TO85M 4668010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 85M_scaffold24_1
Annotathon code: TO85M_4668010
Sample :
  • GPS :-61,976275N -49,452633E
  •  : Ushuaia-Puerto Williams station 85 MESO -
  • (-MESOm, 0°C, 0.2-3 microns)
Authors
Team : BioCell2014
Username : dormemico
Annotated on : 2015-01-27 13:21:18
  • Dorme Marie
  • Mico Lucas

Synopsis

Genomic Sequence

>85M_scaffold24_1 TO85M_4668010 Genomic DNA
CCAGATTTGAGCCCGGACTTTTTCACAGCTGTATTTAAGTCCCCAAGGAGGTCTCTTTTCGCAGCACCCTCCACAGAATTATAGCCATTACTTTCTTTGC
TGGGCCAGAGACAAAATCCATCATGATGCTTGGAAGTGAGCACTATATATTTAGCGCCGGATTCTTTAAACAATTCTGCCCATTTTTCGGGCTCATATTT
TTCCGATTTGAATAATTTAATGAAATCTCGGTATGGAAAATCTTTCCCATAATTTTCTTCGTGATATTTTAGACGTGTGCTGTCACCTGACTTTAATCCA
TTGAGATACCATTCTGCATAACTCCCCCTTGGTCCCCAAGCAGGTACGGAATAGAGCCCCCAGTGAATGAAGATCCCAAACTTGGCATCTTTATACCATT
GGGGCGTGGGACGAGAATCCAGGGATTCCCAATTTGGTTCATAATCCTTAGCAATAAGTGACATAACAGATAACAATATTAACCCAAAGTACCTCATGAA
ATCCTACTCCATTGGTGATTCTATTTGCGGAAGATACCCATTTTCGATAAAGGTCATTATTCCAAATAATGCGCCCCAGGAATGGAACCTGTCAGATGAT
AATCTTGAATCATCGCCTGTCCCGGTAATAGCTGAATAATTCTCACTCACATAACCTTTTCGCGTCCATTCTGTCATAATAAGTTTTAATGATTTTTCCG
ATAACTCGGTTGCAGCATCGGTGTAGCCTGCCTGGCGAAGACTTAAATAAGTGAGAAAATTCAGAGGTGGCCATATGGCACCTTTCCAATAGCGCTGTTG
CGAAAATGTTGGATCGTTCCGAGTTGTGGAAGGTAACATCCATTCTCCATAAAATTCTTCAGTATTGTAGAAATGTTCCATAATTATTTCGTTTTTTTCG
TCATTTCCCACTTTTGCCATGAGCGGATAAAATAAGGTGGGTGAAACCCGGGTTGAAAGCGAATCCACATCAGT

Translation

[478 - 972/974]   indirect strand
>TO85M_4668010 Translation [478-972   indirect strand]
MRYFGLILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEK
YEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLKS

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

[b][u]Pour notre ORF d'interêt[/u][/b] :


Au cours de l'annotation de cette séquence, nous avons sélectionné un ORF de 500 nucléotides, complet en 5' et incomplet en 3'. Notre ORF semble codant puisque nous avons trouvé de nombreux homologues (>5000) avec la base de donnée NR et des domaines protéiques avec INTERPRO (15 domaines trouvés). En outre, nos homologues de BLAST ont de très bonne E value (la meilleure étant de 5e-60, et la plus faible 9.8), ainsi que nos domaines protéiques trouvés dans INTERPRO (5.0E-67 pour le domaine sélectionné).

Notre ORF étant tronqué en 3', nous avons estimé après avoir fait l'alignement multiple, à 400 le nombre d'acides aminés manquant. De plus, grâce à l'alignement multiple nous avons pu déterminer la méthionine d'initiation, qui semble être le troisième acide aminée de notre ORF.


La plupart de nos résultats BLAST nous ont donné des homologues étant des alpha L fucosidase. Dans INTERPRO, le meilleur domaine protéique que l'on ait obtenu avec une E valeur de 5.0E-67, correspond a une Glycoside hydrolase. Or, la alpha L fucosidase fait partie de la famille des Glycosides hydrolases. Cette famille de protéines a pour fonction d'hydrolyser les liaisons glycosidiques.


Au niveau taxonomique, le premier arbre nous a d'abord fait penser que notre ORF appartenait aux bactéries. Cependant, comme nous l'avons présenté précédemment, nous avons fait un deuxième arbre incluant des eucaryotes en vu de confirmer que notre ORF faisait partie des bactéries. Or les résultats obtenus ne coïncident pas, les eucaryotes prenant place au sein des bactéries. Nous ne pouvons alors pas conclure que notre ORF fait partie du groupe des bactéries, ou des eucaryotes.


[b][u]Quant aux autres ORF[/u][/b] :

Nous avons vu au cours de notre recherche d'ORF, qu'un deuxième ORF est exploitable. Celui ci a de nombreux homologues avec BLAST (contre NR) (>1500 homologues) avec comme meilleure E value 2e-38. Cet ORF est, quant à lui, complet en 3' mais incomplet en 5'. Il aurait donc été intéressant de pousser l'analyse avec cet ORF également.  

Les trois autres ORF trouvés sont de petites tailles (64 acides aminés pour le premier, 61 pour le quatrième et 71 pour le cinquième), et ne possèdent que très peu voir pas d'homologues (respectivement 0, 2 et 5). Ils auraient donc été peu exploitables.

ORF finding

PROTOCOLE:

a)Site : SMS ; Outil : ORF Finder ; Paramètre : initiation : any codon, cadre : 1 2 et 3, brin direct, min : 60 AA, code standard

b)Site : SMS ; Outil : ORF Finder ; Paramètre : initiation : any codon, cadre : 1 2 et 3, brin reverse, min : 60 AA, code standard



ANALYSE DES RÉSULTATS:


Voici le tableau récapitulant nos résultats de la recherche d'ORF :


        |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet| nombre de hits   |

        | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'   |blast NR EV<1E-10 |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|

        |               |          |         |           |            |               |             |                  |

  ORF 1 |      194      |    64    |  direct |    445    |     639    |      oui      |      oui    |        0         |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|

        |               |          |         |           |            |               |             |                  |

  ORF 2 |      470      |   156    | reverse |     1     |    471     |      non      |      oui    |       1889       |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|

        |               |          |         |           |            |               |             |                  |

  ORF 3 |      500      |   166    | reverse |     472   |    972     |      oui      |    non      |       5278       |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|

        |               |          |         |           |            |               |             |                  |

  ORF 4 |      185      |   61     | reverse |     497   |    682     |      oui      |    oui      |       2          |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|

        |               |          |         |           |            |               |             |                  |

  ORF 5 |      215      |   71     | reverse |     117   |    332     |      oui      |    oui      |       5          |

  ______|_______________|__________|_________|___________|____________|_______________|_____________|__________________|


Nous avons trouvé 5 ORFs sur la séquence d'ADN.

L'ORF 1, qui se situe sur le brin direct, est court et de plus ne possède aucun homologue connu dans la banque de donnée nr. On peut donc éliminer cet ORF, puisque l’existence de ce gène est peu probable bien que possible. Cependant nous ne pourrons pas effectuer la suite des analyses avec cet ORF puisqu'il n'a aucun homologue connu dans la banque de donnée nr.

Les ORFs 4 et 5, qui se situent sur le brin indirect, sont courts et possèdent peu d'homologues. De plus, l'E-value des BLAST correspondant sont respectivement de 7.0 et 4.3, ce qui est très élevé. On peut donc éliminer ces deux ORFs, bien qu'il soit possible que ces gènes existent sans avoir d'homologues connus, mais cela est peu probable.

Pour les ORFs 1, 4 et 5 les résultats obtenus sont insignifiants par rapport à nos deux ORFs candidats (qui sont significatifs).


Les ORFs 2 et 3, qui se situent sur le brin indirect, sont tous deux de grandes tailles : 470 nucléotides pour l'ORF 2 et 500 nucléotides pour l'ORF 3 (soit 156 et 166 acides aminés). De plus, ils possèdent de nombreux homologues (1889 homologues potentiels pour l'ORF 2 dans la banque de donnée nr, et 5278 pour l'ORF 3) avec des E values très faibles : 2e-38 pour la meilleur E-value pour l'ORF 2 et 5e-60 pour la meilleure E-value pour l'ORF 3. De ce fait, les deux ORFs peuvent convenir pour la suite des analyses. Nous choisirons par défaut l'ORF numéro 3 qui possède plus d'homologues, le premier ayant une E value de 5e-60 et 55% d'identité. De plus cet ORF est tronqué puisqu'il manque une partie de la séquence en 3'. Il est donc possible que l'identité soit plus importante avec la séquence complète.


On remarque également que l'ORF 2 s'étend de la position 1 à la position 471, tandis que l'ORF 3 va de la position 472 à 972. Ces deux ORFs se suivant, on peut penser que notre séquence possèdent deux gènes tronqués en N-ter pour le premier et en C-ter pour le deuxième.



