GOS 1079010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091143176856
Annotathon code: GOS_1079010
Sample :
  • GPS :5°33'10n; 87°5'16w
  • Eastern Tropical Pacific: Dirty Rock, Cocos Island - Costa Rica
  • Fringing Reef (-1.1m, 28.3°C, 0.8-3.0 microns)
Authors
Team : BioCell2009
Username : Yanina
Annotated on : 2010-01-14 19:56:52
  • Hugues Dimitri
  • Mircheva Yanina
  • Monfollet romain

Synopsis

Genomic Sequence

>JCVI_READ_1091143176856 GOS_1079010 Genomic DNA
TGATTTTGATGATGATATAGAAAAAGATTTAGAAAGAATAGAAAAAGCTAAAAAAAGAATTGAAGAAAATAAAATTTTAAAAACTAATAAATTAAGAGAA
ATTTTAAGACTAGAAAAAGATCAAATTAAAAAAATTAAAAATACTTACACCTATGATTATTTTACTGAAAAAGATAAACATGAAAAATTCTATAATGTAG
TATCAGAAAATAGAAAAAGATTTTTAAAATATTGTAGTTATATTTGAAACTACACCAGAAACTAATTAATTAAAGGCTAGATTCTCTATAGATTCTAGCT
TTTTTATTGTGCTATTTTAGAATGATTTTAAATTGTTTAAGGTACAAACACACGTTAAAATTTTAAAATTATAGGATTCTTACTTATGAGATTATCTAGT
TATACTAAGGGATTTGAGAATCTTATTAATTCTTATTATGAGATTAGAGGGTAAAAAGTGCTAATTTTTAAGGTTTTTTAGTTGTTATTAGAATAATATT
TTAGTATTGATTTATATGGAAAAATAAATTATAATTAAAGAGAGTACTATATTCTTTTTTCTTATGACCACCCAAACCAAAGAAACAACACTAGACCGCA
TTGTAAAAAATGATGTTATCTATGATGTAGAGTCAGCAAACTTTGTTGATTTTATTAAAAATGATGGTTCGCTTATGTATTCTTATAATTCTATTGATGA
GGTTTTAAAAGAATACCCAAACGCAATAGTAACTTCATTTGTTAAAGCTTCAGAAATGAGAGATAAGACAAATGAAAGAATTTACAAAGTGGATAAACCT
AAAGTAGTTACAGAGAAAAATTATTTTTACCATCTGGAAGTATTACCACCTAGTAAATGGGAAGGTATAA

Translation

[528 - 869/870]   direct strand
>GOS_1079010 Translation [528-869   direct strand]
IIIKESTIFFFLMTTQTKETTLDRIVKNDVIYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDKPKVVTEKNYF
YHLEVLPPSKWEGI

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

After analizing the target sequence by going through several databases using several search engines(SMS, blast), we have finally found nothing relevant relative to the function of our sequence:

No full ORF;

The calculation of the molecular weight is not relevant because there is no complete protein sequence.

No functional domain found;

No similar or homologous sequence found;

No buildable tree;

No interesting result;

Thus, so far the only conclusion is that this sequence is not complete but only a part of a gene and it's not possible to reveal any evolution history nor parental relations with other sequences known in databases.

ORF finding

PROTOCOLE:


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard (1)' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard (1)' genetic code



ANALYSE DES RÉSULTATS:


The Dna sequence's longest Orf is on the frame 3 on the direct strand, giving incomplete protein (features no stop codon) and does'n start with a Methionine.There is 3 putative ORF on the direct strand and 7 on the reverse strand. The is no ORF on the reverse strand giving at least 60 AA qnd thus no ORF suitible for future analysis.We continue the search of similarity and protein domains with the longest ORF on the direct strand starting at position 528 to 869 .

RÉSULTATS BRUTS:




A) DIRECT STRAND
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 247.
GATTTTGATGATGATATAGAAAAAGATTTAGAAAGAATAGAAAAAGCTAAAAAAAGAATT
GAAGAAAATAAAATTTTAAAAACTAATAAATTAAGAGAAATTTTAAGACTAGAAAAAGAT
CAAATTAAAAAAATTAAAAATACTTACACCTATGATTATTTTACTGAAAAAGATAAACAT
GAAAAATTCTATAATGTAGTATCAGAAAATAGAAAAAGATTTTTAAAATATTGTAGTTAT
ATTTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
DFDDDIEKDLERIEKAKKRIEENKILKTNKLREILRLEKDQIKKIKNTYTYDYFTEKDKH
EKFYNVVSENRKRFLKYCSYI*

>ORF number 1 in reading frame 3 on the direct strand extends from base 528 to base 869.
ATTATAATTAAAGAGAGTACTATATTCTTTTTTCTTATGACCACCCAAACCAAAGAAACA
ACACTAGACCGCATTGTAAAAAATGATGTTATCTATGATGTAGAGTCAGCAAACTTTGTT
GATTTTATTAAAAATGATGGTTCGCTTATGTATTCTTATAATTCTATTGATGAGGTTTTA
AAAGAATACCCAAACGCAATAGTAACTTCATTTGTTAAAGCTTCAGAAATGAGAGATAAG
ACAAATGAAAGAATTTACAAAGTGGATAAACCTAAAGTAGTTACAGAGAAAAATTATTTT
TACCATCTGGAAGTATTACCACCTAGTAAATGGGAAGGTATA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
IIIKESTIFFFLMTTQTKETTLDRIVKNDVIYDVESANFVDFIKNDGSLMYSYNSIDEVL
KEYPNAIVTSFVKASEMRDKTNERIYKVDKPKVVTEKNYFYHLEVLPPSKWEGI




B) REVERSE STRAND

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:



ANALYSE DES RÉSULTATS:


We can't form the Inner Group ( presenting significant inter similarities).

Thus, it's useless to carry out a multiple alignment.

RÉSULTATS BRUTS:

Protein Domains

PROTOCOLE:



A) Protein Domains search:


1)InterProScan/ APPLICATIONS TO RUN 'Check all'/among: BlastProDom, FPrintScan,HMMPIR,HMMPfam,HMMSmart

HMMTigr,ProfileScan,HAMAP,patternScan,SuperFamily,SignalPHMM,TMHMM ,HMMPanther,Gene3D




ANALYSE DES RÉSULTATS:


The amino acid sequence doesn't show any relevant preserved functional domains similar to known protein sequences in databases.Thought there is a small protein domain matching a small part of the sequence ( position 1 to 17 ).This domain is unintegrated and the InterPro doesn't return the E-Value. This is the only result obtained thus we may conclude the amino acid sequence shows no preserved secondary structure/domain and we can't make any predictions concerning the biological function of the query.


RÉSULTATS BRUTS:




A) protein Domains Search:

1)InterProScan Results
Translation	BC470803D309ECF1	114	SignalPHMM	SignalP	signal-peptide	1	17	NA	?	17-Nov-2009	NULL	NULL


Phylogeny

PROTOCOLE:



ANALYSE DES RÉSULTATS:


Lack of relevant information about the origins and the evolution history of this sequence of the marine metagenome , makes it impossible for us to build a significant phylogenetic tree.

RÉSULTATS BRUTS:

Taxonomy report

PROTOCOLE:



ANALYSE DES RÉSULTATS:


Knowing that there is no similarity with protein sequences through databases there is no significant result for the taxonomy report and no possibility to establish parental relations. The taxonomy could not be established so the query is simply classified as unknown sequence making part of the marine metagenome ( 'env' database entry ).

RÉSULTATS BRUTS:



Taxonomy Report

metagenomes ................    60 hits    5 orgs [root; unclassified sequences]
. marine metagenome ........    52 hits    1 orgs [ecological metagenomes]
. organismal metagenomes ...     5 hits    3 orgs 
. . epibiont metagenome ....     3 hits    1 orgs 
. . termite gut metagenome .     1 hits    1 orgs 
. . mouse gut metagenome ...     1 hits    1 orgs 
. metagenome sequence ......     3 hits    1 orgs 

BLAST

PROTOCOLE:


1)blastp/'nr'/default parameters


2)blastx/ 'nr' database/ default parameters


3)tblastx/ 'env_nr' database/ default parameters




ANALYSE DES RÉSULTATS:


Searching through any available database, we found no similarity, so no homology.

1)The BlastP isn't revelant , there is only one Hit for the translation of the ORF direct strand 3 and showing qn E-Value of 9.4 which means that we can't use it to make a conclusion about the origins or the similarity of the query with other sequences situated in this database.

2)The Blast X returns 28 Hits but similar to the BlastP the E-Values and the scores are far too bad to show any information usefull for the establishment of relations of similarity with other sequences.

3) Having no results after BlastX and BlastP among the 'nr' database , we decide to explore the 'env' database and find both the query( 100% identity) and his homologies in order to establish the organism and paternal relations.

The results confirm that the query is indeed classified in the 'env' database. It returns 60 hits and some pretty good E-Values showing similarity with other entries in this database. Thought we can't use the matching Hits for the Multiple Alignements because the hits represent nucleic sequences and it's not in any interest for the alignment. We should translate every Hit in order to obtain amino acid sequences and submit it to multiple alignment.

Even if the results showed good E-value's and scores we should remain sceptic about the similarity between the hits and the query because the TblastX doesn't pay attention to ' stop codons' and interpret them like any other codon. So finally in the Hits sequences we may observe that there is a lot of stop codons meaning no complete or no coding sequences .

Finally , the TblastX showed pretty confusing and leaving no significant and clear similarity or homology to start a multiple alignement even if we had translated the nucleic sequences of the Hits.

RESULTATS BRUTS :

1.  

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ABL97489.1|  putative acyl-CoA dehydrogenase [uncultured ma...  33.1    9.4  

Alignements

>gb|ABL97489.1|  putative acyl-CoA dehydrogenase [uncultured marine bacterium 
HF130_81H07]
Length=414

 Score = 33.1 bits (74),  Expect = 9.4, Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query  54  NSIDEVLKEYPNAIVTSFVKASEMRD--------KTNERIYKVDKPKVVTEKNYF  100
           N ++E  KEY  A++TS  K  EM D        K+ + + + +  K++ EK YF
Sbjct  14  NEVEEFCKEYSGAVITSNDKKFEMHDALSGNSSRKSGKSVGRSEWQKLLIEKGYF  68


2. 

