GOS 1000020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_381
Annotathon code: GOS_1000020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BSB06CIIT
Username : Suleman
Annotated on : 2009-06-04 10:25:43
  • Azariah Suleman

Synopsis

Genomic Sequence

>JCVI_READ_381 GOS_1000020 Genomic DNA
CACTGATGCATCGACACTACAGGCCTGGGTCAACAGATCAAAACCCGGCTGGCAAAGGGGCAGTTTATCGCCCGTGTCGAACAAGTTTTTCCAGACACCG
ATGCAAGTCACTGAGATCAGACAAGTCGCCGAAGAACTGGTCCAGCTACTTGGTCATACAGACTGGGCCATAGGCGGCAGCTTTTTACTTCAGTGTTATG
GTATAGAACCCCAGGCCAGAGATTTGGATCTGGTCTGTACTCTCGAACACTTTGAGCGTTTTAAAGCATTACTCAGCCAGTACGCACAAGCTGTGCCTGT
GACGCCCCACCCTAGCTATTGCAGCCTTGGCTTTGCCCGTTTTGAAAAAAATGGTTTGATGATCGAATTGATGGCAGGCATTCAGGTGCTCACAAACAAC
AGACTGCAGCAGTTTCAGTTTTTGCCGGAACGCATCAGTTGGCAACAAGGTTTGCCATTGATGGCATTAACAGACTGGCAGGTTTTGTATCAGCTATTTG
ACCGCCCACAGCGTGTCGCGCAGTTGCAACAGTATCTACACTCAACGCACTGATGCATTATTTTTCCACTATAAATCATATCAACTCAATCACTTAAGTT
TAACTACTGTCAAAAATGGCTTTTTGCTCAAAAAAAGTACTTGCCAAGGAATGACAACAAAAATATGATGCTCATCATATTGTCAGCCACAGGCCATTTT
GATGACAGCATTAACCAAAAAAGAGATGACCCATCAGCGCATTTTGCAGACCGCTGCAAAGATTATCCGCAGAGATGGTTTTGATGCGCTGGCTGTGGCT
GATGTCATGAAACAAGCAGGTTTAACTCATGGTGGTTTTTACGCCCACTTTGCCAATAGAGATGCACTACTGGCAGAAGCATTAGGGTATGCCGGTGCAG
AATCTGCCACTTTGCTTGAACAAAGTCTGGCAGAGCGCATCAATGCGGGAGTGCAGCCACTTACTGCTTTTATTGAGATTTATCTGTCAGAGCAACATCT
GA

Translation

[ - /1002]   direct strand


Annotator commentaries

Sequence is non-coding because no hits of the domain were found.

ORF finding

PROTOCOL


SMS ORFfinder / direct strand / frames 1,2&3 / min 60 AA / 'atg codon' initiation / 'standard' genetic code

SMS ORFfinder / indirect strand / frames 1,2&3 / min 60 AA / 'atg codon' initiation / 'standard' genetic code




RESULTS ANALYSIS


2ND Frame on the direct strand was selected because of its length.

RAW RESULTS

FORWARD STRAND:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 101 to base 553.
ATGCAAGTCACTGAGATCAGACAAGTCGCCGAAGAACTGGTCCAGCTACTTGGTCATACA
GACTGGGCCATAGGCGGCAGCTTTTTACTTCAGTGTTATGGTATAGAACCCCAGGCCAGA
GATTTGGATCTGGTCTGTACTCTCGAACACTTTGAGCGTTTTAAAGCATTACTCAGCCAG
TACGCACAAGCTGTGCCTGTGACGCCCCACCCTAGCTATTGCAGCCTTGGCTTTGCCCGT
TTTGAAAAAAATGGTTTGATGATCGAATTGATGGCAGGCATTCAGGTGCTCACAAACAAC
AGACTGCAGCAGTTTCAGTTTTTGCCGGAACGCATCAGTTGGCAACAAGGTTTGCCATTG
ATGGCATTAACAGACTGGCAGGTTTTGTATCAGCTATTTGACCGCCCACAGCGTGTCGCG
CAGTTGCAACAGTATCTACACTCAACGCACTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MQVTEIRQVAEELVQLLGHTDWAIGGSFLLQCYGIEPQARDLDLVCTLEHFERFKALLSQ
YAQAVPVTPHPSYCSLGFARFEKNGLMIELMAGIQVLTNNRLQQFQFLPERISWQQGLPL
MALTDWQVLYQLFDRPQRVAQLQQYLHSTH*

>ORF number 1 in reading frame 3 on the direct strand extends from base 702 to base 1001.
ATGACAGCATTAACCAAAAAAGAGATGACCCATCAGCGCATTTTGCAGACCGCTGCAAAG
ATTATCCGCAGAGATGGTTTTGATGCGCTGGCTGTGGCTGATGTCATGAAACAAGCAGGT
TTAACTCATGGTGGTTTTTACGCCCACTTTGCCAATAGAGATGCACTACTGGCAGAAGCA
TTAGGGTATGCCGGTGCAGAATCTGCCACTTTGCTTGAACAAAGTCTGGCAGAGCGCATC
AATGCGGGAGTGCAGCCACTTACTGCTTTTATTGAGATTTATCTGTCAGAGCAACATCTG


>Translation of ORF number 1 in reading frame 3 on the direct strand.
MTALTKKEMTHQRILQTAAKIIRRDGFDALAVADVMKQAGLTHGGFYAHFANRDALLAEA
LGYAGAESATLLEQSLAERINAGVQPLTAFIEIYLSEQHL


REVERSE STRAND:

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


Multiple Alignement

PROTOCOL



RESULTS ANALYSIS

RAW RESULTS

Protein Domains

PROTOCOL


Interpro default parameters at EBI

Pfam default parameters



RESULTS ANALYSIS


NO HITS REPORTED. THEREFORE ANNOTATION CAN'T BE PROCEEDED.

RAW RESULTS

Phylogeny

PROTOCOL



RESULTS ANALYSIS

RAW RESULTS

Taxonomy report

PROTOCOL



RESULTS ANALYSIS

RAW RESULTS

BLAST

PROTOCOL



RESULTS ANALYSIS

RAW RESULTS