Dans la rubrique "Début ORF" nous avons changé la position du codon d'initiation après avoir trouvé la potentielle méthionine d'initiation. En effet, dans l'alignement multiple on peut voir que la première methionine de notre ORF est alignée avec les méthionines d'initiation des autres séquences et que rien ne s'aligne en amont de cette position. On voit que la position de cette méthionine correspond au troisième codon de la protéine correspondant à notre ORF, il s'agit donc du nucléotide 478 de notre séquence complète initiale.

RÉSULTATS BRUTS:
a) brin direct
>ORF number 1 in reading frame 1 on the direct strand extends from base 445 to base 639.
TCCTTAGCAATAAGTGACATAACAGATAACAATATTAACCCAAAGTACCTCATGAAATCC
TACTCCATTGGTGATTCTATTTGCGGAAGATACCCATTTTCGATAAAGGTCATTATTCCA
AATAATGCGCCCCAGGAATGGAACCTGTCAGATGATAATCTTGAATCATCGCCTGTCCCG
GTAATAGCTGAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SLAISDITDNNINPKYLMKSYSIGDSICGRYPFSIKVIIPNNAPQEWNLSDDNLESSPVP
VIAE*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


b) brin reverse
>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 471.
ACTGATGTGGATTCGCTTTCAACCCGGGTTTCACCCACCTTATTTTATCCGCTCATGGCA
AAAGTGGGAAATGACGAAAAAAACGAAATAATTATGGAACATTTCTACAATACTGAAGAA
TTTTATGGAGAATGGATGTTACCTTCCACAACTCGGAACGATCCAACATTTTCGCAACAG
CGCTATTGGAAAGGTGCCATATGGCCACCTCTGAATTTTCTCACTTATTTAAGTCTTCGC
CAGGCAGGCTACACCGATGCTGCAACCGAGTTATCGGAAAAATCATTAAAACTTATTATG
ACAGAATGGACGCGAAAAGGTTATGTGAGTGAGAATTATTCAGCTATTACCGGGACAGGC
GATGATTCAAGATTATCATCTGACAGGTTCCATTCCTGGGGCGCATTATTTGGAATAATG
ACCTTTATCGAAAATGGGTATCTTCCGCAAATAGAATCACCAATGGAGTAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
TDVDSLSTRVSPTLFYPLMAKVGNDEKNEIIMEHFYNTEEFYGEWMLPSTTRNDPTFSQQ
RYWKGAIWPPLNFLTYLSLRQAGYTDAATELSEKSLKLIMTEWTRKGYVSENYSAITGTG
DDSRLSSDRFHSWGALFGIMTFIENGYLPQIESPME*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 472 to base 972.
GATTTCATGAGGTACTTTGGGTTAATATTGTTATCTGTTATGTCACTTATTGCTAAGGAT
TATGAACCAAATTGGGAATCCCTGGATTCTCGTCCCACGCCCCAATGGTATAAAGATGCC
AAGTTTGGGATCTTCATTCACTGGGGGCTCTATTCCGTACCTGCTTGGGGACCAAGGGGG
AGTTATGCAGAATGGTATCTCAATGGATTAAAGTCAGGTGACAGCACACGTCTAAAATAT
CACGAAGAAAATTATGGGAAAGATTTTCCATACCGAGATTTCATTAAATTATTCAAATCG
GAAAAATATGAGCCCGAAAAATGGGCAGAATTGTTTAAAGAATCCGGCGCTAAATATATA
GTGCTCACTTCCAAGCATCATGATGGATTTTGTCTCTGGCCCAGCAAAGAAAGTAATGGC
TATAATTCTGTGGAGGGTGCTGCGAAAAGAGACCTCCTTGGGGACTTAAATACAGCTGTG
AAAAAGTCCGGGCTCAAATCT

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
DFMRYFGLILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRG
SYAEWYLNGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYI
VLTSKHHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLKS

>ORF number 1 in reading frame 2 on the reverse strand extends from base 497 to base 682.
TATTGTTATCTGTTATGTCACTTATTGCTAAGGATTATGAACCAAATTGGGAATCCCTGG
ATTCTCGTCCCACGCCCCAATGGTATAAAGATGCCAAGTTTGGGATCTTCATTCACTGGG
GGCTCTATTCCGTACCTGCTTGGGGACCAAGGGGGAGTTATGCAGAATGGTATCTCAATG
GATTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
YCYLLCHLLLRIMNQIGNPWILVPRPNGIKMPSLGSSFTGGSIPYLLGDQGGVMQNGISM
D*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 117 to base 332.
AGAATTTTATGGAGAATGGATGTTACCTTCCACAACTCGGAACGATCCAACATTTTCGCA
ACAGCGCTATTGGAAAGGTGCCATATGGCCACCTCTGAATTTTCTCACTTATTTAAGTCT
TCGCCAGGCAGGCTACACCGATGCTGCAACCGAGTTATCGGAAAAATCATTAAAACTTAT
TATGACAGAATGGACGCGAAAAGGTTATGTGAGTGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
RILWRMDVTFHNSERSNIFATALLERCHMATSEFSHLFKSSPGRLHRCCNRVIGKIIKTY
YDRMDAKRLCE*

Multiple Alignement

PROTOCOLE:

a) Site : Phylogeny.fr ; Outils : MUSCLE ; Paramètre par défaut

b) Site : Phylogeny.fr ; Outils Gblocks ; Paramètre modifié : "Allow smaller final blocks" et "Allow less stric flancking position"


ANALYSE DES RÉSULTATS:


Avec l'alignement par MUSCLE, on peut supposer où se trouve la méthionine correspondant au codon d'initiation. A la position n°A (voir sur résultats bruts), on peut voir la plupart des séquences homologues qui commencent à cette position avec une méthionine. Il s'agit certainement de la méthionine d'initiation. On voit que notre ORF est décalé de trois résidus : la première méthionine se trouve en position 3. On peut donc penser que la méthionine d'initiation est bien la première méthionine que l'on rencontre dans notre ORF. (* _ méthionine d'initiation) De plus, cela correspond aux résultats trouvés dans la recherche de domaines protéiques conservés : le domaine sélectionné commençait aux résidus de position 3 sur notre ORF, ce qui correspond à notre méthionine d'initiation. En outre, il n'y a pas d'alignement en amont de cette position.

De plus cela confirme que notre séquence est bien complète en N-ter, la méthionine d'initiation étant en position 3, nous avons deux résidus supplémentaires soit 6 nucléotides en plus.


On voit qu'une grande partie de la protéine a été tronquée en C-ter, puisque l'alignement continue entre les autres séquences homologues et que l'on ne retrouve plus l'ORF (celui ci s'arrete à la position 728). La plupart des séquences s'alignent jusqu'à la position 1340 (approximativement). Cependant, on observe certaines parties de l'alignement où on ne retrouve qu'une seule séquence (exemple : zone B sur alignement Gblocks). Il est peu probable que notre protéine ait ces longues séquences présentes uniquement dans certains cas, on peut donc les soustraire. On peut donc estimer qu'il manque à peu près 400 acides aminés à notre protéine (soit 1200 nucléotides).


D'après l'alignement par Gblocks, on trouve quelques blocs assez conservés entre les différentes séquences homologues. Cependant, certaines zones de l'alignement peuvent être remises en question : par exemple à la Position C (position 600) sur l'alignement, on peut voir que toutes les séquences sont alignés avec l'acide aminé E (acide glutamique) sauf pour la deuxième séquence, alors qu'on peut voir qu'elle possède cet acide aminé et qu'il est placé avant l'indel. De la même manière, le D de la troisième séquence peut etre placé en position C puisque c'est un acide aminé très proche.


Quant aux indels, on en retrouve peu (à peu près 5) et de petites tailles (par exemple celui noté INDEL dans l'alignement s'étend sur 5 acides aminés). On retrouve également un INDEL important dû à une séquence plus longue (séquence Bac_Len_Len_1) qui résulte de la présence d'un domaine protéique supplémentaire chez cette espèce.



Le nombre de positions conservées est faible (78 positions) bien que nous ayons diminué la stringence. Mais on remarque qu'il y a plusieurs blocs conservés dans toutes les espèces, ce qui nous montre qu'il y a quand même homologie.

On ne remarque pas les sous groupes (groupe étude/extérieur). On retrouve soit de gros blocs conservés chez toutes les espèces pour toutes les séquences, soit de grands indels dus à certaines séquences qui s'alignent très bien avec les gros blocs mais qui sont souvent trop longues (beaucoup de domaines protéiques insérés). Il est donc difficile de cerner nos deux groupes (étude/extérieur).

De plus, L'ORF n'a pas de signes particuliers qui le distinguent des autres séquences contrairement à la séquence L qui présente une extension en N-ter, ou la séquence M qui a une extension en C-ter. Notre ORF est donc typique de cette famille.


Le domaine sélectionné dans INTERPRO s'étend de la position 3 à 166 de la séquence de notre ORF. En regardant l'alignement multiple dans cette zone (ZONE I), on remarque principalement une région conservée (bloc). Il s'agit surement d'une région conservée de la protéine dans les différentes espèces.