Sequences producing significant alignments:                       (Bits)  Value

gb|EDL98969.1|  rCG22520 [Rattus norvegicus]                       37.7    1.6  
ref|XP_001493214.1|  PREDICTED: similar to transmembrane prote...  37.0    2.7   UniGene infoGene info
gb|EAW71787.1|  transmembrane protein induced by tumor necrosi...  37.0    2.7   Gene info
gb|EAW71786.1|  transmembrane protein induced by tumor necrosi...  37.0    2.7   Gene info
gb|EAW71781.1|  transmembrane protein induced by tumor necrosi...  37.0    2.7   Gene info
gb|EAW71788.1|  transmembrane protein induced by tumor necrosi...  37.0    2.7   Gene info
ref|XP_001109513.1|  PREDICTED: similar to transmembrane prote...  37.0    2.7   UniGene infoGene info
gb|AAH51850.1|  Transmembrane protein 120A [Homo sapiens]          37.0    2.7   Gene info
gb|AAH29487.1|  TMEM120A protein [Homo sapiens] >gb|ABM81928.1...  37.0    2.7   Gene info
ref|NP_001073068.1|  transmembrane protein 120A [Bos taurus] >...  37.0    2.7   UniGene infoGene info
ref|XP_536847.2|  PREDICTED: similar to transmembrane protein ...  37.0    2.7   UniGene infoGene info
ref|NP_114131.1|  transmembrane protein 120A [Homo sapiens] >s...  37.0    2.7   UniGene infoGene info
ref|NP_001076452.1|  transmembrane protein 120A [Danio rerio] ...  36.6    3.5   UniGene infoGene info
ref|ZP_05108052.1|  diphosphomevalonate decarboxylase [Polarib...  36.6    3.5  
emb|CAG00899.1|  unnamed protein product [Tetraodon nigroviridis]  36.2    4.5  
ref|XP_729658.1|  hypothetical protein [Plasmodium yoelii yoel...  36.2    4.5   Gene info
ref|XP_002193261.1|  PREDICTED: transmembrane protein 120A [Ta...  35.8    5.9   UniGene infoGene info
gb|EDM13359.1|  similar to transmembrane protein induced by tu...  35.8    5.9   Gene info
gb|EDL19355.1|  RIKEN cDNA 2010310D06, isoform CRA_a [Mus musc...  35.8    5.9   Gene info
ref|YP_802447.1|  putative ribosomal protein S1 [Candidatus Ca...  35.8    5.9   Gene info
ref|NP_766129.1|  transmembrane protein 120A [Mus musculus] >s...  35.8    5.9   UniGene infoGene info
ref|XP_001016132.1|  hypothetical protein TTHERM_00816250 [Tet...  35.8    5.9   Gene info
ref|NP_001010945.1|  transmembrane protein induced by tumor ne...  35.8    5.9   UniGene infoGene info
sp|P35010.1|ATPD_GALSU  RecName: Full=ATP synthase subunit del...  35.8    5.9  
ref|ZP_05440343.1|  type I restriction-modification system R s...  33.5    7.0  
ref|NP_001107682.1|  hypothetical protein LOC548366 [Xenopus (...  35.4    7.7   UniGene infoGene info
gb|AAH89189.1|  LOC548366 protein [Xenopus tropicalis]             35.4    7.7   Gene info
ref|NP_942459.1|  hypothetical protein slr6016 [Synechocystis ...  35.4    7.7   Gene info


ALIGNEMENTS


>gb|EDL98969.1|  rCG22520 [Rattus norvegicus]
Length=1047

 Score = 37.7 bits (86),  Expect = 1.6
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 8/84 (9%)
 Frame = +3

Query  570  TQTKETTLDRIVKN-----DVIYDVESANFVDFIKNDGSLMYSYNSID---EVLKEYPNA  725
            T T+ET LD  V++     D + D ++A     +KN  S+ + YN  +   +  KE  + 
Sbjct  319  TDTEETELDSNVESSSSSLDKVKDTDTAMLKSLLKNIFSIFFKYNQSEKRQQPEKESESL  378

Query  726  IVTSFVKASEMRDKTNERIYKVDK  797
            I  S    +E  +KT E   KVDK
Sbjct  379  IKHSSSSVTEHLEKTQENFNKVDK  402


>ref|XP_001493214.1| UniGene infoGene info PREDICTED: similar to transmembrane protein 120A [Equus caballus]
Length=329

 GENE ID: 100061105 LOC100061105 | hypothetical protein LOC100061105
[Equus caballus]

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  101  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDATFNFLLVWY  157


>gb|EAW71787.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_f [Homo sapiens]
Length=266

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>gb|EAW71786.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_e [Homo sapiens]
Length=296

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>gb|EAW71781.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_a [Homo sapiens]
 gb|EAW71784.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_a [Homo sapiens]
Length=322

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>gb|EAW71788.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_g [Homo sapiens]
Length=369

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|XP_001109513.1| UniGene infoGene info PREDICTED: similar to transmembrane protein induced by tumor 
necrosis factor alpha [Macaca mulatta]
Length=343

 GENE ID: 715846 LOC715846 | similar to transmembrane protein induced by tumor
necrosis factor alpha [Macaca mulatta]

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDATFNFLLVWY  171


>gb|AAH51850.1| Gene info Transmembrane protein 120A [Homo sapiens]
Length=343

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>gb|AAH29487.1| Gene info TMEM120A protein [Homo sapiens]
 gb|ABM81928.1| Gene info transmembrane protein induced by tumor necrosis factor alpha 
[synthetic construct]
 gb|ABM85106.1| Gene info transmembrane protein induced by tumor necrosis factor alpha 
[synthetic construct]
Length=322

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|NP_001073068.1| UniGene infoGene info transmembrane protein 120A [Bos taurus]
 sp|Q05B45.1|T120A_BOVIN Gene info RecName: Full=Transmembrane protein 120A
 gb|AAI22850.1| Gene info Transmembrane protein 120A [Bos taurus]
Length=343

 GENE ID: 520173 TMEM120A | transmembrane protein 120A [Bos taurus]

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|XP_536847.2| UniGene infoGene info PREDICTED: similar to transmembrane protein induced by tumor 
necrosis factor alpha [Canis familiaris]
Length=414

 GENE ID: 479721 TMEM120A | transmembrane protein 120A [Canis lupus familiaris]

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  186  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  242


>ref|NP_114131.1| UniGene infoGene info transmembrane protein 120A [Homo sapiens]
 sp|Q9BXJ8.1|T120A_HUMAN Gene info RecName: Full=Transmembrane protein 120A; AltName: Full=Transmembrane 
protein induced by tumor necrosis factor alpha
 gb|AAK16442.1|AF327923_1 Gene info transmembrane protein induced by tumor necrosis factor alpha 
[Homo sapiens]
 gb|EAW71783.1| Gene info transmembrane protein induced by tumor necrosis factor alpha, 
isoform CRA_c [Homo sapiens]
Length=343

 GENE ID: 83862 TMEM120A | transmembrane protein 120A [Homo sapiens]
(10 or fewer PubMed links)

 Score = 37.0 bits (84),  Expect = 2.7
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L LISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|NP_001076452.1| UniGene infoGene info transmembrane protein 120A [Danio rerio]
 sp|A3KNK1.1|T120A_DANRE Gene info RecName: Full=Transmembrane protein 120A
 gb|AAI33885.1| Gene info Zgc:162139 protein [Danio rerio]
Length=341

 GENE ID: 100005623 zgc:162139 | zgc:162139 [Danio rerio]
(10 or fewer PubMed links)

 Score = 36.6 bits (83),  Expect = 3.5
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L   SF C F  +Y ++   F FL++ Y
Sbjct  114  NVNVTLLNKQSKFAYKDEYEKFKLYLTVLLLFFSFTCRFLVSYRVVDALFNFLLVWY  170


>ref|ZP_05108052.1|  diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
 gb|EAQ40635.1| Gene info diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
Length=359

 Score = 36.6 bits (83),  Expect = 3.5
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +2

Query  86   NKLREILRLEKDQIKKIKNTYTYDYFTEKDKHEKFYNVVSENRKRFLKYCSYI*NY  253
            N    I  +E ++I+K     T+D F E  K E+F   ++E  KR   YC YI NY
Sbjct  52   NNCHTITTIEFEKIEKTTEV-TFDLFFEGKKKEEFKPKIAEFFKRIQDYCPYIFNY  106


>emb|CAG00899.1|  unnamed protein product [Tetraodon nigroviridis]
Length=346

 Score = 36.2 bits (82),  Expect = 4.5
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++     L ++SF C F ++Y  L   F FL++ Y
Sbjct  119  NVNVTLLNKQAKFAYKDEYEKFKLVVTVILFIVSFTCRFLFSYRALDALFNFLLVWY  175


>ref|XP_729658.1| Gene info hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
 gb|EAA21223.1| Gene info hypothetical protein [Plasmodium yoelii yoelii]
Length=1381

 GENE ID: 3806960 PY00026 | hypothetical protein
[Plasmodium yoelii yoelii str. 17XNL] (10 or fewer PubMed links)

 Score = 36.2 bits (82),  Expect = 4.5
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query  624  DVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDKPK  803
            +++++NF+   K     + +++ I + +  Y N I T+  K +   D+  E I+ +DK  
Sbjct  384  NLKNSNFLQIFKETIKFLSTFD-ISQNMMTYNNGIYTTLKKNNNNSDEIQENIFLIDKIY  442

Query  804  VVTEKNYFYHLEVLPPSK  857
             + + NY+   E++  SK
Sbjct  443  DIFQDNYYSFYELIYESK  460


>ref|XP_002193261.1| UniGene infoGene info PREDICTED: transmembrane protein 120A [Taeniopygia guttata]
Length=341

 GENE ID: 100228073 LOC100228073 | transmembrane protein 120A
[Taeniopygia guttata]

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L ++SF C F  N  +    F FL++ Y
Sbjct  113  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILLIVSFSCRFLLNSRVTDAVFNFLLVWY  169


>gb|EDM13359.1| Gene info similar to transmembrane protein induced by tumor necrosis factor 
alpha, isoform CRA_c [Rattus norvegicus]
Length=188

 GENE ID: 288591 Tmem120a | transmembrane protein 120A [Rattus norvegicus]
(10 or fewer PubMed links)

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L +ISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWY  171


>gb|EDL19355.1| Gene info RIKEN cDNA 2010310D06, isoform CRA_a [Mus musculus]
Length=235

 GENE ID: 215210 Tmem120a | transmembrane protein 120A [Mus musculus]
(Over 10 PubMed links)

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L +ISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|YP_802447.1| Gene info putative ribosomal protein S1 [Candidatus Carsonella ruddii PV]
 dbj|BAF35081.1| Gene info putative ribosomal protein S1 [Candidatus Carsonella ruddii PV]
Length=368

 GENE ID: 4414864 CRP_050 | putative ribosomal protein S1
[Candidatus Carsonella ruddii PV] (10 or fewer PubMed links)

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 0/51 (0%)
 Frame = +2

Query  89   KLREILRLEKDQIKKIKNTYTYDYFTEKDKHEKFYNVVSENRKRFLKYCSY  241
            K ++ +  + ++I KIK    Y YF  K  +  FY ++  N+K ++KY ++
Sbjct  289  KNKKFISNKNNRITKIKKNEFYKYFISKIINNDFYKIIYINKKNYIKYGNF  339


>ref|NP_766129.1| UniGene infoGene info transmembrane protein 120A [Mus musculus]
 sp|Q8C1E7.1|T120A_MOUSE Gene info RecName: Full=Transmembrane protein 120A; AltName: Full=Transmembrane 
protein induced by tumor necrosis factor alpha
 dbj|BAC25759.1| Gene info unnamed protein product [Mus musculus]
 gb|AAH46757.1| Gene info Transmembrane protein 120A [Mus musculus]
 gb|EDL19356.1| Gene info RIKEN cDNA 2010310D06, isoform CRA_b [Mus musculus]
Length=343

 GENE ID: 215210 Tmem120a | transmembrane protein 120A [Mus musculus]
(Over 10 PubMed links)

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L +ISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWY  171


>ref|XP_001016132.1| Gene info hypothetical protein TTHERM_00816250 [Tetrahymena thermophila]
 gb|EAR95887.1| Gene info hypothetical protein TTHERM_00816250 [Tetrahymena thermophila 
SB210]
Length=460

 GENE ID: 7825342 TTHERM_00816250 | hypothetical protein
[Tetrahymena thermophila]

