro2       HSI-P-KGKLVKAFSAFLSPETILFEEEDLRPYECDGLSAYRVLPWMVVLPETVEQVQKI
Gammapro3       -RQ-ARQNQLANAFHQFLPTHSVLIHEEELRPYECDGLSAYRKMPLIVVLPKTIEQIQNI
Gammapro4       VLPAVDKQQLLHEIRRQLPDLDILHRAEELRPYECDGLSAYRTTPMLVVLPRHVEEVQTL
Gammapro5       KTV-ARNAGLIKALRDFLPPESVLDQREQLRPFECDGLSVYRQLPMVVVLPETIAQVQGI
Gammapro6       ALPDVDRTSVLMALREHVPGLEILHTEEEIIPYECDGLSAYRTRPLLVVLPKQMEQVTAI
                                                                            

Alphapro1       LKFCHKENIKVVPRGAGTGLSGGALPLNDAILLSLGKFNKIIEIDFENKCVVTQPGVTNL
Alphapro10      LQYCHANEIPVVPRGSGTSLSGGALPLEDGVLLVLSKFNRVLEIDYDNRCAVVQPGVTNL
Alphapro11      LRYCHKHGIKVVPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRAVVVEPGVTNL
Alphapro12      LKYCHENDIPVVPRGAGTSLSGGALPLEDGVLLVLSKFNKVLDIDFDNRCAVVQPGVTNL
Alphapro13      LKYCQANGIKVVPRGSGTSLSGGALPLADGVLLGLGKFNRILDIDYANRTVTAQPGVTNL
Alphapro14      LRWCHANGVRVVPRGAGTSLSGGALPLADAVLLGMARFNRILAIDYADRIAVVQPGVTNL
Alphapro15      LKYCYDNGIRVVPRGNGTSLSGGSFPLADGVLLGLSKFKRVREIDFDNRVAVVEPGMTNL
Alphapro16      LRYCHGQGIKVVPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRVVVTEPGVTNL
Alphapro17      LKYCFDNGIKVVPRGSGTSLSGGALPLEDAVLLGLSKFKRIREIDFDNRVVVTEPGVTNL
Alphapro2       LKFCHKENIKVVPRGAGTGLSGGALPLNDAILLSLGKFNKIIEIDFENKCVVTQPGVTNL
Alphapro3       LRYCHDNNVRVVPRGAGTSLSGGSMPLQDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNL
Alphapro4       LRYCYANAIKVVPRGAGTSLSGGALPLQDGVLISMMKFNKIKEIDFENRCAVVEPGVTNA
Alphapro5       LRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNL
Alphapro6       LKYCDERNIRVVPRGSGTSLSGGALPLQDAVLLVMSRFNRILEIDFANRAVVTQPGVTNL
Alphapro7       LRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNL
Alphapro8       LRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLVMSRFNRILEIDYPNRVAVVQPGVTNL
Alphapro9       LRYCHQNGIKVVPRGSGTSLSGGALPLADGVLLGLGKFKRIREIDFDNRAVVVEPGVTNL
Betaprot1       LKFAAARNVPVVARGAGTGLSGGALPLEQGILLVMARFNRILHIDPEASIARVQPGVRNL
GOS_1082030     ------------------------------------------------------------
Gammapro1       LRLCQAHQVPVVARGAGTGLSGGAFPLANGVLLGLAKFNRILAIDPDNRCARVQPGVRNL
Gammapro2       LQICHSWDIPVVARGAGTGLSGGALPLKNGVLLSLAKFNRILAIDPISRTARVQPGVRNL
Gammapro3       LQVCREQDVPIVCRGAGTSLSGGALPLNDGVLLSVAKFNRILEIDPVNRTARVQPGVRNL
Gammapro4       LKLCHAHRVPVVARGAGTGLSGGALPLEKGVLLVMARFNQILAIDPAARLARVQPGVRNL
Gammapro5       MRLCHAQDIPVVARGAGTGLSGGALPLANGVLLSLAKFRNILHIDPHNAMATVQPGVRNL
Gammapro6       LAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNL
                                                                            

Alphapro1       GITHAVQHKNFYYAPDPSSQLACSIGGNVAENSGGVHSLKYGTTTNNILGVEMVMMDGTV
Alphapro10      GITKAVEGEGFYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTANNVLGIEFVTIEGEV
Alphapro11      AISQAVDHAGFYYAPDPSSQIACSIGGNIAENSGGVHCLKYGMTTNNVLGCEIVLMTGEI
Alphapro12      GITKAVEHRGFYYAPDPSSQIACSIGGNIAENSGGVHCLKYGLTANNVLGIEFVTIEGEI
Alphapro13      GITHAVQDRGFYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTTNNVLGVEMVTIDGEI
Alphapro14      AITRAVEEEGFYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTTNNVLGVELVTIEGEV
Alphapro15      AVSEAVAHEGFYYAPDPSSQIACSIGGNIAENSGGVHSLKYGLTTNNVLGCEFVLITGEI
Alphapro16      AISQAVAHAGFYYAPDPSSQIACSIGGNVAENSGGVHCLKYGMTTNNVLGCELVLMNGEV
Alphapro17      AISQAVAHAGFYYAPDPSSQIACSIGGNIAENSGGVHCLKYGMTTNNVLGCELVLMSGEI
Alphapro2       GITHAVQHKNFYYAPDPSSQLACSIGGNVAENSGGVHSLKYGTTTNNILGVEMVMMDGTV
Alphapro3       GITKAVEHEGFYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEV
Alphapro4       AISRAVDHRGFYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTTNNVLGVEMALMDGEI
Alphapro5       GITKAVEHEGFYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEV
Alphapro6       GITHAVEHEGFYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTANNILGIQMVLMNGDV
Alphapro7       GITKAVEHEGFYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTANNVLGIEMVLITGEV
Alphapro8       GITKAVEHEGFYYAPDPSSQIACSIGGQVAENAGGVHCLKYGLTANNVLGIEMVLITGEV
Alphapro9       AISQAVDHAGFYYAPDPSSQIACSIGGNIAENSGGVHCLKYGMTTNNVLGCEIVLMTGEI
Betaprot1       AISQAAAIHGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNILKLEVMTIDGER
GOS_1082030     ------------------------------------------------------------
Gammapro1       AISEAAAAHGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNILELKVVTIDGEL
Gammapro2       AISEAAAPAGLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTVHNILGLKMLTMTGEE
Gammapro3       AISQSVAPYGLYYAPDPSSQIACSIGGNVSENAGGVHCLKYGLTVHNVLQVTFLTIDGEL
Gammapro4       AISQAAAPHGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKVEILTVEGEP
Gammapro5       AISEAAAAYGLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTVHNILMLKVVTAEGEL
Gammapro6       AISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLNGEA
                                                                            

Alphapro1       CRVGGKTLDQEG-YDLMGLICGSEGLLGVITEVTVKILKNPQVVKAALIGFPTIEEGGNA
Alphapro10      VRLGGKHLEAEG-YDFLGLMTGSEGLLGVVTEVTVRILQKPETARAVLIGFPTSEQAGEC
Alphapro11      LRIGGKAAECAG-YDLMGVITGSEGLLGVITEVTVRILRKPETARALMVGFTDVEAAGRC
Alphapro12      VRLGGKHLDADGHYDMLGLMTGSEGLLGVVTEVTVRILQAPETARAVLIGFPSSEQAGEC
Alphapro13      LRLGGKHLDSEG-YDLLGVLTGSEGLLAVVTEVTVRILRKPATARALLVGFGNSEEAGAC
Alphapro14      LRLGGRHLDPAG-LDLLGVVVGSEGLLGVVTEVTVRILPRPETARAALIGFPTVESAGQC
Alphapro15      LRIGGRAPENDG-YDLMGIITGSEGLLGVVTEITVRILKKPETARALMVGFAEVEAAGEC
Alphapro16      LRIGGKCTENAG-YDLMGLITGSEGLLGVVTEVTVRILQKPETARALMVGFTQVEAAGEC
Alphapro17      LRIGGKTAESAG-YDLMGIITGSEGLLGVVTEVTVRILRKPETARALLVGFPQVEAAGEC
Alphapro2       CRVGGKTLDQEG-YDLMGLICGSEGLLGVITEVTVKILKNPQVVKAALIGFPTIEEGGNA
Alphapro3       IRLGGKHLDSEG-YDLLGLMTGSEGLLGVVTEITVRILQKPETARAVMVGFPSSEQAGQC
Alphapro4       VRLGGAFLDAEG-YDFLSLVVGSEGMLGVVTEVTVRLLRKPESARALMIAFDSSEAGGAC
Alphapro5       MRLGGKHLDSEA-YDLLGLMTGSEGLLGVVTEITVRILQKPETARAIMVGFPSSEQAGQC
Alphapro6       IRLGGKHLDSDG-YDLMGLMTGSEGLLGVVTEVTVRILKKPETARALLIGFPSSEQAGQC
Alphapro7       MRLGGKHLDSEA-YDLLGLMTGSEGLLGVVTEITVRILQKPETARAIMVGFPSSEQAGQC
Alphapro8       MRLGGKHLDSEA-YDLLGLMTGSEGLLGVVTEITVRILQKPETARAIMVGFPSSEQAGQC
Alphapro9       LKIGGKAAECAG-YDLMGVITGSEGLLGVITEVTVRILRKPETARALMIGFQSVEAAGQC
Betaprot1       LTIGSEALDSPG-FDLLALLTGSEGMLGIVTEVTVKLLTRPQSAKVLLASFDDVEKAGAA
GOS_1082030     ------------------------------------------------------------
Gammapro1       ITLGGQSLDSPG-YDLLALMTGSEGMLGVIVEITVKLLPRPERAQVLLAAFDNVERAGEA
Gammapro2       ISLGGETLDSPG-YDLLALMTGSEGLLGVIIEVTVRLLPLPERAQVILAAFDNVAKAGAA
Gammapro3       ITLGSSGLDGPG-YDLLAVLTGSEGMLGVIVEITVKLLPKPPQVQVLLAAFNNIEDAGTA
Gammapro4       MTLGSDTLDSPG-FDLLALFTGSEGMLGVITEVTVKLLPRPQVAKVLLAAFDSVEKAGGA
Gammapro5       LTIGAETLDAPG-YDLLALMTGSEGMLGIIVEVTVKLLARPERAQVVLAAFDDVVKAGEA
Gammapro6       LTLGSDALDSPG-FDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLA
                                                                            

Alphapro1       ASEIISSGIVPAGMEIMDKALIEATDNFSKAGYPRDAELLLIVELDGTES-EVDELLKQV
Alphapro10      VAAIIAKGIIPAGMEMMDRPAIHAAEDFVHAGYPRDVEALLIVELDGPGA-EVDHLLAEV
Alphapro11      VADIISAGIIPGGMEMMDRPAIHAAEAFVHAGYPLDVEALLIIELDGPQV-EVDELITRV
Alphapro12      VASIIAKGIIPGGMEMMDRPAIHAAEDFVNAGYPRDVEALLIVELDGPKA-EVDHLLTEV
Alphapro13      VAAIVGAGIIPGGMEMMDGLAINAAEDFVHAGYPRDAGALLIVELDGPEV-EVGFLIDRV
Alphapro14      VADVIAAGIIPAGMEMMDRPAIHAAEAFVQVGYPLDVEALLIVEMDGPAA-ECDHLVDEV
Alphapro15      VARIIGAGIIPGGMEMMDKDAIHAAEAFVKAGYPLDVEALLIIELDGPSI-EVDELIRRV
Alphapro16      VARIIGAGIIPGGMEMMDKPAIHAAEAFVHAGYPLDVEALLIIELDGPGV-EVDELISRV
Alphapro17      VARIIGAGIIPGGMEMMDKPAIHAAEAFVHADYPLDVEALLIIELDGSSI-EVDELIKRV
Alphapro2       ASEIISSGIVPAGMEIMDKALIEATDNFSKAGYPRDAELLLIVELDGTES-EVDELLKQV
Alphapro3       VADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPV-EVDYLIGRV
Alphapro4       VADVIAAGIIPGGMEMMDRPAIHAAEDFVHAGYPRDAEAMLIVELDGPPV-EVNHLVGLV
Alphapro5       VADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPV-EVDYLLGRV
Alphapro6       VADIIGAGIIPGGMEMMDRPAIHAAESFVNAGYPLDVEALLIVELDGPQA-EVHHLIESV
Alphapro7       VADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPV-EVDYLLGRV
Alphapro8       VADIIGAGIIPGGMEMMDRPAIKAAEDFVRVGYPLDVEALLIVELDGPPV-EVDYLLGRV
Alphapro9       VADVISAGIIPGGMEMMDKPAIHAAEAFVHAGYPLDVEALLIIELDGPQV-EVDELISRV
Betaprot1       VAQIIGAGVIPGGLEMMDNLAIRAAEDFIHAGYPVDAQAILLCELDGAES-DVQEDCDRV
GOS_1082030     ---------------VMDKPLIKATDDYSKAGYPRDVEAILIVELDGTES-EVNVLIKKV
Gammapro1       VAAIIGSGIIPAGLEMMDNNSIRAAEDFVHAGYPVEAEAILLCELDGTNA-EVSEDIMQV
Gammapro2       VGGIISAGIIPGGLEMMDNLAIRAAEDFVHAGYPQEAAAILLCELDGTQA-EVSHQIRKV
Gammapro3       VAKIIGAGIIPAGLEMMDNPAIRAAEDFIHAGYPKEAEAILLCELDGNNAEEVSEQVAQV
Gammapro4       VADIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVDAEAILLCELDGVEA-DVHADCERV
Gammapro5       VGAIIAAGIIPAGLEMMDRLAIQAAEDFVHAGYPRDAEAILLCELDGTNA-EVSEYIMTM
Gammapro6       VGDIIANGIIPGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVES-DVQEDCERV
                               :**   *.*:: : ...** :.  :*: *:**    :       :

Alphapro1       RSICEKNNCSSLKLSKNEKERLSFWAGRKAAFPACGAMAPDYYCMDGSIPRGKLAEALLE
Alphapro10      AAIADANGATVTKVSNSEEERASFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPRVLAG
Alphapro11      ETIALGCGSTTCQISTSEKERLLFWSGRKAAFPAVGRISPDYLCMDGTIPRAKLPQVLRR
Alphapro12      EAIAGENGATTTRVSQNEEERAAFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPKVLAG
Alphapro13      REIAEAHGATSLRISQNEDERNAFWAGRKAAFPAVGRISPDYYCMDGTIPRRQLPEILSR
Alphapro14      ARIADANGAVSLRVSNDDAERLAFWAGRKAAFPAVGRIAPDYYCMDGTIPRRRLPEVLRR
Alphapro15      EAIALDCRSTTCQISNSEQERLLFWAGRKAAFPAVGRLSPDYLCMDGTIPRGKLPEALAG
Alphapro16      EAIANGCGSTTCRISTSEAERNLFWAGRKAAFPAVGRISPDYLCMDGTIPRGALPKALAR
Alphapro17      EAIALGCGSTTCRISGSEAERDLFWAGRKAAFPAVGRISPDYLCMDGTIPRGALPRALSR
Alphapro2       RSICEKNNCSSLKLSKNEKERLSFWAGRKAAFPACGAMAPDYYCMDGSIPRGKLAEALLE
Alphapro3       EALALRNGSTTCILSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSG
Alphapro4       EAIALKRGATQCRISNSEAERLAFWAGRKAAFPAVGRLSPDYLCMDGTIPRKQLPRVLAG
Alphapro5       EKIALQNGSTTCTLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSG
Alphapro6       DAIARKNGCTTNRVSNSDEERLSFWAGRKAAFPAVGRISPDYYCMDGTIPRKELPRVLSG
Alphapro7       EKIALQNGSTTCTLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSG
Alphapro8       EKIALQNGSTTCTLSQSEEQRLAFWAGRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSG
Alphapro9       EAIALGCGSTTCQISTSEQQRLLFWSGRKAAFPAVGRISPDYLCMDGTIPRKQLPLVLRR
Betaprot1       GALLREAGATDIRIAKDEAERQRFWAGRKNAFPAVGRISPDYYCMDGTIPRRELARVLRG
GOS_1082030     EDIAKKNKATYLRISKNDEERLRFWLGRKAAFPAIGDMSPDYLCMDGTIPRKKLPEVLRE
Gammapro1       RELLIAQGATEVRTAGDDQERLRFWAGRKAAFPAVGRLSPDYYCMDGTIPRKNLGQVLRR
Gammapro2       RELLLSHGAIEIRTALDEQERAKLWQGRKAAFPAVGRLAPDYYCMDGTIPRNRLPQVLER
Gammapro3       SDLLQSCHATEVRVAKDEQERQKIWAGRKSAFPAVGRISPDYYCMDGTIPRKQLPYVLNK
Gammapro4       REVLTLAGATEVRQAKDEAERVRFWAGRKNAFPAVGRLSPDYYCMDGTIPRRELPRVLRS
Gammapro5       RRILTDSGATEVRTAVDEAERQLFWKGRKSAFPAVGRISPDYYCMDGTIPRRQLPHVLRR
Gammapro6       NDILLKAGATDVRLAQDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEG
                  :     .     : .: :*  :* *** **** * ::*** ****:***  *   *  

Alphapro1       IKRLSEKYELPVANCFHAGDGNLHPLIMFDGSDKEQLRKTEEFGAEILKTCVRLGGVITG
Alphapro10      MKAFSEKYDLRVANVFHAGDGNLHPLILYDANKEGELHRAEEFGNDILRLCVEVGGVLTG
Alphapro11      MTEMSEHYGLRVANVFHAGDGNLHPLILYDANQPGEMDKAEAFGADILRLCVEVGGVLTG
Alphapro12      MKAMEKKYGLKCANVFHAGDGNLHPLVLYDAN-AGELERAEEFGNDILKLCVEVGGVLTG
Alphapro13      MTRMSEQYGLRVANVFHAGDGNLHPLILFDANEPGELEKAEAFGSDILRACVELGGVLTG
Alphapro14      MSELAAHHGLGVANVFHAGDGNLHPLILYDAHKPGDLERAEEFGNDILRLCVEVGGVLTG
Alphapro15      IRELGKKYGLRCANVFHAGDGNLHPLILYDANVADEMQRAEDFGADILRLCVKLGGVLSG
Alphapro16      IRELSEKYQLGCANVFHAGDGNLHPLILYDANKPGEMERAEAFGADILRCCVELGGVLTG
Alphapro17      IRDLSEKYGLGVANVFHAGDGNLHPLILYDANKPGEMDKAEAFGAEILCCCVELGGVLTG
Alphapro2       IKRLSEKYKLPVANCFHAGDGNLHPLIMFDGSDKEQLRKTEEFGAEILKTCVRLGGVITG
Alphapro3       MRDLSEKYGLRVANVFHAGDGNLHPLILYDANIPGELEAAENFGADILRLCVKVGGVLTG
Alphapro4       IAELSEKHKLRVANVFHAGDGNLHPLILYDANKPGELQAAEDFGSDILRLCVEVGGVLTG
Alphapro5       MRALSEKYGLRVANVFHAGDGNLHPLILYDANNPGELEAAEDFGADILRLCVKVGGVLTG
Alphapro6       MRELSEKYGLGVANVFHAGDGNLHPLILYDANKPGELERAEGFGADILRLCVQVGGVLTG
Alphapro7       MRALSEKYGLRVANVFHAGDGNLHPLILYDANNPGELEAAEDFGADILRLCVKVGGVLTG
Alphapro8       MRALSEKYGLRVANVFHAGDGNLHPLILYDANNPGELEAAEDFGADILRLCVKVGGVLTG
Alphapro9       MNEMSEKYGLRVANVFHAGDGNLHPLILYDANKPGEQDAAEAFGADILKLCVEVGGVLTG
Betaprot1       IAALSNEYGLRVANVFHAGDGNMHPLILFDANSPGEMERAETLGAKILELCVEVGGSITG
GOS_1082030     ITKLSQKHGLRVANCFHAGDGNLHPLIMFDSNIKSELKRAEKFGADILKYCVKVGGVLTG
Gammapro1       IGEMSDEFGLRVANVFHAGDGNLHPLILYDADTPGQLERTEDFGGRILELCVEYGGTITG
Gammapro2       INELSQEFNLPVANVFHAGDGNLHPLILYDANRPGELERAEQLGANILELCVAVGGTITG
Gammapro3       IKELSKTYDLQVANVFHAGDGNLHPLILYDANQPGELERAEEFGGRILEVCVEVGGTITG
Gammapro4       IKELSAQYGLRVANVFHAGDGNMHPLILFDANQPGELERAEALGGKILELCVEVGGSITG
Gammapro5       ISEMSEEYGLAVANVFHAGDGNLHPLILFDANKEGELHRAEELGQGILQLCVEVGGTITG
Gammapro6       IARLSQQYDLRVANVFHAGDGNMHPLILFDANEPGEFARAEELGGKILELCVEVGGSISG
                :  :   . *  ** *******:***:::*.    :   :* :*  **  **  ** ::*

Alphapro1       EHGVGVEKRELMCEMFNNTDIQQQLDIKKSLDEKNLLNPGKVYPILRKCAEEGRVHVHRN
Alphapro10      EHGVGVEKRDLMPEMFSEDDLRHQQRVKCAFDDKHLLNPGKVFPQLHRCAELGRMHVHKG
Alphapro11      EHGVGIEKRDLMPEMFSDIDLNQQQRLKCAFDSEGLLNPGKVFPTLHRCAELGRMHVHGG
Alphapro12      EHGVGVEKRDLMPEMFSETDMNHQQRVKCTFDAKHLLNPGKVFPQLHRCAELGRMHVHKG
Alphapro13      EHGVGVEKRDLMGTMFSEIDLAQQQRLKCAWDPNGLLNPGKVFPTLHRCAELGRMHIQRG
Alphapro14      EHGVGVEKRDLMPEMFSDIDLKQQQRVKCAFDPASLLNPGKVFPTLHRCAELGRMHVHGG
Alphapro15      EHGIGVEKRDLMPEMLSDIDLAHHQRIKCAFDAKGLLNPGKMFPTLHRCAELGRMHVHGG
Alphapro16      EHGVGIEKRDLMPDMFTEIDLNQQQRVKCAFDHLGLLNPGKVFPTLHRCAELGRMHVHAG
Alphapro17      EHGVGIEKRDLMPYMFSEADLNQQQRLKCAFDARGLLNPGKVFPTLHRCAELGRVHVHGG
Alphapro2       EHGVGVEKRELMCEMFNNTDIQQQLDIKKSLDEKNLLNPGKVYPILRKCAEEGRVHVHRN
Alphapro3       EHGVGIEKRDLMPEMFNEIDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVHRG
Alphapro4       EHGVGVEKRDLMPVMFNEIDLDQQIGIKCAFDEKMLLNPGKMFPTLHRCAEMGRMHVHQG
Alphapro5       EHGVGIEKRDLMPEMFNETDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRG
Alphapro6       EHGVGVEKRDLMPEMFSEEDLNQQIRVKCAFDPNHLLNPGKVFPQLHRCAELGRMHIHRG
Alphapro7       EHGVGIEKRDLMPEMFNETDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRG
Alphapro8       EHGVGIEKRDLMPEMFNETDLDQQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRG
Alphapro9       EHGVGIEKRDLMPEMFSDIDLNQQQRLKCAFDSEGLLNPGKVFPTLHRCAELGRMHVHKG
Betaprot1       EHGVGREKINQMCVQFSSEELKLFHSLKAAFDPDGLLNPGKNIPTLHRCAEFGAMHIHRG
GOS_1082030     EHGVGIEKRDLMCEMFNDEDIQQQLHIKQAFDDKSLLNPGKVYPILHRCAESGKMHVHKG
Gammapro1       EHGVGIEKLNQMCTQFTPDALTQFHAVKAAFDPRGLLNPGKAVPTLHRCAEFGAMHVHHG
Gammapro2       EHGVGIEKINQMCIQFGTAELQQFHALKAAFDPKGLLNPGKAVPTLHRCAEFGAMHVHQG
Gammapro3       EHGVGIEKINQMCVQFNSSELEQFHALKQAFDPNKLLNPGKAIPTLARCVEFGAMHVHGG
Gammapro4       EHGVGREKINQMCAQFNSDELTFFHAIKAAFDASGLLNPGKNIPTLHRCAEFGAMHIHAG
Gammapro5       EHGVGMEKIDQMCIQFRSAELAQFHAVKAAFDPSGLLNPGKAVPTLQRCAEFGAMHVHHG
Gammapro6       EHGIGREKINQMCAQFNSDEITTLHAVKAAFDPDGLLNPGKNIPTLHRCAEFGAMHVHHG
                ***:* ** : *   :    :     :* : *   ******  * * :*.* * :*:  .

