IMPORTANT NOTICE: service disruptions might occur during network maintenance on Monday June 1st 2026 from 13:00 to 18:00 (Paris time, also known as Central European Summer Time), we apologize for any inconveniance this may cause!

Forum "ORF finding"

Thread subject: Project A

[ Return to forums ]
Project A
kavh123
2 May 2010 11:33
Non evaluated contribution
SDISGFNSSVITYPDAQLVPGINGKAIHLVNNEESSEVIVHLA
cbuffet
6 May 2010 8:36
Non evaluated contribution
According to blast, it is more likely to be a Chain A, The Hc Fragment Of Tetanus Toxin Complexed With Galactose
Length=441

Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 1/43 (2%)

Query  1   SDISGFNSSVITYPDAQLVPGINGKAIHLVNNEESSEVIVHLA  43
           SDISGFNSSVITYPDAQLVPGINGKAIHLVNNEE SEVIVH A
Sbjct  23  SDISGFNSSVITYPDAQLVPGINGKAIHLVNNEE-SEVIVHKA  64

no ORF has been found.
lldowns
11 May 2010 3:36
Non evaluated contribution
To whom it may concern:

I think you all may be a bit confused about the La Trobe University project.  This is a public, international and professional forum for this specific project involving dna sequences obtained throughout the oceans of the world.  

The project A, involving a hypothetical case of protein fragments should not be discussed on this forum.  That is what we have the La Trobe University LMS forum for.  I doubt tetanus toxin with the exact sequence found in the practical manual was found in one of the ocean samples...  Also, protein fragments do not have open reading frames.  Please use the correct forum to discuss your work.