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)
 Frame = +3

Query  600  IVKNDVIYDVESANFVDFIKNDGSLMYSYNSI----DEVLKEYPNAIVTSFVKASEMRDK  767
            I++N + Y       +D IK     +++ N I    D+VL    N  + SF K  E+ D+
Sbjct  173  IIQNQLNYQQNKNELIDLIKKANYYVFNINKIENMKDQVLSIINNLDIISFSKNDEIFDQ  232

Query  768  TNERIYKVDK  797
             NE++   DK
Sbjct  233  PNEKLKAGDK  242


>ref|NP_001010945.1| UniGene infoGene info transmembrane protein induced by tumor necrosis factor alpha 
[Rattus norvegicus]
 sp|Q5HZE2.1|T120A_RAT Gene info RecName: Full=Transmembrane protein 120A; AltName: Full=Transmembrane 
protein induced by tumor necrosis factor alpha
 gb|AAH89063.1| Gene info Transmembrane protein 120A [Rattus norvegicus]
 gb|EDM13358.1| Gene info similar to transmembrane protein induced by tumor necrosis factor 
alpha, isoform CRA_b [Rattus norvegicus]
Length=343

 GENE ID: 288591 Tmem120a | transmembrane protein 120A [Rattus norvegicus]
(10 or fewer PubMed links)

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L +ISF C F  N  +    F FL++ Y
Sbjct  115  NVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWY  171


>sp|P35010.1|ATPD_GALSU  RecName: Full=ATP synthase subunit delta, chloroplastic; AltName: 
Full=ATP synthase F(1) sector subunit delta; AltName: Full=F-type 
ATPase subunit delta
 pir||S39519  H+-transporting two-sector ATPase (EC 3.6.3.14) delta chain - 
red alga (Cyanidium caldarium) chloroplast
 emb|CAA48024.1|  H(+)-transporting ATP synthase [Galdieria sulphuraria]
Length=177

 Score = 35.8 bits (81),  Expect = 5.9
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 8/119 (6%)
 Frame = +3

Query  531  IIKESTIFFF-----LMTTQTKETTLDRIVKNDVIYDVESANFVDFIKNDGSLMYSYNSI  695
            ++K+   F++     L++ Q K+ T+  +  N++  D  + NF+  +     ++Y Y+ +
Sbjct  38   VLKQMPEFYYFLVNPLISQQIKKNTIKIVFNNNL--DKITLNFLLILIERRRIIYFYDIV  95

Query  696  DEVLKEYPNAIVTSFVKASEMRDKT-NERIYKVDKPKVVTEKNYFYHLEVLPPSKWEGI  869
            D+ +  +  A  TS V+ + +   T  ++ Y ++K K +T+ NY      + PS   G+
Sbjct  96   DQFILIWNKATNTSVVEIASVISLTEKQQQYLINKLKEITKANYIKLKLKIDPSLIGGL  154


>ref|ZP_05440343.1|  type I restriction-modification system R subunit (endonuclease) 
[Fusobacterium sp. D11]
Length=1127

 Score = 33.5 bits (75),  Expect(2) = 7.0
 Identities = 18/85 (21%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +3

Query  564  MTTQTKETTLDRIVKNDVIYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFV  743
            ++ +T+ + + +    D++ ++E  +  + IKN  SL +S     E+ K++ N ++ + +
Sbjct  798  ISVKTRISYVKKYKNIDILKNLEEKDVDEIIKNLSSLPFSVEEKTEMEKKFENLVLKTQL  857

Query  744  KASEMRDKTNERIYKVDKPKVVTEK  818
            K  + +   NE+   +D  K +++K
Sbjct  858  KLFDNKKTENEKTEILDISKELSKK  882


 Score = 20.8 bits (42),  Expect(2) = 7.0
 Identities = 8/16 (50%), Positives = 11/16 (68%), Gaps = 0/16 (0%)
 Frame = +2

Query  398  SYTKGFENLINSYYEI  445
            +Y K +ENLIN  Y +
Sbjct  774  NYKKLWENLINEVYNL  789


>ref|NP_001107682.1| UniGene infoGene info hypothetical protein LOC548366 [Xenopus (Silurana) tropicalis]
 sp|Q5FWV6.2|T120A_XENTR Gene info RecName: Full=Transmembrane protein 120A
 gb|AAI53699.1| Gene info Tmem120a protein [Xenopus tropicalis]
Length=336

 GENE ID: 548366 tmem120a | hypothetical LOC548366
[Xenopus (Silurana) tropicalis] (10 or fewer PubMed links)

 Score = 35.4 bits (80),  Expect = 7.7
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L ++SF C F  N  +    F FL++ Y
Sbjct  114  NVNVTLLSKQSKFAYKDEYEKFKLYLTMILMVLSFICRFVLNSRVTDAVFNFLLVWY  170


>gb|AAH89189.1| Gene info LOC548366 protein [Xenopus tropicalis]
Length=332

 GENE ID: 548366 tmem120a | hypothetical LOC548366
[Xenopus (Silurana) tropicalis] (10 or fewer PubMed links)

 Score = 35.4 bits (80),  Expect = 7.7
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 0/57 (0%)
 Frame = -2

Query  362  NFNVCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHY  192
            N NV L  KQ K   K   +K ++Y    L ++SF C F  N  +    F FL++ Y
Sbjct  110  NVNVTLLSKQSKFAYKDEYEKFKLYLTMILMVLSFICRFVLNSRVTDAVFNFLLVWY  166


>ref|NP_942459.1| Gene info hypothetical protein slr6016 [Synechocystis sp. PCC 6803]
 ref|NP_942518.1| Gene info hypothetical protein slr6075 [Synechocystis sp. PCC 6803]
 dbj|BAD02073.1| Gene info slr6016 [Synechocystis sp. PCC 6803]
 dbj|BAD02132.1| Gene info slr6075 [Synechocystis sp. PCC 6803]
Length=800

 GENE ID: 2656220 slr6016 | slr6016 [Synechocystis sp. PCC 6803]
(10 or fewer PubMed links)

 Score = 35.4 bits (80),  Expect = 7.7
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +3

Query  576  TKETTLDRIVKNDVIYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVK  746
            +K   L   +K   I  +  +N++ F+KND     S NS +E++ E  N I++S +K
Sbjct  514  SKNIKLRTDLKLSKIQSIVRSNYLSFLKNDALQHVSTNSSNEIVSEITNKIISSEIK  570


3)  

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value   N

gb|AACY024015330.1|  Marine metagenome 1096626247929, whole ge...   335    8e-174  1
gb|AACY021585665.1|  Marine metagenome 1095403672263, whole ge...   148    2e-33   1
gb|ABLZ01021387.1|  Marine metagenome 35901259, whole genome s...  76.2    7e-12   1
gb|AACY021641759.1|  Marine metagenome 1092963184137, whole ge...  45.1    2e-08   1
gb|AACY022812614.1|  Marine metagenome ctg_1101667219965, whol...  54.7    2e-05   1
gb|AACY023501208.1|  Marine metagenome ctg_1101668308559, whol...  52.8    8e-05   1
gb|AACY021339034.1|  Marine metagenome 1095454123292, whole ge...  51.5    2e-04   1
gb|AAUQ01103827.1|  Epibiont metagenome ALV_LSA_193_C21.y01, w...  41.8    0.16    1
gb|AACY023317216.1|  Marine metagenome ctg_1101668124567, whol...  41.8    0.16    1
gb|AACY021170728.1|  Marine metagenome 1090115, whole genome s...  41.4    0.22    1
gb|AACY020606950.1|  Marine metagenome 1504068, whole genome s...  40.5    0.42    1
gb|AACY020512011.1|  Marine metagenome 1096626680869, whole ge...  40.0    0.58    1
gb|AACY020274809.1|  Marine metagenome 1096626774938, whole ge...  33.6    0.96    1
gb|AACY020117089.1|  Marine metagenome 1096626136086, whole ge...  39.1    1.1     1
gb|AACY021387769.1|  Marine metagenome 1095403632936, whole ge...  33.6    1.9     1
gb|AAUQ01084005.1|  Epibiont metagenome ALV_LSA_114_P17.x01, w...  38.2    2.1     1
gb|AACY020055141.1|  Marine metagenome 1096626062042, whole ge...  38.2    2.1     1
gb|AACY020152277.1|  Marine metagenome 1096626815385, whole ge...  38.2    2.1     1
gb|AACY022963343.1|  Marine metagenome ctg_1101667370694, whol...  32.7    2.2     1
gb|AACY022673193.1|  Marine metagenome ctg_1101667080544, whol...  29.9    2.8     1
gb|AACY020235835.1|  Marine metagenome 1096626271730, whole ge...  37.7    2.9     1
gb|AACY023117858.1|  Marine metagenome ctg_1101667525209, whol...  37.7    2.9     1
gb|AATO01003273.1|  Metagenome sequence ctg11226, whole genome...  37.7    2.9     1
gb|AACY020491677.1|  Marine metagenome 1096626654898, whole ge...  37.3    3.9     1
gb|AACY024053574.1|  Marine metagenome 1096626427323, whole ge...  37.3    3.9     1
gb|AAFX01000142.1|  Metagenome sequence XZS50392.x1, whole gen...  37.3    3.9     1
gb|AACY020361888.1|  Marine metagenome 1096626448504, whole ge...  30.4    4.3     1
gb|AACY021380844.1|  Marine metagenome 1093010131612, whole ge...  30.9    4.4     1
gb|AACY023757639.1|  Marine metagenome ctg_1101668564990, whol...  33.1    4.7     1
gb|AACY021580813.1|  Marine metagenome 1095900171261, whole ge...  30.9    5.0     1
gb|AACY020067571.1|  Marine metagenome 1096626076952, whole ge...  36.8    5.4     1
gb|AACY020222464.1|  Marine metagenome 1096626766721, whole ge...  36.8    5.4     1
gb|AACY020501038.1|  Marine metagenome 1096626665338, whole ge...  36.8    5.4     1
gb|AACY020917846.1|  Marine metagenome 2044684, whole genome s...  36.8    5.4     1
gb|AACY021224217.1|  Marine metagenome 1093015601443, whole ge...  36.8    5.4     1
gb|AACY021477871.1|  Marine metagenome 2151054, whole genome s...  36.8    5.4     1
gb|AACY021602597.1|  Marine metagenome 1092963175926, whole ge...  36.8    5.4     1
gb|AACY021992406.1|  Marine metagenome 1092344281921, whole ge...  36.8    5.4     1
gb|AACY023599376.1|  Marine metagenome ctg_1101668406727, whol...  36.8    5.4     1
gb|AACY023740582.1|  Marine metagenome ctg_1101668547933, whol...  36.8    5.4     1
gb|AAQL01000747.1|  Metagenome sequence s8_159088, whole genom...  36.8    5.4     1
gb|AACY020704604.1|  Marine metagenome 1092963015084, whole ge...  30.4    5.7     1
gb|AAUQ01115046.1|  Epibiont metagenome ALV_LSB_011_B08.y01, w...  29.5    6.2     1
gb|AACY024065144.1|  Marine metagenome 1096626483896, whole ge...  30.4    6.7     1
gb|AACY023669546.1|  Marine metagenome ctg_1101668476897, whol...  32.7    6.8     1
gb|AACY022082885.1|  Marine metagenome 1091145313637, whole ge...  34.5    7.2     1
gb|ABDH01041033.1|  Termite gut metagenome tgut2b_Contig41724,...  36.3    7.4     1
gb|AACY020551522.1|  Marine metagenome 1096626840899, whole ge...  36.3    7.4     1
gb|AACY020980424.1|  Marine metagenome 2054719, whole genome s...  36.3    7.4     1
gb|AACY021972045.1|  Marine metagenome 1092256274953, whole ge...  36.3    7.4     1
gb|AACY022366934.1|  Marine metagenome 1920805, whole genome s...  36.3    7.4     1
gb|AACY023001088.1|  Marine metagenome ctg_1101667408439, whol...  36.3    7.4     1
gb|AACY023123346.1|  Marine metagenome ctg_1101667530697, whol...  36.3    7.4     1
gb|AATD01000504.1|  Mouse gut metagenome OB1_U_BO-aaa15d10.b1,...  36.3    7.4     1
gb|AACY023679118.1|  Marine metagenome ctg_1101668486469, whol...  30.4    8.1     1
gb|AACY021186113.1|  Marine metagenome 93617, whole genome sho...  33.6    8.3     1
gb|AACY023297295.1|  Marine metagenome ctg_1101668104646, whol...  33.6    9.0     1
gb|AACY023059525.1|  Marine metagenome ctg_1101667466876, whol...  33.1    9.4     1
gb|AACY020267172.1|  Marine metagenome 1096626318567, whole ge...  33.1    9.4     1
gb|AACY022796170.1|  Marine metagenome ctg_1101667203521, whol...  25.4    9.9     1