Alphapro1       EEKFPDLPRF
Alphapro10      QVAFPDLPRF
Alphapro11      KTAFPDIPRF
Alphapro12      EVAFPDLPRF
Alphapro13      QLPFPDLPRF
Alphapro14      ALPFPDLPRF
Alphapro15      KLPFPDIPRF
Alphapro16      KLAFPDLPRF
Alphapro17      KLAFPDLPRF
Alphapro2       EEKFPDLPRF
Alphapro3       ELAFPDIPRF
Alphapro4       QLPFPELPRF
Alphapro5       ALAFPDLPRF
Alphapro6       QMPFPDLERF
Alphapro7       ALAFPDLPRF
Alphapro8       ALAFPDLPRF
Alphapro9       QLPFPDIPRF
Betaprot1       KLPFPDLERF
GOS_1082030     DIKFKDIPRF
Gammapro1       QLPHPDIPRF
Gammapro2       KLPFPELDRF
Gammapro3       QLPFSGIERF
Gammapro4       QLPFPELERF
Gammapro5       KLSHPELERF
Gammapro6       HLPFPELERF
                   .  : **

Protein Domains

PROTOCOLE:


recherche de domaines protéiques conservés sur le site interproscan avec les paramètres par défaut



ANALYSE DES RÉSULTATS:


Notre séquence semble correspondre à plusieurs domaines protéiques sur INTERPRO, ces domaines possédants tous des E-values significatives allant de 1.8e-68 à 3.1e-46. Néanmoins un seul de ces domaines semble être le domaine "parent" des autres. C'est donc celui-ci que l'on va retenir pour notre séquence.

Celui-ci commence au début de notre ORF et correspond à la partie C-terminale d'une protéine. Notre ORF est donc incomplète en 3'.

Le domaine que l'on retient correspond au domaine C-terminal d'une oxydase du FAD qui est une enzyme qui intervient dans de nombreuses fonctions biologiques. Cette enzyme a une interaction spécifique et non covalente avec le FAD. Elle a une activité catalytique.


RÉSULTATS BRUTS:

Translation	BD5B0F6C6B413865	234	HMMPanther	PTHR11748:SF6	D-LACTATE DEHYDROGENASE (GLYCOOXIREDUCTASE GLCD)	2	226	1.8e-68	T	24-Nov-2009	NULL	NULL	
Translation	BD5B0F6C6B413865	234	HMMPanther	PTHR11748	D-LACTATE DEHYDROGENASE	2	226	1.8e-68	T	24-Nov-2009	NULL	NULL	
Translation	BD5B0F6C6B413865	234	superfamily	SSF55103	FAD-linked oxidases, C-terminal domain	1	205	9.4e-52	T	24-Nov-2009	IPR016164	FAD-linked oxidase-like, C-terminal	Molecular Function: catalytic activity (GO:0003824), Molecular Function: FAD binding (GO:0050660)
Translation	BD5B0F6C6B413865	234	HMMPfam	PF02913	FAD-oxidase_C	1	206	3.1e-46	T	24-Nov-2009	IPR004113	FAD-linked oxidase, C-terminal	Molecular Function: catalytic activity (GO:0003824), Molecular Function: FAD binding (GO:0050660)

Phylogeny

PROTOCOLE:


a) Phylogeny.fr / phylogeny analysis / à la carte / parametres par defaut sans alignement multiple / méthode PhyML / step by step

b) Phylogeny.fr / phylogeny analysis / à la carte / parametres par defaut sans alignement multiple / méthode BioNJ / step by step


ANALYSE DES RÉSULTATS:


On remarque que pour les deux arbres phylogénétiques on obtient le même positionnement de notre séquence au sein de ses homologues. Notre séquence est dans les deux cas très proche de Alphapro1 et Alphapro2. Celui-ci s'intègre parfaitement dans l'arbre dans le groupe des a-protéobacteries et les groupes extérieurs sont bien tels que nous les avions décrits.

Les deux arbres sont cohérents entre eux.

RÉSULTATS BRUTS:

a) Méthode PhyML :

                                     --------0.1-------
 
         +-----------------------------Alphapro13
         |
         |      +------------------------------Alphapro14
         |      |
         |      |                               +--------------------------Alphapro15
 +-------+      |                               |
 |       |      |                         +-----+        +--------Alphapro16
 |       |      |                         |     +--------+
 |       |      |                         |              |
 |       |      |       +-----------------+              +---------------Alphapro17
 |       +------+       |                 |
 |              |       |                 |      +--------Alphapro11
 |              |       |                 +------+
 |              |       |                        +-------Alphapro9
 |              |       |
 |              |       |            +---------------------------Alphapro4
 |              |       |            |
 |              +-------+       +----+              +----Alphapro3
 |                      |       |    |              |
 |                      |       |    +--------------+     +Alphapro5
 |                      |       |                   |     |
 |                      |     +-+                   |     |Alphapro7
 |                      |     | |                   +-----+
 |                      |     | |                         +Alphapro8
 |                      |     | |
 |                      +-----+ +-------------------Alphapro6
 |                            |
 |                            |
 |                            |               +----------Alphapro10
 |                            +---------------+
 |                                            +--------------Alphapro12
 |
 |                                                                                                           +Alphapro1
 |                                                +----------------------------------------------------------+
 |                                                |                                                          +-Alphapro2
 |------------------------------------------------+
 |                                                +------------------------GOS_1082030
 |
 |                                                                                    +--------------------Betaprot1
 |                                                                                    |
 |                                                         +--------------------------+   +-------------Gammapro4
 |                                                         |                          +---+
 |                                                         |                              |
 |                                                         |                              +--------------------Gammapro6
 |                                                    +----+
 |                                                    |    |         +--------------------------------Gammapro1
 |                                                    |    |     +---+
 +----------------------------------------------------+    +-----+   +---------------------------------Gammapro2
                                                      |          |
                                                      |          +----------------------------------Gammapro3
                                                      |
                                                      +----------------------------Gammapro5



b) Méthode BioNJ :

      -----0.05----
 
          +----------------------------------Alphapro13
          |
          |                                                         +-----------------------------------Gammapro1
          |                                                      +--+
          |                                                      |  +-----------------------------------Gammapro2
     +----+                                                   +--+
     |    |                                                   |  +---------------------------------------Gammapro3
     |    |                                                  ++
     |    |                                                  ||
     |    +--------------------------------------------------++------------------------------------Gammapro5
     |                                                       |
     |                                                       |                   +--------------------Betaprot1
     |                                                       +-------------------+
     |                                                                           |     +-----------------Gammapro4
     |                                                                           +-----+
     |                                                                                 +-----------------------Gammapro6
     |
     |                    +-------------------------------Alphapro15
     |                    |
     |                   ++        +-----------Alphapro16
 +---+                   |+--------+
 |   |                   |         +----------------Alphapro17
 |   |     +-------------+
 |   |     |             |       +-----------Alphapro11
 |   |     |             +-------+
 |   |     |                     +---------Alphapro9
 |   |     |
 |   |  +--+
 |   |  |  |+--------------------------------Alphapro4
 |   |  |  ||
 |   |  |  ||                  +--------------Alphapro10
 |   |  |  ||      +-----------+
 |   |  |  ++   +--+           +------------------Alphapro12
 |   |  |   |   |  |
 |   |  |   |   |  +----------------------Alphapro6
 |   |  |   +---+
 |   +--+       |                   +-----Alphapro3
 |      |       |                   |
 |      |       |                   |     +Alphapro5
 |      |       +-------------------+     |
 |      |                           |     |Alphapro7
 |      |                           +-----+
 |      |                                 |
 |      |                                 +Alphapro8
 |      |
 |      +--------------------------------------Alphapro14
 |
 |                                                                                                           +Alphapro1
 |                                        +------------------------------------------------------------------+
 +----------------------------------------+                                                                  +-Alphapro2
                                          |
                                          +----------------------------------GOS_1082030


        

Taxonomy report

PROTOCOLE:


Rapport taxonomique trouvé grâce au Blast p contre nr sur NCBI



ANALYSE DES RÉSULTATS:


D'après le rapport taxonomique, on peut voir que notre protéine semblerait appartenir au groupe taxonomique des a-protéobacteries.

Selon l'arbre phylogénétique, on peut dire que notre groupe extérieur correspond aux g-proteobacteries et aux b-proteobacteries.



RÉSULTATS BRUTS:

Lineage Report

Bacteria            [bacteria]
. Proteobacteria      [proteobacteria]
. . Alphaproteobacteria [a-proteobacteria]
. . . SAR11 cluster       [a-proteobacteria]
. . . . alpha proteobacterium HIMB114 -----------------------------  374   2 hits [a-proteobacteria]  D-lactate dehydrogenase [alpha proteobacterium HIMB114] >gi
. . . . Candidatus Pelagibacter ubique HTCC1002 ...................  348   2 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase [Candidatus Pelagibacter ubique 
. . . . Candidatus Pelagibacter ubique HTCC1062 ...................  348   2 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase [Candidatus Pelagibacter ubique 
. . . Labrenzia aggregata IAM 12614 -------------------------------  351   2 hits [a-proteobacteria]  ATPase, E1-E2 type [Stappia aggregata IAM 12614] >gi|118436
. . . Pseudovibrio sp. JE062 ......................................  341   2 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase [Pseudovibrio sp. JE062] >gi|211
. . . Ochrobactrum intermedium LMG 3301 ...........................  338   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Ochrobactrum intermed
. . . Ochrobactrum anthropi ATCC 49188 ............................  337   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Ochrobactrum anthropi
. . . Methylocella silvestris BL2 .................................  333   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Methylocella silvestris 
. . . Brucella abortus str. 2308 A ................................  332   2 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase chain D [Brucella abortus str. 2
. . . Chelativorans sp. BNC1 ......................................  332   2 hits [a-proteobacteria]  FAD linked oxidase-like [Mesorhizobium sp. BNC1] >gi|110283
. . . Brucella melitensis bv. 1 str. 16M ..........................  332   4 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase chain D [Brucella melitensis 16M
. . . Brucella ceti M644/93/1 .....................................  332   3 hits [a-proteobacteria]  FAD binding domain protein [Brucella ceti M644/93/1] >gi|25
. . . Brucella ceti M13/05/1 ......................................  332   3 hits [a-proteobacteria]  FAD binding domain protein [Brucella ceti M644/93/1] >gi|25
. . . Brucella abortus bv. 1 str. 9-941 ...........................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella melitensis biovar Abortus 2308 .....................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella ovis ATCC 25840 ....................................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus S19 ........................................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella melitensis ATCC 23457 ..............................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus bv. 6 str. 870 .............................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus bv. 2 str. 86/8/59 .........................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella suis bv. 5 str. 513 ................................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella sp. 83/13 ..........................................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus bv. 4 str. 292 .............................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella microti CCM 4915 ...................................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella melitensis bv. 1 str. Rev.1 ........................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella neotomae 5K33 ......................................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella melitensis bv. 3 str. Ether ........................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus bv. 9 str. C68 .............................  332   3 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella melitensis bv. 2 str. 63/9 .........................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella abortus NCTC 8038 ..................................  332   2 hits [a-proteobacteria]  GlcD, glycolate oxidase, subunit GlcD [Brucella abortus bv.
. . . Brucella suis bv. 3 str. 686 ................................  332   3 hits [a-proteobacteria]  hypothetical protein Bsuib36_01342 [Brucella suis bv. 3 str
. . . Mesorhizobium loti MAFF303099 ...............................  332   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Mesorhizobium loti MAFF3030
. . . Brucella suis 1330 ..........................................  332   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Brucella suis 1330] >gi|23
. . . Brucella abortus bv. 3 str. Tulya ...........................  332   3 hits [a-proteobacteria]  FAD binding domain protein [Brucella abortus bv. 3 str. Tul
. . . Brucella suis ATCC 23445 ....................................  332   2 hits [a-proteobacteria]  hypothetical protein BSUIS_B0183 [Brucella suis ATCC 23445]
. . . Brucella ceti B1/94 .........................................  330   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Brucella ceti B1/94] >gi|26
. . . Brucella pinnipedialis M292/94/1 ............................  330   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Brucella ceti B1/94] >gi|26
. . . Brucella canis ATCC 23365 ...................................  330   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Brucella canis ATCC 2
. . . Brucella suis bv. 4 str. 40 .................................  330   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Brucella canis ATCC 2
. . . Brucella pinnipedialis M163/99/10 ...........................  330   2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: D-lactate dehydrogenase [Brucella pinn
. . . Brucella pinnipedialis B2/94 ................................  330   2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: D-lactate dehydrogenase [Brucella pinn
. . . Brucella ceti M490/95/1 .....................................  330   2 hits [a-proteobacteria]  LOW QUALITY PROTEIN: D-lactate dehydrogenase [Brucella pinn
. . . Aurantimonas manganoxydans SI85-9A1 .........................  330   2 hits [a-proteobacteria]  glycolate oxidase, subunit glcD [Aurantimonas manganoxydans
. . . Rhodopseudomonas palustris CGA009 ...........................  329   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Rhodopseudomonas palustris 
. . . Rhodopseudomonas palustris TIE-1 ............................  329   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Rhodopseudomonas palustris 
. . . Rhodopseudomonas palustris BisB5 ............................  329   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Rhodopseudomonas palu
. . . Rhodopseudomonas palustris HaA2 .............................  329   2 hits [a-proteobacteria]  FAD linked oxidase-like [Rhodopseudomonas palustris HaA2] >
. . . Fulvimarina pelagi HTCC2506 .................................  327   2 hits [a-proteobacteria]  ATPase, E1-E2 type:FAD linked oxidase, C-terminal:FAD linke
. . . Mesorhizobium opportunistum WSM2075 .........................  325   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Mesorhizobium opportu
. . . alpha proteobacterium BAL199 ................................  323   2 hits [a-proteobacteria]  FAD linked oxidase-like protein [alpha proteobacterium BAL1
. . . Sphingomonas wittichii RW1 ..................................  323   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Sphingomonas wittichi
. . . Rhodospirillum centenum SW ..................................  322   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Rhodospirillum centenum SW
. . . Oligotropha carboxidovorans OM5 .............................  319   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Oligotropha carboxidovoran
. . . Rhodopseudomonas palustris BisB18 ...........................  318   2 hits [a-proteobacteria]  FAD linked oxidase-like [Rhodopseudomonas palustris BisB18]
. . . Xanthobacter autotrophicus Py2 ..............................  316   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Xanthobacter 
. . . Azorhizobium caulinodans ORS 571 ............................  316   2 hits [a-proteobacteria]  glycolate oxidase subunit protein [Azorhizobium caulinodans
. . . Rhodopseudomonas palustris BisA53 ...........................  315   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Rhodopseudomo
. . . Bradyrhizobium japonicum USDA 110 ...........................  313   2 hits [a-proteobacteria]  glycolate oxidase subunit [Bradyrhizobium japonicum USDA 11
. . . Nitrobacter sp. Nb-311A .....................................  313   2 hits [a-proteobacteria]  FAD linked oxidase [Nitrobacter sp. Nb-311A] >gi|85698679|g
. . . Bradyrhizobium sp. BTAi1 ....................................  312   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Bradyrhizobium sp. BTAi1] 
. . . Nitrobacter winogradskyi Nb-255 .............................  311   2 hits [a-proteobacteria]  FAD linked oxidase [Nitrobacter winogradskyi Nb-255] >gi|74
. . . Bradyrhizobium sp. ORS278 ...................................  311   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Bradyrhizobium sp. ORS278]
. . . Nitrobacter hamburgensis X14 ................................  306   2 hits [a-proteobacteria]  FAD linked oxidase-like [Nitrobacter hamburgensis X14] >gi|
. . . Beijerinckia indica subsp. indica ATCC 9039 .................  306   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Beijerinckia indica s
. . . Phenylobacterium zucineum HLK1 ..............................  305   2 hits [a-proteobacteria]  FAD/FMN-containing dehydrogenase [Phenylobacterium zucineum
. . . Gluconacetobacter diazotrophicus PAl 5 ......................  261   4 hits [a-proteobacteria]  putative glycolate oxidase subunit glcD [Gluconacetobacter 
. . . Acidiphilium cryptum JF-5 ...................................  249   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Acidiphilium 
. . . Rhodobacter sphaeroides ATCC 17025 ..........................  245   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Rhodobacter s
. . . Sagittula stellata E-37 .....................................  243   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Sagittula stell
. . . Granulibacter bethesdensis CGDNIH1 ..........................  239   2 hits [a-proteobacteria]  (S)-2-hydroxy-acid oxidase chain D [Granulibacter bethesden
. . . Ruegeria sp. TM1040 .........................................  238   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Silicibacter sp. TM10
. . . Roseovarius sp. 217 .........................................  238   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseovarius sp. 217] >gi|8
. . . Dinoroseobacter shibae DFL 12 ...............................  238   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Dinoroseobact
. . . Ruegeria sp. R11 ............................................  238   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Ruegeria sp. R11] >gi|2140
. . . Roseovarius sp. TM1035 ......................................  237   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Roseovarius sp. TM103
. . . Silicibacter sp. TrichCH4B ..................................  237   2 hits [a-proteobacteria]  D-lactate dehydrogenase [Silicibacter sp. TrichCH4B] >gi|25
. . . Ruegeria pomeroyi DSS-3 .....................................  236   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Ruegeria pomeroyi DSS-3] >
. . . Rhodobacteraceae bacterium KLH11 ............................  236   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Rhodobacteraceae bacterium 
. . . Roseobacter sp. AzwK-3b .....................................  236   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseobacter sp. AzwK-3b] >
. . . Rhodobacterales bacterium HTCC2150 ..........................  235   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Rhodobacterales bacterium 
. . . Phaeobacter gallaeciensis BS107 .............................  235   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Phaeobacter gallaecie
. . . Roseobacter sp. MED193 ......................................  235   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseobacter sp. MED193] >g
. . . Silicibacter lacuscaerulensis ITI-1157 ......................  234   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Silicibacter lacuscaerulen
. . . Methylobacterium populi BJ001 ...............................  234   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Methylobacterium populi 
. . . Phaeobacter gallaeciensis 2.10 ..............................  234   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Phaeobacter gallaeciensis 
. . . Methylobacterium radiotolerans JCM 2831 .....................  233   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Methylobacter
. . . Rhodobacterales bacterium HTCC2255 ..........................  233   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [alpha proteobacterium HTCC
. . . Sulfitobacter sp. NAS-14.1 ..................................  232   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Sulfitobacter sp. NAS-14.1
. . . Sulfitobacter sp. EE-36 .....................................  232   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Sulfitobacter sp. EE-36] >
. . . Thalassiobium sp. R2A62 .....................................  232   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Thalassiobium sp. R2A62] >
. . . Roseovarius nubinhibens ISM .................................  232   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseovarius nubinhibens IS
. . . Methylobacterium extorquens PA1 .............................  232   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Methylobacter
. . . Methylobacterium chloromethanicum CM4 .......................  232   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Methylobacterium chlorom
. . . Methylobacterium extorquens AM1 .............................  232   2 hits [a-proteobacteria]  putative glycolate oxidase (glcD-like), FAD-linked subunit 
. . . Methylobacterium extorquens DM4 .............................  231   2 hits [a-proteobacteria]  putative glycolate oxidase (glcD-like), FAD-linked subunit 
. . . Oceanibulbus indolifex HEL-45 ...............................  231   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Oceanibulbus indolifex HEL
. . . Roseobacter sp. SK209-2-6 ...................................  231   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseobacter sp. SK209-2-6]
. . . Roseovarius sp. HTCC2601 ....................................  231   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Roseovarius sp. HTCC2601] 
. . . Rhizobium sp. NGR234 ........................................  231   4 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Rhizobium sp. NGR234] >gi|
. . . Roseobacter sp. GAI101 ......................................  230   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Roseobacter sp. GAI101] >g
. . . Methylobacterium nodulans ORS 2060 ..........................  230   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Methylobacterium nodulan
. . . Methylobacterium sp. 4-46 ...................................  230   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Methylobacter
. . . Rhodobacterales bacterium Y4I ...............................  230   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Rhodobacterales bacterium 
. . . Octadecabacter antarcticus 238 ..............................  230   2 hits [a-proteobacteria]  glycolate oxidase, GlcD subunit [Octadecabacter antarcticus
. . . Rhodobacter sp. SW2 .........................................  229   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Rhodobacter sp. SW2] >gi
. . . Oceanicola batsensis HTCC2597 ...............................  229   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Oceanicola bats
. . . Rhodobacterales bacterium HTCC2654 ..........................  229   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Rhodobacterales
. . . Hyphomicrobium denitrificans ATCC 51888 .....................  228   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Hyphomicrobium denitr
. . . Rhodobacter sphaeroides KD131 ...............................  228   2 hits [a-proteobacteria]  FAD linked oxidase domain protein [Rhodobacter sphaeroides 
. . . Roseobacter sp. CCS2 ........................................  228   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Roseobacter sp. CCS2]
. . . Citreicella sp. SE45 ........................................  228   2 hits [a-proteobacteria]  D-lactate dehydrogenase [Citreicella sp. SE45] >gi|26041975
. . . Rhodobacter sphaeroides 2.4.1 ...............................  228   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Rhodobacter sph
. . . Roseobacter litoralis Och 149 ...............................  227   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Roseobacter litoralis Och 
. . . Jannaschia sp. CCS1 .........................................  227   2 hits [a-proteobacteria]  FAD linked oxidase-like [Jannaschia sp. CCS1] >gi|88862730|
. . . Loktanella vestfoldensis SKA53 ..............................  227   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Loktanella vest
. . . Rhodobacter sphaeroides ATCC 17029 ..........................  227   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Rhodobacter s
. . . Octadecabacter antarcticus 307 ..............................  226   2 hits [a-proteobacteria]  FAD linked oxidase, C-terminal domain protein [Octadecabact
. . . Hoeflea phototrophica DFL-43 ................................  226   2 hits [a-proteobacteria]  putative glycolate oxidase subunit [Hoeflea phototrophica D
. . . Roseobacter denitrificans OCh 114 ...........................  225   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Roseobacter denitrificans 
. . . Rhizobium etli CIAT 652 .....................................  223   2 hits [a-proteobacteria]  glycolate oxidase protein, subunit D [Rhizobium etli CIAT 6
. . . Rhizobium etli 8C-3 .........................................  223   1 hit  [a-proteobacteria]  glycolate oxidase protein, subunit D [Rhizobium etli 8C-3]
. . . Rhizobium etli CFN 42 .......................................  221   2 hits [a-proteobacteria]  glycolate oxidase subunit D protein [Rhizobium etli CFN 42]
. . . Paracoccus denitrificans PD1222 .............................  220   2 hits [a-proteobacteria]  FAD linked oxidase domain-containing protein [Paracoccus de
. . . Sinorhizobium medicae WSM419 ................................  219   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Sinorhizobium medicae
. . . Oceanicola granulosus HTCC2516 ..............................  219   2 hits [a-proteobacteria]  putative glycolate oxidase subunit protein [Oceanicola gran
. . . Agrobacterium tumefaciens str. C58 ..........................  218   2 hits [a-proteobacteria]  glycolate oxidase subunit [Agrobacterium tumefaciens str. C
. . . Rhizobium leguminosarum bv. trifolii WSM2304 ................  218   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Rhizobium leguminosar
. . . Rhizobium leguminosarum bv. trifolii WSM1325 ................  216   2 hits [a-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Rhizobium leguminosar
. . . Rhizobium leguminosarum bv. viciae 3841 .....................  216   2 hits [a-proteobacteria]  putative glycolate oxidase subunit [Rhizobium leguminosarum
. . . Rhodobacterales bacterium HTCC2083 ..........................  216   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Rhodobacterales bacterium 
. . . Agrobacterium vitis S4 ......................................  214   2 hits [a-proteobacteria]  glycolate oxidase subunit GlcD [Agrobacterium vitis S4] >gi
. . . Agrobacterium radiobacter K84 ...............................  213   2 hits [a-proteobacteria]  glycolate oxidase, subunit GlcD [Agrobacterium radiobacter 
. . . Sinorhizobium meliloti 1021 .................................  211   2 hits [a-proteobacteria]  glycolate oxidase subunit protein [Sinorhizobium meliloti 1
. . Thioalkalivibrio sp. HL-EbGR7 ---------------------------------  285   2 hits [g-proteobacteria]  FAD linked oxidase domain protein [Thioalkalivibrio sp. HL-
. . Alkalilimnicola ehrlichii MLHE-1 ..............................  285   2 hits [g-proteobacteria]  FAD linked oxidase domain-containing protein [Alkalilimnico
. . Pseudomonas syringae pv. syringae B728a .......................  284   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas syringae pv. sy
. . Nitrosococcus oceani ATCC 19707 ...............................  283   2 hits [g-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Nitrosococcus oceani 
. . Nitrosococcus oceani AFC27 ....................................  283   2 hits [g-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Nitrosococcus oceani 
. . Beggiatoa sp. PS ..............................................  282   2 hits [g-proteobacteria]  glycolate oxidase,  subunit D [Beggiatoa sp. PS] >gi|152068
. . Mariprofundus ferrooxydans PV-1 ...............................  282   2 hits [proteobacteria]    glycolate oxidase subunit GlcD [Mariprofundus ferrooxydans 
. . Pseudomonas syringae pv. tabaci ATCC 11528 ....................  281   1 hit  [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas syringae pv. ta
. . Thauera sp. MZ1T ..............................................  280   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Thauera sp. MZ1T] >gi|21
. . Pseudomonas syringae pv. phaseolicola 1448A ...................  280   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas syringae pv. ph
. . Pseudomonas stutzeri A1501 ....................................  280   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas stutzeri A1501]
. . Sideroxydans lithotrophicus ES-1 ..............................  279   2 hits [g-proteobacteria]  FAD linked oxidase domain protein [Sideroxydans lithotrophi
. . Pseudomonas putida W619 .......................................  278   4 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas putida W619] >g
. . Burkholderia phymatum STM815 ..................................  278   6 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia phymatum STM8
. . Acidithiobacillus ferrooxidans ATCC 53993 .....................  278   2 hits [g-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Acidithiobacillus fer
. . Escherichia coli B str. REL606 ................................  278   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli B s
. . Escherichia coli BL21(DE3) ....................................  278   4 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli B s
. . Pseudomonas syringae pv. oryzae str. 1_6 ......................  277   1 hit  [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas syringae pv. or
. . Escherichia coli 53638 ........................................  277   2 hits [enterobacteria]    glycolate oxidase, subunit GlcD [Escherichia coli 53638] >g
. . Acidithiobacillus ferrooxidans ATCC 23270 .....................  277   2 hits [g-proteobacteria]  glycolate oxidase, subunit GlcD [Acidithiobacillus ferrooxi
. . Burkholderia phytofirmans PsJN ................................  277   4 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia phytofirmans 
. . Escherichia coli 536 ..........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli 536] >gi|4
. . Escherichia coli ..............................................  277   1 hit  [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli 536] >gi|4
. . Escherichia coli E24377A ......................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli HS ...........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli B7A ..........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli E22 ..........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli E110019 ......................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli 101-1 ........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli E24377A] >
. . Escherichia coli DH1 ..........................................  277   1 hit  [enterobacteria]    glycolate oxidase, subunit GlcD [Escherichia coli DH1]
. . Escherichia coli IAI39 ........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli IAI39] >gi
. . Escherichia coli 83972 ........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli 839
. . Escherichia albertii TW07627 ..................................  277   2 hits [enterobacteria]    glycolate oxidase, subunit GlcD [Escherichia albertii TW076
. . Escherichia coli str. K-12 substr. MG1655 .....................  277   3 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli CFT073 .......................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli str. K-12 substr. W3110 ......................  277   3 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli ATCC 8739 ....................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli str. K-12 substr. DH10B ......................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli SE11 .........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli IAI1 .........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli 55989 ........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli UMN026 .......................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli BW2952 .......................................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Shigella sp. D9 ...............................................  277   1 hit  [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia sp. 4_1_40B .......................................  277   1 hit  [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli O103:H2 str. 12009 ...........................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli O26:H11 str. 11368 ...........................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli O111:H- str. 11128 ...........................  277   2 hits [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli O6 ...........................................  277   1 hit  [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia coli K-12 .........................................  277   1 hit  [enterobacteria]    glycolate oxidase subunit, FAD-linked [Escherichia coli str
. . Escherichia sp. 1_1_43 ........................................  277   2 hits [enterobacteria]    glycolate oxidase subunit [Escherichia sp. 1_1_43] >gi|2268
. . Pseudomonas mendocina ymp .....................................  277   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas mendocina ymp] 
. . Dechloromonas aromatica RCB ...................................  276   2 hits [b-proteobacteria]  FAD linked oxidase, C-terminal:FAD linked oxidase, N-termin
. . Pseudomonas fluorescens Pf-5 ..................................  276   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas fluorescens Pf-
. . Escherichia coli ED1a .........................................  276   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli ED1a] >gi|
. . Pseudomonas syringae pv. tomato str. DC3000 ...................  276   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas syringae pv. to
. . Pseudomonas syringae pv. tomato T1 ............................  276   2 hits [g-proteobacteria]  glycolate oxidase, subunit GlcD [Pseudomonas syringae pv. t
. . Burkholderia sp. H160 .........................................  276   4 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia sp. H160] >gi
. . Pseudomonas fluorescens Pf0-1 .................................  276   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas fluorescens Pf0
. . Burkholderia xenovorans LB400 .................................  276   4 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia xenovorans LB4
. . Escherichia coli UTI89 ........................................  276   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli UTI89] >gi
. . Escherichia coli APEC O1 ......................................  276   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli UTI89] >gi
. . Escherichia coli S88 ..........................................  276   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli UTI89] >gi
. . Methylibium petroleiphilum PM1 ................................  275   4 hits [b-proteobacteria]  putative glycolate oxidase (FAD-linked subunit) oxidoreduct
. . Escherichia coli F11 ..........................................  275   2 hits [enterobacteria]    glycolate oxidase, subunit GlcD [Escherichia coli F11] >gi|
. . Limnobacter sp. MED105 ........................................  275   2 hits [b-proteobacteria]  glycolate oxidase subunit [Limnobacter sp. MED105] >gi|1498
. . Acidithiobacillus caldus ATCC 51756 ...........................  275   2 hits [g-proteobacteria]  Glycolate dehydrogenase, subunit GlcD [Acidithiobacillus ca
. . Escherichia coli SMS-3-5 ......................................  275   2 hits [enterobacteria]    glycolate oxidase, subunit GlcD [Escherichia coli SMS-3-5] 
. . Escherichia coli O127:H6 str. E2348/69 ........................  275   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia coli O127:H6 st
. . Pseudomonas putida F1 .........................................  275   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas putida F1] >gi|
. . Escherichia sp. 3_2_53FAA .....................................  275   2 hits [enterobacteria]    glycolate oxidase subunit GlcD [Escherichia sp. 3_2_53FAA] 
. . Pseudomonas entomophila L48 ...................................  275   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas entomophila L48
. . Nitrosomonas sp. AL212 ........................................  273   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Nitrosomonas sp. AL21
. . Leptothrix cholodnii SP-6 .....................................  273   4 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Leptothrix ch
. . Azotobacter vinelandii DJ .....................................  273   2 hits [g-proteobacteria]  glycolate oxidase, subunit GlcD [Azotobacter vinelandii DJ]
. . Pseudomonas putida GB-1 .......................................  273   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas putida GB-1] >g
. . Rhodoferax ferrireducens T118 .................................  273   2 hits [b-proteobacteria]  FAD linked oxidase-like [Rhodoferax ferrireducens T118] >gi
. . Nitrosomonas europaea ATCC 19718 ..............................  272   2 hits [b-proteobacteria]  glcD; glycolate oxidase subunit GlcD [Nitrosomonas europaea
. . Janthinobacterium sp. Marseille ...............................  272   2 hits [b-proteobacteria]  glycolate oxidase (fad-linked subunit) oxidoreductase prote
. . Halorhodospira halophila SL1 ..................................  272   2 hits [g-proteobacteria]  FAD linked oxidase domain-containing protein [Halorhodospir
. . Pseudomonas aeruginosa LESB58 .................................  272   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa LESB
. . Pseudomonas aeruginosa PAO1 ...................................  272   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa PAO1
. . Pseudomonas aeruginosa C3719 ..................................  272   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa PAO1
. . Polaromonas naphthalenivorans CJ2 .............................  271   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Polaromonas n
. . Pseudomonas aeruginosa UCBPP-PA14 .............................  271   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa UCBP
. . Pseudomonas putida KT2440 .....................................  271   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas putida KT2440] 
. . Comamonas testosteroni CNB-2 ..................................  271   2 hits [b-proteobacteria]  FAD linked oxidase-like protein [Comamonas testosteroni CNB
. . Pseudomonas aeruginosa PA7 ....................................  271   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa PA7]
. . Candidatus Vesicomyosocius okutanii HA ........................  271   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Candidatus Vesicomyosocius 
. . Delftia acidovorans SPH-1 .....................................  270   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Delftia acido
. . Chromohalobacter salexigens DSM 3043 ..........................  270   2 hits [g-proteobacteria]  glycolate oxidase, subunit GlcD [Chromohalobacter salexigen
. . Burkholderia sp. 383 ..........................................  270   4 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia sp. 383] >gi|7
. . Bordetella petrii DSM 12804 ...................................  270   1 hit  [b-proteobacteria]  glycolate oxidase subunit [Bordetella petrii DSM 12804] >gi
. . Bordetella petrii .............................................  270   1 hit  [b-proteobacteria]  glycolate oxidase subunit [Bordetella petrii DSM 12804] >gi
. . Azoarcus sp. BH72 .............................................  270   2 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Azoarcus sp. BH72] >gi|1196
. . Thiobacillus denitrificans ATCC 25259 .........................  270   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Thiobacillus denitrificans
. . Polaromonas sp. JS666 .........................................  270   2 hits [b-proteobacteria]  FAD linked oxidase-like [Polaromonas sp. JS666] >gi|9169556
. . Aromatoleum aromaticum EbN1 ...................................  270   2 hits [b-proteobacteria]  glycolate oxidase (FAD-linked subunit) oxidoreductase prote
. . Comamonas testosteroni KF-1 ...................................  270   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Comamonas testosteroni K
. . Herminiimonas arsenicoxydans ..................................  269   2 hits [b-proteobacteria]  Glycolate oxidase subunit glcD [Herminiimonas arsenicoxydan
. . Pseudomonas aeruginosa 2192 ...................................  269   2 hits [g-proteobacteria]  glycolate oxidase subunit GlcD [Pseudomonas aeruginosa 2192
. . Nitrosomonas eutropha C91 .....................................  268   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Nitrosomonas 
. . Burkholderia ambifaria IOP40-10 ...............................  268   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Burkholderia ambifaria I
. . Burkholderia ambifaria AMMD ...................................  268   4 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia ambifaria AMMD
. . Burkholderia ambifaria MEX-5 ..................................  268   4 hits [b-proteobacteria]  FAD linked oxidase domain protein [Burkholderia ambifaria M
. . Burkholderia oklahomensis EO147 ...............................  267   2 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia oklahomensis E
. . Burkholderia oklahomensis C6786 ...............................  267   2 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia oklahomensis C
. . Pseudomonas aeruginosa PACS2 ..................................  267   1 hit  [g-proteobacteria]  hypothetical protein PaerPA_01005534 [Pseudomonas aeruginos
. . Bordetella pertussis Tohama I .................................  267   2 hits [b-proteobacteria]  glycolate oxidase subunit [Bordetella pertussis Tohama I] >
. . Allochromatium vinosum DSM 180 ................................  267   2 hits [g-proteobacteria]  glycolate oxidase, subunit GlcD [Allochromatium vinosum DSM
. . Bordetella bronchiseptica RB50 ................................  267   2 hits [b-proteobacteria]  glycolate oxidase subunit [Bordetella bronchiseptica RB50] 
. . Burkholderia ambifaria MC40-6 .................................  267   4 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia ambifaria MC4
. . Diaphorobacter sp. TPSY .......................................  266   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Diaphorobacter sp. TPSY]
. . Acidovorax sp. JS42 ...........................................  266   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Acidovorax sp
. . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ...  266   2 hits [g-proteobacteria]  FAD linked oxidase domain-containing protein [Candidatus Ru
. . Burkholderia cenocepacia J2315 ................................  266   4 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Burkholderia cenocepacia J2
. . Acidovorax delafieldii 2AN ....................................  265   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Acidovorax delafieldii 2
. . Bordetella avium 197N .........................................  265   2 hits [b-proteobacteria]  glycolate oxidase subunit [Bordetella avium 197N] >gi|11542
. . Acidovorax citrulli AAC00-1 ...................................  265   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Acidovorax av
. . Verminephrobacter eiseniae EF01-2 .............................  264   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Verminephroba
. . Nitrosospira multiformis ATCC 25196 ...........................  264   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Nitrosospira multifor
. . Bordetella parapertussis 12822 ................................  263   1 hit  [b-proteobacteria]  glycolate oxidase subunit [Bordetella parapertussis 12822] 
. . Bordetella parapertussis ......................................  263   1 hit  [b-proteobacteria]  glycolate oxidase subunit [Bordetella parapertussis 12822] 
. . Thioalkalivibrio sp. K90mix ...................................  260   2 hits [g-proteobacteria]  FAD linked oxidase domain protein [Thioalkalivibrio sp. K90
. . Ralstonia metallidurans CH34 ..................................  257   2 hits [b-proteobacteria]  FAD linked oxidase-like protein [Ralstonia metallidurans CH
. . Psychrobacter arcticus 273-4 ..................................  257   2 hits [g-proteobacteria]  glycolate oxidase subunit D [Psychrobacter arcticus 273-4] 
. . Ralstonia solanacearum IPO1609 ................................  256   2 hits [b-proteobacteria]  glycolate oxidase (fad-linked subunit) protein [Ralstonia s
. . Ralstonia solanacearum MolK2 ..................................  256   2 hits [b-proteobacteria]  glycolate oxidase (fad-linked subunit) protein [Ralstonia s
. . Methylococcus capsulatus str. Bath ............................  256   2 hits [g-proteobacteria]  glycolate oxidase, GlcD subunit [Methylococcus capsulatus s
. . Ralstonia solanacearum GMI1000 ................................  256   2 hits [b-proteobacteria]  glycolate oxidase FAD-linked subunit oxidoreductase [Ralsto
. . Ralstonia solanacearum UW551 ..................................  256   2 hits [b-proteobacteria]  (S)-2-hydroxy-acid oxidase chain D [Ralstonia solanacearum 
. . Variovorax paradoxus S110 .....................................  256   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Variovorax paradoxus S11
. . Burkholderia pseudomallei 1710b ...............................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 668 .................................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 9 ...................................  256   1 hit  [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei NCTC 13177 ..........................  256   1 hit  [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 576 .................................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei Pakistan 9 ..........................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1655 ................................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei Pasteur 52237 .......................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei S13 .................................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Burkholderia pseudomallei 1710a ...............................  256   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Ralstonia pickettii 12D .......................................  256   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Ralstonia pickettii 1
. . Thiomonas intermedia K12 ......................................  255   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Thiomonas intermedia K12
. . Burkholderia pseudomallei K96243 ..............................  255   2 hits [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 305 .................................  255   2 hits [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei DM98 ................................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 14 ..................................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 91 ..................................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 7894 ................................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 112 .................................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei BCC215 ..............................  255   1 hit  [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Burkholderia pseudomallei 406e ................................  255   2 hits [b-proteobacteria]  putative glycolate oxidase subunit GlcD [Burkholderia pseud
. . Marinobacter algicola DG893 ...................................  255   2 hits [g-proteobacteria]  glycolate oxidase subunit D [Marinobacter algicola DG893] >
. . Burkholderia pseudomallei MSHR346 .............................  255   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia pseudomallei 
. . Psychrobacter cryohalolentis K5 ...............................  255   2 hits [g-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Psychrobacter cryohal
. . Ralstonia pickettii 12J .......................................  254   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Ralstonia pickettii 1
. . Burkholderia thailandensis E264 ...............................  254   3 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia thailandensis
. . Burkholderia thailandensis TXDOH ..............................  254   1 hit  [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia thailandensis
. . Burkholderia thailandensis Bt4 ................................  254   1 hit  [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia thailandensis
. . Burkholderia thailandensis MSMB43 .............................  254   1 hit  [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia thailandensis
. . Ralstonia eutropha H16 ........................................  253   2 hits [b-proteobacteria]  glycolate oxidase subunit GlcD [Ralstonia eutropha H16] >gi
. . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ......  253   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Candidatus Accumulibacte
. . Burkholderia mallei ATCC 23344 ................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei GB8 horse 4 ...............................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei SAVP1 .....................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei NCTC 10247 ................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia pseudomallei 1106a ...............................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei PRL-20 ....................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia pseudomallei 1106b ...............................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei ATCC 10399 ................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei FMH .......................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei JHU .......................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei 2002721280 ................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei ATCC 2
. . Burkholderia mallei NCTC 10229 ................................  252   2 hits [b-proteobacteria]  glycolate oxidase, subunit GlcD [Burkholderia mallei NCTC 1
. . Marinobacter aquaeolei VT8 ....................................  252   2 hits [g-proteobacteria]  FAD linked oxidase domain-containing protein [Marinobacter 
. . Cupriavidus taiwanensis .......................................  251   2 hits [b-proteobacteria]  Glycolate oxidase subunit glcD [Cupriavidus taiwanensis] >g
. . Ralstonia eutropha JMP134 .....................................  251   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Ralstonia eutropha JM
. . Burkholderia glumae BGR1 ......................................  251   2 hits [b-proteobacteria]  FAD linked oxidase-like protein [Burkholderia glumae BGR1] 
. . Burkholderia pseudomallei B7210 ...............................  250   1 hit  [b-proteobacteria]  putative glycolate oxidase, subunit GlcD [Burkholderia pseu
. . Burkholderia multivorans ATCC 17616 ...........................  250   4 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Burkholderia 
. . Burkholderia multivorans CGD1 .................................  250   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Burkholderia 
. . Burkholderia ubonensis Bu .....................................  249   1 hit  [b-proteobacteria]  FAD linked oxidase domain protein [Burkholderia ubonensis B
. . Burkholderia multivorans CGD2M ................................  249   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Burkholderia multivorans
. . Burkholderia multivorans CGD2 .................................  249   2 hits [b-proteobacteria]  FAD linked oxidase domain protein [Burkholderia multivorans
. . marine gamma proteobacterium HTCC2148 .........................  248   2 hits [g-proteobacteria]  FAD linked oxidase, C-terminal domain protein [marine gamma
. . Hahella chejuensis KCTC 2396 ..................................  248   2 hits [g-proteobacteria]  FAD/FMN-containing dehydrogenase [Hahella chejuensis KCTC 2
. . Burkholderia cenocepacia MC0-3 ................................  247   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Burkholderia 
. . Burkholderia graminis C4D1M ...................................  246   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Burkholderia graminis
. . Burkholderia vietnamiensis G4 .................................  246   2 hits [b-proteobacteria]  FAD linked oxidase domain-containing protein [Burkholderia 
. . Burkholderia cenocepacia AU 1054 ..............................  246   2 hits [b-proteobacteria]  FAD linked oxidase-like [Burkholderia cenocepacia AU 1054] 
. . Burkholderia cenocepacia HI2424 ...............................  246   2 hits [b-proteobacteria]  FAD linked oxidase-like [Burkholderia cenocepacia AU 1054] 
. . Marinobacter sp. ELB17 ........................................  242   2 hits [g-proteobacteria]  glycolate oxidase subunit D [Marinobacter sp. ELB17] >gi|12
. . marine gamma proteobacterium HTCC2143 .........................  241   2 hits [g-proteobacteria]  glycolate oxidase subunit D [marine gamma proteobacterium H
. . Burkholderia cenocepacia PC184 ................................  237   2 hits [b-proteobacteria]  FAD linked oxidase-like [Burkholderia cenocepacia PC184] >g
. . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .  235   2 hits [b-proteobacteria]  D-lactate dehydrogenase (cytochrome) [Polynucleobacter nece
. . uncultured SUP05 cluster bacterium ............................  216   1 hit  [g-proteobacteria]  glycolate oxidase subunit GlcD [uncultured SUP05 cluster ba
. Methylacidiphilum infernorum V4 ---------------------------------  244   2 hits [verrucomicrobia]   Glycolate oxidase, subunit GlcD [Methylacidiphilum infernor
. uncultured marine bacterium .....................................  233 367 hits [bacteria]          GlcD [uncultured marine bacterium]
. Cyanothece sp. PCC 7425 .........................................  232   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Cyanothece sp. PCC 7425] >
. 'Nostoc azollae' 0708 ...........................................  228   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD ['Nostoc azollae' 0708] >gi
. Nostoc sp. PCC 7120 .............................................  228   2 hits [cyanobacteria]     glycolate oxidase subunit [Nostoc sp. PCC 7120] >gi|1713440
. Microcoleus chthonoplastes PCC 7420 .............................  225   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Microcoleus chthonoplastes
. Anabaena variabilis ATCC 29413 ..................................  225   2 hits [cyanobacteria]     glycolate oxidase subunit GlcD [Anabaena variabilis ATCC 29
. Synechococcus sp. JA-2-3B'a(2-13) ...............................  225   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Synechococcus sp. JA-2-3B'
. Arthrospira maxima CS-328 .......................................  225   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Arthrospira maxima CS-328]
. Synechococcus elongatus PCC 7942 ................................  224   2 hits [cyanobacteria]     glycolate oxidase subunit GlcD [Synechococcus elongatus PCC
. Synechococcus elongatus PCC 6301 ................................  224   2 hits [cyanobacteria]     glycolate oxidase subunit GlcD [Synechococcus elongatus PCC
. Cyanothece sp. PCC 7822 .........................................  223   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Cyanothece sp. PCC 7822] >
. Lyngbya sp. PCC 8106 ............................................  223   2 hits [cyanobacteria]     Glycolate oxidase subunit GlcD [Lyngbya sp. PCC 8106] >gi|1
. Synechococcus sp. JA-3-3Ab ......................................  222   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Synechococcus sp. JA-3-3Ab
. Acaryochloris marina MBIC11017 ..................................  222   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Acaryochloris marina MBIC1
. Cyanothece sp. PCC 7424 .........................................  222   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Cyanothece sp. PCC 7424] >
. Cyanothece sp. CCY0110 ..........................................  221   2 hits [cyanobacteria]     glycolate oxidase subunit; GlcD [Cyanothece sp. CCY0110] >g
. Synechococcus sp. PCC 7002 ......................................  220   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Synechococcus sp. PCC 7002
. Meiothermus silvanus DSM 9946 ...................................  220   2 hits [bacteria]          FAD/FMN-dependent dehydrogenase [Meiothermus silvanus DSM 9
. Thermus thermophilus HB27 .......................................  219   2 hits [bacteria]          (S)-2-hydroxy-acid oxidase chain D [Thermus thermophilus HB
. Geobacillus kaustophilus HTA426 .................................  219   2 hits [firmicutes]        glycolate oxidase subunit [Geobacillus kaustophilus HTA426]
. Nostoc punctiforme PCC 73102 ....................................  219   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Nostoc punctiforme PCC 731
. Cyanothece sp. ATCC 51142 .......................................  219   2 hits [cyanobacteria]     glycolate oxidase subunit [Cyanothece sp. ATCC 51142] >gi|1
. Thermobaculum terrenum ATCC BAA-798 .............................  219   2 hits [bacteria]          FAD linked oxidase domain protein [Thermobaculum terrenum A
. Geobacillus sp. Y412MC52 ........................................  218   2 hits [firmicutes]        FAD linked oxidase domain protein [Geobacillus sp. Y412MC52
. Geobacillus sp. Y412MC61 ........................................  218   2 hits [firmicutes]        FAD linked oxidase domain protein [Geobacillus sp. Y412MC52
. Geobacillus thermodenitrificans NG80-2 ..........................  218   2 hits [firmicutes]        glycolate oxidase subunit [Geobacillus thermodenitrificans 
. Geobacillus sp. G11MC16 .........................................  218   2 hits [firmicutes]        FAD linked oxidase domain protein [Geobacillus sp. G11MC16]
. Meiothermus ruber DSM 1279 ......................................  217   2 hits [bacteria]          FAD/FMN-dependent dehydrogenase [Meiothermus ruber DSM 1279
. Thermus aquaticus Y51MC23 .......................................  217   2 hits [bacteria]          FAD linked oxidase domain protein [Thermus aquaticus Y51MC2
. Nodularia spumigena CCY9414 .....................................  216   2 hits [cyanobacteria]     Glycolate oxidase subunit GlcD [Nodularia spumigena CCY9414
. Synechococcus sp. PCC 7335 ......................................  216   2 hits [cyanobacteria]     FAD linked oxidase, C-terminal domain protein [Synechococcu
. Thermus thermophilus HB8 ........................................  215   2 hits [bacteria]          glycolate oxidase subunit [Thermus thermophilus HB8] >gi|55
. Microcystis aeruginosa NIES-843 .................................  214   2 hits [cyanobacteria]     glycolate oxidase subunit [Microcystis aeruginosa NIES-843]
. Thermosynechococcus elongatus BP-1 ..............................  214   2 hits [cyanobacteria]     glycolate oxidase subunit [Thermosynechococcus elongatus BP
. Geobacillus sp. Y4.1MC1 .........................................  214   2 hits [firmicutes]        FAD linked oxidase domain protein [Geobacillus sp. Y4.1MC1]
. Cyanothece sp. PCC 8802 .........................................  214   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Cyanothece sp. PCC 8802] >
. Geobacillus sp. WCH70 ...........................................  214   2 hits [firmicutes]        FAD linked oxidase domain protein [Geobacillus sp. WCH70] >
. Cyanothece sp. PCC 8801 .........................................  214   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Cyanothece sp. PCC 8801] >
. Geodermatophilus obscurus DSM 43160 .............................  213   2 hits [high GC Gram+]     FAD/FMN-dependent dehydrogenase [Geodermatophilus obscurus 
. Microcystis aeruginosa PCC 7806 .................................  213   1 hit  [cyanobacteria]     unnamed protein product [Microcystis aeruginosa PCC 7806]
. Crocosphaera watsonii WH 8501 ...................................  213   2 hits [cyanobacteria]     Glycolate oxidase subunit GlcD [Crocosphaera watsonii WH 85
. Rubrobacter xylanophilus DSM 9941 ...............................  213   2 hits [high GC Gram+]     D-lactate dehydrogenase (cytochrome) [Rubrobacter xylanophi
. Trichodesmium erythraeum IMS101 .................................  213   2 hits [cyanobacteria]     glycolate oxidase, subunit GlcD [Trichodesmium erythraeum I
. Gloeobacter violaceus PCC 7421 ..................................  212   2 hits [cyanobacteria]     glycolate oxidase subunit [Gloeobacter violaceus PCC 7421] 
. Thermomicrobium roseum DSM 5159 .................................  212   2 hits [GNS bacteria]      glycolate oxidase subunit glcD [Thermomicrobium roseum DSM 
. Bacillus clausii KSM-K16 ........................................  212   2 hits [firmicutes]        glycolate oxidase subunit [Bacillus clausii KSM-K16] >gi|56
. Synechocystis sp. PCC 6803 ......................................  210   2 hits [cyanobacteria]     glycolate oxidase subunit; GlcD [Synechocystis sp. PCC 6803
. Saccharopolyspora erythraea NRRL 2338 ...........................  207   2 hits [high GC Gram+]     glycolate oxidase subunit [Saccharopolyspora erythraea NRRL
. Alicyclobacillus acidocaldarius LAA1 ............................  206   2 hits [firmicutes]        FAD linked oxidase domain protein [Alicyclobacillus acidoca
. Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ...  206   2 hits [firmicutes]        FAD linked oxidase domain protein [Alicyclobacillus acidoca
. uncultured marine bacterium HF4000_APKG2098 .....................  205   1 hit  [bacteria]          putative FAD-linked oxidase, C-terminal domain protein [unc