Dans un second temps, nous avons tenté de recommencer l'alignement et la construction de l'arbre en enlevant certaines séquences qui s'alignaient mal. Cependant, l'arbre obtenu avec ce nouvel alignement était très différent de celui présenté à la rubrique suivante, et pas plus robuste. Nous avons donc décidé de ne pas le faire apparaître ici car l'arbre initial nous semble de meilleur qualité. Ceci nous confirme que notre alignement est peu robuste puisque qu'en enlevant quelques séquences l'arbre qui en résulte se trouve modifié.

RÉSULTATS BRUTS:
a) Alignement MUSCLE format CLUSTALw
Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      MKFAKFLLKLSFAAGSFAAIAAEQPNILFIMSDDHTTQGIGAYGGRLAKFNPTPTIDTLA  <---------- Sequence L 
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      EEGALLSNTFCTNGICTPSRASIMTGQYSAVNGAPILADSLPKEKQYLAQEMKKAGYSTA
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      VIGKWHLHDRPDAFDYYKVLKGQGKYFDPSFFETGKKGMVKMQGHSSDCITDSVLDYLEN
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               
                                                                POSITION N°  A  <------
Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ----------------------------------------------------------MK
Bac_Pro_Bet_1      -----------------------------------------------------PMPALPA
Bac_Spi_Spi_1      ----------------------------------------------------------ML
Bac_Act_Act_1      ----------------------------------------------MPKDPQHAGTSRIT
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ----------------------------------------------------------MK
Bac_Bac_Fla_1      ----------------------------------------------------------MI
Bac_Bac_Fla_2      ----------------------------------------------------------MR
Bac_Bac_Fla_3      ----------------------------------------------------------ML
Bac_Bac_Bac_4      ----------------------------------------------------------MK
Bac_Bac_Bac_1      ----------------------------------------------------------M-
Bac_Bac_Bac_2      ----------------------------------------------------------MK
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      RDKTKPFFLKYHFKAPHDMFENAPRYDSYLKDAVIPEPANMWERGNHGSIATRGHNDELI
Bac_Bac_Bac_3      ----------------------------------------------------------MK
Bac_Bac_Cyt_3      ----------------------------------------------------------MK
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ----------------------------------------------------------DF
Bac_Bac_Bac_5      ----------------------------------------------------------MR
Bac_Bac_Sph_1      ----------------------------------------------------------MK
Bac_Bac_Sph_3      ----------------------------------------------------------MK
Bac_Bac_Cyt_2      ----------------------------------------------------------MK
Bac_Pla_Pla_1      ----------------------------------------------------------ML
Bac_Bac_Sph_6      ----------------------------------------------------------MK
Bac_Ver_Opi_1      ----------------------------------------------------------MK
Bac_Aci_Aci_1      ----------------------------------------------------------MM
Bac_Aci_Sol_1      ----------------------------------------------------------MR
Bac_Bac_Sph_4      ----------------------------------------------------------MK
Bac_Bac_Sph_8      ----------------------------------------------------------MK
Bac_Bac_Cyt_4      ----------------------------------------------------------MK
Bac_Bac_Fla_4      ---------------------------------------------------------MKS
Bac_Ten_Mol_1      ----------------------------------------------------------MY
Bac_Act_Act_2      ----------------------------------------------------------ME
Bac_Pro_Alp_1      ---------------------------------------------------------MIR
Bac_Dic_Dic_1      ----------------------------------------------------------MK
Bac_Arm_Cht_1      ----------------------------------------------------------MS
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               
                   *
Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      KRAI-----------MAALLGLTVH-----------------------------------
Bac_Pro_Bet_1      KQAPDSVA-------MGDAQSAPVV-----------------------------------
Bac_Spi_Spi_1      NFFGFKPL-------FAHLKSLILS-----------------------------------
Bac_Act_Act_1      RRSLFAGSVAVGLSALSLSSARASV-----------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      IKYIA----------LAFTLLLAYS-----------------------------------
Bac_Bac_Fla_1      KKVRRKLF-------VCLMGSLFLC-----------------------------------
Bac_Bac_Fla_2      KIWVF----------VLIMMLLFGS-----------------------------------
Bac_Bac_Fla_3      KKVTI----------LFVFLCIVYS-----------------------------------
Bac_Bac_Bac_4      KVIS-----------LSIMLAFVLM-----------------------------------
Bac_Bac_Bac_1      ---------------FCLLVAISSM-----------------------------------
Bac_Bac_Bac_2      THLIA----------IFCLVSISLM-----------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      HKIGTSIGKRNPRRNMGLDLSKVFPDEAISQELSDKQYKKQAYQTYIKKYLRCVKGVDDN
Bac_Bac_Bac_3      KTLFIS---------FILSLGLHYS-----------------------------------
Bac_Bac_Cyt_3      KSL------------FFLLLFFAFT-----------------------------------
Bac_Bac_Sph_5      ---------------MLPAMLMVLT-----------------------------------
ORF                MRYFG----------LILLSVMSLI-----------------------------------
Bac_Bac_Bac_5      TKIAS----------LVMLLLLLPM-----------------------------------
Bac_Bac_Sph_1      KIVKY----------LLLCMFLFSQ-----------------------------------
Bac_Bac_Sph_3      KHTFY----------ITLSVSLFLM-----------------------------------
Bac_Bac_Cyt_2      KLLV-----------LGLLLNLSLI-----------------------------------
Bac_Pla_Pla_1      NRVPQ----------LCLLTLSLFC-----------------------------------
Bac_Bac_Sph_6      KII------------LYAAAFLLGC-----------------------------------
Bac_Ver_Opi_1      T--------------LACALLLCVS-----------------------------------
Bac_Aci_Aci_1      KRWLL----------LTLMSAVPLF-----------------------------------
Bac_Aci_Sol_1      RRDILR---------ACAAAPLALA-----------------------------------
Bac_Bac_Sph_4      RRTLIKGG-------LAAASSLWLS-----------------------------------
Bac_Bac_Sph_8      RRTLIKGM-------AATLPSMWLS-----------------------------------
Bac_Bac_Cyt_4      KSIFIV---------MLFAVLLTAC-----------------------------------
Bac_Bac_Fla_4      GKYIVLSF-------FILSLTILSC-----------------------------------
Bac_Ten_Mol_1      KKIS--------------------------------------------------------
Bac_Act_Act_2      TD-------------EDMRRDLAAI-----------------------------------
Bac_Pro_Alp_1      RSSRLTGGRLIRACLLATALSVPAG-----------------------------------
Bac_Dic_Dic_1      YKMP--------------------------------------------------------
Bac_Arm_Cht_1      SRRRLSPRWRWREIGAAALFLLLPC-----------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      VKRVVDYLKKEGLYDNTVIIYTGDQGFMLGEHDYIDKRWAYEETMRMPMIIRYPKSVKAG
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      SKYDFINENVDFAPTMLDFAGVATPEYMQGSSFKDELETGKENASTKQAAYYHYWMNMFH
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      HDNPAHIAIRTKTHKLIMFYGSSWSNEPLTPPAWELYDLVKDPSEMNNVYDKSENVELIK
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      --------------------------------------------------LTAPAQQPT-
Bac_Pro_Bet_1      ---------------------------------------------KLDLPVTAGPFQPTW
Bac_Spi_Spi_1      -------------------------------------------------------YILNI
Bac_Act_Act_1      ---------------------------------------------LHREAPFPGVYQPTW
Bac_Chl_Chl_1      -----------------------------------------------------MMYEPTL
Bac_The_The_1      ------------------------------------------------MISMKPRYKPDW
Bac_Fir_Clo_1      --------------------------------------------------MGDVRFTGNW
Bac_Fir_Clo_2      --------------------------------------------------MGDVRFTGNW
Bac_Bac_Cyt_1      ------------------------------------------------QMATAQKYEADW
Bac_Bac_Fla_1      ----------------------------------------------IGSLQAQENYKPTW
Bac_Bac_Fla_2      -----------------------------------------------EKLTAQKKYEPTW
Bac_Bac_Fla_3      -----------------------------------------------GVAQTQKQYQPTW
Bac_Bac_Bac_4      ------------------------------------------------MKAQEKVYQPTW
Bac_Bac_Bac_1      ---------------------------------------------------AQNSYQPNW
Bac_Bac_Bac_2      ---------------------------------------------------GQKTYAPAW
Bac_Pro_Gam_1      --------------------------------------------------MTNKTYQPDW
Bac_Len_Len_1      QLKDQLKQMRADYKEDDKKFPFNEIIEDFWDYDEEDRRKALEISKRFAASPMKERYSADW
Bac_Bac_Bac_3      ---------------------------------------------------YAQEYKSTW
Bac_Bac_Cyt_3      ---------------------------------------------------TKAQYAPQW
Bac_Bac_Sph_5      --------------------------------------------------VSSQQYQPTW
ORF                ----------------------------------------------------AKDYEPNW
Bac_Bac_Bac_5      ------------------------------------------------AGVRAQDKIKTW
Bac_Bac_Sph_1      -------------------------------------------------SLRAQDYQANW
Bac_Bac_Sph_3      ---------------------------------------------TISPGNFAQTYQPEW
Bac_Bac_Cyt_2      -------------------------------------------------KVEAQTYKPKW
Bac_Pla_Pla_1      ----------------------------------VCAANAQQTASVETESQSAQREADAW
Bac_Bac_Sph_6      ------------------------------------------------APLAAQQYSADW
Bac_Ver_Opi_1      ---------------------------------------------WSAFAGAPTTYQPTW
Bac_Aci_Aci_1      ----------------------------------------------------AQTYQPDW
Bac_Aci_Sol_1      ---------------------------------------------AGQRAFGQTRYQPTW
Bac_Bac_Sph_4      ------------------------------------KSSANNLFLSGEGVKAAGPFQPTW
Bac_Bac_Sph_8      ----------------------------------GAFGSNFLKEQHLGEPIAKGPFNPSW
Bac_Bac_Cyt_4      ------------------------------------------QTKDVNKTVNNTPFEANW
Bac_Bac_Fla_4      --------------------------------------ADKKDKKEEIAQETKPVYEANW
Bac_Ten_Mol_1      ---------------------------------------------EIEKVINEGPFKDTW
Bac_Act_Act_2      -----------------------------------------------DEVIERGRFKPDW
Bac_Pro_Alp_1      AALAAKQPSAPATAPTADTLSPAQIDLQWEKRGAKHVSDIAAELKQVEQGDGQGPFRPDW
Bac_Dic_Dic_1      ----------------------------------------------------EGPFEPTW
Bac_Arm_Cht_1      -------LAWGQGEGSTQNQLINPSQPYWLQWKSMYPSRVEAILQKADAVIARGPFQANW
Bac_Bac_Sph_7      -------------------------------------------------------YQSNW
                                                                               