ALIGNEMENTS

>gb|AACY024015330.1|  Marine metagenome 1096626247929, whole genome shotgun sequence
Length=897

 Score =  335 bits (725),  Expect = 8e-174
 Identities = 142/144 (98%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +3/+1

Query  438  MRLEGKKC*FLRFFSCY*NNILVLIYMEK*IIIKESTIFFFLMTTQTKETTLDRIVKNDV  617
            MRLEGKKC*FLRFFSCY*NNILVLIYMEK*IIIKE+TIFFFLMTTQTKETTLDRIVKNDV
Sbjct  466  MRLEGKKC*FLRFFSCY*NNILVLIYMEK*IIIKENTIFFFLMTTQTKETTLDRIVKNDV  645

Query  618  IYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDK  797
            IYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDK
Sbjct  646  IYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDK  825

Query  798  PKVVTEKNYFYHLEVLPPSKWEGI  869
            PKVVTEK YFYHLEVLPPSKWEGI
Sbjct  826  PKVVTEKTYFYHLEVLPPSKWEGI  897


 Score =  301 bits (651),  Expect = 8e-174
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +2/+3

Query  2    DFDDDIEKDLeriekakkrieenkiLKTNKLREILRLEKDQIKKIKNTYTYDYFTEKDKH  181
            DFDDDIEKDLERIEKAKKRIEENKILKTNKLREILRLEKDQIKKIKNTYTYDYFTEKDKH
Sbjct  30   DFDDDIEKDLERIEKAKKRIEENKILKTNKLREILRLEKDQIKKIKNTYTYDYFTEKDKH  209

Query  182  EKFYNVVSENRKRFLKYCSYI*NYTRN*LIKG*ILYRF*LFYCAILE*F*IV*GTNTR*N  361
            EKFYNVVSENRKRFLKYCSYI*NYTRN*LIKG*ILYRF*LFYCAILE*F*IV*GTNTR*N
Sbjct  210  EKFYNVVSENRKRFLKYCSYI*NYTRN*LIKG*ILYRF*LFYCAILE*F*IV*GTNTR*N  389

Query  362  FKIIGFLLMRLSSYTKGFENLINSYYEIRG  451
            FKIIGFLLMRLSSYTK FENLINSYYEIRG
Sbjct  390  FKIIGFLLMRLSSYTKVFENLINSYYEIRG  479


 Score =  522 bits (1134),  Expect = 3e-146
 Identities = 235/241 (97%), Positives = 238/241 (98%), Gaps = 0/241 (0%)
 Frame = -2/-1

Query  869  YTFPFTRW*YFQMVKIIFLCNYFRFIHFVNSFICLISHF*SFNK*SYYCVWVff*nlinr  690
            YTFPFTRW*YFQMVKI FLCNYFRFI+FV+SFICLISHF*SFNK*SYYCVWVFF*NLINR
Sbjct  897  YTFPFTRW*YFQMVKISFLCNYFRFIYFVDSFICLISHF*SFNK*SYYCVWVFF*NLINR  718

Query  689  iirIHKRTIIFNKINKVC*LYIIDNIIFYNAV*CCFFGLGGHKKKEYSTLFNYNLFFHIN  510
            IIRIHKRTIIFNK+NKVC*LYIIDNIIFYNAV*CCFFGLGGHKKKEYS LFNYNLFFHIN
Sbjct  717  IIRIHKRTIIFNKVNKVC*LYIIDNIIFYNAV*CCFFGLGGHKKKEYSILFNYNLFFHIN  538

Query  509  QY*NIILITTKKP*KLALFTL*SHNKN**DSQIP*YN*IIS*VRIL*F*NFNVCLYLKQF  330
            QY*NIILITTKKP*KLALFTL*SHNKN**DSQIP*YN*IIS*VRIL*F*NFNVCLYLKQF
Sbjct  537  QY*NIILITTKKP*KLALFTL*SHNKN**DSQIP*YN*IIS*VRIL*F*NFNVCLYLKQF  358

Query  329  KIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ*NNHR  150
            KIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHYRI HVYLFQ*NNHR
Sbjct  357  KIILK*HNKKARIYRESSL*LISFWCSFKYNYNILKIFFYFLILHYRISHVYLFQ*NNHR  178

Query  149  C  147
            C
Sbjct  177  C  175


 Score =  281 bits (607),  Expect = 3e-125
 Identities = 123/126 (97%), Positives = 123/126 (97%), Gaps = 0/126 (0%)
 Frame = +2/+3

Query  491  E*YFSIDLYGKINYN*REYYILFSYDHPNQRNNTRPHCKK*CYL*CRVSKLC*FY*K*WF  670
            E*YFSIDLYGKINYN*REYYILFSYDHPNQRNNTRPHCKK*CYL*CRVSKLC* Y*K*WF
Sbjct  519  E*YFSIDLYGKINYN*REYYILFSYDHPNQRNNTRPHCKK*CYL*CRVSKLC*LY*K*WF  698

Query  671  AYVFL*FY**GFKRIPKRNSNFIC*SFRNER*DK*KNLQSG*T*SSYREKLFLPSGSITT  850
            AYVFL*FY**GFKRIPKRNSNFIC*SFRNER*DK*KNLQS *T*SSYRE LFLPSGSITT
Sbjct  699  AYVFL*FY**GFKRIPKRNSNFIC*SFRNER*DK*KNLQSR*T*SSYRENLFLPSGSITT  878

Query  851  **MGRY  868
            **MGRY
Sbjct  879  **MGRY  896


 Score =  168 bits (361),  Expect = 3e-125
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1/+2

Query  253  HQKLIN*RLDSL*ILAFLLCYFRMILNCLRYKHTLKF*NYRILTYEII*LY*GI*ESY*F  432
            HQKLIN*RLDSL*ILAFLLCYFRMILNCLRYKHTLKF*NYRILTYEII*LY*GI*ESY*F
Sbjct  281  HQKLIN*RLDSL*ILAFLLCYFRMILNCLRYKHTLKF*NYRILTYEII*LY*GI*ESY*F  460

Query  433  LL*D*RVKSANF*GFLVV  486
            LL*D*RVKSANF*GFLVV
Sbjct  461  LL*D*RVKSANF*GFLVV  514


 Score = 44.6 bits (91),  Expect = 3e-125
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +1/+2

Query  142  YLHL*LFY*KR*T*KIL*CSIR  207
            YLHL*LFY*KR*T*+IL*CSIR
Sbjct  170  YLHL*LFY*KR*T*EIL*CSIR  235


 Score =  358 bits (777),  Expect = 4e-113
 Identities = 185/187 (98%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = -1/-3

Query  702  PHQ*NYKNT*ANHHF**NQQSlltlhhr*hhfLQCGLVLFLWFGWS*EKRI*YSL*L*FI  523
            PHQ*NYKNT*ANHHF**+QQSLLTLHHR*HHFLQCGLVLFLWFGWS*EKRI*YSL*L*FI
Sbjct  730  PHQ*NYKNT*ANHHF**SQQSLLTLHHR*HHFLQCGLVLFLWFGWS*EKRI*YSL*L*FI  551

Query  522  FPYKSILKYYSNNN*KTLKISTFYPLIS**ELIRFSNPLV*LDNLISKNPIILKF*RVFV  343
            FPYKSILKYYSNNN*KTLKISTFYPLIS**ELIRFSN LV*LDNLISKNPIILKF*RVFV
Sbjct  550  FPYKSILKYYSNNN*KTLKISTFYPLIS**ELIRFSNTLV*LDNLISKNPIILKF*RVFV  371

Query  342  P*TI*NHSKIAQ*KS*NL*RI*PLIN*FLV*FQI*LQYFKNLFLFSDTTL*NFSCLSFSV  163
            P*TI*NHSKIAQ*KS*NL*RI*PLIN*FLV*FQI*LQYFKNLFLFSDTTL*NFSCLSFSV
Sbjct  370  P*TI*NHSKIAQ*KS*NL*RI*PLIN*FLV*FQI*LQYFKNLFLFSDTTL*NFSCLSFSV  191

Query  162  K*S*V*V  142
            K*S*V*V
Sbjct  190  K*S*V*V  170


 Score = 75.3 bits (158),  Expect = 4e-113
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1/-3

Query  867  YLPIY*VVILPDGKNNFSL*LL*VYPLCKFFHLSY  763
            YLPIY*VVILPDGKN FSL*LL*VY LC+FFHLSY
Sbjct  895  YLPIY*VVILPDGKNKFSL*LL*VYLLCRFFHLSY  791


 Score =  197 bits (424),  Expect = 9e-93
 Identities = 91/92 (98%), Positives = 91/92 (98%), Gaps = 0/92 (0%)
 Frame = -3/-2

Query  508  NTKILF**QLKNLKN*HFLPSNLIIRINKILKSLSITR*SHK*ESYNFKILTCVCTLNNL  329
            NTKILF**QLKNLKN*HFLPSNLIIRINKILK LSITR*SHK*ESYNFKILTCVCTLNNL
Sbjct  536  NTKILF**QLKNLKN*HFLPSNLIIRINKILKYLSITR*SHK*ESYNFKILTCVCTLNNL  357

Query  328  KSF*NSTIKKLESIENLAFN*LVSGVVSNITT  233
            KSF*NSTIKKLESIENLAFN*LVSGVVSNITT
Sbjct  356  KSF*NSTIKKLESIENLAFN*LVSGVVSNITT  261


 Score =  148 bits (318),  Expect = 9e-93
 Identities = 67/67 (100%), Positives = 67/67 (100%), Gaps = 0/67 (0%)
 Frame = -3/-2

Query  751  EALTNEVTIAFGYSFKTSSIEL*EYISEPSFLIKSTKFADSTS*ITSFFTMRSSVVSLVW  572
            EALTNEVTIAFGYSFKTSSIEL*EYISEPSFLIKSTKFADSTS*ITSFFTMRSSVVSLVW
Sbjct  779  EALTNEVTIAFGYSFKTSSIEL*EYISEPSFLIKSTKFADSTS*ITSFFTMRSSVVSLVW  600

Query  571  VVIRKKN  551
            VVIRKKN
Sbjct  599  VVIRKKN  579


 Score = 39.6 bits (80),  Expect = 9e-93
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3/-2