BLAST

PROTOCOLE:


a)Blastx de la séquence complète contre nr sur le site NCBI

b)Blast p de l'ORF considérée(de 234 acides aminés) contre nr sur le site NCBI

c)Blast p de l'ORF considérée(de 234 acides aminés) contre swissprot sur le site NCBI



ANALYSE DES RÉSULTATS:


Le résultat de la recherche d'homologues par le blastx permet de mettre en évidence de nombreux homologues sur la fin de notre séquence. Ce blast nous permet également de confirmer notre cadre de lecture.


Pour le blastp, on a des homologues jusqu'à la fin de notre liste. C'est pourquoi on augmente le nombre de séquences ciblées à 1000. Même en faisant celà, on obtient des résultats avec des E-values qui diminuent régulièrement de 5e-102 à 1e-20. Il n'y a aucun saut important dans les E-values, on doit donc déterminer un seuil d'homologies arbitraire qu'on va fixer à 6e-40 (on choisit aussi ce seuil d'homologie car il y a un saut dans la valeur des hits à cette E-value).

Pour le blastp contre SwissProt on a des hits qui varient beaucoup plus mais on a moins de séquences dans nos résultats. Celà est du au fait que cette banque ne contient que peu de séquences; il est donc rare d'obtenir des homologies avec des E-values aussi bonnes que 5e-74 dans cette banque. Les fiches des meilleurs hits nous indiquent que notre protéine serait une sous-unité glycolate oxydase.

RÉSULTATS BRUTS:

a) Blast x de la séquence complète

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_06055662.1|  D-lactate dehydrogenase [alpha proteobacte...   366    2e-99
ref|ZP_01548045.1|  ATPase, E1-E2 type [Stappia aggregata IAM ...   343    2e-92
ref|ZP_01264560.1|  (S)-2-hydroxy-acid oxidase [Candidatus Pel...   342    4e-92
ref|YP_265702.1|  (S)-2-hydroxy-acid oxidase [Candidatus Pelag...   342    4e-92 Gene info
ref|ZP_05087045.1|  (S)-2-hydroxy-acid oxidase [Pseudovibrio s...   332    5e-89
ref|ZP_04681851.1|  D-lactate dehydrogenase (cytochrome) [Ochr...   327    1e-87
ref|YP_001371547.1|  D-lactate dehydrogenase (cytochrome) [Och...   326    2e-87 Gene info
ref|YP_002362004.1|  FAD linked oxidase domain protein [Methyl...   322    3e-86 Gene info
ref|YP_672933.1|  FAD linked oxidase-like [Mesorhizobium sp. B...   322    3e-86 Gene info
ref|ZP_01227859.1|  glycolate oxidase, subunit glcD [Aurantimo...   320    1e-85
ref|ZP_05952913.1|  LOW QUALITY PROTEIN: D-lactate dehydrogena...   320    2e-85
ref|ZP_05934314.1|  glycolate oxidase subunit GlcD [Brucella c...   320    2e-85
ref|ZP_05173848.1|  FAD binding domain protein [Brucella ceti ...   320    2e-85
ref|ZP_05164426.1|  hypothetical protein Bsuib36_01342 [Brucel...   320    2e-85
ref|ZP_05157141.1|  FAD binding domain protein [Brucella abort...   320    2e-85
ref|ZP_04595682.1|  (S)-2-hydroxy-acid oxidase chain D [Brucel...   320    2e-85
ref|YP_001622024.1|  hypothetical protein BSUIS_B0183 [Brucell...   320    2e-85 Gene info
ref|NP_542042.1|  (S)-2-hydroxy-acid oxidase chain D [Brucella...   320    2e-85 Gene info
ref|NP_699382.1|  glycolate oxidase, subunit GlcD [Brucella su...   320    2e-85 Gene info
ref|YP_222980.1|  GlcD, glycolate oxidase, subunit GlcD [Bruce...   320    2e-85 Gene info
ref|NP_107324.1|  glycolate oxidase subunit GlcD [Mesorhizobiu...   319    2e-85 Gene info
ref|YP_001594146.1|  D-lactate dehydrogenase (cytochrome) [Bru...   318    5e-85 Gene info
ref|ZP_01438649.1|  ATPase, E1-E2 type:FAD linked oxidase, C-t...   318    7e-85
ref|NP_946481.1|  glycolate oxidase subunit GlcD [Rhodopseudom...   317    1e-84 Gene info
ref|YP_571257.1|  D-lactate dehydrogenase (cytochrome) [Rhodop...   315    6e-84 Gene info
ref|YP_485446.1|  FAD linked oxidase-like [Rhodopseudomonas pa...   314    8e-84 Gene info
ref|ZP_05810871.1|  D-lactate dehydrogenase (cytochrome) [Meso...   313    1e-83
ref|YP_002290252.1|  glycolate oxidase, subunit GlcD [Oligotro...   310    1e-82 Gene info
ref|YP_002298352.1|  glycolate oxidase, subunit GlcD [Rhodospi...   310    2e-82 Gene info
ref|ZP_02187380.1|  FAD linked oxidase-like protein [alpha pro...   310    2e-82
ref|YP_001261496.1|  D-lactate dehydrogenase (cytochrome) [Sph...   310    2e-82 Gene info
ref|YP_534577.1|  FAD linked oxidase-like [Rhodopseudomonas pa...   307    1e-81 Gene info
ref|YP_001522999.1|  glycolate oxidase subunit protein [Azorhi...   303    2e-80 Gene info
ref|YP_783593.1|  FAD linked oxidase domain-containing protein...   303    2e-80 Gene info
ref|YP_001416772.1|  FAD linked oxidase domain-containing prot...   303    2e-80 Gene info
ref|NP_774183.1|  glycolate oxidase subunit [Bradyrhizobium ja...   300    2e-79 Gene info
ref|ZP_01045220.1|  FAD linked oxidase [Nitrobacter sp. Nb-311...   300    2e-79
ref|YP_001207996.1|  glycolate oxidase, subunit GlcD [Bradyrhi...   298    8e-79 Gene info
ref|YP_319186.1|  FAD linked oxidase [Nitrobacter winogradskyi...   298    8e-79 Gene info
ref|YP_001237778.1|  glycolate oxidase, subunit GlcD [Bradyrhi...   298    8e-79 Gene info
ref|YP_001833012.1|  D-lactate dehydrogenase (cytochrome) [Bei...   296    2e-78 Gene info
ref|YP_578399.1|  FAD linked oxidase-like [Nitrobacter hamburg...   294    1e-77 Gene info
ref|YP_002131859.1|  FAD/FMN-containing dehydrogenase [Phenylo...   288    8e-76 Gene info
ref|YP_742728.1|  FAD linked oxidase domain-containing protein...   275    5e-72 Gene info
ref|YP_002514104.1|  FAD linked oxidase domain protein [Thioal...   274    9e-72 Gene info
ref|YP_236401.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   274    1e-71 Gene info
ref|ZP_02002890.1|  glycolate oxidase,  subunit D [Beggiatoa s...   273    2e-71
ref|YP_342548.1|  D-lactate dehydrogenase (cytochrome) [Nitros...   273    2e-71 Gene info
ref|YP_001170979.1|  glycolate oxidase subunit GlcD [Pseudomon...   273    3e-71 Gene info
ref|ZP_01452647.1|  glycolate oxidase subunit GlcD [Mariprofun...   272    3e-71
ref|ZP_05638796.1|  glycolate oxidase subunit GlcD [Pseudomona...   271    1e-70
ref|YP_275412.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   270    2e-70 Gene info
ref|YP_001890079.1|  glycolate oxidase, subunit GlcD [Burkhold...   269    4e-70 Gene info
ref|YP_001861763.1|  glycolate oxidase, subunit GlcD [Burkhold...   269    4e-70 Gene info
ref|ZP_05339883.1|  FAD linked oxidase domain protein [Siderox...   268    5e-70
ref|YP_003046034.1|  glycolate oxidase subunit, FAD-linked [Es...   268    5e-70 Gene info
ref|ZP_03001416.1|  glycolate oxidase, subunit GlcD [Escherich...   268    5e-70
gb|ACX38401.1|  glycolate oxidase, subunit GlcD [Escherichia c...   268    6e-70
ref|ZP_04005484.1|  glycolate oxidase subunit, FAD-linked [Esc...   268    6e-70
ref|ZP_04872209.1|  glycolate oxidase subunit [Escherichia sp....   268    6e-70
ref|YP_002409377.1|  glycolate oxidase subunit GlcD [Escherich...   268    6e-70 Gene info
ref|YP_001464436.1|  glycolate oxidase subunit GlcD [Escherich...   268    6e-70 Gene info
ref|YP_001749175.1|  glycolate oxidase subunit GlcD [Pseudomon...   268    6e-70 Gene info
ref|YP_670941.1|  glycolate oxidase subunit GlcD [Escherichia ...   268    6e-70 Gene info
ref|NP_417453.1|  glycolate oxidase subunit, FAD-linked [Esche...   268    6e-70 Gene info
ref|YP_002355288.1|  FAD linked oxidase domain protein [Thauer...   268    8e-70 Gene info
ref|ZP_02900702.1|  glycolate oxidase, subunit GlcD [Escherich...   268    8e-70
ref|ZP_01915485.1|  glycolate oxidase subunit [Limnobacter sp....   268    8e-70
ref|YP_002399476.1|  glycolate oxidase subunit GlcD [Escherich...   267    1e-69 Gene info
ref|YP_001185709.1|  glycolate oxidase subunit GlcD [Pseudomon...   267    1e-69 Gene info
ref|YP_259376.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   267    1e-69 Gene info
ref|ZP_04587865.1|  glycolate oxidase subunit GlcD [Pseudomona...   266    2e-69
ref|YP_001863464.1|  glycolate oxidase, subunit GlcD [Burkhold...   266    2e-69 Gene info
ref|YP_347951.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   266    2e-69 Gene info
ref|ZP_04536762.1|  glycolate oxidase subunit GlcD [Escherichi...   266    2e-69
ref|YP_002426087.1|  glycolate oxidase, subunit GlcD [Acidithi...   266    2e-69 Gene info
ref|ZP_03265772.1|  glycolate oxidase, subunit GlcD [Burkholde...   266    2e-69
ref|YP_002219802.1|  D-lactate dehydrogenase (cytochrome) [Aci...   266    2e-69 Gene info
ref|YP_542372.1|  glycolate oxidase subunit GlcD [Escherichia ...   266    2e-69 Gene info
ref|YP_558802.1|  glycolate oxidase subunit GlcD [Burkholderia...   266    2e-69 Gene info
ref|YP_002330729.1|  glycolate oxidase subunit GlcD [Escherich...   266    3e-69 Gene info
ref|ZP_03033406.1|  glycolate oxidase, subunit GlcD [Escherich...   266    3e-69
ref|YP_001745237.1|  glycolate oxidase, subunit GlcD [Escheric...   266    3e-69 Gene info
ref|YP_286515.1|  FAD linked oxidase, C-terminal:FAD linked ox...   265    4e-69 Gene info
ref|YP_001022826.1|  putative glycolate oxidase (FAD-linked su...   265    4e-69 Gene info
ref|YP_002801429.1|  glycolate oxidase, subunit GlcD [Azotobac...   265    4e-69 Gene info
ref|YP_001749071.1|  glycolate oxidase subunit GlcD [Pseudomon...   265    5e-69 Gene info
ref|ZP_05291860.1|  Glycolate dehydrogenase, subunit GlcD [Aci...   265    7e-69
ref|YP_001267342.1|  glycolate oxidase subunit GlcD [Pseudomon...   265    7e-69 Gene info
ref|ZP_05316285.1|  D-lactate dehydrogenase (cytochrome) [Nitr...   264    9e-69
ref|YP_001219147.1|  glycolate oxidase subunit GlcD [Candidatu...   264    9e-69 Gene info
ref|YP_608739.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   264    1e-68 Gene info
ref|YP_521888.1|  FAD linked oxidase-like [Rhodoferax ferrired...   264    1e-68 Gene info
ref|YP_001352025.1|  glycolate oxidase (fad-linked subunit) ox...   263    2e-68 Gene info
ref|YP_001668396.1|  glycolate oxidase subunit GlcD [Pseudomon...   263    2e-68 Gene info
ref|ZP_03397127.1|  glycolate oxidase, subunit GlcD [Pseudomon...   263    2e-68
ref|NP_793335.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   263    2e-68 Gene info
ref|YP_903562.1|  FAD linked oxidase domain-containing protein...   262    4e-68 Gene info
ref|NP_840754.1|  glcD; glycolate oxidase subunit GlcD [Nitros...   262    4e-68 Gene info
ref|YP_980537.1|  FAD linked oxidase domain-containing protein...   262    4e-68 Gene info