Bac_Cya_Chr_1      ----------MNWFESARLGMFIHWGHSSSRGW--------------------------E
Bac_Bac_Sph_2      ----ENKA-KMEWFEDAKLGIFIHWGIYSVQGISE------------------------S
Bac_Pro_Bet_1      ESIAQQYPGTPAWLREAKFGIWVHFGPQAAGMSGD-------------------------
Bac_Spi_Spi_1      MKP-DK---ITQW-QKLGFGMFIHYGLYSLCGGV--------------------------
Bac_Act_Act_1      ASL-DSHP-LPTWFDDAKLGIFIHWGIFSVPAWAP-----------RGE--------YAE
Bac_Chl_Chl_1      ESV-RAHI-VPDWFHDAKLGIFIHWGLYSVPGWAPTTGPLHDVVAKEGWKEWFRRNPYAE
Bac_The_The_1      ESL-REHT-VPKWFDKAKFGIFIHWGIYSVPGWATPTGEL----GKVPMDAWFFQNPYAE
Bac_Fir_Clo_1      NSV-NAHT-VPKWYEDCKFGIFIHWGIYSVPAFAPHTWEL----GEVDSKEWFADNPYAE
Bac_Fir_Clo_2      NSV-NAHT-VPKWYEDCKFGIFIHWGIYSVPAFAPHTWEL----GEVDSKEWFADNPYAE
Bac_Bac_Cyt_1      ASL-DQRP-IPGWFEDAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_1      ESL-DSRP-VPDWFHDAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_2      ESI-DSRK-TPDWFGNAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_3      ESI-DSRS-VPNWFGGAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Bac_4      ESL-DSRP-VPSWFGNAKFGIFIHWGLYSVPAWSP-----------KGT--------YAE
Bac_Bac_Bac_1      ESL-DKRP-VPAWFENAKFGIFIHWGLYSVPAWSP-----------KGT--------YSE
Bac_Bac_Bac_2      ESL-DTRP-VPSWFENAKFGIFIHWGLYSVPMWSP-----------KGT--------YSE
Bac_Pro_Gam_1      ASL-DSRE-MPQWFNEARFGIFIHWGVYSVPSWRKINNTL------FGS--------YAE
Bac_Len_Len_1      DSL-DSRP-VPAWYNKAKFGIFIHWGLYSVPAFAP-----------HGT--------YAE
Bac_Bac_Bac_3      ESI-DSRP-IPEWFSEAKFGIFIHWGLYSVPAWAPTNGPV------YEK--------YSE
Bac_Bac_Cyt_3      SSL-DQRP-TPAWFEDAKFGIFIHWGLYSVPAWATLSNAD----GFGSY--------YSE
Bac_Bac_Sph_5      ESL-ESRP-IPQWYPNAKFGIFIHWGLYSVPAWATNSNAD----GFGSN--------YAE
ORF                ESL-DSRP-TPQWYKDAKFGIFIHWGLYSVPAWGP-----------RGS--------YAE
Bac_Bac_Bac_5      DEL-DRRP-IPKWWTDAKFGIFIHWGVYSVPAYAPVKEVK----GVYEK--------YAE
Bac_Bac_Sph_1      QSI-DQRE-IPQWWQDAKFGIFIHWGPYSVPAYAPIKEVE----GVYEK--------YAE
Bac_Bac_Sph_3      QSL-DKRQ-TPSWWTDAKFGIFIHWGLYSVPAYAPVNEVK----GVYEK--------YAE
Bac_Bac_Cyt_2      ESL-DKRE-TPTWWTDAKFGIFIHWGPYSVPAYAPVNEVE----GVYEK--------YAE
Bac_Pla_Pla_1      KAI-DARP-TPQWWRDAKFGIFIHWGPYSVPAFSEVGR-------------------YSE
Bac_Bac_Sph_6      ASL-NKRG-IPAWFNQAKFGIFIHWGVYAVPSFAVV---G------PGG--------YSE
Bac_Ver_Opi_1      ESL-DQRP-MPAWYREAKFGVFIHWGVYSVPAWGQ-----------HGE--------YAE
Bac_Aci_Aci_1      NSL-DKRP-TPAWFSDAKFGIFIHWGVYSVPAYAPVIP-G------KLA--------YAE
Bac_Aci_Sol_1      ESI-DARP-SPAWYTDSKFGIFIHWGVYSVPSYAPVKSKG------ETM--------YAE
Bac_Bac_Sph_4      ESL-AKYQ-VPDWFRDAKFGMWAHWGPQCQPERGD-------------------------
Bac_Bac_Sph_8      ESL-QHYK-TPEWFRDAKFGIWAHWGPQCQPEAGD-------------------------
Bac_Bac_Cyt_4      ESL-KTYQ-TPPWFQDAKLGIFIHWGPYSVPAFGS------------------------E
Bac_Bac_Fla_4      ESIKKNYK-DPTWFNKKKFGIFIHWGAYSVPEYSS------------------------E
Bac_Ten_Mol_1      ESL-QKKN-IPSWFKNSKFGIFIHWGLYSVPAFNN------------------------E
Bac_Act_Act_2      ESL-QQHR-TPRWFEEAKFGIFIHWGVYSVPAFGS------------------------E
Bac_Pro_Alp_1      ASL-KNYQ-VPQWYADAKFGVFIHWGLYSVPAFGS------------------------E
Bac_Dic_Dic_1      ESL-KNYK-IPEWYKDAKFGIFIHYGVYAVPAFGS------------------------E
Bac_Arm_Cht_1      ASL-VRYQ-IPKWYLDAKLGIFIHWGVYSVPAFGS------------------------E
Bac_Bac_Sph_7      ESL-KKYQ-VPDWFRDAKFGIFIHWGVYSVPAFKN------------------------E
                               *     :*:: *:*  .                               