Query  868  IPSHLLGGNTSRW*K  824
            IPSHLLGGNTSRW*K
Sbjct  896  IPSHLLGGNTSRW*K  852


 Score =  133 bits (285),  Expect = 3e-67
 Identities = 59/60 (98%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +3/+1

Query  177  NMKNSIM*YQKIEKDF*NIVVIFETTPETN*LKARFSIDSSFFIVLF*NDFKLFKVQTHV  356
            NM+NSIM*YQKIEKDF*NIVVIFETTPETN*LKARFSIDSSFFIVLF*NDFKLFKVQTHV
Sbjct  205  NMRNSIM*YQKIEKDF*NIVVIFETTPETN*LKARFSIDSSFFIVLF*NDFKLFKVQTHV  384


 Score = 79.0 bits (166),  Expect = 3e-67
 Identities = 34/37 (91%), Positives = 35/37 (94%), Gaps = 0/37 (0%)
 Frame = +1/+2

Query  757  *EIRQMKEFTKWINLK*LQRKIIFTIWKYYHLVNGKV  867
            *EIRQMKE TK INLK*LQRK+IFTIWKYYHLVNGKV
Sbjct  785  *EIRQMKESTK*INLK*LQRKLIFTIWKYYHLVNGKV  895


 Score = 67.0 bits (140),  Expect = 3e-67
 Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +1/+2

Query  517  WKNKL*LKRVLYSFFL*PPKPKKQH*TA  600
            WKNKL*LKR+LYSFFL*PPKPKKQH*TA
Sbjct  545  WKNKL*LKRILYSFFL*PPKPKKQH*TA  628


 Score = 43.7 bits (89),  Expect = 3e-67
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +1/+2

Query  658  KMMVRLCILIILLMRF*KN  714
            KMMVRLCILIILLMRF*KN
Sbjct  686  KMMVRLCILIILLMRF*KN  742


>gb|AACY021585665.1|  Marine metagenome 1095403672263, whole genome shotgun sequence
Length=727

 Score =  148 bits (317),  Expect = 2e-33
 Identities = 66/77 (85%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3/-1

Query  478  KNLKN*HFLPSNLIIRINKILKSLSITR*SHK*ESYNFKILTCVCTLNNLKSF*NSTIKK  299
            KNLKN +FLPSNLI+R NKILKSLSITR*SHK*ESYNFKILTC+CTLNNLK+ *NST+KK
Sbjct  727  KNLKNRYFLPSNLILRFNKILKSLSITR*SHK*ESYNFKILTCICTLNNLKTL*NSTLKK  548

Query  298  LESIENLAFN*LVSGVV  248
            LES ENLAFN*LV  VV
Sbjct  547  LESKENLAFN*LVPDVV  497


 Score =  140 bits (301),  Expect = 3e-31
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1/+1

Query  253  HQKLIN*RLDSL*ILAFLLCYFRMILNCLRYKHTLKF*NYRILTYEII*LY*GI*ESY*F  432
            HQ+LIN*RLDSL*ILAFL+CYFR  LNCLRYK+TLKF*NYRILTYEII*LY*GI*ESY* 
Sbjct  502  HQELIN*RLDSL*ILAFLVCYFRAFLNCLRYKYTLKF*NYRILTYEII*LY*GI*ESY*I  681

Query  433  LL*D*RVKSANF*GF  477
            L *D*RVKS  F*GF
Sbjct  682  LR*D*RVKSIYF*GF  726


 Score =  138 bits (295),  Expect = 2e-30
 Identities = 69/77 (89%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1/-2

Query  477  KTLKISTFYPLIS**ELIRFSNPLV*LDNLISKNPIILKF*RVFVP*TI*NHSKIAQ*KS  298
            KTLKI TFYPLIS *+LIRFSNPLV*LDNLISKNPIILKF*RVFVP*TI*  SKIA *KS
Sbjct  726  KTLKIDTFYPLISS*DLIRFSNPLV*LDNLISKNPIILKF*RVFVP*TI*KRSKIAH*KS  547

Query  297  *NL*RI*PLIN*FLV*F  247
            *NL RI*PLIN*FL+*F
Sbjct  546  *NLKRI*PLIN*FLM*F  496


 Score =  127 bits (271),  Expect = 5e-29
 Identities = 61/68 (89%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2/+2

Query  248  NYTRN*LIKG*ILYRF*LFYCAILE*F*IV*GTNTR*NFKIIGFLLMRLSSYTKGFENLI  427
            NY RN*LIKG*IL+RF*LF CAILE F*IV*GTNTR*NFKIIGFLLMRLSSYTKGFENLI
Sbjct  497  NYIRN*LIKG*ILFRF*LF*CAILERF*IV*GTNTR*NFKIIGFLLMRLSSYTKGFENLI  676

Query  428  NSYYEIRG  451
             S  EIRG
Sbjct  677  KS*DEIRG  700


 Score = 25.8 bits (50),  Expect = 5e-29
 Identities = 11/13 (84%), Positives = 11/13 (84%), Gaps = 0/13 (0%)
 Frame = +3/+3

Query  438  MRLEGKKC*FLRF  476
            MRLEGKK  FLRF
Sbjct  687  MRLEGKKYLFLRF  725


 Score =  123 bits (264),  Expect = 3e-26
 Identities = 68/88 (77%), Positives = 70/88 (79%), Gaps = 0/88 (0%)
 Frame = -2/-3

Query  476  KP*KLALFTL*SHNKN**DSQIP*YN*IIS*VRIL*F*NFNVCLYLKQFKIILK*HNKKA  297
            KP*K  LFTL*SH K **DSQIP*YN*IIS*VRIL*F*NFNV LYLKQFK  LK*H KKA
Sbjct  725  KP*K*ILFTL*SHLKI**DSQIP*YN*IIS*VRIL*F*NFNVYLYLKQFKNALK*HTKKA  546

Query  296  RIYRESSL*LISFWCSFKYNYNILKIFF  213
            RI RESSL*LIS  CSF    +   +FF
Sbjct  545  RI*RESSL*LISS*CSFYCGTDSQFLFF  462


 Score = 63.8 bits (133),  Expect = 4e-08
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3/+3

Query  246  ETTPETN*LKARFSIDSSFFIVLF*NDFKLFKVQTHV  356
            +TT  TN*LKARFS+DSSFF VLF*+ FKLFKVQ HV
Sbjct  495  KTTSGTN*LKARFSLDSSFFSVLF*SVFKLFKVQIHV  605


>gb|ABLZ01021387.1|  Marine metagenome 35901259, whole genome shotgun sequence
Length=126

 Score = 76.2 bits (160),  Expect = 7e-12
 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3/-3

Query  457  FLPSNLIIRINKILKSLSITR*SHK*ESYNFKILTCVCTL  338
            FL SNL +R NKILKSL+IT *SHK*ESYNFKILTC+CTL
Sbjct  124  FLTSNLNLRFNKILKSLAIT**SHK*ESYNFKILTCICTL  5


 Score = 66.6 bits (139),  Expect = 6e-09
 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1/-1

Query  456  FYPLIS**ELIRFSNPLV*LDNLISKNPIILKF*RVFVP*  337
            F PLIS *+LIRFSN L+ L+NLISKNPIILKF*RVFVP*
Sbjct  123  F*PLIST*DLIRFSNLLLSLNNLISKNPIILKF*RVFVP*  4


 Score = 64.8 bits (135),  Expect = 2e-08
 Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2/+2

Query  338  *GTNTR*NFKIIGFLLMRLSSYTKGFENLINSYYEIRG  451
            *GTNTR*NFKIIGFLLMRL S +K FENLI S  EIRG
Sbjct  5    *GTNTR*NFKIIGFLLMRLLSDSKRFENLIKS*VEIRG  118


 Score = 46.4 bits (95),  Expect = 9e-05
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +1/+1

Query  337  LRYKHTLKF*NYRILTYEII  396
            LRYK+TLKF*NYRILTYEII
Sbjct  4    LRYKYTLKF*NYRILTYEII  63


 Score = 22.6 bits (43),  Expect = 9e-05
 Identities = 12/15 (80%), Positives = 13/15 (86%), Gaps = 0/15 (0%)
 Frame = +1/+1

Query  412  I*ESY*FLL*D*RVK  456
            I*ESY* L *D*R+K
Sbjct  79   I*ESY*ILS*D*RLK  123


 Score = 51.9 bits (107),  Expect = 2e-04
 Identities = 30/39 (76%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2/-2

Query  455  FTL*SHNKN**DSQIP*YN*IIS*VRIL*F*NFNVCLYL  339
            F L*S  K **DSQI  Y+ IIS*VRIL*F*NFNV LYL
Sbjct  122  FNL*SQLKI**DSQISCYHLIIS*VRIL*F*NFNVYLYL  6


>gb|AACY021641759.1|  Marine metagenome 1092963184137, whole genome shotgun sequence
Length=1009

 Score = 45.1 bits (92),  Expect = 2e-08
 Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3/+1

Query  364  KILTCVCTLNNLKSF*NSTIKKLESIENLAFN*LVSGVV  248
            K+  C  TL +LKSF + T+KKL+S +NLA N*LVS ++
Sbjct  787  KVNLCNTTLTSLKSFNS*TLKKLDSNKNLAIN*LVSDLI  903


 Score = 30.4 bits (60),  Expect = 2e-08
 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1/+1

Query  414  NPLV*LDNLISKNPIILK  361
            N LV*L+NL  KNPIILK
Sbjct  736  N*LV*LENLTRKNPIILK  789


 Score = 24.4 bits (47),  Expect = 2e-08
 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 0/21 (0%)
 Frame = -2/+2

Query  536  NYNLFFHINQY*NIILITTKK  474
            NY  F+ I QY*   +I+TKK
Sbjct  626  NYKPFY*ITQY*INTIISTKK  688


 Score = 38.6 bits (78),  Expect = 1e-07
 Identities = 20/32 (62%), Positives = 21/32 (65%), Gaps = 0/32 (0%)
 Frame = +3/-3

Query  258  ETN*LKARFSIDSSFFIVLF*NDFKLFKVQTH  353
            ETN*L ARF  +SSFF V   NDFKL  V  H
Sbjct  893  ETN*LIARFLFESSFFNV*ELNDFKLVNVVLH  798


 Score = 33.1 bits (66),  Expect = 1e-07
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +2/-3

Query  353  R*NFKIIGFLLMRLSSYTKGFENLI  427
            R  FKIIGFL +R SSYT  F+ L+
Sbjct  797  RLTFKIIGFLRVRFSSYTN*FKVLL  723


 Score = 25.8 bits (50),  Expect = 1e-07
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 0/29 (0%)
 Frame = +3/-1

Query  474  FFSCY*NNILVLIYMEK*IIIKESTIFFF  560
            FFS Y    LVL Y+ K  II+E  I F+
Sbjct  688  FFSAYYCINLVLCYLVKWFIIRE*FIHFY  602


 Score = 30.4 bits (60),  Expect = 0.099
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1/-2

Query  355  LKF*NYRILTYEII*LY  405
            + F*NYRILT EI+*LY
Sbjct  795  VNF*NYRILTCEIL*LY  745


 Score = 29.9 bits (59),  Expect = 0.099
 Identities = 18/28 (64%), Positives = 19/28 (67%), Gaps = 0/28 (0%)
 Frame = +1/-1