b) Blast p de l'ORF considérée(de 234 acides aminés) contre nr sur le site NCBI 

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_06055662.1|  D-lactate dehydrogenase [alpha proteobacte...   374    5e-102
ref|ZP_01548045.1|  ATPase, E1-E2 type [Stappia aggregata IAM ...   351    4e-95 
ref|ZP_01264560.1|  (S)-2-hydroxy-acid oxidase [Candidatus Pel...   348    2e-94 
ref|YP_265702.1|  (S)-2-hydroxy-acid oxidase [Candidatus Pelag...   348    2e-94  Gene info
ref|ZP_05087045.1|  (S)-2-hydroxy-acid oxidase [Pseudovibrio s...   341    3e-92 
ref|ZP_04681851.1|  D-lactate dehydrogenase (cytochrome) [Ochr...   338    3e-91 
ref|YP_001371547.1|  D-lactate dehydrogenase (cytochrome) [Och...   337    5e-91  Gene info
ref|YP_002362004.1|  FAD linked oxidase domain protein [Methyl...   333    1e-89  Gene info
ref|ZP_04595682.1|  (S)-2-hydroxy-acid oxidase chain D [Brucel...   332    2e-89 
ref|YP_672933.1|  FAD linked oxidase-like [Mesorhizobium sp. B...   332    2e-89  Gene info
ref|NP_542042.1|  (S)-2-hydroxy-acid oxidase chain D [Brucella...   332    2e-89  Gene info
ref|ZP_05173848.1|  FAD binding domain protein [Brucella ceti ...   332    2e-89 
ref|YP_222980.1|  GlcD, glycolate oxidase, subunit GlcD [Bruce...   332    2e-89  Gene info
ref|ZP_05164426.1|  hypothetical protein Bsuib36_01342 [Brucel...   332    2e-89 
ref|NP_107324.1|  glycolate oxidase subunit GlcD [Mesorhizobiu...   332    2e-89  Gene info
ref|NP_699382.1|  glycolate oxidase, subunit GlcD [Brucella su...   332    2e-89  Gene info
ref|ZP_05157141.1|  FAD binding domain protein [Brucella abort...   332    3e-89 
ref|YP_001622024.1|  hypothetical protein BSUIS_B0183 [Brucell...   332    3e-89  Gene info
ref|ZP_05934314.1|  glycolate oxidase subunit GlcD [Brucella c...   330    5e-89 
ref|YP_001594146.1|  D-lactate dehydrogenase (cytochrome) [Bru...   330    6e-89  Gene info
ref|ZP_05952913.1|  LOW QUALITY PROTEIN: D-lactate dehydrogena...   330    9e-89 
ref|ZP_01227859.1|  glycolate oxidase, subunit glcD [Aurantimo...   330    1e-88 
ref|NP_946481.1|  glycolate oxidase subunit GlcD [Rhodopseudom...   329    1e-88  Gene info
ref|YP_571257.1|  D-lactate dehydrogenase (cytochrome) [Rhodop...   329    2e-88  Gene info
ref|YP_485446.1|  FAD linked oxidase-like [Rhodopseudomonas pa...   329    2e-88  Gene info
ref|ZP_01438649.1|  ATPase, E1-E2 type:FAD linked oxidase, C-t...   327    4e-88 
ref|ZP_05810871.1|  D-lactate dehydrogenase (cytochrome) [Meso...   325    2e-87 
ref|ZP_02187380.1|  FAD linked oxidase-like protein [alpha pro...   323    8e-87 
ref|YP_001261496.1|  D-lactate dehydrogenase (cytochrome) [Sph...   323    8e-87  Gene info
ref|YP_002298352.1|  glycolate oxidase, subunit GlcD [Rhodospi...   322    2e-86  Gene info
ref|YP_002290252.1|  glycolate oxidase, subunit GlcD [Oligotro...   319    2e-85  Gene info
ref|YP_534577.1|  FAD linked oxidase-like [Rhodopseudomonas pa...   318    2e-85  Gene info
ref|YP_001416772.1|  FAD linked oxidase domain-containing prot...   316    1e-84  Gene info
ref|YP_001522999.1|  glycolate oxidase subunit protein [Azorhi...   316    1e-84  Gene info
ref|YP_783593.1|  FAD linked oxidase domain-containing protein...   315    2e-84  Gene info
ref|NP_774183.1|  glycolate oxidase subunit [Bradyrhizobium ja...   313    6e-84  Gene info
ref|ZP_01045220.1|  FAD linked oxidase [Nitrobacter sp. Nb-311...   313    8e-84 
ref|YP_001237778.1|  glycolate oxidase, subunit GlcD [Bradyrhi...   312    2e-83  Gene info
ref|YP_319186.1|  FAD linked oxidase [Nitrobacter winogradskyi...   311    3e-83  Gene info
ref|YP_001207996.1|  glycolate oxidase, subunit GlcD [Bradyrhi...   311    3e-83  Gene info
ref|YP_578399.1|  FAD linked oxidase-like [Nitrobacter hamburg...   306    7e-82  Gene info
ref|YP_001833012.1|  D-lactate dehydrogenase (cytochrome) [Bei...   306    1e-81  Gene info
ref|YP_002131859.1|  FAD/FMN-containing dehydrogenase [Phenylo...   305    3e-81  Gene info
ref|YP_002514104.1|  FAD linked oxidase domain protein [Thioal...   285    2e-75  Gene info
ref|YP_742728.1|  FAD linked oxidase domain-containing protein...   285    3e-75  Gene info
ref|YP_236401.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   284    5e-75  Gene info
ref|YP_342548.1|  D-lactate dehydrogenase (cytochrome) [Nitros...   283    9e-75  Gene info
ref|ZP_02002890.1|  glycolate oxidase,  subunit D [Beggiatoa s...   282    2e-74 
ref|ZP_01452647.1|  glycolate oxidase subunit GlcD [Mariprofun...   282    2e-74 
ref|ZP_05638796.1|  glycolate oxidase subunit GlcD [Pseudomona...   281    5e-74 
ref|YP_002355288.1|  FAD linked oxidase domain protein [Thauer...   280    6e-74  Gene info
ref|YP_275412.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   280    6e-74  Gene info
ref|YP_001170979.1|  glycolate oxidase subunit GlcD [Pseudomon...   280    8e-74  Gene info
ref|ZP_05339883.1|  FAD linked oxidase domain protein [Siderox...   279    1e-73 
ref|YP_001749175.1|  glycolate oxidase subunit GlcD [Pseudomon...   278    4e-73  Gene info
ref|YP_001861763.1|  glycolate oxidase, subunit GlcD [Burkhold...   278    4e-73  Gene info
ref|YP_002219802.1|  D-lactate dehydrogenase (cytochrome) [Aci...   278    4e-73  Gene info
ref|YP_003046034.1|  glycolate oxidase subunit, FAD-linked [Es...   278    4e-73  Gene info
ref|ZP_04587865.1|  glycolate oxidase subunit GlcD [Pseudomona...   277    5e-73 
ref|ZP_03001416.1|  glycolate oxidase, subunit GlcD [Escherich...   277    5e-73 
ref|YP_002426087.1|  glycolate oxidase, subunit GlcD [Acidithi...   277    5e-73  Gene info
ref|YP_001890079.1|  glycolate oxidase, subunit GlcD [Burkhold...   277    6e-73  Gene info
ref|YP_670941.1|  glycolate oxidase subunit GlcD [Escherichia ...   277    7e-73  Gene info
ref|YP_001464436.1|  glycolate oxidase subunit GlcD [Escherich...   277    7e-73  Gene info
gb|ACX38401.1|  glycolate oxidase, subunit GlcD [Escherichia c...   277    7e-73 
ref|YP_002409377.1|  glycolate oxidase subunit GlcD [Escherich...   277    7e-73  Gene info
ref|ZP_04005484.1|  glycolate oxidase subunit, FAD-linked [Esc...   277    7e-73 
ref|ZP_02900702.1|  glycolate oxidase, subunit GlcD [Escherich...   277    7e-73 
ref|NP_417453.1|  glycolate oxidase subunit, FAD-linked [Esche...   277    7e-73  Gene info
ref|ZP_04872209.1|  glycolate oxidase subunit [Escherichia sp....   277    7e-73 
ref|YP_001185709.1|  glycolate oxidase subunit GlcD [Pseudomon...   277    8e-73  Gene info
ref|YP_286515.1|  FAD linked oxidase, C-terminal:FAD linked ox...   276    8e-73  Gene info
ref|YP_259376.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   276    9e-73  Gene info
ref|YP_002399476.1|  glycolate oxidase subunit GlcD [Escherich...   276    1e-72  Gene info
ref|YP_001749071.1|  glycolate oxidase subunit GlcD [Pseudomon...   276    1e-72  Gene info
ref|NP_793335.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   276    1e-72  Gene info
ref|ZP_03397127.1|  glycolate oxidase, subunit GlcD [Pseudomon...   276    1e-72 
ref|ZP_03265772.1|  glycolate oxidase, subunit GlcD [Burkholde...   276    1e-72 
ref|YP_347951.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   276    1e-72  Gene info
ref|YP_558802.1|  glycolate oxidase subunit GlcD [Burkholderia...   276    2e-72  Gene info
ref|YP_542372.1|  glycolate oxidase subunit GlcD [Escherichia ...   276    2e-72  Gene info
ref|YP_001863464.1|  glycolate oxidase, subunit GlcD [Burkhold...   275    2e-72  Gene info
ref|YP_001022826.1|  putative glycolate oxidase (FAD-linked su...   275    2e-72  Gene info
ref|ZP_03033406.1|  glycolate oxidase, subunit GlcD [Escherich...   275    2e-72 
ref|ZP_01915485.1|  glycolate oxidase subunit [Limnobacter sp....   275    2e-72 
ref|ZP_05291860.1|  Glycolate dehydrogenase, subunit GlcD [Aci...   275    2e-72 
ref|YP_001745237.1|  glycolate oxidase, subunit GlcD [Escheric...   275    2e-72  Gene info
ref|YP_002330729.1|  glycolate oxidase subunit GlcD [Escherich...   275    2e-72  Gene info
ref|YP_001267342.1|  glycolate oxidase subunit GlcD [Pseudomon...   275    2e-72  Gene info
ref|ZP_04536762.1|  glycolate oxidase subunit GlcD [Escherichi...   275    3e-72 
ref|YP_608739.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   275    4e-72  Gene info
ref|ZP_05316285.1|  D-lactate dehydrogenase (cytochrome) [Nitr...   273    7e-72 
ref|YP_001790204.1|  FAD linked oxidase domain-containing prot...   273    8e-72  Gene info
ref|YP_002801429.1|  glycolate oxidase, subunit GlcD [Azotobac...   273    8e-72  Gene info
ref|YP_001668396.1|  glycolate oxidase subunit GlcD [Pseudomon...   273    8e-72  Gene info
ref|YP_521888.1|  FAD linked oxidase-like [Rhodoferax ferrired...   273    1e-71  Gene info
ref|NP_840754.1|  glcD; glycolate oxidase subunit GlcD [Nitros...   272    2e-71  Gene info
ref|YP_001352025.1|  glycolate oxidase (fad-linked subunit) ox...   272    2e-71  Gene info
ref|YP_001001817.1|  FAD linked oxidase domain-containing prot...   272    2e-71  Gene info
ref|YP_002443328.1|  glycolate oxidase subunit GlcD [Pseudomon...   272    2e-71  Gene info
ref|NP_254042.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   272    2e-71  Gene info
ref|YP_980537.1|  FAD linked oxidase domain-containing protein...   271    3e-71  Gene info
ref|YP_793829.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   271    3e-71  Gene info
ref|NP_745876.1|  glycolate oxidase subunit GlcD [Pseudomonas ...   271    4e-71  Gene info
ref|YP_003280419.1|  FAD linked oxidase-like protein [Comamona...   271    5e-71  Gene info
ref|YP_001351448.1|  glycolate oxidase subunit GlcD [Pseudomon...   271    5e-71  Gene info
ref|YP_001219147.1|  glycolate oxidase subunit GlcD [Candidatu...   271    6e-71  Gene info
ref|YP_001562113.1|  FAD linked oxidase domain-containing prot...   270    6e-71  Gene info
gb|ABE60034.1|  glycolate oxidase, subunit GlcD [Chromohalobac...   270    6e-71  Gene info
ref|YP_370794.1|  glycolate oxidase subunit GlcD [Burkholderia...   270    6e-71  Gene info
ref|YP_001631346.1|  glycolate oxidase subunit [Bordetella pet...   270    7e-71  Gene info
ref|YP_574733.2|  glycolate oxidase subunit GlcD [Chromohaloba...   270    8e-71  Gene info
ref|YP_932502.1|  glycolate oxidase subunit GlcD [Azoarcus sp....   270    8e-71  Gene info
ref|YP_313805.1|  glycolate oxidase, subunit GlcD [Thiobacillu...   270    9e-71  Gene info
ref|YP_547295.1|  FAD linked oxidase-like [Polaromonas sp. JS6...   270    1e-70  Gene info
ref|YP_159571.1|  glycolate oxidase (FAD-linked subunit) oxido...   270    1e-70  Gene info
ref|ZP_03540981.1|  FAD linked oxidase domain protein [Comamon...   270    1e-70 
ref|YP_001020156.1|  putative glycolate oxidase (FAD-linked su...   269    1e-70  Gene info
emb|CAL60511.2|  Glycolate oxidase subunit glcD [Herminiimonas...   269    2e-70 
ref|YP_001098640.1|  glycolate oxidase subunit glcD [Herminiim...   269    2e-70  Gene info
ref|YP_001792283.1|  FAD linked oxidase domain-containing prot...   269    2e-70  Gene info
ref|ZP_04937082.1|  glycolate oxidase subunit GlcD [Pseudomona...   269    2e-70 
ref|YP_748079.1|  FAD linked oxidase domain-containing protein...   268    2e-70  Gene info
ref|ZP_02891974.1|  FAD linked oxidase domain protein [Burkhol...   268    3e-70 
ref|YP_776821.1|  glycolate oxidase subunit GlcD [Burkholderia...   268    3e-70  Gene info
ref|ZP_02910717.1|  FAD linked oxidase domain protein [Burkhol...   268    3e-70 
ref|ZP_02360485.1|  glycolate oxidase subunit GlcD [Burkholder...   267    5e-70 
ref|ZP_02367825.1|  glycolate oxidase subunit GlcD [Burkholder...   267    5e-70 
ref|ZP_01368375.1|  hypothetical protein PaerPA_01005534 [Pseu...   267    5e-70 
ref|NP_881487.1|  glycolate oxidase subunit [Bordetella pertus...   267    6e-70  Gene info
ref|ZP_04772856.1|  glycolate oxidase, subunit GlcD [Allochrom...   267    7e-70 
ref|NP_888483.1|  glycolate oxidase subunit [Bordetella bronch...   267    7e-70  Gene info
ref|YP_001812151.1|  glycolate oxidase, subunit GlcD [Burkhold...   267    8e-70  Gene info
ref|YP_002551901.1|  FAD linked oxidase domain protein [Diapho...   266    8e-70  Gene info
ref|YP_984753.1|  FAD linked oxidase domain-containing protein...   266    8e-70  Gene info
ref|YP_903562.1|  FAD linked oxidase domain-containing protein...   266    1e-69  Gene info
ref|YP_002235417.1|  glycolate oxidase subunit GlcD [Burkholde...   266    2e-69  Gene info
ref|ZP_04765309.1|  FAD linked oxidase domain protein [Acidovo...   265    2e-69 
ref|YP_786667.1|  glycolate oxidase subunit [Bordetella avium ...   265    2e-69  Gene info
ref|YP_969023.1|  FAD linked oxidase domain-containing protein...   265    2e-69  Gene info
ref|YP_995426.1|  FAD linked oxidase domain-containing protein...   264    5e-69  Gene info
ref|YP_410873.1|  D-lactate dehydrogenase (cytochrome) [Nitros...   264    7e-69  Gene info
ref|NP_884722.1|  glycolate oxidase subunit [Bordetella parape...   263    8e-69  Gene info
ref|YP_001601026.1|  putative glycolate oxidase subunit glcD [...   261    5e-68  Gene info
ref|YP_002275665.1|  FAD linked oxidase domain protein [Glucon...   261    5e-68  Gene info
ref|ZP_03691180.1|  FAD linked oxidase domain protein [Thioalk...   260    8e-68 
ref|YP_585068.1|  FAD linked oxidase-like protein [Ralstonia m...   257    7e-67  Gene info
ref|YP_264932.1|  glycolate oxidase subunit D [Psychrobacter a...   257    7e-67  Gene info
ref|YP_002260628.1|  glycolate oxidase (fad-linked subunit) pr...   256    9e-67  Gene info
ref|YP_002252106.1|  glycolate oxidase (fad-linked subunit) pr...   256    9e-67  Gene info
ref|YP_113958.1|  glycolate oxidase, GlcD subunit [Methylococc...   256    1e-66  Gene info
ref|NP_520787.1|  glycolate oxidase FAD-linked subunit oxidore...   256    1e-66  Gene info
ref|ZP_00944290.1|  (S)-2-hydroxy-acid oxidase chain D [Ralsto...   256    1e-66 
ref|YP_002942151.1|  FAD linked oxidase domain protein [Variov...   256    2e-66  Gene info
ref|YP_334713.1|  glycolate oxidase, subunit GlcD [Burkholderi...   256    2e-66  Gene info
ref|YP_002982440.1|  D-lactate dehydrogenase (cytochrome) [Ral...   256    2e-66  Gene info
ref|ZP_05499364.1|  FAD linked oxidase domain protein [Thiomon...   255    2e-66 
ref|YP_109437.1|  putative glycolate oxidase subunit GlcD [Bur...   255    2e-66  Gene info
ref|ZP_01893839.1|  glycolate oxidase subunit D [Marinobacter ...   255    2e-66 
ref|YP_002898148.1|  glycolate oxidase, subunit GlcD [Burkhold...   255    2e-66  Gene info
ref|YP_581146.1|  D-lactate dehydrogenase (cytochrome) [Psychr...   255    3e-66  Gene info
ref|YP_001900457.1|  D-lactate dehydrogenase (cytochrome) [Ral...   254    4e-66  Gene info
ref|ZP_02356917.1|  putative glycolate oxidase, subunit GlcD [...   254    4e-66 
ref|YP_441838.1|  glycolate oxidase, subunit GlcD [Burkholderi...   254    6e-66  Gene info
ref|ZP_02464654.1|  glycolate oxidase, subunit GlcD [Burkholde...   254    6e-66 
ref|YP_727537.1|  glycolate oxidase subunit GlcD [Ralstonia eu...   253    1e-65  Gene info
ref|YP_003167257.1|  FAD linked oxidase domain protein [Candid...   253    1e-65  Gene info
ref|YP_103967.1|  glycolate oxidase, subunit GlcD [Burkholderi...   252    2e-65  Gene info
ref|YP_001027177.1|  glycolate oxidase, subunit GlcD [Burkhold...   252    2e-65  Gene info
ref|YP_960562.1|  FAD linked oxidase domain-containing protein...   252    3e-65  Gene info
ref|YP_002006561.1|  Glycolate oxidase subunit glcD [Cupriavid...   251    3e-65  Gene info
ref|YP_296995.1|  D-lactate dehydrogenase (cytochrome) [Ralsto...   251    4e-65  Gene info
ref|YP_002910515.1|  FAD linked oxidase-like protein [Burkhold...   251    6e-65  Gene info
ref|ZP_02472690.1|  putative glycolate oxidase, subunit GlcD [...   250    6e-65 
ref|YP_001580833.1|  FAD linked oxidase domain-containing prot...   250    7e-65  Gene info
ref|ZP_02908859.1|  FAD linked oxidase domain protein [Burkhol...   249    1e-64 
ref|YP_001235660.1|  FAD linked oxidase domain-containing prot...   249    1e-64  Gene info
ref|ZP_02378602.1|  FAD linked oxidase domain protein [Burkhol...   249    2e-64 
ref|ZP_03575280.1|  FAD linked oxidase domain protein [Burkhol...   249    2e-64 
ref|YP_772517.1|  FAD linked oxidase domain-containing protein...   249    2e-64  Gene info
ref|YP_001858732.1|  D-lactate dehydrogenase (cytochrome) [Bur...   248    3e-64  Gene info
ref|ZP_05094743.1|  FAD linked oxidase, C-terminal domain prot...   248    4e-64 
ref|YP_436882.1|  FAD/FMN-containing dehydrogenase [Hahella ch...   248    4e-64  Gene info
ref|YP_001764002.1|  FAD linked oxidase domain-containing prot...   247    6e-64  Gene info
ref|YP_002232392.1|  putative glycolate oxidase subunit GlcD [...   247    8e-64  Gene info
ref|ZP_02882533.1|  D-lactate dehydrogenase (cytochrome) [Burk...   246    1e-63 
ref|YP_001118542.1|  FAD linked oxidase domain-containing prot...   246    1e-63  Gene info
ref|YP_620137.1|  FAD linked oxidase-like [Burkholderia cenoce...   246    1e-63  Gene info
ref|YP_368065.1|  FAD linked oxidase-like [Burkholderia sp. 38...   246    2e-63  Gene info
ref|ZP_03270189.1|  FAD linked oxidase domain protein [Burkhol...   246    2e-63 
ref|YP_557073.1|  D-lactate dehydrogenase (cytochrome) [Burkho...   246    2e-63  Gene info
ref|YP_001166423.1|  FAD linked oxidase domain-containing prot...   245    3e-63  Gene info
ref|YP_001939548.1|  Glycolate oxidase, subunit GlcD [Methylac...   244    4e-63  Gene info
ref|YP_001894368.1|  FAD linked oxidase domain protein [Burkho...   244    7e-63  Gene info
ref|ZP_01748048.1|  putative glycolate oxidase subunit protein...   243    1e-62 
ref|ZP_01739949.1|  glycolate oxidase subunit D [Marinobacter ...   242    2e-62 
ref|ZP_01615058.1|  glycolate oxidase subunit D [marine gamma ...   241    3e-62 
ref|YP_745051.1|  (S)-2-hydroxy-acid oxidase chain D [Granulib...   239    1e-61  Gene info
ref|YP_614496.1|  D-lactate dehydrogenase (cytochrome) [Silici...   238    3e-61  Gene info
ref|ZP_01037020.1|  glycolate oxidase, GlcD subunit [Roseovari...   238    5e-61 
ref|YP_001534230.1|  FAD linked oxidase domain-containing prot...   238    5e-61  Gene info
ref|ZP_05090038.1|  glycolate oxidase, subunit GlcD [Ruegeria ...   238    5e-61 
ref|ZP_04939592.1|  FAD linked oxidase-like [Burkholderia ceno...   237    6e-61 
ref|ZP_01880011.1|  D-lactate dehydrogenase (cytochrome) [Rose...   237    8e-61 
ref|ZP_05741544.1|  D-lactate dehydrogenase [Silicibacter sp. ...   237    9e-61 
ref|YP_168674.1|  glycolate oxidase, GlcD subunit [Ruegeria po...   236    9e-61  Gene info
ref|ZP_05124415.1|  glycolate oxidase subunit GlcD [Rhodobacte...   236    2e-60 
ref|ZP_01901212.1|  glycolate oxidase, GlcD subunit [Roseobact...   236    2e-60 
ref|YP_001156558.1|  D-lactate dehydrogenase (cytochrome) [Pol...   235    2e-60  Gene info
ref|ZP_01740813.1|  glycolate oxidase, GlcD subunit [Rhodobact...   235    2e-60 
ref|ZP_02144605.1|  D-lactate dehydrogenase (cytochrome) [Phae...   235    2e-60 
ref|ZP_01055711.1|  glycolate oxidase, GlcD subunit [Roseobact...   235    2e-60 
ref|ZP_05785739.1|  glycolate oxidase, GlcD subunit [Silicibac...   234    7e-60 
ref|YP_001923572.1|  FAD linked oxidase domain protein [Methyl...   234    7e-60  Gene info
ref|ZP_02147795.1|  glycolate oxidase, GlcD subunit [Phaeobact...   234    7e-60 
gb|ABI29510.1|  GlcD [uncultured marine bacterium]                  233    8e-60 
ref|YP_001756974.1|  FAD linked oxidase domain-containing prot...   233    1e-59  Gene info
ref|ZP_01447588.1|  glycolate oxidase, GlcD subunit [alpha pro...   233    1e-59 
ref|ZP_00961965.1|  glycolate oxidase, GlcD subunit [Sulfitoba...   232    2e-59 
ref|YP_002481310.1|  glycolate oxidase, subunit GlcD [Cyanothe...   232    2e-59  Gene info
ref|ZP_00954650.1|  glycolate oxidase, GlcD subunit [Sulfitoba...   232    2e-59 
ref|ZP_05343043.1|  glycolate oxidase, GlcD subunit [Thalassio...   232    2e-59 
ref|ZP_00959967.1|  glycolate oxidase, GlcD subunit [Roseovari...   232    2e-59 
ref|YP_001638399.1|  FAD linked oxidase domain-containing prot...   232    2e-59  Gene info
ref|YP_002419730.1|  FAD linked oxidase domain protein [Methyl...   232    2e-59  Gene info
ref|YP_002961900.1|  putative glycolate oxidase (glcD-like), F...   232    3e-59  Gene info
ref|YP_003066703.1|  putative glycolate oxidase (glcD-like), F...   231    3e-59  Gene info
ref|ZP_02152709.1|  glycolate oxidase, GlcD subunit [Oceanibul...   231    4e-59 
ref|ZP_01753915.1|  glycolate oxidase, GlcD subunit [Roseobact...   231    5e-59 
ref|ZP_01443337.1|  glycolate oxidase, GlcD subunit [Roseovari...   231    6e-59 
ref|YP_002824159.1|  glycolate oxidase, subunit GlcD [Rhizobiu...   231    6e-59  Gene info
ref|ZP_05101796.1|  glycolate oxidase, subunit GlcD [Roseobact...   230    7e-59 
ref|YP_002499752.1|  FAD linked oxidase domain protein [Methyl...   230    9e-59  Gene info
ref|YP_001769878.1|  FAD linked oxidase domain-containing prot...   230    1e-58  Gene info
ref|ZP_05078731.1|  glycolate oxidase, subunit GlcD [Rhodobact...   230    1e-58 
ref|ZP_05066253.1|  glycolate oxidase, GlcD subunit [Octadecab...   230    1e-58 
ref|ZP_05843973.1|  FAD linked oxidase domain protein [Rhodoba...   229    1e-58 
ref|ZP_00998957.1|  putative glycolate oxidase subunit protein...   229    1e-58 
ref|ZP_01012212.1|  putative glycolate oxidase subunit protein...   229    1e-58 
ref|ZP_05375253.1|  D-lactate dehydrogenase (cytochrome) [Hyph...   228    3e-58 
ref|ZP_03764670.1|  glycolate oxidase, subunit GlcD ['Nostoc a...   228    4e-58 
ref|NP_489309.1|  glycolate oxidase subunit [Nostoc sp. PCC 71...   228    4e-58  Gene info
ref|YP_002526774.1|  FAD linked oxidase domain protein [Rhodob...   228    4e-58  Gene info
ref|ZP_01749250.1|  D-lactate dehydrogenase (cytochrome) [Rose...   228    4e-58 
ref|ZP_05783111.1|  D-lactate dehydrogenase [Citreicella sp. S...   228    4e-58 
ref|YP_354104.1|  putative glycolate oxidase subunit protein [...   228    4e-58  Gene info
ref|ZP_02139971.1|  glycolate oxidase, subunit GlcD [Roseobact...   227    6e-58 
ref|YP_508632.1|  FAD linked oxidase-like [Jannaschia sp. CCS1...   227    8e-58  Gene info
ref|ZP_01003357.1|  putative glycolate oxidase subunit protein...   227    8e-58 
ref|YP_001044554.1|  FAD linked oxidase domain-containing prot...   227    9e-58  Gene info
ref|ZP_05052061.1|  FAD linked oxidase, C-terminal domain prot...   226    1e-57 
ref|ZP_02165474.1|  putative glycolate oxidase subunit [Hoefle...   226    2e-57 
ref|ZP_05027454.1|  glycolate oxidase, subunit GlcD [Microcole...   225    2e-57 
ref|YP_323030.1|  glycolate oxidase subunit GlcD [Anabaena var...   225    2e-57  Gene info
ref|YP_479029.1|  glycolate oxidase, subunit GlcD [Synechococc...   225    3e-57  Gene info
ref|YP_681011.1|  glycolate oxidase, subunit GlcD [Roseobacter...   225    3e-57  Gene info
ref|ZP_03271936.1|  glycolate oxidase, subunit GlcD [Arthrospi...   225    4e-57 
ref|YP_399295.1|  glycolate oxidase subunit GlcD [Synechococcu...   224    4e-57  Gene info
ref|YP_171947.1|  glycolate oxidase subunit GlcD [Synechococcu...   224    5e-57  Gene info
ref|ZP_03152952.1|  glycolate oxidase, subunit GlcD [Cyanothec...   223    1e-56 
gb|AAY81754.1|  putative GlcD [uncultured marine bacterium]         223    1e-56 
ref|YP_001977056.1|  glycolate oxidase protein, subunit D [Rhi...   223    1e-56  Gene info
ref|ZP_03511653.1|  glycolate oxidase protein, subunit D [Rhiz...   223    2e-56 
ref|ZP_01621192.1|  Glycolate oxidase subunit GlcD [Lyngbya sp...   223    2e-56 
ref|YP_476174.1|  glycolate oxidase, subunit GlcD [Synechococc...   222    2e-56  Gene info
ref|YP_001515423.1|  glycolate oxidase, subunit GlcD [Acaryoch...   222    2e-56  Gene info
ref|YP_002378456.1|  glycolate oxidase, subunit GlcD [Cyanothe...   222    3e-56  Gene info
ref|YP_002824941.1|  glycolate oxidase, subunit GlcD [Rhizobiu...   221    4e-56  Gene info
ref|ZP_01729584.1|  glycolate oxidase subunit; GlcD [Cyanothec...   221    5e-56 
ref|YP_468346.1|  glycolate oxidase subunit D protein [Rhizobi...   221    6e-56  Gene info
ref|YP_001736081.1|  glycolate oxidase, subunit GlcD [Synechoc...   220    8e-56  Gene info
ref|ZP_04036510.1|  FAD/FMN-dependent dehydrogenase [Meiotherm...   220    9e-56 
ref|YP_918159.1|  FAD linked oxidase domain-containing protein...   220    9e-56  Gene info
gb|ABI29412.1|  GlcD [uncultured marine bacterium] >gb|ABI2962...   219    1e-55 
gb|ABI29357.1|  GlcD [uncultured marine bacterium]                  219    2e-55 
ref|YP_004104.1|  (S)-2-hydroxy-acid oxidase chain D [Thermus ...   219    2e-55  Gene info
gb|ABI29332.1|  GlcD [uncultured marine bacterium]                  219    2e-55 
ref|YP_001326086.1|  D-lactate dehydrogenase (cytochrome) [Sin...   219    2e-55  Gene info
ref|YP_147385.1|  glycolate oxidase subunit [Geobacillus kaust...   219    2e-55  Gene info
ref|ZP_01157973.1|  putative glycolate oxidase subunit protein...   219    2e-55 
ref|YP_001869359.1|  glycolate oxidase, subunit GlcD [Nostoc p...   219    2e-55  Gene info
ref|YP_001801479.1|  glycolate oxidase subunit [Cyanothece sp....   219    2e-55  Gene info
ref|YP_003321904.1|  FAD linked oxidase domain protein [Thermo...   219    2e-55 
gb|ABI29513.1|  GlcD [uncultured marine bacterium] >gb|ABI2969...   218    3e-55 
ref|ZP_04394045.1|  FAD linked oxidase domain protein [Geobaci...   218    3e-55 
gb|ABI29694.1|  GlcD [uncultured marine bacterium]                  218    3e-55 
gb|ABI29770.1|  GlcD [uncultured marine bacterium]                  218    4e-55 
ref|NP_353688.2|  glycolate oxidase subunit [Agrobacterium tum...   218    4e-55  Gene info
gb|ABI29589.1|  GlcD [uncultured marine bacterium] >gb|ABI2959...   218    4e-55 
gb|ABI29525.1|  GlcD [uncultured marine bacterium]                  218    4e-55 
ref|YP_001125498.1|  glycolate oxidase subunit [Geobacillus th...   218    5e-55  Gene info
ref|ZP_03147082.1|  FAD linked oxidase domain protein [Geobaci...   218    5e-55 
ref|YP_002279974.1|  D-lactate dehydrogenase (cytochrome) [Rhi...   218    6e-55  Gene info
gb|ABI29457.1|  GlcD [uncultured marine bacterium]                  217    7e-55 
ref|ZP_04038177.1|  FAD/FMN-dependent dehydrogenase [Meiotherm...   217    8e-55 
ref|ZP_03496051.1|  FAD linked oxidase domain protein [Thermus...   217    1e-54 
gb|AAY81819.1|  putative GlcD [uncultured marine bacterium]         217    1e-54 
gb|ABI29747.1|  GlcD [uncultured marine bacterium] >gb|ABI2975...   216    1e-54 
gb|ABI29575.1|  GlcD [uncultured marine bacterium]                  216    1e-54 
gb|ABI29347.1|  GlcD [uncultured marine bacterium]                  216    1e-54 
gb|ABI29383.1|  GlcD [uncultured marine bacterium]                  216    1e-54 
ref|YP_002974339.1|  D-lactate dehydrogenase (cytochrome) [Rhi...   216    1e-54  Gene info
ref|ZP_01631400.1|  Glycolate oxidase subunit GlcD [Nodularia ...   216    2e-54 
ref|YP_766475.1|  putative glycolate oxidase subunit [Rhizobiu...   216    2e-54  Gene info
ref|ZP_05036419.1|  FAD linked oxidase, C-terminal domain prot...   216    2e-54 
ref|ZP_05075634.1|  glycolate oxidase, subunit GlcD [Rhodobact...   216    2e-54 
gb|ABI29293.1|  GlcD [uncultured marine bacterium] >gb|ABI2970...   216    2e-54 
gb|ABI29319.1|  GlcD [uncultured marine bacterium]                  216    2e-54 
gb|EEZ79525.1|  glycolate oxidase subunit GlcD [uncultured SUP...   216    2e-54 
gb|ABI29320.1|  GlcD [uncultured marine bacterium]                  216    2e-54 
gb|AAY81823.1|  putative GlcD [uncultured marine bacterium]         216    2e-54 
gb|AAY81811.1|  putative GlcD [uncultured marine bacterium] >g...   215    3e-54 
gb|AAY81804.1|  putative GlcD [uncultured marine bacterium] >g...   215    3e-54 
gb|AAY81817.1|  putative GlcD [uncultured marine bacterium]         215    3e-54 
gb|AAY81805.1|  putative GlcD [uncultured marine bacterium]         215    3e-54 
gb|AAY81835.1|  putative GlcD [uncultured marine bacterium]         215    3e-54 