Bac_Cya_Chr_1      LSWPLVGGV--------------------FSLPYCQDVAIAEYHQNASNFKPTD--YNPR
Bac_Bac_Sph_2      WAFFNNYIN------------------------------HENYMKQLNGFTASK--YKPN
Bac_Pro_Bet_1      WYARRMYVP-----------G---TTAYANHLKDYGHPSQVGYKELLRDWNPRK--LDPA
Bac_Spi_Spi_1      WKGEPIKRG------------------YSEQILSHGKIPKEEYKALQNKFTCKN--FDAE
Bac_Act_Act_1      WYPESMRDP-----------N---NPTYTYHRQTYGA--DFKYRDFIPMFRAQR--WDPE
Bac_Chl_Chl_1      WYMNSLRIP-----------G---SPTVDYHAQHFGA--DFPYERFAETFNRETAAWDPA
Bac_The_The_1      WYENSLRIK-----------E---SPTWEYHVKTYGE--NFEYEKFADLFTAEK--WDPQ
Bac_Fir_Clo_1      WYYNSLNIG-----------K---GPTYKHHIEKYGK--DFKYEDFIPMWKAEN--WDPK
Bac_Fir_Clo_2      WYYNSLNIG-----------K---GPTYKHHIEKYGK--DFKYEDFIPMWKAEN--WDPK
Bac_Bac_Cyt_1      WYQYWLQSK--SLFGNGDFKG---DEVYEYHKKTYGD--DFTYYDFGPEFTADL--FDPE
Bac_Bac_Fla_1      WYQYWLQDE--TLFGNGDFTG---KEIVDFHNETYGE--DYSYYDFGKEFKADL--FEPD
Bac_Bac_Fla_2      WYQYWLQNK--TLFGNGNFKG---DEVVNYHEKTYGK--DFTYYDFGEMFTADL--FEPD
Bac_Bac_Fla_3      WYQYWLQSE--ALFGNGDFKG---DEVTKYHHKTYGK--NFDYYKFGEMFKADL--FEPD
Bac_Bac_Bac_4      WYKHWADKK--DLFGNGDFKG---DEVYEYHKKMYGE--K-SYADFAAMFKALD--YNPV
Bac_Bac_Bac_1      WYKYWLDKK--TLMGNGDFKG---TEVYDYHVEMYGR--DFTYADFAPMFRALS--YNPD
Bac_Bac_Bac_2      WYKYWLDRK--TLLGNGDFTG---TEVYDYHKKMYGE--DFTYADFAPMFKAMS--YDAN
Bac_Pro_Gam_1      WYYASVYGQ----------YR---NNDDDFHQRNYAP--DFLYRDFAPQFKAEL--FQPE
Bac_Len_Len_1      WYWNALKVKPVGKKEIKMSRH---LKVNEFHNRVYGK--DFGYEDFREQFTCEM--FDPN
Bac_Bac_Bac_3      WYWARQNPS-----------DKPFPAFTDFHNKMYGE--KIGYTDFVSGFKAEM--FDPA
Bac_Bac_Cyt_3      WYWERLNNS-------KLKIH---KEFVDFHQRVYSG--K-PYQEFAHDFKAEL--FEPS
Bac_Bac_Sph_5      WYWQRLIND-------KLKIH---KEFVDFQNRVYGP--NFKYPDFAPMFKAEL--FDPS
ORF                WYLNGLKSG-----------D---STRLKYHEENYGK--DFPYRDFIKLFKSEK--YEPE
Bac_Bac_Bac_5      HYEARLKSG-----------N---KLFTDFHNRTYGK--NFKYADFAPMFKAEY--FRAD
Bac_Bac_Sph_1      HYENRLKTK-----------N---KLFLDFHNKTYGP--NFTYQDFAPLFKAEH--FKPE
Bac_Bac_Sph_3      HYENRLIQG-----------N---KLFTDHHKQFYGE--QFKYSDFAAMFKAEY--FKPE
Bac_Bac_Cyt_2      HYENRLLQK-----------N---KLFTDHHNRYFGE--NFTYQDFAPQFKAEY--FNPD
Bac_Pla_Pla_1      WYWMDLANP-------KRRSH---KIVKKFHNRVYGE--RFTYPDFVPMFTCEL--FDAD
Bac_Bac_Sph_6      WYWYQLDGA-------NDETH---KKVRAFHDKNYGK--DFGYQQFESQFKAEL--FDPA
Bac_Ver_Opi_1      WYWERVKSP-----------KPEHAAWAEFHRQNYGP--RFDYMDFAPRFTAEL--FDAK
Bac_Aci_Aci_1      WYWHQMTEG-----RDNPKANPIETGTWAYHQKMYGA--DYKYQNFAPQFRAQL--FDPD
Bac_Aci_Sol_1      WYWNSLNKA-----------N---SSTRKFHDRVYGT--DFKYFDFAPLFRAEL--YDPA
Bac_Bac_Sph_4      WYARGMYQE-----------G---SDQYKYHCKKYGHPSKFGFKDVINEWKAER--WDPE
Bac_Bac_Sph_8      WYARNMYEE-----------G---SRQYKFHLKKYGHPSKFGFKDVINEWKAEK--WDPE
Bac_Bac_Cyt_4      WYPRWMYMDSVQWNPDGEVTSEEPSWVYQHHVDTYGSPAEFGYKDFIPMFKAEK--FNAT
Bac_Bac_Fla_4      WYPRKMYMDTATFSAQLNLEKKGPSDVYLHHKKEWGDQKKFGYKDFIPMFKGEN--FDAN
Bac_Ten_Mol_1      WYSRNMYIE-----------G---MEEFKHHIETYGAHKGFGYKDFIPMFKADK--FDPS
Bac_Act_Act_2      WYSRNMHVQ-----------G---SPEFEHHVKTYGPQKDFGYKDFIPMFKAER--FDPD
Bac_Pro_Alp_1      WYSRLMYTK-----------G---TKEYDHHIKTFGPQDKFGYKDFIPLFKAEK--YDPR
Bac_Dic_Dic_1      WYSRNMYVE-----------G---SPEYEHHLKTYGEHKKFGYKDFIPLFKAEK--FDPY
Bac_Arm_Cht_1      WYPREMYLQ-----------N---SATFKHHVATYGPQNRFGYKDFIPMFKAEK--FDPM
Bac_Bac_Sph_7      WYPRNMYQQ-----------G---SEEYKHQVEKYGPMDKFGYKDFIPQFKAEK--FNAD
                                                             :      :        . 