Query  256  QKLIN*RLDSL*ILAFLLCYFRMILNCL  339
            QKLIN* LDS   LAFL+    MILN L
Sbjct  895  QKLIN**LDSYLSLAFLMFKN*MILNLL  812


 Score = 37.3 bits (75),  Expect = 1.6
 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1/+2

Query  333  I*NHSKIAQ*KS*NL*RI*PLIN*FLV*FQI*LQYFKNLFLFS  205
            +*NHS +  *KS*   RI* LIN*FL+*F + + +   +F  S
Sbjct  818  V*NHSILKH*KS*TQIRI*LLIN*FLI*FYLIIHFKNTIFNIS  946


 Score = 21.7 bits (41),  Expect = 1.6
 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = -2/+2

Query  404  YN*IIS*VRIL*F*NFNVCL  345
            YN* IS VRIL*F*     +
Sbjct  746  YN*RISHVRIL*F*KLTYAI  805


>gb|AACY022812614.1|  Marine metagenome ctg_1101667219965, whole genome shotgun sequence
Length=843

 Score = 54.7 bits (113),  Expect = 2e-05
 Identities = 20/22 (90%), Positives = 20/22 (90%), Gaps = 0/22 (0%)
 Frame = +3/-2

Query  804  VVTEKNYFYHLEVLPPSKWEGI  869
            VVTEK YFYHLEVLPP KWEGI
Sbjct  842  VVTEKTYFYHLEVLPPKKWEGI  777


 Score = 49.6 bits (102),  Expect = 7e-04
 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 0/22 (0%)
 Frame = -2/+3

Query  869  YTFPFTRW*YFQMVKIIFLCNY  804
            Y FPF RW*YFQM+KI F CNY
Sbjct  777  YAFPFFRW*YFQMIKISFFCNY  842


 Score = 44.1 bits (90),  Expect = 0.034
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1/-3

Query  805  *LQRKIIFTIWKYYHLVNGKV*  870
            *LQ+K+IF IWKYYHL NGK *
Sbjct  841  *LQKKLIFIIWKYYHLKNGKA*  776


 Score = 38.2 bits (77),  Expect = 2.1
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2/-1

Query  803  SSYREKLFLPSGSITT**MGRY  868
            SSYR+ LFL SGSITT* MGR+
Sbjct  843  SSYRKNLFLSSGSITT*KMGRH  778


 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 0/22 (0%)
 Frame = -1/+2

Query  870  LYLPIY*VVILPDGKNNFSL*L  805
            L LPI+*VVILPD KN F L*L
Sbjct  776  LCLPIF*VVILPDDKNKFFL*L  841


>gb|AACY023501208.1|  Marine metagenome ctg_1101668308559, whole genome shotgun sequence
Length=1569

 Score = 52.8 bits (109),  Expect = 8e-05
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 0/57 (0%)
 Frame = +3/+3

Query  690  SIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDKPKVVTEKNYFYHLEVLPPSKW  860
            +I E LK YP+  +  +  A +++ K  E+ Y   KP VV++  Y+  LEVLPP +W
Sbjct  204  TIKEYLKMYPSVSLVPYTTALKLQQKHYEKKYNAYKPYVVSKTYYWDKLEVLPPDQW  374


>gb|AACY021339034.1|  Marine metagenome 1095454123292, whole genome shotgun sequence
Length=830

 Score = 51.5 bits (106),  Expect = 2e-04
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 0/58 (0%)
 Frame = +3/+3

Query  690  SIDEVLKEYPNAIVTSFVKASEMRDKTNERIYKVDKPKVVTEKNYFYHLEVLPPSKWE  863
            +I E L+ YP+  + S  +A  ++ K  E+ Y   KP +  E+N+   L VLPP +WE
Sbjct  291  TIREYLEIYPDCKIVSRKQALRLQQKHYEKKYNAYKPYITNEENFLEKLNVLPPEQWE  464


>gb|AAUQ01103827.1|  Epibiont metagenome ALV_LSA_193_C21.y01, whole genome shotgun 
sequence
Length=738

 Score = 41.8 bits (85),  Expect = 0.16
 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 0/32 (0%)
 Frame = -2/+3

Query  260  FWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ  165
            F+CS K N++I+K+FF +L L Y  F++  F+
Sbjct  306  FYCSLKINFHIMKLFFRYLHLSYEFFYLISFK  401


>gb|AACY023317216.1|  Marine metagenome ctg_1101668124567, whole genome shotgun sequence
Length=1573

 Score = 41.8 bits (85),  Expect = 0.16
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3/+3

Query  720   NAIVTSFVKASEMRDKTNERIYKVDKPKVVTEKNYFYHLEVLPPSKWEGI  869
             NA+  SF K    RD+T    YK+   K++T  NY Y+L +L P   EG+
Sbjct  1173  NALQ*SFYKPIAQRDQTLNIRYKLSSSKLMTCSNYQYYLTLLAPPPSEGL  1322


>gb|AACY021170728.1|  Marine metagenome 1090115, whole genome shotgun sequence
Length=766

 Score = 41.4 bits (84),  Expect = 0.22
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 0/39 (0%)
 Frame = -2/+1

Query  869  YTFPFTRW*YFQMVKIIFLCNYFRFIHFVNSFICLISHF  753
            + F   +W* F     IF+ N+ RF+H  NS +C+I+ F
Sbjct  16   FKFKSIKW*PFAFTLNIFILNFNRFVHIYNSKVCIITFF  132


>gb|AACY020606950.1|  Marine metagenome 1504068, whole genome shotgun sequence
Length=913

 Score = 40.5 bits (82),  Expect = 0.42
 Identities = 13/39 (33%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2/-2

Query  80   KTNKLREILRLEKDQIKKIKNTYTYDYFTEKDKHEKFYN  196
            K N+L +++R++K +IK+IKN   ++ +   D+ + F+N
Sbjct  120  KFNRLEQVIRIKKREIKEIKNILNFEKYNTLDQQKLFFN  4


>gb|AACY020512011.1|  Marine metagenome 1096626680869, whole genome shotgun sequence
Length=1927

 Score = 40.0 bits (81),  Expect = 0.58
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2/-2

Query  242   YNYNILKIFFYFLILHYRIFHVYLF  168
             Y YN L I+  FLIL+Y +FH+YLF
Sbjct  1704  YLYNFLNIYL*FLILNYILFHLYLF  1630


>gb|AACY020274809.1|  Marine metagenome 1096626774938, whole genome shotgun sequence
Length=2863

 Score = 33.6 bits (67),  Expect = 0.96
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 0/33 (0%)
 Frame = -2/-1

Query  839   FQMVKIIFLCNYFRFIHFVNSFICLISHF*SFN  741
             F M+ I F  +YF F+H  N F    S F SFN
Sbjct  1063  FFMLSIFFFRSYFFFLHSFNFFYLFSSFFFSFN  965


 Score = 27.6 bits (54),  Expect = 0.96
 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 0/28 (0%)
 Frame = -2/-3

Query  242  YNYNILKIFFYFLILHYRIFHVYLFQ*N  159
            Y      + FYFLI ++ IF  + + *N
Sbjct  647  YRLTFYFLIFYFLIFYFLIFFSFFYS*N  564


>gb|AACY020117089.1|  Marine metagenome 1096626136086, whole genome shotgun sequence
Length=3063

 Score = 39.1 bits (79),  Expect = 1.1
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = -2/-2

Query  869   YTFPFTRW*YFQMVKIIFLCNYFRFIHFVNSFICLISHF  753
             + F   +W* F     IF+ N+  F+H  NS IC+I+ F
Sbjct  1145  FEFETVKW*PFTFTFNIFILNFNSFVHIYNSKICIITFF  1029


>gb|AACY021387769.1|  Marine metagenome 1095403632936, whole genome shotgun sequence
Length=640

 Score = 33.6 bits (67),  Expect = 1.9
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = -2/+2

Query  659  FNKINKVC*LYIIDNIIFYNAV*CCF  582
            F  INK C* Y I+N+ FY+ +  CF
Sbjct  410  FYPINKFC*SYTINNMTFYHIIYFCF  487


 Score = 24.4 bits (47),  Expect = 1.9
 Identities = 7/14 (50%), Positives = 11/14 (78%), Gaps = 0/14 (0%)
 Frame = -2/+2

Query  842  YFQMVKIIFLCNYF  801
            +FQ+V  I+ CN+F
Sbjct  356  FFQLVLSIYFCNFF  397


>gb|AAUQ01084005.1|  Epibiont metagenome ALV_LSA_114_P17.x01, whole genome shotgun 
sequence
Length=920

 Score = 38.2 bits (77),  Expect = 2.1
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 0/35 (0%)
 Frame = -2/-3

Query  827  KIIFLCNYFRFIHFVNSFICLISHF*SFNK*SYYC  723
            +II  C YF++++    F+C+  +F  F K SYYC
Sbjct  447  RIIIECFYFKYVYV*CEFVCVYGYFV*FVKFSYYC  343


>gb|AACY020055141.1|  Marine metagenome 1096626062042, whole genome shotgun sequence
Length=1574

 Score = 38.2 bits (77),  Expect = 2.1
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%)
 Frame = -2/-3

Query  269   LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLF  168
             LI+ W  +   Y +L   F+F+ILH+ IFH  +F
Sbjct  1407  LITLWHLYNIFYILLFFIFFFIILHFIIFHFSIF  1306


>gb|AACY020152277.1|  Marine metagenome 1096626815385, whole genome shotgun sequence
Length=4315

 Score = 38.2 bits (77),  Expect = 2.1
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 0/39 (0%)
 Frame = -2/+1

Query  869  YTFPFTRW*YFQMVKIIFLCNYFRFIHFVNSFICLISHF  753
            + F   +W* F     IF+ N   FIH  NS IC+I+ F
Sbjct  796  FEFETIKW*PFTFTFYIFIFNLNNFIHIYNSKICIITFF  912


>gb|AACY022963343.1|  Marine metagenome ctg_1101667370694, whole genome shotgun sequence
Length=1025

 Score = 32.7 bits (65),  Expect = 2.2
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 0/43 (0%)
 Frame = -2/-1

Query  353  VCLYLKQFKIILK*HNKKARIYRESSL*LISFWCSFKYNYNIL  225
            +C YL++   +  *HN K R+ +E  L*+   +  F Y   IL
Sbjct  278  LCFYLQEILHLCN*HNLK*RLLKEVDL*IQLIYYFFSYKIKIL  150


 Score = 25.8 bits (50),  Expect = 2.2
 Identities = 8/16 (50%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2/-2

Query  833  MVKIIFLCNYFRFIHF  786
            ++ I+F+CNY   IHF
Sbjct  730  LLVILFICNYSFLIHF  683


>gb|AACY022673193.1|  Marine metagenome ctg_1101667080544, whole genome shotgun sequence
Length=955

 Score = 29.9 bits (59),  Expect = 2.8
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 0/26 (0%)
 Frame = -2/-1

Query  830  VKIIFLCNYFRFIHFVNSFICLISHF  753
            + I+F  N+ R   F NS++ LIS F
Sbjct  325  ISILFFSNFTRLTFFSNSYLSLISFF  248


 Score = 28.1 bits (55),  Expect = 2.8
 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -2/-3

Query  266  ISFWCSFKYNYNILKIFFYF  207
            ++FW SF + YNIL + + F
Sbjct  179  LNFWFSFFFLYNILNLIYCF  120


>gb|AACY020235835.1|  Marine metagenome 1096626271730, whole genome shotgun sequence
Length=2236