ref|YP_143771.1|  glycolate oxidase subunit [Thermus thermophi...   215    3e-54  Gene info
gb|AAY81834.1|  putative GlcD [uncultured marine bacterium]         215    3e-54 
gb|ABI29492.1|  GlcD [uncultured marine bacterium]                  215    3e-54 
gb|ABI29658.1|  GlcD [uncultured marine bacterium]                  214    4e-54 
ref|YP_002547567.1|  glycolate oxidase subunit GlcD [Agrobacte...   214    5e-54  Gene info
gb|AAY81813.1|  putative GlcD [uncultured marine bacterium] >g...   214    5e-54 
ref|YP_001660274.1|  glycolate oxidase subunit [Microcystis ae...   214    5e-54  Gene info
ref|NP_682415.1|  glycolate oxidase subunit [Thermosynechococc...   214    6e-54  Gene info
ref|ZP_05371875.1|  FAD linked oxidase domain protein [Geobaci...   214    6e-54 
ref|YP_003136624.1|  glycolate oxidase, subunit GlcD [Cyanothe...   214    7e-54  Gene info
gb|AAY81822.1|  putative GlcD [uncultured marine bacterium]         214    7e-54 
ref|YP_002949915.1|  FAD linked oxidase domain protein [Geobac...   214    7e-54  Gene info
ref|YP_002371060.1|  glycolate oxidase, subunit GlcD [Cyanothe...   214    8e-54  Gene info
ref|YP_002543507.1|  glycolate oxidase, subunit GlcD [Agrobact...   213    1e-53  Gene info
ref|ZP_03889560.1|  FAD/FMN-dependent dehydrogenase [Geodermat...   213    1e-53 
gb|AAY81838.1|  putative GlcD [uncultured marine bacterium]         213    1e-53 
gb|AAY81836.1|  putative GlcD [uncultured marine bacterium]         213    1e-53 
emb|CAO89264.1|  unnamed protein product [Microcystis aerugino...   213    1e-53 
gb|ABI29257.1|  GlcD [uncultured marine bacterium]                  213    1e-53 
ref|ZP_00518485.1|  Glycolate oxidase subunit GlcD [Crocosphae...   213    1e-53 
ref|YP_645557.1|  D-lactate dehydrogenase (cytochrome) [Rubrob...   213    1e-53  Gene info
ref|YP_723572.1|  glycolate oxidase, subunit GlcD [Trichodesmi...   213    1e-53  Gene info
gb|AAY81828.1|  putative GlcD [uncultured marine bacterium]         213    2e-53 
ref|NP_926015.1|  glycolate oxidase subunit [Gloeobacter viola...   212    2e-53  Gene info
gb|ABI29772.1|  GlcD [uncultured marine bacterium]                  212    2e-53 
ref|YP_002521514.1|  glycolate oxidase subunit glcD [Thermomic...   212    2e-53  Gene info
ref|YP_175671.1|  glycolate oxidase subunit [Bacillus clausii ...   212    2e-53  Gene info
ref|NP_384883.1|  glycolate oxidase subunit protein [Sinorhizo...   211    3e-53  Gene info
gb|AAY81832.1|  putative GlcD [uncultured marine bacterium] >g...   211    4e-53 
gb|ABI29249.1|  GlcD [uncultured marine bacterium]                  211    5e-53 
ref|NP_442186.1|  glycolate oxidase subunit; GlcD [Synechocyst...   210    9e-53  Gene info
gb|ABI29425.1|  GlcD [uncultured marine bacterium]                  208    4e-52 
gb|ABI29370.1|  GlcD [uncultured marine bacterium]                  207    5e-52 
gb|ABI29491.1|  GlcD [uncultured marine bacterium]                  207    5e-52 
gb|ABI29753.1|  GlcD [uncultured marine bacterium]                  207    6e-52 
ref|YP_001108461.1|  glycolate oxidase subunit [Saccharopolysp...   207    7e-52  Gene info
gb|ABI29270.1|  GlcD [uncultured marine bacterium]                  207    7e-52 
gb|ABI29252.1|  GlcD [uncultured marine bacterium] >gb|ABI2949...   207    9e-52 
gb|ABI29460.1|  GlcD [uncultured marine bacterium]                  207    9e-52 
gb|ABI29388.1|  GlcD [uncultured marine bacterium]                  207    1e-51 
ref|ZP_03495051.1|  FAD linked oxidase domain protein [Alicycl...   206    1e-51 
gb|ABI29599.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29605.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|AAY81802.1|  putative GlcD [uncultured marine bacterium] >g...   206    1e-51 
gb|ABI29470.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29375.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|AAY81775.1|  putative GlcD [uncultured marine bacterium] >g...   206    1e-51 
gb|ABI29281.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29521.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29316.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29547.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29431.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
ref|YP_003185926.1|  FAD linked oxidase domain protein [Alicyc...   206    1e-51  Gene info
gb|ABI29762.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29519.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29648.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29329.1|  GlcD [uncultured marine bacterium] >gb|ABI2937...   206    1e-51 
gb|ABI29461.1|  GlcD [uncultured marine bacterium] >gb|ABI2950...   206    1e-51 
gb|ABI29336.1|  GlcD [uncultured marine bacterium]                  206    1e-51 
gb|ABI29659.1|  GlcD [uncultured marine bacterium] >gb|ABI2967...   206    2e-51 
gb|ABI29391.1|  GlcD [uncultured marine bacterium] >gb|ABI2954...   206    2e-51 
gb|ABI29447.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29530.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29453.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29550.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29644.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29467.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29368.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABI29429.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|AAY81797.1|  putative GlcD [uncultured marine bacterium]         206    2e-51 
gb|ABI29419.1|  GlcD [uncultured marine bacterium]                  206    2e-51 
gb|ABZ10374.1|  putative FAD-linked oxidase, C-terminal domain...   205    2e-51 
gb|ABI29574.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|ABI29387.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|AAY81776.1|  putative GlcD [uncultured marine bacterium] >g...   205    2e-51 
gb|ABI29633.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|ABI29478.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|ABI29544.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|AAY81791.1|  putative GlcD [uncultured marine bacterium]         205    2e-51 
gb|AAY81793.1|  putative GlcD [uncultured marine bacterium] >g...   205    2e-51 
gb|ABI29273.1|  GlcD [uncultured marine bacterium]                  205    2e-51 
gb|ABI29602.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29687.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29475.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29317.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29408.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29468.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29382.1|  GlcD [uncultured marine bacterium] >gb|ABI2964...   205    3e-51 
gb|ABI29300.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29545.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29641.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29271.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29668.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29479.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29650.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29296.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29255.1|  GlcD [uncultured marine bacterium] >gb|ABI2928...   205    3e-51 
gb|ABI29409.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29682.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29779.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29794.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29338.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29717.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29310.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29318.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29716.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29600.1|  GlcD [uncultured marine bacterium]                  205    3e-51 
gb|ABI29554.1|  GlcD [uncultured marine bacterium]                  205    4e-51 
gb|ABI29548.1|  GlcD [uncultured marine bacterium]                  205    4e-51 
gb|ABI29469.1|  GlcD [uncultured marine bacterium]                  205    4e-51 
gb|AAY81801.1|  putative GlcD [uncultured marine bacterium] >g...   205    4e-51 
gb|ABI29454.1|  GlcD [uncultured marine bacterium]                  205    4e-51 
gb|ABI29627.1|  GlcD [uncultured marine bacterium]                  205    4e-51 
gb|ABI29611.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29643.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29294.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29568.1|  GlcD [uncultured marine bacterium] >gb|ABI2958...   204    4e-51 
gb|ABI29438.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|AAY81788.1|  putative GlcD [uncultured marine bacterium] >g...   204    4e-51 
gb|ABI29327.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|AAY81780.1|  putative GlcD [uncultured marine bacterium]         204    4e-51 
gb|ABI29493.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29286.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29436.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|AAY81786.1|  putative GlcD [uncultured marine bacterium]         204    4e-51 
gb|ABI29305.1|  GlcD [uncultured marine bacterium]                  204    4e-51 
gb|ABI29335.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|AAY81779.1|  putative GlcD [uncultured marine bacterium]         204    5e-51 
gb|ABI29265.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|ABI29421.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|ABI29676.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|ABI29350.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|ABI29720.1|  GlcD [uncultured marine bacterium] >gb|ABI2972...   204    5e-51 
gb|ABI29474.1|  GlcD [uncultured marine bacterium]                  204    5e-51 
gb|ABI29325.1|  GlcD [uncultured marine bacterium] >gb|ABI2940...   204    5e-51 
gb|ABI29685.1|  GlcD [uncultured marine bacterium]                  204    6e-51 
gb|ABI29624.1|  GlcD [uncultured marine bacterium]                  204    7e-51 
gb|ABI29396.1|  GlcD [uncultured marine bacterium]                  204    7e-51 
gb|ABI29477.1|  GlcD [uncultured marine bacterium]                  204    7e-51 
gb|ABI29645.1|  GlcD [uncultured marine bacterium]                  204    7e-51 
gb|ABI29248.1|  GlcD [uncultured marine bacterium]                  204    7e-51 
gb|ABI29488.1|  GlcD [uncultured marine bacterium]                  204    8e-51 
gb|AAY81774.1|  putative GlcD [uncultured marine bacterium]         204    8e-51 
gb|AAY81792.1|  putative GlcD [uncultured marine bacterium] >g...   204    8e-51 
gb|ABI29637.1|  GlcD [uncultured marine bacterium]                  204    8e-51 
gb|ABI29444.1|  GlcD [uncultured marine bacterium]                  204    8e-51 
gb|ABI29483.1|  GlcD [uncultured marine bacterium]                  204    8e-51 
gb|ABI29580.1|  GlcD [uncultured marine bacterium]                  204    9e-51 
gb|ABI29630.1|  GlcD [uncultured marine bacterium]                  203    9e-51 
gb|ABI29631.1|  GlcD [uncultured marine bacterium]                  203    9e-51 
gb|ABI29601.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29709.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29441.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29285.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29514.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29509.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29652.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29487.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29523.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29274.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29437.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29511.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29647.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29680.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29283.1|  GlcD [uncultured marine bacterium] >gb|ABI2936...   203    1e-50 
gb|ABI29315.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29508.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29385.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29349.1|  GlcD [uncultured marine bacterium] >gb|ABI2940...   203    1e-50 
gb|ABI29324.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29698.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29455.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29593.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29494.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29536.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29345.1|  GlcD [uncultured marine bacterium] >gb|ABI2936...   203    1e-50 
gb|ABI29655.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29302.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29598.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29401.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29528.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29678.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29290.1|  GlcD [uncultured marine bacterium] >gb|ABI2929...   203    1e-50 
gb|ABI29578.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29389.1|  GlcD [uncultured marine bacterium]                  203    1e-50 
gb|ABI29731.1|  GlcD [uncultured marine bacterium] >gb|ABI2975...   202    2e-50 
gb|ABI29661.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
ref|YP_003319243.1|  FAD linked oxidase domain protein [Sphaer...   202    2e-50  Gene info
gb|ABI29594.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29440.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29569.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29253.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29560.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29473.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29691.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29433.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29549.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29551.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29352.1|  GlcD [uncultured marine bacterium] >gb|ABI2935...   202    2e-50 
gb|ABI29407.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29496.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29484.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29344.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29361.1|  GlcD [uncultured marine bacterium]                  202    2e-50 
gb|ABI29476.1|  GlcD [uncultured marine bacterium]                  202    3e-50 
gb|ABI29378.1|  GlcD [uncultured marine bacterium]                  202    3e-50 
ref|ZP_01470681.1|  putative glycolate oxidase subunit glcD [S...   202    3e-50 
gb|ABI29328.1|  GlcD [uncultured marine bacterium]                  202    3e-50 
gb|AAY81787.1|  putative GlcD [uncultured marine bacterium] >g...   202    3e-50 
gb|ABI29590.1|  GlcD [uncultured marine bacterium]                  201    3e-50 
gb|ABI29618.1|  GlcD [uncultured marine bacterium]                  201    3e-50 
gb|ABI29482.1|  GlcD [uncultured marine bacterium]                  201    3e-50 
gb|ABI29443.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29322.1|  GlcD [uncultured marine bacterium] >gb|ABI2936...   201    4e-50 
gb|ABI29490.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29529.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|AAY81807.1|  putative GlcD [uncultured marine bacterium] >g...   201    4e-50 
gb|ABI29394.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29340.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29776.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29571.1|  GlcD [uncultured marine bacterium]                  201    4e-50 
gb|ABI29662.1|  GlcD [uncultured marine bacterium]                  201    5e-50 
gb|ABI29527.1|  GlcD [uncultured marine bacterium]                  201    5e-50 
gb|ABI29277.1|  GlcD [uncultured marine bacterium]                  201    5e-50 
ref|ZP_04474487.1|  FAD/FMN-dependent dehydrogenase [Streptosp...   201    5e-50 
gb|ABI29432.1|  GlcD [uncultured marine bacterium]                  201    5e-50 
gb|AAZ67912.1|  glycolate oxidase subunit D [Pseudomonas stutz...   201    6e-50 
ref|YP_377702.1|  putative glycolate oxidase subunit GlcD [Syn...   201    6e-50  Gene info
gb|ABI29458.1|  GlcD [uncultured marine bacterium]                  201    6e-50 
gb|ABI29619.1|  GlcD [uncultured marine bacterium]                  201    6e-50 
gb|ABI29541.1|  GlcD [uncultured marine bacterium]                  201    6e-50 
gb|AAZ67911.1|  glycolate oxidase subunit D [Oceanimonas doudo...   201    7e-50 
gb|ABI29515.1|  GlcD [uncultured marine bacterium]                  201    7e-50 
gb|ABI29538.1|  GlcD [uncultured marine bacterium]                  201    7e-50 
gb|ABI29481.1|  GlcD [uncultured marine bacterium]                  201    7e-50 
gb|ABI29592.1|  GlcD [uncultured marine bacterium]                  201    7e-50 
gb|ABI29326.1|  GlcD [uncultured marine bacterium]                  201    7e-50 
gb|ABI29534.1|  GlcD [uncultured marine bacterium]                  200    8e-50 
gb|ABI29623.1|  GlcD [uncultured marine bacterium]                  200    8e-50 
gb|ABI29587.1|  GlcD [uncultured marine bacterium]                  200    8e-50 
gb|ABI29675.1|  GlcD [uncultured marine bacterium]                  200    1e-49 
gb|ABI29649.1|  GlcD [uncultured marine bacterium]                  200    1e-49 
gb|ABI29543.1|  GlcD [uncultured marine bacterium]                  200    1e-49 
gb|ABI29553.1|  GlcD [uncultured marine bacterium]                  200    1e-49 
ref|YP_466074.1|  D-lactate dehydrogenase (cytochrome) [Anaero...   200    1e-49  Gene info
ref|YP_001380105.1|  D-lactate dehydrogenase (cytochrome) [Ana...   200    1e-49  Gene info
gb|ABI29334.1|  GlcD [uncultured marine bacterium]                  200    1e-49 
ref|YP_002493448.1|  D-lactate dehydrogenase (cytochrome) [Ana...   199    1e-49  Gene info
gb|ABI29374.1|  GlcD [uncultured marine bacterium] >gb|ABI2942...   199    2e-49 
gb|ABI29683.1|  GlcD [uncultured marine bacterium]                  199    2e-49 
gb|ABI29634.1|  GlcD [uncultured marine bacterium]                  199    2e-49 
ref|ZP_03127786.1|  FAD linked oxidase domain protein [Chthoni...   199    2e-49 
gb|ABI29567.1|  GlcD [uncultured marine bacterium]                  199    2e-49 
gb|ABI29485.1|  GlcD [uncultured marine bacterium]                  199    3e-49 
gb|ABI29689.1|  GlcD [uncultured marine bacterium]                  198    4e-49 
gb|ABI29314.1|  GlcD [uncultured marine bacterium]                  198    4e-49 
gb|ABI29381.1|  GlcD [uncultured marine bacterium]                  197    5e-49 
gb|ABI29565.1|  GlcD [uncultured marine bacterium]                  197    6e-49 
ref|ZP_04480401.1|  FAD/FMN-dependent dehydrogenase [Stackebra...   197    7e-49 
ref|YP_003300848.1|  D-lactate dehydrogenase (cytochrome) [The...   197    8e-49  Gene info
ref|ZP_01128773.1|  glycolate oxidase, subunit GlcD [Nitrococc...   197    8e-49 
gb|ABI29736.1|  GlcD [uncultured marine bacterium]                  196    1e-48 
ref|ZP_01086534.1|  putative glycolate oxidase subunit GlcD [S...   196    2e-48 
ref|YP_003132141.1|  FAD/FMN-dependent dehydrogenase [Saccharo...   196    2e-48  Gene info
gb|ABI29737.1|  GlcD [uncultured marine bacterium]                  196    2e-48 
ref|ZP_05043892.1|  glycolate oxidase subunit [Cyanobium sp. P...   196    2e-48 
ref|ZP_01086154.1|  putative glycolate oxidase subunit GlcD [S...   196    2e-48 
ref|ZP_01470119.1|  putative glycolate oxidase subunit GlcD [S...   196    2e-48 
gb|ABI29595.1|  GlcD [uncultured marine bacterium]                  196    2e-48 
ref|NP_897899.1|  putative glycolate oxidase subunit GlcD [Syn...   195    3e-48  Gene info
ref|YP_380989.1|  putative glycolate oxidase subunit GlcD [Syn...   195    4e-48  Gene info
ref|YP_002135306.1|  D-lactate dehydrogenase (cytochrome) [Ana...   194    6e-48  Gene info
gb|AAY81772.1|  putative GlcD [uncultured marine bacterium]         193    9e-48 
gb|ABI29790.1|  GlcD [uncultured marine bacterium]                  193    1e-47 
gb|ABI29284.1|  GlcD [uncultured marine bacterium] >gb|ABI2928...   193    1e-47 
gb|ABI29343.1|  GlcD [uncultured marine bacterium] >gb|ABI2935...   193    1e-47 
gb|ABI29339.1|  GlcD [uncultured marine bacterium]                  193    1e-47 
gb|ABI29386.1|  GlcD [uncultured marine bacterium] >gb|ABI2940...   192    2e-47 
gb|ABI29278.1|  GlcD [uncultured marine bacterium]                  192    2e-47 
emb|CBA32371.1|  Glycolate oxidase subunit glcD [Curvibacter p...   191    4e-47 
gb|ABI29264.1|  GlcD [uncultured marine bacterium]                  191    4e-47 
gb|ABI29742.1|  GlcD [uncultured marine bacterium] >gb|ABI2975...   191    5e-47 
ref|ZP_05790257.1|  glycolate oxidase, subunit GlcD [Synechoco...   191    6e-47 
gb|ABI29392.1|  GlcD [uncultured marine bacterium]                  191    7e-47 
gb|ABI29710.1|  GlcD [uncultured marine bacterium]                  190    8e-47 
gb|ABI29376.1|  GlcD [uncultured marine bacterium] >gb|ABI2941...   190    9e-47 
gb|ABI29721.1|  GlcD [uncultured marine bacterium]                  189    2e-46 
ref|YP_003116672.1|  D-lactate dehydrogenase (cytochrome) [Cat...   189    3e-46  Gene info
gb|ABI29262.1|  GlcD [uncultured marine bacterium]                  188    3e-46 
ref|YP_731260.1|  glycolate oxidase subunit [Synechococcus sp....   188    5e-46  Gene info
ref|YP_001016713.1|  putative glycolate oxidase subunit glcD [...   187    5e-46  Gene info
ref|ZP_04333723.1|  FAD/FMN-dependent dehydrogenase [Nocardiop...   187    7e-46 
ref|NP_895123.1|  putative glycolate oxidase subunit glcD [Pro...   187    8e-46  Gene info
ref|ZP_05913484.1|  glycolate oxidase subunit [Brevibacterium ...   187    8e-46 
ref|NP_870286.1|  glycolate oxidase subunit GlcD [Rhodopirellu...   186    1e-45  Gene info
gb|ABI29625.1|  GlcD [uncultured marine bacterium]                  186    2e-45 
ref|YP_001227903.1|  glycolate oxidase subunit GlcD [Synechoco...   185    3e-45  Gene info
ref|YP_822338.1|  FAD linked oxidase domain-containing protein...   185    4e-45  Gene info
ref|YP_002462870.1|  FAD linked oxidase domain protein [Chloro...   184    5e-45  Gene info
ref|NP_559193.1|  glycolate oxidase subunit glcD [Pyrobaculum ...   184    6e-45  Gene info
ref|ZP_04427643.1|  FAD/FMN-dependent dehydrogenase [Planctomy...   183    1e-44 
ref|YP_001152737.1|  D-lactate dehydrogenase (cytochrome) [Pyr...   182    2e-44  Gene info
ref|ZP_02737143.1|  Glycolate oxidase subunit [Gemmata obscuri...   182    2e-44 
ref|YP_001635733.1|  D-lactate dehydrogenase (cytochrome) [Chl...   182    2e-44  Gene info
ref|YP_001434195.1|  D-lactate dehydrogenase (cytochrome) [Ros...   181    4e-44  Gene info
ref|ZP_01123143.1|  putative glycolate oxidase subunit glcD [S...   181    8e-44 
ref|YP_001225543.1|  glycolate oxidase subunit GlcD [Synechoco...   180    9e-44  Gene info
gb|ABI29358.1|  GlcD [uncultured marine bacterium]                  179    2e-43 
ref|YP_001056110.1|  FAD linked oxidase domain-containing prot...   179    2e-43  Gene info
ref|YP_002463224.1|  D-lactate dehydrogenase (cytochrome) [Chl...   178    4e-43  Gene info
ref|ZP_01079635.1|  putative glycolate oxidase subunit glcD [S...   178    4e-43 
ref|ZP_01856216.1|  glycolate oxidase subunit [Planctomyces ma...   177    7e-43 
ref|YP_001277671.1|  D-lactate dehydrogenase (cytochrome) [Ros...   177    8e-43  Gene info
gb|ABI29557.1|  GlcD [uncultured marine bacterium]                  175    4e-42 
ref|YP_001634764.1|  FAD linked oxidase domain-containing prot...   174    7e-42  Gene info
ref|YP_002569002.1|  FAD linked oxidase domain protein [Chloro...   174    7e-42  Gene info
gb|ABI29287.1|  GlcD [uncultured marine bacterium]                  174    9e-42 
ref|YP_001874953.1|  D-lactate dehydrogenase (cytochrome) [Elu...   172    2e-41  Gene info
ref|YP_002838504.1|  FAD linked oxidase domain protein [Sulfol...   172    3e-41  Gene info
ref|YP_002839635.1|  FAD linked oxidase domain protein [Sulfol...   171    5e-41  Gene info
ref|YP_001433497.1|  D-lactate dehydrogenase (cytochrome) [Ros...   171    8e-41  Gene info
ref|YP_002832995.1|  FAD linked oxidase domain protein [Sulfol...   170    1e-40  Gene info
ref|YP_001275954.1|  D-lactate dehydrogenase (cytochrome) [Ros...   169    2e-40  Gene info
ref|YP_002830241.1|  FAD linked oxidase domain protein [Sulfol...   168    4e-40  Gene info
ref|NP_344472.1|  glycolate oxidase glcD subunit. (glcD) [Sulf...   167    6e-40  Gene info
ref|YP_002760112.1|  glycolate oxidase subunit GlcD [Gemmatimo...   162    2e-38  Gene info
ref|YP_001190652.1|  FAD linked oxidase domain-containing prot...   160    1e-37  Gene info
ref|YP_519590.1|  hypothetical protein DSY3357 [Desulfitobacte...   159    3e-37  Gene info
ref|YP_064758.1|  glycolate oxidase subunit (GlcD) [Desulfotal...   158    5e-37  Gene info
ref|YP_002436274.1|  FAD linked oxidase domain protein [Desulf...   157    1e-36  Gene info
ref|YP_003109961.1|  FAD linked oxidase domain protein [Acidim...   156    2e-36  Gene info
ref|NP_693753.1|  glycolate oxidase subunit [Oceanobacillus ih...   155    2e-36  Gene info
ref|ZP_01665966.1|  FAD linked oxidase domain protein [Thermos...   155    3e-36 
ref|YP_001374339.1|  glycolate oxidase, subunit GlcD [Bacillus...   153    1e-35  Gene info
gb|ABI29346.1|  GlcD [uncultured marine bacterium]                  153    1e-35 
ref|YP_001422164.1|  YsfC [Bacillus amyloliquefaciens FZB42] >...   152    3e-35  Gene info
ref|ZP_03127846.1|  D-lactate dehydrogenase (cytochrome) [Chth...   152    4e-35 
ref|NP_378297.1|  D-lactate dehydrogenase [Sulfolobus tokodaii...   152    4e-35  Gene info
gb|AAY81781.1|  putative GlcD [uncultured marine bacterium] >g...   151    6e-35 
gb|ABI29312.1|  GlcD [uncultured marine bacterium]                  151    6e-35 
gb|ABI29254.1|  GlcD [uncultured marine bacterium] >gb|ABI2926...   151    7e-35 
gb|ABI29301.1|  GlcD [uncultured marine bacterium]                  150    7e-35 
ref|YP_002992167.1|  FAD linked oxidase domain protein [Desulf...   150    8e-35  Gene info
gb|AAY81857.1|  putative GlcD [uncultured marine bacterium]         150    9e-35 
gb|AAY81798.1|  putative GlcD [uncultured marine bacterium] >g...   150    1e-34 
ref|YP_001635735.1|  D-lactate dehydrogenase (cytochrome) [Chl...   150    1e-34  Gene info
gb|ABI29450.1|  GlcD [uncultured marine bacterium]                  150    1e-34 
gb|ABI29759.1|  GlcD [uncultured marine bacterium]                  150    1e-34 
ref|ZP_00049552.2|  COG0277: FAD/FMN-containing dehydrogenases...   150    1e-34 
ref|YP_177529.1|  glycolate oxidase subunit [Bacillus clausii ...   150    1e-34  Gene info
ref|ZP_04038796.1|  FAD/FMN-dependent dehydrogenase [Meiotherm...   149    2e-34 
gb|ABI29566.1|  GlcD [uncultured marine bacterium]                  149    2e-34 
ref|YP_002462868.1|  D-lactate dehydrogenase (cytochrome) [Chl...   149    2e-34  Gene info
ref|YP_431138.1|  FAD linked oxidase-like [Moorella thermoacet...   149    2e-34  Gene info
gb|ABI29771.1|  GlcD [uncultured marine bacterium]                  149    3e-34 
ref|ZP_04216664.1|  Glycolate oxidase subunit [Bacillus cereus...   148    4e-34 
gb|ABI29667.1|  GlcD [uncultured marine bacterium]                  148    4e-34 
ref|ZP_06000057.1|  LOW QUALITY PROTEIN: glycolate oxidase sub...   148    4e-34 
ref|ZP_04299600.1|  Glycolate oxidase subunit [Bacillus cereus...   148    5e-34 
ref|YP_360131.1|  glycolate oxidase, GlcD subunit [Carboxydoth...   147    6e-34  Gene info
ref|YP_519449.1|  hypothetical protein DSY3216 [Desulfitobacte...   147    6e-34  Gene info
ref|YP_001212780.1|  FAD/FMN-containing dehydrogenases [Peloto...   147    6e-34  Gene info