Bac_Cya_Chr_1      LWASLAKRLGVEYVILTTKHHDGFSLFPTTTSD------FCYGGGNSQQDLVKQFVEAMR
Bac_Bac_Sph_2      EWAQLIHDSGAKYSVITTKHHDGVSLWDSKADKAI----TIKKDAQARQDVLDPFVKALQ
Bac_Pro_Bet_1      KLTALYKEAGARFLLVQGVHHDNFDLWDSRYQP------WNSVRLGPKRDLLGEWAAAAR
Bac_Spi_Spi_1      KICALAKAAGMKYIIITAKHHDGFCLFDTKTTG------YNSVKAPAKRDLIAELSQACK
Bac_Act_Act_1      EWADLFASAGARYVVPVGAHHDGFPLWNTRTTE------WNSVTMGPKRDILQQLGAAVR
Bac_Chl_Chl_1      VWADLFKRAGAQYVVLTTKHHDGFLLWPSARPN------PFRAGYHATRDLVGDLTSAVR
Bac_The_The_1      EWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTD------FNSVKRGPKRDLVGDLAKAVR
Bac_Fir_Clo_1      QWAEIFKEAGAEYVVLTTKHHDGFCLFPSKYTH------FNSVEMGPKRNITGELTEAVR
Bac_Fir_Clo_2      QWAEIFKEAGAEYVVLTTKHHDGFCLFPSKYTH------FNSVEMGPKRNITGELTEAVR
Bac_Bac_Cyt_1      AWASLFEKAGAKYIVLTSKHHDGFTLWPNEQAN-DRGFAWNSMEVGAKRDLVGELTQAVR
Bac_Bac_Fla_1      QWASLFKESGARYVILTSKHHDGFALWPSEEAND-RGFPWNSKEVGARKDLLGELSESVK
Bac_Bac_Fla_2      AWATLFKNSGAKYIVLTSKHHDGYTLWPNKEAND-RGFAWNSMEVGAKRDLVGELSKSVK
Bac_Bac_Fla_3      KWASLFEEAGAKYVVLTSKHHDGFTLWPNKEAND-RGFAWNSMEVGSKKDLVGELSNAVK
Bac_Bac_Bac_4      QWAELFEKAGAKYVVLTTKHHDGYALWPSKEASRDFGRPWNSMDIGPGRDLVGEFTEAVR
Bac_Bac_Bac_1      EWAKLFERSGAKYVVLTTKHHDGFALWPSKEASSSYGRPWNSMEIGAHRDLVGEYVDALR
Bac_Bac_Bac_2      EWADLFKRAGAKYIVLTTKHHEGFALWPSKEASKSYGRPWNSMEIGAHRDLVGEYVNALR
Bac_Pro_Gam_1      AWAALFKSSGAKYVVLTTKHHDGFCLWPTENRHKKG---WNSGDTGPKRDLLGDITQAVR
Bac_Len_Len_1      QWADIFKKSGAKYVVLTAKHHDGYTLWPNKEASKSFGMPWNTVDSGPGRDLCQELGDAVR
Bac_Bac_Bac_3      KWAEIFKQSGAKYIVLTSKHHDGFALWPSEQAWN-----WNSEEVGPHRDLAGDLSEAIK
Bac_Bac_Cyt_3      KWADILENSGAKYVVLTSKHHEGFTMWPSKYSWN-----WNAGDIGPRRDLLGDLTKAVK
Bac_Bac_Sph_5      KWAQIFKDAGAKYVVLTSKHHDGFALWPSRESWN-----WNAMDAGPHRDLAGDLSKAVK
ORF                KWAELFKESGAKYIVLTSKHHDGFCLWPSKESNG-----YNSVEGAAKRDLLGDLNTAVK
Bac_Bac_Bac_5      DWAKLFRKAGARYVVLTSKHHDGFCLWNSRYSPH-----WNSVVMGPHMDIMDSISRAVT
Bac_Bac_Sph_1      QWAELFKKAGAKYVVLTSKHHDGFCLWPSKYSPN-----WNSVDIGAHRDLAGDLTKAVR
Bac_Bac_Sph_3      EWADLFAKSGAKYVVLTSKHHDGFCLWPSAESNK-----WNSVDAGPHRDLAGDLTNAVK
Bac_Bac_Cyt_2      AWADLFQKAGAKYVVLTSKHHDGFSLWPSAFSPR-----WNSVAIGAHRDLAGDLTEAVR
Bac_Pla_Pla_1      QWAKAFEESGAKYVVLTSKHHDGYCLWPSEEADLAWGRPWNSTNSGPGRDLVGELTEAVR
Bac_Bac_Sph_6      QWADVFKRSGAKYVVLTSKHHEGYCLWDNKQADSVWGRPWNAVTGTPKRDLLGDLTSEVR
Bac_Ver_Opi_1      QWADLFARAGVRYVVPTSKHHDGFALWPSAEASRTWGRPWNAAEIGPKRDLLRELADATR
Bac_Aci_Aci_1      QWAATLADSGAKYVVLTSKHHEGFALWPSKEASATWDRPWNAVEVGPKRDLLGDVSDAVR
Bac_Aci_Sol_1      HWADVFERSGAKYVALTSKHHEGFTLWRNQQANQTWGRPWNAADIGPKRDIALDLMEAGR
Bac_Bac_Sph_4      ELVSLYKKTGARYFMALANHHDNLDLYNSKYQS------WNSTKVGPKKDLIGGWAKAAK
Bac_Bac_Sph_8      ELVSLYKSAGAQYFMALANHHDNFDLYNSKYQKD-----WNATKIGPKKDLIGGWAKAAR
Bac_Bac_Cyt_4      EWIKLFKKAGAKYVVPVAEHHDGFAMYNSNYTR------WNAVNMGPQRDVLGELSKASK
Bac_Bac_Fla_4      EWIDLFKKSGAKYVIPVAEHHDGFAMYKSNVTR------WNAVDMGPKRDILGELFKAGR
Bac_Ten_Mol_1      HWAKIIKKSGAKYVFPVAEHHDGFQMYKSDISK------WNSYEMGPKKDILGELKNAFN
Bac_Act_Act_2      AWADLFVDAGARYVVPVAEHHDGFQMYASRLSH------WNAAEMGPKRDVLGELTEAFH
Bac_Pro_Alp_1      AWAALFRAAGAQYVVPVAEHHDGFAMYDTKLSD------WSAVRMGPKRDLIGDLARAVR
Bac_Dic_Dic_1      EWADLFKKAGAKYVVPVAEHHDGFAMYDCSFTR------WCASKMGPKRDIIGELAKAVR
Bac_Arm_Cht_1      AWAKLFKAAGAKYVVPVAEHHDGFAMYNSDLTT------WCAAKMGPKRDIIGELAQAVR
Bac_Bac_Sph_7      DWATLFAKAGAKYVVPVAEHHDGFAMYKTTLSK------WNATEMGPKRDIVGELAEAIR
                            *  :      **:.  ::                   .  ::         
                         <FIN ORF-------------------------------------------------------------
Bac_Cya_Chr_1      E-AGLRVGFYFS-L-IDW---HHPDY---------------------------------P
Bac_Bac_Sph_2      K-TGLKTGLYYS-L-PDW---SH------------------------------------P
Bac_Pro_Bet_1      A-SGLRYGVAFHHE-YTWWW-WQTAFESDPTGAYAGKPYDGALTLADGKGKWWEGLDPRL
Bac_Spi_Spi_1      K-NGLKFGLYFS-W-IDWNCEFAL-----------------------------------P
Bac_Act_Act_1      A-KKMHYAPSYHQL-LNY---YT------------------------------------P
Bac_Chl_Chl_1      A-AGLRMGLYYSGG-LDWT--FNDRVIADIV----------------------------D
Bac_The_The_1      E-AGLRFGVYYSGG-LDWRFTTE------------------------------------P
Bac_Fir_Clo_1      D-AGIRMGLYYSGL-IDWQYAND------------------------------------P
Bac_Fir_Clo_2      D-EGIRMGLYYSGL-IDWQYAND------------------------------------P
Bac_Bac_Cyt_1      Q-TEVKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_1      S-AGLKMGYYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_2      A-VGLKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_3      K-KGIKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Bac_4      G-KGLRVGLYYS-M-IEW---DS------------------------------------P
Bac_Bac_Bac_1      K-TDIKVGCYFS-L-REW---DN------------------------------------P
Bac_Bac_Bac_2      K-TDLKVGCYFS-L-REW---DN------------------------------------P
Bac_Pro_Gam_1      D-CGLKMGVYYS-S-VEWETNSSHRPES-------------------------------G
Bac_Len_Len_1      SVGGMKMGYYYS-I-WDW---FN------------------------------------P
Bac_Bac_Bac_3      Q-SGMHMGFYYS-L-YEW---YN------------------------------------P
Bac_Bac_Cyt_3      S-KGLKMGYYYS-L-YEW---FN------------------------------------P
Bac_Bac_Sph_5      A-AGLHMGFYYS-L-YEW---YN------------------------------------P
ORF                K-SGLKS-----------------------------------------------------
Bac_Bac_Bac_5      C-QGMHFGFYYS-L-LEW---SH------------------------------------P
Bac_Bac_Sph_1      T-SGLRMGFYYS-L-LEW---SH------------------------------------P
Bac_Bac_Sph_3      D-KGLKMGFYYS-L-LEW---NN------------------------------------P
Bac_Bac_Cyt_2      K-KGLRMGFYYS-L-LEW---NH------------------------------------P
Bac_Pla_Pla_1      K-TDVKMGLYYS-I-YEW---FN------------------------------------P
Bac_Bac_Sph_6      K-AGLKMGYYYS-L-YEW---FN------------------------------------P
Bac_Ver_Opi_1      E-RGLKFGFYYS-L-YEW---FN------------------------------------P
Bac_Aci_Aci_1      S-RGLRMGYYYS-L-YEW---YN------------------------------------P
Bac_Aci_Sol_1      A-KGLHMGIYYS-L-YEW---YN------------------------------------P
Bac_Bac_Sph_4      N-AGLPFGVSVHAA-HAWSW-YETAQRADKNGPLAGVPYDGKLTASDGAGKWWNKFDPQE
Bac_Bac_Sph_8      N-NGLPFGVSIHAS-HAWRW-YEMAQRADKTGQYSGIPYDGKLTQADGKGKWWSGLDPQE
Bac_Bac_Cyt_4      E-QGLYFGASSHFA-FNWNY-YNHKEGFDTADPEYA-----------------------D
Bac_Bac_Fla_4      Q-KGMIMGASSHFA-FNWSF-FNKKDHFDTTNPAYA-----------------------D
Bac_Ten_Mol_1      N-ENLIFCTSTHRA-EHWFFMSHGKKFESDIPQESRKG---------------------D
Bac_Act_Act_2      R-RGLVDGASSHRV-EHWFF-MGHGKDFDSDIHEPLKRG--------------------D
Bac_Pro_Alp_1      A-QGLHLGLSSHRAEHDWF--FDEGRKIPSDVNDPRYA---------------------D
Bac_Dic_Dic_1      D-NFLTFGVSYHRA-EHWWF-FHEGMKFDSDVRDKEYF---------------------D
Bac_Arm_Cht_1      K-EGLVFGLSTHRE-EHWWF-YNGGMQFDSDVRDPEYY---------------------S
Bac_Bac_Sph_7      K-QNLVFGLSSHRI-EHWFF-MNGGRKFMSDVIDPKYA---------------------D
                       :                                                       
-------------------------------------------------------------------------------...>
Bac_Cya_Chr_1      AFTEADK--------------PYRFDKIPQPTPQQWERFSEVMFEQIRELLTLYGRIDII
Bac_Bac_Sph_2      YYDVNTR---------------TRKRYTLKEEPQRWENYVKYYQTQLNELSERYHP-DLI
Bac_Pro_Bet_1      LYG-PDLREYKGVTAAAHTDWNTPPAGIFSRHTAYAEWYAKRWALRMMDVVDRYDP-DFI
Bac_Spi_Spi_1      ISDHNSD--------------------------KIPPKHQKVNIEQLKELFTNYGPLCEL
Bac_Act_Act_1      EYDGPHP------------------------DYLSEKYLREWMLPQMRELVEDVGT-EML
Bac_Chl_Chl_1      LFMGVPQ----------------------------QLEYVEYANAHWKELIDRYQP-SIL
Bac_The_The_1      IRY-PED---------------LSYIRPN------TYEYADYAYKQVMELVDLYLP-DVL
Bac_Fir_Clo_1      IFE-DDD---------------LFGTASP------TFAYADYSYNQMKELVDDYAP-SVF
Bac_Fir_Clo_2      IFE-DDD---------------LFGTASP------TFAYADYSYNQMKELVDDYAP-SVF
Bac_Bac_Cyt_1      LWL-SDK----------------------------DKFVDQHYLPQVKDLVQRYQP-DIL
Bac_Bac_Fla_1      WWQ-NDK----------------------------ERFVNEHFLPQIKDLVKTYKP-DVL
Bac_Bac_Fla_2      WWQ-QDK----------------------------ERFVNDHFLPQVKDLVTKYEP-DVL
Bac_Bac_Fla_3      WWQ-NDK----------------------------ERFVDEHFLPQVKDLVQNYQP-DIL
Bac_Bac_Bac_4      LCM-RGR---------------M------------DCYVKEHLFPQCKELVTNYKP-DLL
Bac_Bac_Bac_1      LYN-KET---------------M------------DLFYERHFFPQLKDLVNRYKP-DLI
Bac_Bac_Bac_2      LYN-RET---------------M------------DLFYERHFFPQLKDLVNNYKP-DLI
Bac_Pro_Gam_1      YFI-PQR-------------------DREKFGIAEQSYPDEILIPQLKELVTNYQP-CLI
Bac_Len_Len_1      YDD-RID---------------IKKKAKYIDMKKHNKYVREVMYPQFRELVKKYKP-ALI
Bac_Bac_Bac_3      LYK-KD----------------L------------PKYVSDHMIPQMKDLVNRYQP-DIV
Bac_Bac_Cyt_3      LYK-TDP----------------------------DKYIEERMLLQMRELVDQYEP-DIL
Bac_Bac_Sph_5      LYK-TDV----------------------------KKYVAQHMLPQLKDLVTRYQP-DIV
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      LYD-KKT---------------I------------GRWVDEHMLPQLQELVVKYKP-DVI
Bac_Bac_Sph_1      LYK-KES---------------I------------EQWVDRHMIPQMQELVNAYQP-EVI
Bac_Bac_Sph_3      LYK-PQT---------------I------------DNYVENHMSPQMKDLVTRYKP-EVI
Bac_Bac_Cyt_2      LYK-TAT---------------I------------NQWVEEHMLPQMKELVMAYKP-EVI
Bac_Pla_Pla_1      LYT-ADV----------------------------DLFVDKHLIPQFKDMVNRYHP-AVI
Bac_Bac_Sph_6      LWK-KDK----------------------------ASYVKNVMTPQFKDLVTRYKP-SVI
Bac_Ver_Opi_1      LWL-KER----------------------------PRYVTQHMIPQFKDVVTRYQP-AII
Bac_Aci_Aci_1      LYL-SDK----------------------------QRYVRQHMFPQFKDLVTRYKP-AII
Bac_Aci_Sol_1      LWL-TDN----------------------------KRYVAEHMFPQFKDAVTHLKP-SII
Bac_Bac_Sph_4      LYA-QNH---ALSEKSDIDGTIHRQWNWGNGVCPPSKEYCEKFYKRTIELIDNYEP-EFI
Bac_Bac_Sph_8      LYA-QNH---PLSQNSLDNNFDTRQWDWGNGVYPPSKAYIDKFYNRTVDLINKYNP-DVV
Bac_Bac_Cyt_4      LYS-RNH----------------------PHYAPADKEFLELWWNRTKDIIDNYHP-DIL
Bac_Bac_Fla_4      LYSTKGK----------------------DLNEPVSKEFKELWWARTKDIIDNYQP-DIM
Bac_Ten_Mol_1      FYW-PSF--------------EEKGAYDFQSEPKPSKEFLEDWLERTVEIIDKYDP-KIL
Bac_Act_Act_2      FYW-PAM--------------PEPDHWDQHSKPEPTHEYLDDWLLRCCEIVDRYRP-KVL
Bac_Pro_Alp_1      FYG-PAQ--------LRVKEKGSDDADVFGDFTPVSQAWLSDWLARSAELVDLYHP-DLI
Bac_Dic_Dic_1      LYG-PAQ----------------------PESMQPNEEFLEDWLLRLFEIVDKYQP-QLV
Bac_Arm_Cht_1      FYG-PAA----------------------PENVPPTKAFLDDWLARDCELVDKYHP-QIV
Bac_Bac_Sph_7      FYG-PAR----------------------EENETMTPEYMNDWLLRCTELVDKYQP-QLV
                                                                               