 Score = 37.7 bits (76),  Expect = 2.9
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +3/+3

Query  603   VKNDVIYDVESANFVDFIKNDGSLMYSYNSIDEVLKEYPN  722
             VK + + DV S N   F K  G+ +  Y+S+DE+LKE  N
Sbjct  1317  VKVEAVCDVNSENLNLFTKKFGNHLRKYSSVDEMLKEEKN  1436


>gb|AACY023117858.1|  Marine metagenome ctg_1101667525209, whole genome shotgun sequence
Length=932

 Score = 37.7 bits (76),  Expect = 2.9
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 0/31 (0%)
 Frame = -2/+2

Query  596  V*CCFFGLGGHKKKEYSTLFNYNLFFHINQY  504
            V*CCFF + G+    +ST  +++L+F++ QY
Sbjct  506  V*CCFFNI*GNNYVTWSTYNSHSLYFYVTQY  598


>gb|AATO01003273.1|  Metagenome sequence ctg11226, whole genome shotgun sequence
Length=1620

 Score = 37.7 bits (76),  Expect = 2.9
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -2/+1

Query  233  NILKIFFYFLILHYRIFHVYLFQ*NNHRC  147
            NI    FYF  ++  +FH  L +*NNHRC
Sbjct  841  NIALWIFYFACINVTLFHASLLK*NNHRC  927


>gb|AACY020491677.1|  Marine metagenome 1096626654898, whole genome shotgun sequence
Length=2407

 Score = 37.3 bits (75),  Expect = 3.9
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2/+3

Query  827  KIIFLCNYFRFIHFVNSFICLISHF  753
            K+  +CN+++FIHF  SFI LIS F
Sbjct  822  KMKTICNFYQFIHFFFSFITLISFF  896


>gb|AACY024053574.1|  Marine metagenome 1096626427323, whole genome shotgun sequence
Length=1270

 Score = 37.3 bits (75),  Expect = 3.9
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 0/41 (0%)
 Frame = -2/-1

Query  269   LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ*NNHRC  147
             LI  + SF+Y  N +++    L+L Y   HVY+FQ ++  C
Sbjct  1066  LILVYQSFRYRLNFVQVILLDLLLLYNELHVYVFQNDHLNC  944


>gb|AAFX01000142.1|  Metagenome sequence XZS50392.x1, whole genome shotgun sequence
Length=4282

 Score = 37.3 bits (75),  Expect = 3.9
 Identities = 12/21 (57%), Positives = 18/21 (85%), Gaps = 0/21 (0%)
 Frame = -2/+1

Query  236  YNILKIFFYFLILHYRIFHVY  174
            YN+L   FYFLIL+YRI++++
Sbjct  121  YNLLIYLFYFLILYYRIYYIF  183


>gb|AACY020361888.1|  Marine metagenome 1096626448504, whole genome shotgun sequence
Length=1488

 Score = 30.4 bits (60),  Expect = 4.3
 Identities = 11/19 (57%), Positives = 14/19 (73%), Gaps = 0/19 (0%)
 Frame = -2/-3

Query  809   NYFRFIHFVNSFICLISHF  753
             N FRFI F+N+F  LI H+
Sbjct  1243  NNFRFIFFINNFFNLIIHY  1187


 Score = 27.6 bits (54),  Expect = 4.3
 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 0/17 (0%)
 Frame = -2/-1

Query  245  KYNYNILKIFFYFLILH  195
            KYN  +LK  FYFL+ H
Sbjct  903  KYNQLLLKF*FYFLLFH  853


>gb|AACY021380844.1|  Marine metagenome 1093010131612, whole genome shotgun sequence
Length=807

 Score = 30.9 bits (61),  Expect = 4.4
 Identities = 8/18 (44%), Positives = 14/18 (77%), Gaps = 0/18 (0%)
 Frame = -2/-3

Query  815  LCNYFRFIHFVNSFICLI  762
            + NY +F+ F+N+FIC +
Sbjct  631  IVNYIKFLRFINNFICFL  578


 Score = 26.3 bits (51),  Expect = 4.4
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -2/-2

Query  248  FKYNYNILKIFFYFLILHYRIF  183
            ++Y+YN   + +YF IL Y IF
Sbjct  131  YEYHYNYSILTYYFYIL*Y*IF  66


>gb|AACY023757639.1|  Marine metagenome ctg_1101668564990, whole genome shotgun sequence
Length=1176

 Score = 33.1 bits (66),  Expect = 4.7
 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -2/-1

Query  839  FQMVKIIFLCNYFRFIHFVNSFICLISHF  753
            F  +   F+ ++FRF+ F + F+C IS F
Sbjct  339  FHFISFHFISSHFRFVSFHSVFVCFISVF  253


 Score = 24.4 bits (47),  Expect = 4.7
 Identities = 7/16 (43%), Positives = 11/16 (68%), Gaps = 0/16 (0%)
 Frame = -2/-2

Query  215  FYFLILHYRIFHVYLF  168
            F+F++ H+R FH   F
Sbjct  122  FHFMVFHFRGFHFMRF  75


>gb|AACY021580813.1|  Marine metagenome 1095900171261, whole genome shotgun sequence
Length=927

 Score = 30.9 bits (61),  Expect = 5.0
 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -2/-2

Query  260  FWCSFKYNYNILKIFFYFLILHYRIFHVY  174
            F  +  +++ +LKI F F + + +IFH Y
Sbjct  662  FLHTISFHHTLLKILFLFCLFYQKIFHQY  576


 Score = 26.3 bits (51),  Expect = 5.0
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%)
 Frame = -2/-3

Query  833  MVKIIFLCNYFRFIHFVNSFICLI  762
            +VKI FLC +F FI F   ++ +I
Sbjct  706  IVKIDFLCVHFSFIIFYIRYLFII  635


>gb|AACY020067571.1|  Marine metagenome 1096626076952, whole genome shotgun sequence
Length=2007

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 0/33 (0%)
 Frame = -2/+2

Query  245   KYNYNILKIFFYFLILHYRIFHVYLFQ*NNHRC  147
             K+NY +  IF+Y  + +Y I   Y    N+HRC
Sbjct  1112  KFNYKLFMIFYYMSVSYYNIVINYSSTSNHHRC  1210


>gb|AACY020222464.1|  Marine metagenome 1096626766721, whole genome shotgun sequence
Length=2038

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%)
 Frame = +2/+1

Query  119   DQIKKIKNTYTYDYFTEKDKHEKFYNVVSENRKRFLKYCSYI*NYTRN  262
             D +KKI+N + + YF  KD    F  ++S  +  F +Y  +   Y  N
Sbjct  1198  DNLKKIQNVFLHCYFNSKDTDLLFNKLISNEKTDFSRYNYFYARYLDN  1341


>gb|AACY020501038.1|  Marine metagenome 1096626665338, whole genome shotgun sequence
Length=1820

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -2/-2

Query  272   *LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ  165
             *LISF+C    N   LK FF +LI  +  FH+ L+Q
Sbjct  1630  *LISFFCMQIQNVFDLKQFFSYLIFRHSFFHLLLYQ  1523


>gb|AACY020917846.1|  Marine metagenome 2044684, whole genome shotgun sequence
Length=902

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 0/42 (0%)
 Frame = -2/-2

Query  293  IYRESSL*LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLF  168
            +YR   +*+  F C +KY Y  + I+ Y  I  Y   ++YL+
Sbjct  310  VYRMLCI*IYKFKCKYKYKYIYIYIYIYMYIYIYI*IYLYLY  185


>gb|AACY021224217.1|  Marine metagenome 1093015601443, whole genome shotgun sequence
Length=418

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 0/39 (0%)
 Frame = -2/+1

Query  869  YTFPFTRW*YFQMVKIIFLCNYFRFIHFVNSFICLISHF  753
            + F   +W* F     IF+ N   F+H  NS IC+I+ F
Sbjct  148  FEFETIKW*PFTFTFYIFIFNLNNFVHINNSKICIITFF  264


>gb|AACY021477871.1|  Marine metagenome 2151054, whole genome shotgun sequence
Length=916

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 0/29 (0%)
 Frame = -2/+1

Query  239  NYNILKIFFYFLILHYRIFHVYLFQ*NNH  153
            N++++K F YF    + +FH+YLF * NH
Sbjct  784  NHHLIKKFEYFFCYKFFLFHLYLFF*KNH  870


>gb|AACY021602597.1|  Marine metagenome 1092963175926, whole genome shotgun sequence
Length=894

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%)
 Frame = +2/-2

Query  119  DQIKKIKNTYTYDYFTEKDKHEKFYNVVSENRKRFLKYCSYI*NYTRN  262
            D +KKI+N + + YF  KD    F  ++S  +  F +Y  +   Y  N
Sbjct  377  DNLKKIQNVFLHCYFNSKDTDLLFNKLISNEKTDFSRYNYFYARYLDN  234


>gb|AACY021992406.1|  Marine metagenome 1092344281921, whole genome shotgun sequence
Length=818

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -2/-3

Query  251  SFKYNYNILKIFFYFLILHYRIFHVYL  171
            SF + YNI KI FYF ++ ++I H+ +
Sbjct  486  SFMFFYNI*KIIFYFFLIFFKIIHIIM  406


>gb|AACY023599376.1|  Marine metagenome ctg_1101668406727, whole genome shotgun sequence
Length=1069

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 0/43 (0%)
 Frame = +3/+1

Query  735  SFVKASEMRDKTNERIYKVDKPKVVTEKNYFYHLEVLPPSKWE  863
            +F KA   ++  NE + + DKP  V E+   Y +EV    KWE
Sbjct  349  AFDKARPKKNLYNEEVDENDKPLSVAEETLLYDIEVEEEKKWE  477


>gb|AACY023740582.1|  Marine metagenome ctg_1101668547933, whole genome shotgun sequence
Length=1807

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%)
 Frame = +2/-1

Query  152   YDYFTEKDKHEKFYNVVSENRKRFLKYCSYI*  247
             YD+F  K  +E  +N V  NR+ F+K+  YI*
Sbjct  1342  YDFFNSKISYENIFNRV*NNRRLFIKWLKYI*  1247


>gb|AAQL01000747.1|  Metagenome sequence s8_159088, whole genome shotgun sequence
Length=3853

 Score = 36.8 bits (74),  Expect = 5.4
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -2/-1

Query  257  WCSFKYNYNILKIFFYFLILHYRIFHVY  174
            WC F +N+N  ++FFY+L+  +  F  +
Sbjct  352  WCFFLFNWNFNRLFFYYLLCFFNSFSFF  269


>gb|AACY020704604.1|  Marine metagenome 1092963015084, whole genome shotgun sequence
Length=772

 Score = 30.4 bits (60),  Expect = 5.7
 Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 0/40 (0%)
 Frame = -2/+2

Query  266  ISFWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ*NNHRC  147
            ++FW +F +  NIL + ++F ++     + ++F *  H C
Sbjct  653  MNFWFTFLFLINILNLIYWF*LIINFFIYNWIFA*RIHIC  772


 Score = 26.3 bits (51),  Expect = 5.7
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 0/24 (0%)
 Frame = -2/+3

Query  830  VKIIFLCNYFRFIHFVNSFICLIS  759
            + IIF  N+ R   F +S++ LIS
Sbjct  507  ISIIFFSNFTRLTFFSSSYLSLIS  578


>gb|AAUQ01115046.1|  Epibiont metagenome ALV_LSB_011_B08.y01, whole genome shotgun 
sequence
Length=620