ref|ZP_04144647.1|  Glycolate oxidase subunit [Bacillus thurin...   147    7e-34 
ref|ZP_04150364.1|  Glycolate oxidase subunit [Bacillus pseudo...   147    7e-34 
ref|YP_894021.1|  (S)-2-hydroxy-acid oxidase, subunit D [Bacil...   147    7e-34  Gene info
ref|ZP_04185165.1|  Glycolate oxidase subunit [Bacillus cereus...   147    7e-34 
ref|ZP_03238446.1|  glycolate oxidase, subunit GlcD [Bacillus ...   147    7e-34 
ref|ZP_04156139.1|  Glycolate oxidase subunit [Bacillus mycoid...   147    7e-34 
ref|ZP_00237210.1|  glycolate oxidase, subunit glcD [Bacillus ...   147    8e-34 
ref|ZP_04161952.1|  Glycolate oxidase subunit [Bacillus mycoid...   147    8e-34 
ref|ZP_04173578.1|  Glycolate oxidase subunit [Bacillus cereus...   147    8e-34 
gb|AAY81840.1|  putative GlcD [uncultured marine bacterium] >g...   147    8e-34 
ref|ZP_04583268.1|  glycolate oxidase subunit glcd [Helicobact...   147    9e-34 
ref|YP_001644087.1|  glycolate oxidase, subunit GlcD [Bacillus...   147    9e-34  Gene info
ref|ZP_04261047.1|  Glycolate oxidase subunit [Bacillus cereus...   147    1e-33 
ref|ZP_04167883.1|  Glycolate oxidase subunit [Bacillus mycoid...   147    1e-33 
ref|YP_077574.1|  glycolate oxidase subunit GlcD [Bacillus lic...   147    1e-33  Gene info
ref|ZP_05371943.1|  glycolate oxidase, subunit GlcD [Geobacill...   147    1e-33 
ref|YP_001940248.1|  Glycolate dehydrogenase subunit GlcD [Met...   147    1e-33  Gene info
ref|ZP_04293988.1|  Glycolate oxidase subunit [Bacillus cereus...   147    1e-33 
ref|ZP_04196419.1|  Glycolate oxidase subunit [Bacillus cereus...   147    1e-33 
ref|YP_254918.1|  glycolate oxidase subunit [Sulfolobus acidoc...   146    1e-33  Gene info
ref|ZP_04316494.1|  Glycolate oxidase subunit [Bacillus cereus...   146    1e-33 
ref|ZP_03656554.1|  glycolate oxidase subunit GLCD [Helicobact...   146    2e-33 
ref|ZP_02170033.1|  lipoyltransferase and lipoate-protein liga...   146    2e-33 
ref|ZP_04288346.1|  Glycolate oxidase subunit [Bacillus cereus...   146    2e-33 
ref|ZP_03726814.1|  D-lactate dehydrogenase (cytochrome) [Opit...   146    2e-33 
ref|YP_389728.1|  glycolate oxidase, subunit GlcD [Desulfovibr...   146    2e-33  Gene info
ref|ZP_04101119.1|  Glycolate oxidase subunit [Bacillus thurin...   146    2e-33 
ref|ZP_04190860.1|  Glycolate oxidase subunit [Bacillus cereus...   146    2e-33 
ref|ZP_04070891.1|  Glycolate oxidase subunit [Bacillus thurin...   146    2e-33 
ref|ZP_00740070.1|  (S)-2-hydroxy-acid oxidase chain D [Bacill...   146    2e-33 
gb|ABZ10375.1|  putative FAD binding domain protein [unculture...   146    2e-33 
ref|ZP_03229593.1|  glycolate oxidase, subunit GlcD [Bacillus ...   146    2e-33 
ref|YP_001230959.1|  FAD linked oxidase domain-containing prot...   145    2e-33  Gene info
gb|ABI29700.1|  GlcD [uncultured marine bacterium]                  145    2e-33 
ref|YP_003322153.1|  FAD linked oxidase domain protein [Thermo...   145    3e-33 
gb|AAY81760.1|  putative GlcD [uncultured marine bacterium] >g...   145    3e-33 
gb|AAY81848.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
gb|AAY81866.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
gb|AAY81849.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
ref|ZP_04077589.1|  Glycolate oxidase subunit [Bacillus thurin...   145    3e-33 
ref|YP_035523.1|  (S)-2-hydroxy-acid oxidase, subunit D [Bacil...   145    3e-33  Gene info
ref|ZP_04250177.1|  Glycolate oxidase subunit [Bacillus cereus...   145    3e-33 
gb|AAY81851.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
gb|AAY81839.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
ref|YP_082789.1|  (S)-2-hydroxy-acid oxidase, subunit D [Bacil...   145    3e-33  Gene info
ref|ZP_04095550.1|  Glycolate oxidase subunit [Bacillus thurin...   145    3e-33 
gb|AAY81844.1|  putative GlcD [uncultured marine bacterium]         145    3e-33 
ref|YP_003245646.1|  FAD linked oxidase domain protein [Geobac...   145    4e-33  Gene info
gb|AAY81768.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
gb|AAY81737.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
ref|YP_844668.1|  FAD linked oxidase domain-containing protein...   145    4e-33  Gene info
gb|AAY81765.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
gb|AAY81736.1|  putative GlcD [uncultured marine bacterium] >g...   145    4e-33 
gb|AAY81858.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
gb|AAY81756.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
gb|AAY81868.1|  putative GlcD [uncultured marine bacterium] >g...   145    4e-33 
gb|AAY81764.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
gb|AAY81762.1|  putative GlcD [uncultured marine bacterium]         145    4e-33 
ref|NP_977731.1|  glycolate oxidase, subunit GlcD [Bacillus ce...   145    4e-33  Gene info
ref|ZP_03108014.1|  glycolate oxidase, subunit GlcD [Bacillus ...   145    5e-33 
gb|AAY81861.1|  putative GlcD [uncultured marine bacterium]         145    5e-33 
ref|ZP_04113875.1|  Glycolate oxidase subunit [Bacillus thurin...   144    5e-33 
ref|ZP_04238456.1|  Glycolate oxidase subunit [Bacillus cereus...   144    6e-33 
ref|NP_831079.1|  (S)-2-hydroxy-acid oxidase chain D [Bacillus...   144    6e-33  Gene info
gb|AAY81770.1|  putative GlcD [uncultured marine bacterium]         144    6e-33 
ref|YP_003197904.1|  FAD linked oxidase domain protein [Desulf...   144    7e-33  Gene info
gb|AAY81746.1|  putative GlcD [uncultured marine bacterium]         144    7e-33 
ref|YP_003021137.1|  FAD linked oxidase domain protein [Geobac...   144    7e-33  Gene info
ref|ZP_04083457.1|  Glycolate oxidase subunit [Bacillus thurin...   144    8e-33 
gb|AAY81842.1|  putative GlcD [uncultured marine bacterium]         144    8e-33 
ref|NP_843775.1|  glycolate oxidase, subunit GlcD [Bacillus an...   143    1e-32  Gene info
gb|AAY81739.1|  putative GlcD [uncultured marine bacterium]         143    1e-32 
ref|NP_952674.1|  glycolate oxidase subunit GlcD, putative [Ge...   143    1e-32  Gene info
gb|AAY81738.1|  putative GlcD [uncultured marine bacterium]         143    1e-32 
gb|ABI29258.1|  GlcD [uncultured marine bacterium]                  143    1e-32 
gb|AAY81742.1|  putative GlcD [uncultured marine bacterium]         143    1e-32 
gb|AAY81854.1|  putative GlcD [uncultured marine bacterium]         143    1e-32 
ref|YP_359293.1|  putative glycolate oxidase, GlcD subunit [Ca...   143    1e-32  Gene info
ref|ZP_04226859.1|  Glycolate oxidase subunit [Bacillus cereus...   143    2e-32 
ref|ZP_04272416.1|  Glycolate oxidase subunit [Bacillus cereus...   142    2e-32 
ref|YP_002604080.1|  LdhA [Desulfobacterium autotrophicum HRM2...   142    2e-32  Gene info
ref|YP_002602126.1|  GlcD1 [Desulfobacterium autotrophicum HRM...   142    2e-32  Gene info
ref|ZP_04244247.1|  Glycolate oxidase subunit [Bacillus cereus...   142    2e-32 
gb|AAY81735.1|  putative GlcD [uncultured marine bacterium]         142    2e-32 
gb|AAY81741.1|  putative GlcD [uncultured marine bacterium]         142    2e-32 
gb|AAY81750.1|  putative GlcD [uncultured marine bacterium] >g...   142    3e-32 
ref|ZP_04853845.1|  glycolate oxidase subunit [Paenibacillus s...   142    3e-32 
gb|ABI29307.1|  GlcD [uncultured marine bacterium] >gb|ABI2972...   142    3e-32 
ref|ZP_06008850.1|  Glycolate oxidase, subunit GlcD [Campyloba...   142    3e-32 
gb|ABI29785.1|  GlcD [uncultured marine bacterium]                  142    3e-32 
gb|ABI29735.1|  GlcD [uncultured marine bacterium] >gb|ABI2978...   142    3e-32 
ref|ZP_01666156.1|  FAD linked oxidase domain protein [Thermos...   142    3e-32 
ref|ZP_04232708.1|  Glycolate oxidase subunit [Bacillus cereus...   142    3e-32 
ref|ZP_02330775.1|  glycolate oxidase, subunit GlcD [Paenibaci...   142    4e-32 
ref|YP_002139705.1|  FAD linked oxidase domain protein [Geobac...   142    4e-32  Gene info
ref|YP_003157575.1|  FAD linked oxidase domain protein [Desulf...   142    4e-32  Gene info
gb|AAY81856.1|  putative GlcD [uncultured marine bacterium]         141    4e-32 
ref|ZP_01666597.1|  FAD linked oxidase domain protein [Thermos...   141    5e-32 
gb|ABI29348.1|  GlcD [uncultured marine bacterium]                  141    5e-32 
ref|ZP_04034604.1|  FAD/FMN-dependent dehydrogenase [Meiotherm...   140    9e-32 
ref|ZP_04432839.1|  glycolate oxidase, subunit GlcD [Bacillus ...   140    9e-32 
gb|ABI29426.1|  GlcD [uncultured marine bacterium]                  140    1e-31 
ref|YP_004418.1|  (S)-2-hydroxy-acid oxidase chain D [Thermus ...   140    1e-31  Gene info
ref|ZP_03630636.1|  FAD linked oxidase domain protein [bacteri...   139    2e-31 
ref|ZP_05311298.1|  FAD linked oxidase domain protein [Geobact...   139    2e-31 
ref|NP_390746.1|  glycolate oxidase subunit [Bacillus subtilis...   139    2e-31  Gene info
ref|YP_144063.1|  (s)-2-hydroxy-acid oxidase subunit (GlcD) [T...   139    2e-31  Gene info
gb|ABI29730.1|  GlcD [uncultured marine bacterium] >gb|ABI2979...   139    3e-31 
ref|YP_074822.1|  glycolate oxidase subunit [Symbiobacterium t...   139    3e-31  Gene info
ref|ZP_03312466.1|  hypothetical protein DESPIG_02393 [Desulfo...   138    4e-31 
ref|YP_002603123.1|  GlcD2 [Desulfobacterium autotrophicum HRM...   138    4e-31  Gene info
ref|YP_147867.1|  glycolate oxidase subunit [Geobacillus kaust...   138    4e-31  Gene info
ref|ZP_05898685.1|  glycolate oxidase, subunit GlcD [Selenomon...   138    4e-31 
ref|YP_002953383.1|  FAD linked oxidase [Desulfovibrio magneti...   138    6e-31  Gene info
gb|ABI29446.1|  GlcD [uncultured marine bacterium]                  138    6e-31 
ref|YP_002316373.1|  Glycolate oxidase, subunit GlcD [Anoxybac...   137    8e-31  Gene info
gb|ABI29306.1|  GlcD [uncultured marine bacterium]                  137    9e-31 
ref|ZP_05373048.1|  FAD linked oxidase domain protein [Geobaci...   137    9e-31 
ref|YP_002731527.1|  D-lactate dehydrogenase [Persephonella ma...   137    1e-30  Gene info
ref|ZP_03496455.1|  FAD linked oxidase domain protein [Thermus...   137    1e-30 
ref|YP_902202.1|  FAD linked oxidase domain-containing protein...   137    1e-30  Gene info
ref|YP_002480568.1|  FAD linked oxidase domain protein [Desulf...   137    1e-30  Gene info
ref|YP_001678994.1|  glycolate oxidase, subunit glcd [Heliobac...   136    1e-30  Gene info
ref|NP_243596.1|  glycolate oxidase subunit [Bacillus halodura...   136    1e-30  Gene info
ref|YP_844527.1|  FAD linked oxidase domain-containing protein...   136    2e-30  Gene info
ref|YP_002248510.1|  glycolate oxidase subunit [Thermodesulfov...   136    2e-30  Gene info
ref|YP_002771000.1|  putative FAD linked oxidase [Brevibacillu...   135    2e-30  Gene info
ref|YP_002728399.1|  glycolate oxidase, subunit GlcD [Sulfurih...   135    4e-30  Gene info
gb|ABI29303.1|  GlcD [uncultured marine bacterium]                  134    6e-30 
ref|ZP_05625651.1|  glycolate oxidase, subunit GlcD [Campyloba...   134    6e-30 
ref|ZP_03737913.1|  FAD linked oxidase domain protein [Desulfo...   134    8e-30 
ref|YP_012238.1|  glycolate oxidase, subunit GlcD [Desulfovibr...   134    8e-30  Gene info
ref|YP_002121190.1|  FAD linked oxidase domain protein [Hydrog...   134    9e-30  Gene info
ref|ZP_01870930.1|  FAD linked oxidase-like protein [Caminibac...   133    1e-29 
ref|YP_884787.1|  glycolate oxidase subunit [Mycobacterium sme...   133    2e-29  Gene info
ref|NP_295454.1|  glycolate oxidase subunit GlcD [Deinococcus ...   132    3e-29  Gene info
ref|YP_001124498.1|  glycolate oxidase subunit [Geobacillus th...   132    3e-29  Gene info
ref|ZP_04809529.1|  glycolate oxidase subunit glcd [Helicobact...   132    3e-29 
gb|ABI29411.1|  GlcD [uncultured marine bacterium]                  132    3e-29 
ref|YP_002457208.1|  FAD linked oxidase domain protein [Desulf...   132    4e-29  Gene info
ref|YP_604095.1|  FAD linked oxidase-like protein [Deinococcus...   132    4e-29  Gene info
ref|ZP_01172174.1|  hypothetical protein B14911_22002 [Bacillu...   131    5e-29 
ref|ZP_06009348.1|  glycolate oxidase, subunit GlcD [Campyloba...   130    9e-29 
ref|YP_891868.1|  glycolate oxidase, subunit GlcD [Campylobact...   130    1e-28  Gene info
ref|YP_001355812.1|  glycolate oxidase, subunit GlcD [Nitratir...   130    1e-28  Gene info
ref|ZP_01875016.1|  (S)-2-hydroxy-acid oxidase chain D [Lentis...   129    2e-28 
ref|YP_902904.1|  FAD linked oxidase domain-containing protein...   129    2e-28  Gene info
ref|YP_063795.1|  glycolate oxidase subunit (GlcD) [Desulfotal...   129    3e-28  Gene info
ref|ZP_05072063.1|  glycolate oxidase [Campylobacterales bacte...   129    3e-28 
ref|ZP_04584171.1|  D-lactate dehydrogenase [Sulfurihydrogenib...   129    4e-28 
ref|YP_664675.1|  glycolate oxidase subunit [Helicobacter acin...   128    4e-28  Gene info
ref|YP_627224.1|  glycolate oxidase subunit [Helicobacter pylo...   128    5e-28  Gene info
ref|YP_001359427.1|  glycolate oxidase, subunit GlcD [Sulfurov...   127    7e-28  Gene info
ref|YP_001634307.1|  D-lactate dehydrogenase (cytochrome) [Chl...   127    7e-28  Gene info
ref|YP_002429181.1|  FAD linked oxidase domain protein [Desulf...   127    8e-28  Gene info
ref|YP_001931477.1|  D-lactate dehydrogenase (cytochrome) [Sul...   127    9e-28  Gene info
ref|YP_002607220.1|  glycolate oxidase subunit glcd [Nautilia ...   126    2e-27  Gene info
ref|YP_002786105.1|  putative Glycolate oxidase subunit glcD [...   126    2e-27  Gene info
ref|YP_176743.1|  glycolate oxidase subunit [Bacillus clausii ...   126    2e-27  Gene info
gb|ACX98013.1|  glycolate oxidase [Helicobacter pylori 51]          126    2e-27 
gb|ACX99423.1|  glycolate oxidase subunit [Helicobacter pylori...   126    2e-27 
ref|YP_386183.1|  FAD linked oxidase-like [Geobacter metallire...   126    2e-27  Gene info
ref|NP_223177.1|  putative glycolate oxidase [Helicobacter pyl...   126    2e-27  Gene info
ref|ZP_03053197.1|  glycolate oxidase, subunit GlcD [Bacillus ...   126    2e-27 
ref|YP_001487024.1|  (S)-2-hydroxy-acid oxidase subunit D [Bac...   125    2e-27  Gene info
ref|ZP_05005018.1|  oxidoreductase subunit [Streptomyces clavu...   125    3e-27 
ref|ZP_02927538.1|  glycolate oxidase subunit GlcD, putative [...   125    3e-27 
ref|ZP_03439790.1|  hypothetical protein HP9810_889g20 [Helico...   125    3e-27 
ref|YP_002266096.1|  glycolate oxidase subunit [Helicobacter p...   125    4e-27  Gene info
ref|YP_002301149.1|  glycolate oxidase subunit [Helicobacter p...   125    4e-27  Gene info
ref|YP_001910341.1|  putative Glycolate oxidase [Helicobacter ...   125    4e-27  Gene info
ref|YP_003057578.1|  Glycolate oxidase subunit [Helicobacter p...   125    4e-27  Gene info
ref|YP_001407138.1|  glycolate oxidase, subunit GlcD [Campylob...   125    5e-27  Gene info
ref|ZP_03240252.1|  glycolate oxidase subunit [Helicobacter py...   125    5e-27 
ref|YP_003304643.1|  D-lactate dehydrogenase (cytochrome) [Sul...   125    5e-27  Gene info
ref|YP_003238560.1|  FAD linked oxidase domain protein [Ammoni...   124    7e-27  Gene info
ref|NP_214211.1|  D-lactate dehydrogenase [Aquifex aeolicus VF...   124    8e-27  Gene info
ref|ZP_03438302.1|  hypothetical protein HPB128_198g23 [Helico...   124    9e-27 
ref|ZP_02178717.1|  D-lactate dehydrogenase [Hydrogenivirga sp...   124    1e-26 
ref|NP_207306.1|  glycolate oxidase subunit (glcD) [Helicobact...   124    1e-26  Gene info
ref|YP_001229433.1|  FAD linked oxidase domain-containing prot...   123    1e-26  Gene info
ref|ZP_05311772.1|  FAD linked oxidase domain protein [Geobact...   123    2e-26 
ref|ZP_05001090.1|  (S)-2-hydroxy-acid oxidase [Streptomyces s...   123    2e-26 
gb|AAB39717.1|  putative glycolate oxidase subunit [Helicobact...   122    2e-26 
ref|YP_002536297.1|  FAD linked oxidase domain protein [Geobac...   122    3e-26  Gene info
ref|YP_002432142.1|  FAD linked oxidase domain protein [Desulf...   122    3e-26  Gene info
ref|YP_001950712.1|  FAD linked oxidase domain protein [Geobac...   122    3e-26  Gene info
ref|ZP_05803090.1|  FAD linked oxidase domain protein [Strepto...   122    3e-26 
ref|ZP_05506839.1|  putative oxidoreductase [Streptomyces sp. C]    122    3e-26 
ref|ZP_04581646.1|  glycolate oxidase subunit glcd [Helicobact...   122    4e-26 
ref|YP_001540107.1|  D-lactate dehydrogenase (cytochrome) [Cal...   122    4e-26  Gene info
ref|ZP_05362697.1|  glycolate oxidase, subunit GlcD [Campyloba...   121    5e-26 
ref|YP_002464087.1|  D-lactate dehydrogenase (cytochrome) [Chl...   121    7e-26  Gene info
ref|NP_954336.1|  glycolate oxidase subunit GlcD, putative [Ge...   120    7e-26  Gene info
ref|YP_002512834.1|  oxidoreductase, FAD-binding [Thioalkalivi...   120    8e-26  Gene info
ref|YP_002951083.1|  FAD linked oxidase domain protein [Geobac...   120    1e-25  Gene info
ref|YP_112719.1|  oxidoreductase, FAD-binding [Methylococcus c...   120    1e-25  Gene info
ref|NP_297637.1|  D-lactate dehydrogenase [Xylella fastidiosa ...   120    1e-25  Gene info
ref|YP_001527889.1|  FAD linked oxidase domain-containing prot...   119    2e-25  Gene info
ref|YP_358170.1|  glycolate oxidase subunit D [Pelobacter carb...   119    2e-25  Gene info
ref|ZP_01068588.1|  glycolate oxidase, subunit GlcD [Campyloba...   119    2e-25 
ref|YP_001482732.1|  glycolate oxidase, subunit GlcD [Campylob...   119    2e-25  Gene info
ref|ZP_01069231.1|  glycolate oxidase, subunit GlcD [Campyloba...   119    2e-25 
ref|YP_001397696.1|  glycolate oxidase, subunit GlcD [Campylob...   119    2e-25  Gene info
ref|ZP_03689575.1|  FAD linked oxidase domain protein [Thioalk...   119    2e-25 
ref|NP_906521.1|  glycolate oxidase subunit GLCD [Wolinella su...   119    3e-25  Gene info
ref|YP_002026975.1|  FAD linked oxidase domain protein [Stenot...   119    3e-25  Gene info
ref|YP_179334.1|  glycolate oxidase, subunit GlcD [Campylobact...   119    3e-25  Gene info
ref|ZP_00652843.1|  FAD linked oxidase, C-terminal:FAD linked ...   119    3e-25 
ref|ZP_00681130.1|  FAD linked oxidase, C-terminal:FAD linked ...   119    3e-25 
ref|ZP_05134291.1|  (S)-2-hydroxy-acid oxidase, subunit D [Ste...   119    4e-25 
ref|YP_002137388.1|  FAD linked oxidase domain protein [Geobac...   119    4e-25  Gene info
ref|ZP_00683320.1|  FAD linked oxidase, C-terminal:FAD linked ...   118    4e-25 
ref|YP_001106455.1|  (S)-2-hydroxy-acid oxidase, subunit D [Sa...   118    4e-25  Gene info
ref|YP_392888.1|  FAD linked oxidase-like [Sulfurimonas denitr...   118    4e-25  Gene info
ref|NP_779897.1|  glycolate oxidase [Xylella fastidiosa Temecu...   118    6e-25  Gene info
ref|ZP_05541003.1|  (S)-2-hydroxy-acid oxidase [Streptomyces g...   118    6e-25 
ref|YP_001970631.1|  putative glycolate oxidase subunit D [Ste...   117    6e-25  Gene info
ref|NP_860400.1|  glycolate oxidase [Helicobacter hepaticus AT...   117    6e-25  Gene info
ref|YP_003020409.1|  FAD linked oxidase domain protein [Geobac...   117    6e-25  Gene info
ref|NP_636100.1|  D-lactate dehydrogenase [Xanthomonas campest...   117    1e-24  Gene info
ref|YP_002575790.1|  glycolate oxidase [Campylobacter lari RM2...   117    1e-24  Gene info
ref|ZP_05373099.1|  FAD linked oxidase domain protein [Geobaci...   116    1e-24 
ref|ZP_03610435.1|  glycolate oxidase, subunit GlcD [Campyloba...   116    1e-24 
emb|CAI78684.1|  FAD/FMN-containing dehydrogenases [uncultured...   116    1e-24 
ref|ZP_00371558.1|  glycolate oxidase subunit (glcD) [Campylob...   116    2e-24 
emb|CBG72665.1|  putative oxidoreductase [Streptomyces scabiei...   116    2e-24 
ref|ZP_00367237.1|  probable glycolate oxidase chain D Cj1213c...   116    2e-24 
ref|YP_001127226.1|  glycolate oxidase subunit GlcD, putative ...   115    2e-24  Gene info
ref|ZP_05315255.1|  D-lactate dehydrogenase (cytochrome) [Nitr...   115    2e-24 
ref|YP_001826126.1|  putative oxidoreductase [Streptomyces gri...   115    3e-24  Gene info
ref|YP_362545.1|  putative glycolate oxidase [Xanthomonas camp...   115    3e-24  Gene info
ref|ZP_04687939.1|  (S)-2-hydroxy-acid oxidase [Streptomyces g...   115    3e-24 
ref|YP_001379077.1|  FAD linked oxidase domain-containing prot...   115    3e-24  Gene info
ref|ZP_05015965.1|  oxidoreductase [Streptomyces sviceus ATCC ...   115    4e-24 
ref|ZP_05525878.1|  oxidoreductase subunit [Streptomyces livid...   115    5e-24 
ref|YP_001737371.1|  FAD linked oxidase domain-containing prot...   115    5e-24  Gene info
ref|ZP_04774105.1|  FAD linked oxidase domain protein [Allochr...   114    6e-24 
ref|YP_631166.1|  putative glycolate oxidase, GlcD subunit [My...   114    6e-24  Gene info
ref|YP_149068.1|  D-lactate dehydrogenase [Geobacillus kaustop...   114    6e-24  Gene info
ref|NP_641115.1|  D-lactate dehydrogenase [Xanthomonas axonopo...   114    7e-24  Gene info
ref|ZP_05711082.1|  FAD linked oxidase domain protein [Desulfu...   114    7e-24 
ref|ZP_04693535.1|  putative oxidoreductase [Streptomyces rose...   114    9e-24 
ref|YP_465171.1|  FAD linked oxidase-like [Anaeromyxobacter de...   114    9e-24  Gene info
ref|ZP_03657688.1|  glycolate oxidase [Helicobacter cinaedi CC...   114    1e-23 
ref|XP_002125231.1|  PREDICTED: similar to D-lactate dehydroge...   114    1e-23  UniGene infoGene info
ref|ZP_04393393.1|  FAD linked oxidase domain protein [Geobaci...   114    1e-23 
ref|ZP_05531811.1|  (S)-2-hydroxy-acid oxidase [Streptomyces v...   114    1e-23 
ref|NP_627151.1|  oxidoreductase subunit [Streptomyces coelico...   114    1e-23  Gene info
ref|YP_410893.1|  D-lactate dehydrogenase (cytochrome) [Nitros...   114    1e-23  Gene info
ref|ZP_04704509.1|  putative oxidoreductase [Streptomyces albu...   113    2e-23 
ref|YP_884716.1|  oxidoreductase, FAD-binding [Mycobacterium s...   113    2e-23  Gene info
ref|ZP_05804712.1|  FAD linked oxidase domain protein [Strepto...   113    2e-23 
ref|YP_001106085.1|  FAD-binding oxidoreductase [Saccharopolys...   113    2e-23  Gene info
ref|XP_002400000.1|  D-lactate dehydrogenase, putative [Ixodes...   112    2e-23  UniGene infoGene info
ref|ZP_01465696.1|  glycolate oxidase subunit [Stigmatella aur...   112    2e-23 
ref|ZP_05520057.1|  putative FAD-linked oxidase [Streptomyces ...   112    2e-23 
ref|NP_826328.1|  (S)-2-hydroxy-acid oxidase [Streptomyces ave...   112    2e-23  Gene info
ref|YP_565645.1|  FAD linked oxidase-like protein [Methanococc...   112    2e-23  Gene info
dbj|BAB69152.1|  putative oxidoreductase [Streptomyces avermit...   112    2e-23 
ref|YP_001490750.1|  glycolate oxidase [Arcobacter butzleri RM...   112    3e-23  Gene info
ref|XP_001501363.1|  PREDICTED: lactate dehydrogenase D [Equus...   112    3e-23  UniGene infoGene info
ref|XP_001833387.1|  hypothetical protein CC1G_05087 [Coprinop...   112    3e-23  Gene info
ref|YP_002487135.1|  FAD linked oxidase domain protein [Arthro...   112    4e-23  Gene info
ref|YP_202480.1|  D-lactate dehydrogenase [Xanthomonas oryzae ...   111    6e-23  Gene info
ref|YP_001912212.1|  D-lactate dehydrogenase [Xanthomonas oryz...   111    6e-23  Gene info
ref|YP_003100214.1|  FAD linked oxidase domain protein [Actino...   111    6e-23  Gene info
gb|AAR03942.1|  HP0509 protein [Helicobacter pylori]                111    6e-23 
ref|ZP_02241843.1|  D-lactate dehydrogenase [Xanthomonas oryza...   111    7e-23 
ref|YP_002134272.1|  FAD linked oxidase domain protein [Anaero...   111    7e-23  Gene info
ref|NP_841082.1|  D-lactate dehydrogenase [Nitrosomonas europa...   110    9e-23  Gene info
ref|XP_001626025.1|  predicted protein [Nematostella vectensis...   110    9e-23  UniGene infoGene info
emb|CAF91420.1|  unnamed protein product [Tetraodon nigroviridis]   110    1e-22 
ref|XP_001375142.1|  PREDICTED: similar to Lactate dehydrogena...   110    1e-22  UniGene infoGene info
ref|YP_003275300.1|  FAD linked oxidase domain protein [Gordon...   109    2e-22  Gene info
ref|YP_452648.1|  D-lactate dehydrogenase [Xanthomonas oryzae ...   109    2e-22  Gene info
ref|ZP_02532602.1|  D-lactate dehydrogenase (cytochrome) [Endo...   109    2e-22 
ref|XP_001743586.1|  hypothetical protein [Monosiga brevicolli...   109    2e-22  Gene info
ref|YP_002492407.1|  FAD linked oxidase domain protein [Anaero...   109    2e-22  Gene info
ref|XP_852976.1|  PREDICTED: similar to D-lactate dehydrogenas...   109    2e-22  UniGene infoGene info
ref|YP_342408.1|  D-lactate dehydrogenase (cytochrome) [Nitros...   109    3e-22  Gene info
ref|YP_003266622.1|  FAD linked oxidase domain protein [Halian...   108    4e-22  Gene info
ref|ZP_05484068.1|  FAD linked oxidase domain protein [Strepto...   108    4e-22 
ref|XP_002188270.1|  PREDICTED: similar to lactate dehydrogena...   108    4e-22  UniGene infoGene info
ref|YP_002768579.1|  FAD-linked oxidase [Rhodococcus erythropo...   108    4e-22  Gene info
ref|YP_002778485.1|  putative FAD-linked oxidase [Rhodococcus ...   108    5e-22  Gene info
ref|YP_003102006.1|  FAD linked oxidase domain protein [Actino...   108    5e-22  Gene info
ref|ZP_04383000.1|  oxidoreductase, FAD-binding [Rhodococcus e...   107    1e-21 
gb|EEH10823.1|  D-lactate dehydrogenase [Ajellomyces capsulatu...   107    1e-21 
ref|YP_001106066.1|  putative glycolate oxidase [Saccharopolys...   107    1e-21  Gene info
ref|NP_081846.3|  D-lactate dehydrogenase precursor [Mus muscu...   107    1e-21  UniGene infoGene info
dbj|BAB29488.1|  unnamed protein product [Mus musculus]             107    1e-21  Gene info
ref|YP_002954483.1|  FAD linked oxidase [Desulfovibrio magneti...   107    1e-21  Gene info
ref|XP_001540533.1|  conserved hypothetical protein [Ajellomyc...   106    2e-21  Gene info
gb|EDL11504.1|  lactate dehydrogenase D, isoform CRA_a [Mus mu...   106    2e-21  Gene info
ref|ZP_05517386.1|  putative oxidoreductase [Streptomyces hygr...   106    2e-21 
ref|ZP_04477709.1|  FAD/FMN-dependent dehydrogenase [Streptosp...   106    2e-21 
emb|CAJ71454.1|  similar to glycolate oxidase subunit GlcD [Ca...   106    2e-21 
ref|ZP_00994551.1|  putative oxidoreductase [Janibacter sp. HT...   106    2e-21 
ref|YP_001615721.1|  D-lactate dehydrogenase [Sorangium cellul...   106    2e-21  Gene info
ref|YP_715640.1|  putative glycolate oxidase [Frankia alni ACN...   106    2e-21  Gene info
ref|YP_003048095.1|  FAD linked oxidase domain protein [Methyl...   106    2e-21  Gene info
ref|YP_703197.1|  D-lactate dehydrogenase (cytochrome) [Rhodoc...   105    3e-21  Gene info
gb|EER44528.1|  D-lactate dehydrogenase [Ajellomyces capsulatu...   105    3e-21 
ref|ZP_01462977.1|  FAD/FMN-containing dehydrogenase [Stigmate...   105    4e-21 
ref|ZP_04385032.1|  oxidoreductase, FAD-binding [Rhodococcus e...   105    4e-21 
ref|XP_001103000.1|  PREDICTED: similar to D-lactate dehydroge...   105    4e-21  UniGene infoGene info
ref|YP_002763469.1|  FAD-linked oxidase [Rhodococcus erythropo...   105    4e-21  Gene info
ref|YP_003113242.1|  FAD linked oxidase domain protein [Catenu...   105    5e-21  Gene info
ref|YP_002780250.1|  putative FAD-linked oxidase [Rhodococcus ...   105    5e-21  Gene info
ref|YP_003262571.1|  FAD linked oxidase domain protein [Haloth...   105    5e-21  Gene info
ref|YP_002989817.1|  D-lactate dehydrogenase (cytochrome) [Des...   104    6e-21  Gene info
ref|XP_002107659.1|  hypothetical protein TRIADDRAFT_51388 [Tr...   104    6e-21  Gene info
gb|AAI29668.1|  LOC100036924 protein [Xenopus laevis]               104    7e-21  Gene info
ref|ZP_05478064.1|  putative FAD-linked oxidase [Streptomyces ...   104    8e-21 
ref|YP_387583.1|  glycolate oxidase, subunit GlcD, putative [D...   104    9e-21  Gene info
ref|YP_003204478.1|  FAD linked oxidase domain protein [Nakamu...   104    9e-21 
ref|ZP_03860534.1|  FAD/FMN-dependent dehydrogenase [Kribbella...   104    9e-21 
ref|YP_002603304.1|  GlcD3 [Desulfobacterium autotrophicum HRM...   103    1e-20  Gene info
ref|YP_002435983.1|  D-lactate dehydrogenase (cytochrome) [Des...   103    1e-20  Gene info
ref|YP_001561096.1|  FAD linked oxidase domain-containing prot...   103    1e-20  Gene info
ref|YP_010048.1|  glycolate oxidase, subunit GlcD, putative [D...   103    1e-20  Gene info