Bac_Cya_Chr_1      WFD-GS---WERTPSQWRS--------SELAQMIR---QLQPDILIND-RL---------
Bac_Bac_Sph_2      WFD-GD---WEHNSEEWKT--Q-----QTLSNLR----KYNPNIIINS-RL---------
Bac_Pro_Bet_1      YTD-GTSD-QPFSGNGTGTGMKSDAIQHVMADFYNRTLKNRGKVD----TF---------
Bac_Spi_Spi_1      WMD------MGYPTKKQSEEVR-----ALAQ-------KLQLDMMINGRIW---------
Bac_Act_Act_1      WLD-GD---WMNPAEDFRT--K-----EFVAWYYNRALARREEVLVND-RL---------
Bac_Chl_Chl_1      WND------IGYPAAANLV--------ELFSFYYNTI----PEGVIND-RFTQASIGDGP
Bac_The_The_1      WND-MG---WPEKGKE-DL--K-----YLFAYYYNKH-P---EGSVND-RW---------
Bac_Fir_Clo_1      WND-IG---WPTQSEEM-M--P-----YFFAHYYNKV-P---EGVVND-RF---------
Bac_Fir_Clo_2      WND-IG---WPTQSEEM-M--P-----YFFAHYYNKV-P---EGVVND-RF---------
Bac_Bac_Cyt_1      WTD-GE---WEIEDTQWRS--E-----EFLAWLYNES-AAKDYILVND-RW---------
Bac_Bac_Fla_1      WGD-GE---WDITSDDWKS--K-----QFLAWLFNES-EVKKSIVIND-RW---------
Bac_Bac_Fla_2      WAD-GE---WDMDADKWKS--K-----ELLAWLFNES-KVKNSIVIND-RW---------
Bac_Bac_Fla_3      WAD-GE---WDMEAEKWKS--K-----EFLAWLFNES-KIKNTVVVND-RW---------
Bac_Bac_Bac_4      WSD-GN---GGYSEDIYKI--K-----DFLAWLYSAT-DVKDKVVVND-RW---------
Bac_Bac_Bac_1      WSD-GP---DQLNDKQWQA--E-----RTLAWLYSES-PVKDSIVVND-RW---------
Bac_Bac_Bac_2      WAD-GP---DSMNDKIWQV--E-----RTLSWLYSES-PVKDSIVVND-RW---------
Bac_Pro_Gam_1      FSDGGE---WDFSEEYSQT--K-----EFLSWLYNEA-PNKDEVVVND-RF---------
Bac_Len_Len_1      FSD-GD---WWADDNFWQT--K-----PLLAQLFNGA-MNRDEVVIND-RW---------
Bac_Bac_Bac_3      WTD-GE---WELTSDQWKS--T-----DFLAWLYNES-PVKNTVVVND-RW---------
Bac_Bac_Cyt_3      WGD-GE---WDKPTKDWKI--E-----PFMAWLFNES-KVKNHIVIND-RW---------
Bac_Bac_Sph_5      WPD-GE---WDHSDTIWRS--R-----EFIAWLYNDS-PVKNTVVVND-RW---------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      YAD-GE---WDYDSETLKS--R-----KFLSWLYDES-PVRNSVVVND-RW---------
Bac_Bac_Sph_1      FAD-GE---WDYPSETLKS--T-----TFLSWLYNES-PVRQQVVVND-RW---------
Bac_Bac_Sph_3      FAD-GE---WDYPSEKLRS--P-----QFLSWLYNES-AVKNTVVVND-RW---------
Bac_Bac_Cyt_2      FSD-GE---WDYASNQFKS--E-----KFLAWLYNES-PVKQTVVVND-RW---------
Bac_Pla_Pla_1      FTD-GE---WDHPAATWRT--S-----EMLTWLFNES-PCKEEVVIND-RW---------
Bac_Bac_Sph_6      FSD-GE---WEQSDTAWHS--A-----ELLAWLFNES-PVKDEVAVDD-RW---------
Bac_Ver_Opi_1      FSD-GE---WEMTAKEWRS--E-----ELLAWLFNES-AVKDEVVVND-RW---------
Bac_Aci_Aci_1      FSD-GE---WDLDSSEWHS--P-----ELLAWLFNDS-PVKDDVVIND-RW---------
Bac_Aci_Sol_1      FSD-GE---WELTSAEWNS--P-----ELLAWLFNES-PVRDEVVIDD-RW---------
Bac_Bac_Sph_4      YFDDTALPLWPASDAGL----------RIAAHLYNTN--LKRHGKLNAGIF---------
Bac_Bac_Sph_8      YFDDDKLPFWPVNDAGL----------RIAAHLYNKS--IEEHGVLRAVLN---------
Bac_Bac_Cyt_4      WFD------FVLDHEEFDPYHP-----LLAQYYYNKGIEWGKDVVLQTKNF---------
Bac_Bac_Fla_4      WFD------FYLDIPDFADQRP-----KLAAYYYNKGIEWGKEVVLQDKNF---------
Bac_Ten_Mol_1      YFD------WWIQHEAFKPYLK-----KVAAYYYNNAFKNNKDVII---AY---------
Bac_Act_Act_2      YFD------WWILHEAVQPYLR-----RFVAYYYDRADEWGEEVTV---CY---------
Bac_Pro_Alp_1      YFD------WWIGHPTFRSTLP-----KFLAYYYNSQAKLGGSAIVNY-KI---------
Bac_Dic_Dic_1      YFD------WWIEQPAFEPYLK-----KFFAYYYNRAHEWGKGVVINY-KL---------
Bac_Arm_Cht_1      WFD------WWINTPAFRPYLQ-----RFAAYYYDRAAQWHKGVVINY-KY---------
Bac_Bac_Sph_7      WFD------WWIEQPALDAYKK-----SFASYYYNKALEWNKGVVINY-KN---------
                                                                               