 Score = 29.5 bits (58),  Expect = 6.2
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = -2/+3

Query  242  YNYNILKIFFYFLILHYRIFHVYLFQ  165
            YNY +LK + Y  +L Y +  ++LFQ
Sbjct  255  YNYFLLKFYLYQQLLRYLLRILHLFQ  332


 Score = 26.7 bits (52),  Expect = 6.2
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 0/51 (0%)
 Frame = -2/+3

Query  668  TIIFNKINKVC*LYIIDNIIFYNAV*CCFFGLGGHKKKEYSTLFNYNLFFH  516
            +I ++ I K   L+   N IF +   C FF +  +  K++   FN+  FF+
Sbjct  24   SIFYDSIVKFLNLFSC*NSIFVSF*ICFFFCIKFNTIKQFINKFNFIKFFN  176


>gb|AACY024065144.1|  Marine metagenome 1096626483896, whole genome shotgun sequence
Length=923

 Score = 30.4 bits (60),  Expect = 6.7
 Identities = 9/23 (39%), Positives = 16/23 (69%), Gaps = 0/23 (0%)
 Frame = -2/+3

Query  260  FWCSFKYNYNILKIFFYFLILHY  192
            FWCS ++N N L I F ++ +++
Sbjct  711  FWCSIRWNNN*L*IIFIYIFINF  779


 Score = 26.3 bits (51),  Expect = 6.7
 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 0/23 (0%)
 Frame = -2/+3

Query  824  IIFLCNYFRFIHFVNSFICLISH  756
            IIF C Y  +I++ +S  C  +H
Sbjct  516  IIFSCRYHSYIYWFSSKCCFRNH  584


>gb|AACY023669546.1|  Marine metagenome ctg_1101668476897, whole genome shotgun sequence
Length=1277

 Score = 32.7 bits (65),  Expect = 6.8
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2/-3

Query  218  FFYFLILHYRIFHVYLFQ*NN  156
            ++YF IL  R+ HVYLF * N
Sbjct  747  YYYFNILFLRVLHVYLFY*QN  685


 Score = 24.4 bits (47),  Expect = 6.8
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 0/32 (0%)
 Frame = -2/-1

Query  863   FPFTRW*YFQMVKIIFLCNYFRFIHFVNSFIC  768
             FPF    +  +  IIFL + F FI F   F C
Sbjct  1166  FPFIHIPFCFLFFIIFLFHTFPFIFFCFIFHC  1071


>gb|AACY022082885.1|  Marine metagenome 1091145313637, whole genome shotgun sequence
Length=995

 Score = 34.5 bits (69),  Expect = 7.2
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%)
 Frame = -2/-1

Query  842  YFQMVKIIFLCNYFRFIHFVNSFICLI  762
            YF    ++   NYFRF H VN+  C +
Sbjct  947  YFSFTSMVCWTNYFRFFHLVNNSCCTV  867


 Score = 22.1 bits (42),  Expect = 7.2
 Identities = 8/28 (28%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = -2/-1

Query  254  CSFKYNYNILKIFFYFLILHYRIFHVYL  171
            C F YNY+ ++   + ++ H+ I   Y+
Sbjct  356  CHFIYNYDNIRNDSFRILPHFFIIPRYI  273


>gb|ABDH01041033.1| Download subject sequence spanning the                                    HSP Termite gut metagenome tgut2b_Contig41724, whole genome shotgun 
sequence
Length=10710

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 0/36 (0%)
 Frame = +2/+3

Query  125   IKKIKNTYTYDYFTEKDKHEKFYNVVSENRKRFLKY  232
             I+  +NT  + YF +K +++ + ++ S NR RF +Y
Sbjct  9153  IRFCRNTCRFGYFVDKSRYQLYCSIKSSNRDRFTEY  9260


>gb|AACY020551522.1|  Marine metagenome 1096626840899, whole genome shotgun sequence
Length=5913

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 11/30 (36%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -2/+3

Query  242   YNYNILKIFFYFLILHYRIFHVYLFQ*NNH  153
             Y Y+++K  +Y LIL++ ++ ++LFQ + H
Sbjct  3765  YQYHLIKNCYYLLILYHLVYQLFLFQHHQH  3854


>gb|AACY020980424.1|  Marine metagenome 2054719, whole genome shotgun sequence
Length=882

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 0/34 (0%)
 Frame = -2/-3

Query  269  LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLF  168
            L+ +  S+ Y Y  + IF Y  I  YR  H+Y++
Sbjct  601  LLIYLSSYLYIYRYIHIFIYIYIYRYRYIHIYIY  500


>gb|AACY021972045.1|  Marine metagenome 1092256274953, whole genome shotgun sequence
Length=1034

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%)
 Frame = -2/-2

Query  827  KIIFLCNYFRFIHFVNSFICLISHF*SFN  741
            KI F  ++++FI F N  +CLISHF  F+
Sbjct  865  KIFF*MHFYKFITFTNRPLCLISHFFRFS  779


>gb|AACY022366934.1|  Marine metagenome 1920805, whole genome shotgun sequence
Length=901

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 0/29 (0%)
 Frame = -2/-1

Query  257  WCSFKYNYNILKIFFYFLILHYRIFHVYL  171
            +C + Y YN + IF Y++ L Y I H+YL
Sbjct  748  FCIYIYIYN*INIFIYYMYLSYFI*HIYL  662


>gb|AACY023001088.1|  Marine metagenome ctg_1101667408439, whole genome shotgun sequence
Length=807

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 0/38 (0%)
 Frame = -2/+1

Query  260  FWCSFKYNYNILKIFFYFLILHYRIFHVYLFQ*NNHRC  147
            F+ S +YN+N    F+ F  +HY  +    + *NN  C
Sbjct  364  FYSSIRYNFNFFIFFYAFFYIHYCTYLRNTYA*NNSSC  477


>gb|AACY023123346.1|  Marine metagenome ctg_1101667530697, whole genome shotgun sequence
Length=884

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = -2/+1

Query  848  W*YFQMVKIIFLCNYFRFIHFVNSFIC  768
            W +F  V IIF    F +IHF N FIC
Sbjct  130  WIWFLWVNIIFFNRLFCYIHFYNPFIC  210


>gb|AATD01000504.1|  Mouse gut metagenome OB1_U_BO-aaa15d10.b1, whole genome shotgun 
sequence
Length=879

 Score = 36.3 bits (73),  Expect = 7.4
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2/-3

Query  242  YNYNILKIFFYFLILHYRIFHVYLF  168
            Y +N  KIFFYF   H+ IFHV +F
Sbjct  838  YPFN*NKIFFYF*FFHFSIFHVDVF  764


>gb|AACY023679118.1|  Marine metagenome ctg_1101668486469, whole genome shotgun sequence
Length=1124

 Score = 30.4 bits (60),  Expect = 8.1
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 0/31 (0%)
 Frame = -2/-1

Query  257  WCSFKYNYNILKIFFYFLILHYRIFHVYLFQ  165
            W SF YN N  ++  YF     + F V+ F+
Sbjct  671  WSSFSYNNNFTRLHIYFSYNSLKKFKVFQFK  579


 Score = 26.3 bits (51),  Expect = 8.1
 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 0/22 (0%)
 Frame = -2/-1

Query  806  YFRFIHFVNSFICLISHF*SFN  741
            Y RF+  + +FI  I+ F +FN
Sbjct  746  YIRFVRLIKNFIYFINTFVTFN  681


>gb|AACY021186113.1|  Marine metagenome 93617, whole genome shotgun sequence
Length=841

 Score = 33.6 bits (67),  Expect = 8.3
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2/-1

Query  260  FWCSFKYNYNILKIFFYFL  204
            FWC   YN+NI   FFYFL
Sbjct  292  FWCYKMYNFNIWINFFYFL  236


 Score = 22.6 bits (43),  Expect = 8.3
 Identities = 8/16 (50%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2/-3

Query  836  QMVKIIFLCNYFRFIH  789
            Q+ K+IFL ++F F H
Sbjct  725  QLQKLIFLVSHF*FYH  678


>gb|AACY023297295.1|  Marine metagenome ctg_1101668104646, whole genome shotgun sequence
Length=1255

 Score = 33.6 bits (67),  Expect = 9.0
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 0/29 (0%)
 Frame = -2/+3

Query  266  ISFWCSFKYNYNILKIFFYFLILHYRIFH  180
            IS W +++   N +KIFF F I+ Y I+H
Sbjct  789  ISDWFNWRVFINFIKIFFNFTIIIYIIYH  875


 Score = 23.1 bits (44),  Expect = 9.0
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%)
 Frame = -2/+2

Query  584  FFGLGGHKKKEYSTLFNYNLFFHINQY*NIILI  486
            F+ L  +  K++    +  L+ HI  Y*NIIL+
Sbjct  173  FYILASYYCKKFLHQVHGLLYDHIAYY*NIILL  271


>gb|AACY023059525.1|  Marine metagenome ctg_1101667466876, whole genome shotgun sequence
Length=697

 Score = 33.1 bits (66),  Expect = 9.4
 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 0/23 (0%)
 Frame = -2/+1

Query  233  NILKIFFYFLILHYRIFHVYLFQ  165
            N LK+FF F ++ Y+ FH + FQ
Sbjct  358  NYLKLFFLFYLV*YQFFHYFFFQ  426


 Score = 22.6 bits (43),  Expect = 9.4
 Identities = 8/12 (66%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
 Frame = -2/+1

Query  548  STLFNYNLFFHI  513
            S LF YNLFF +
Sbjct  244  SKLFEYNLFFDL  279


>gb|AACY020267172.1|  Marine metagenome 1096626318567, whole genome shotgun sequence
Length=1826

 Score = 33.1 bits (66),  Expect = 9.4
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 0/27 (0%)
 Frame = -2/-3

Query  830   VKIIFLCNYFRFIHFVNSFICLISHF*  750
             + I+FL N+ RF  F NS+  LIS F*
Sbjct  1455  ISILFLSNFTRFTFFSNSYFNLISFF*  1375


 Score = 24.0 bits (46),  Expect = 9.4
 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 0/36 (0%)
 Frame = -2/-1

Query  275   L*LISFWCSFKYNYNILKIFFYFLILHYRIFHVYLF  168
             +* + F C +   +    ++FY L+    +F VY+F
Sbjct  1394  I*FLFFECKY*EGHQTNLLYFYILL*SLVLFLVYVF  1287


>gb|AACY022796170.1|  Marine metagenome ctg_1101667203521, whole genome shotgun sequence
Length=775

 Score = 25.4 bits (49),  Expect = 9.9
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = -2/-1

Query  830  VKIIFLCNYFRFIHFVNSFICLIS  759
            + IIF  N+ R   F +S+  LIS
Sbjct  592  ISIIFFSNFTRLTFFSSSYFSLIS  521


 Score = 24.4 bits (47),  Expect = 9.9
 Identities = 7/20 (35%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -2/-3

Query  266  ISFWCSFKYNYNILKIFFYF  207
            ++FW +F +  NIL + ++F
Sbjct  446  MNFWFTFFFLINILNLIYWF  387


 Score = 23.1 bits (44),  Expect = 9.9
 Identities = 9/16 (56%), Positives = 10/16 (62%), Gaps = 0/16 (0%)
 Frame = -2/-3

Query  230  ILKIFFYFLILHYRIF  183
            I+  F Y LI  YRIF
Sbjct  380  IINFFIYNLIFAYRIF  333