c)Blast p de l'ORF considérée(de 234 acides aminés) contre swissprot sur le site NCBI 

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P0AEQ0.1|GLCD_ECOL6  RecName: Full=Glycolate oxidase subuni...   277    5e-74
sp|P94535.1|GLCD_BACSU  RecName: Full=Glycolate oxidase subuni...   139    1e-32
sp|Q7TNG8.1|LDHD_MOUSE  RecName: Full=Probable D-lactate dehyd...   107    8e-23 Gene info
sp|Q86WU2.1|LDHD_HUMAN  RecName: Full=Probable D-lactate dehyd...   102    2e-21 Gene info
sp|Q12627.2|DLD1_KLULA  RecName: Full=D-lactate dehydrogenase ...  94.4    5e-19
sp|P32891.2|DLD1_YEAST  RecName: Full=D-lactate dehydrogenase ...  89.7    1e-17 Gene info
sp|P77748.1|YDIJ_ECOLI  RecName: Full=Uncharacterized protein ...  57.8    6e-08
sp|Q57252.1|Y1163_HAEIN  RecName: Full=Uncharacterized protein...  57.8    6e-08
sp|Q8N465.3|D2HDH_HUMAN  RecName: Full=D-2-hydroxyglutarate de...  51.2    5e-06 Gene info
sp|Q1JPD3.2|D2HDH_BOVIN  RecName: Full=D-2-hydroxyglutarate de...  48.5    3e-05 Gene info
sp|A1L258.1|D2HDH_DANRE  RecName: Full=D-2-hydroxyglutarate de...  47.0    9e-05 Gene info
sp|Q8CIM3.2|D2HDH_MOUSE  RecName: Full=D-2-hydroxyglutarate de...  43.5    0.001 Gene info
sp|P39976.1|DLD3_YEAST  RecName: Full=D-lactate dehydrogenase ...  43.1    0.002 Gene info
sp|P84850.1|D2HDH_RAT  RecName: Full=D-2-hydroxyglutarate dehy...  42.7    0.002 Gene info
sp|P46681.1|DLD2_YEAST  RecName: Full=D-lactate dehydrogenase ...  41.2    0.006 Gene info
sp|Q9C1X2.1|YN53_SCHPO  RecName: Full=Putative D-lactate dehyd...  37.4    0.070 Gene info
sp|O96759.1|ADAS_DICDI  RecName: Full=Alkyldihydroxyacetonepho...  37.4    0.087
sp|Q67NH9.1|CNPD_SYMTH  RecName: Full=2',3'-cyclic-nucleotide ...  36.6    0.14 
sp|A9UL13.1|RBR1_WHEAT  RecName: Full=Retinoblastoma-related p...  34.7    0.48  Gene info
sp|O97157.1|ADAS_TRYBB  RecName: Full=Alkyldihydroxyacetonepho...  34.3    0.58 
sp|Q7VM66.1|SYL_HAEDU  RecName: Full=Leucyl-tRNA synthetase; A...  32.0    3.1  
sp|P0A9I2.1|CITE_ECOL6  RecName: Full=Citrate lyase subunit be...  31.6    4.2  
sp|A8F323.2|SYA_RICM5  RecName: Full=Alanyl-tRNA synthetase; A...  31.6    4.3  
sp|O14047.1|PPK11_SCHPO  RecName: Full=Serine/threonine-protei...  31.2    5.2   Gene info
sp|A8F078.1|SYA_RICCK  RecName: Full=Alanyl-tRNA synthetase; A...  31.2    5.7   Gene info
sp|O51526.2|DPO3A_BORBU  RecName: Full=DNA polymerase III subu...  31.2    6.0  
sp|Q92G00.1|SYA_RICCN  RecName: Full=Alanyl-tRNA synthetase; A...  31.2    6.2  
sp|B0BVK9.1|SYA_RICRO  RecName: Full=Alanyl-tRNA synthetase; A...  30.8    6.7   Gene info
sp|P19862.1|PHYA1_MAIZE  RecName: Full=Phytochrome A               30.8    7.0  
sp|A1AM18.1|RS6_PELPD  RecName: Full=30S ribosomal protein S6      30.4    9.6   Gene info