IMPORTANT NOTICE: service disruptions might occur during network maintenance on Monday June 1st 2026 from 13:00 to 18:00 (Paris time, also known as Central European Summer Time), we apologize for any inconveniance this may cause!

Forum "Recherche d'homologues: BLAST"

Thread subject: Taxonomy report et list report apres Blast

[ Return to forums ]
Taxonomy report et list report apres Blast
GRP1_SMAINI
28 Feb 2018 11:01
Non evaluated contribution
Je n'arrive pas à faire fonctionner le taxonomy list pour cette sequence: (le format semble etre faux)



TSDRLNQLGIHSLEHLIFHLPSRYQDKTSITQLSDAKISDESLIEASIDRIEVIPSRHRQLLCYLSDNQNHRILLRFFHFNQYQKQAFVRGETIQCFGEI
KVGREGLEMHHPEYRLITQEQKPLLESTLSPIYPLCSGVTQAKMKKWVNEALEALNTSIIDDYFEKIINNTMPSLKDSLFLLHHPKQGENLSKIESFTHI
SQQRLIIEELATHQLSLLKIKSARKSKKTTAFSINHSLSDKLLKSLDFQLTKAQNRSIEEINKDIASSNPMLRLLQGDVGSGKTIVAVFALLQAVENNFQ
TAVMAPTEILARQHLQS
A_Haudry_18
28 Feb 2018 12:23
Game master

BLAST taxonomic report

Follow the instructions on the TaxReports tool to extract taxonomic information from your list of BLASTp hits.

Copy the full BLAST Lineage Report in the Annotathon 'Taxonomy report' 'Raw results" field. Only include the first chapter called Lineage Report.

DO not use the sequence, but the blast results

GRP1_DELPUECH
1 Mar 2018 9:44
Non evaluated contribution

Il faut que tu clique sur "plain text" dans formatting option, sans aller dans taxonomie report. tu copie-colle ta liste de séquences données par blast , tu verras ça marchera, cela va te la trier selon la philogénie automatiquement.

GRP1_SMAINI
1 Mar 2018 10:29
Non evaluated contribution

Merci pour vos réponses! effectivement il fallait d'abord passer dans plain text dans formatting options et faire reformat avant de coller les sequences dans taxreport