Bac_Cya_Chr_1      ------------P------GQGD--FATPEQF------IPPKPPDGL-WEVCLTIND-SW
Bac_Bac_Sph_2      ------------N------HHGD--YDTPEQG------IPVVRPSAPYWELCYTMND-SW
Bac_Pro_Bet_1      ------------SVIKFHPKFNG--TVSTEEG----SIPAGIRNDEA-WIAETPVG--DW
Bac_Spi_Spi_1      ------------N------DCGD--FCTMGDN-----KFPDKSLNVP-WQTPASIYHETW
Bac_Act_Act_1      ------------G--MVRSKHGD--FYTQEYD-----YDVGQGPEHK-WENTRGCGL-SF
Bac_Chl_Chl_1      PDPAAIMQALAQG-MLPTPPHFD--FRTPEYA------VFPDIKAEK-WESCRGLGY-SF
Bac_The_The_1      ------------G-V----PHWD--FKTAEYH----VNYPGDLPGYK-WEFTRGIGL-SF
Bac_Fir_Clo_1      -----------------NGRYHD--FLTKEYK------AGSVNRNEK-WEMCRGMGL-SF
Bac_Fir_Clo_2      -----------------NGRYHD--FLTKEYK------SGSVNRNEK-WEMCRGMGL-SF
Bac_Bac_Cyt_1      ------------G-KGLRQKHGG--YYTTEYE------A-GKVFDKP-WEECRGMGF-SF
Bac_Bac_Fla_1      ------------G-KETRKNHGG--YFTTEYE------AEAPEFDRP-WEETRGMGF-SF
Bac_Bac_Fla_2      ------------G-KGVRKHHGG--FFTTEYE------SEAPEFTRP-WEECRGMGF-SF
Bac_Bac_Fla_3      ------------G-KGVRKKHGG--YFTTEYE------SEAPEFEKP-WEECRGMGF-SF
Bac_Bac_Bac_4      ------------A-KGMKHVHGD--FFTSEYS------TSDLDVEKP-WEECRGIGF-SF
Bac_Bac_Bac_1      ------------A-NNTGRKHGD--YYTREYS------STNSTFDKP-WEECRGIGL-SF
Bac_Bac_Bac_2      ------------A-NNTGRKHGD--YYTREYS------NTNSTYNKP-WEECRGIGF-SF
Bac_Pro_Gam_1      ------------C-KEMPGEHGD--YYSTEYN-----DKEGFGKLHP-WEESRGIGK-SY
Bac_Len_Len_1      ------------G-KGRG-KHGG--YFTTEYG------SGFEGIDKP-WEENRGMGH-SF
Bac_Bac_Bac_3      ------------G-KETRGKHGG--IYTTEYDLVGDLAADRVKPGHP-WEECRGIGG-SF
Bac_Bac_Cyt_3      ------------G-SDTRSKYGS--FYTTEYA-----DVSKVKFTRP-WEECRGIGE-SF
Bac_Bac_Sph_5      ------------G-SGGR-KYGS--FNTTEYG------HGTASLEKP-WEECRGIGE-SF
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------G-YETRSKHGD--YYTTEYNLVHQKEGIGDKASHP-WEESRGIGT-SY
Bac_Bac_Sph_1      ------------G-KETRSKHGG--YYTTEYDLVHDQKGIGDQASHP-WEESRGIGT-SY
Bac_Bac_Sph_3      ------------G-KETRSKHGG--YYTTEYDLVHDAKGIGEKAAHP-WEESRGIGT-SY
Bac_Bac_Cyt_2      ------------G-KETRSKHGD--YYTTEYDLVGDKLGFGDKATHP-WEESRGIGT-SY
Bac_Pla_Pla_1      ------------G-KGDRHKHGG--YYTTEYG------AGLPNAENP-WEENRGMAH-SF
Bac_Bac_Sph_6      ------------G-SNTRGHNNGATYLTSEYG-------SGMQPGVV-WEESQGIGN-SY
Bac_Ver_Opi_1      ------------G-SDTRHRHGG--YWTTEYA------AGLSDGSHA-WEESRGMAF-SY
Bac_Aci_Aci_1      ------------G-KDTRHKHGG--YWTTEYT------AGMSGMDHP-WEESRGMGF-SY
Bac_Aci_Sol_1      ------------G-KDTRHKHGG--YYTTEYT------SGMQQAAHP-WEESRGMGY-SY
Bac_Bac_Sph_4      ------------G-KILDEQQRKCMIWDIERG------QSNKIEPEP-WQTDTCIG--QW
Bac_Bac_Sph_8      ------------G-KMLNEDQRKAMVWDIERG------QANDIQPLP-WQTDTCIG--GW
Bac_Bac_Cyt_4      ------------G-RRTFPEGTN--VWDIERG------KSADILEFP-WQTDTSIGKNSW
Bac_Bac_Fla_4      ------------S-HEAFPEGTV--IYDLERG------KLPGIRKLP-WQTDTSIGKNSW
Bac_Ten_Mol_1      ------------K-HDAFVYGSG--IVEIERG------RFKELKHFP-WQTETAIANNSW
Bac_Act_Act_2      ------------K-QDSMMFGTA--VPDVERG------QLAEAKPYH-WQTDTAIALNSW
Bac_Pro_Alp_1      ------------G---AFPEGAG--VLDIERG------QLPGIQPRV-WQTCTSISNDSW
Bac_Dic_Dic_1      ---------------NAVPRECA--VFDVERG------KLGDIDPIY-WQTDTSISRLSW
Bac_Arm_Cht_1      ---------------AAFPSQAA--VLDLERG------EMGGIRPQF-WQTDTSISNNSW
Bac_Bac_Sph_7      ---------------TAFPEGSA--VLDIERG------KLAGIRQMA-WQTDDAVGFKSW
                                                                               

Bac_Cya_Chr_1      GYNKA---DNNYKDARTLVHKLCEIAAKGGKLLLNVSPMGNGQIPPPQQECLESVAEWMS
Bac_Bac_Sph_2      GYQAF---DKHYKTPNMIVRTLVDCISMGGNLLLDIGPKEDGTIPQEQVAILKELGRWTG
Bac_Pro_Bet_1      YY-----GPWFTYDAGAVIRYLLEQVARDGNVAICISPLPDGSLDEGSVRMLKEVGAWMR
Bac_Spi_Spi_1      GYRSWQRRGDKNKKAQELIESLIRVRAMGGNYLLNIGPKGDGSVVAFEAEVLKKIGSFFK
Bac_Act_Act_1      GYNQA-EPLADYMTIEQLITMFVDNVANWGNLLLNVGPRADGTINDIQVDLLKGLGRWLE
Bac_Chl_Chl_1      GYNRN-ETVDDMLSPVKLIRSFVDIVSKNGNLLINVGPMGDGTIPPEQAERLEALGAWLS
Bac_The_The_1      GYNRN-EGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLR
Bac_Fir_Clo_1      GYNAN-EGDDKLISVPDLISLLVGTVANNGNLLLNIGPKADGTIPEEQVRRLKILGAWLK
Bac_Fir_Clo_2      GYNAN-EGDDKLISVPDLISLLVGTVANNGNLLLNIGPKADGTIPEEQVRRLKILGAWLK
Bac_Bac_Cyt_1      GYNQN-EDAWDYNSTQALLLMLIDIVSNGGNLLLDIGPDHRGNIPPIMQERLMEMGEWLA
Bac_Bac_Fla_1      GYNQN-EDSGDYNSPQALILMLVNVVSTGGNLLLDVGPDARGNIPPIMQERLLQMGKWLK
Bac_Bac_Fla_2      GYNQN-EDAQDYNSSKSLVLMLINVVSTGGNLLLDIGPDARGNIPPIMQDRLLDIGKWLK
Bac_Bac_Fla_3      GYNQN-EDSEDYNTPKALVLMLVNIVSTGGNLLLDIGPDSRGRIPVIMQERLKQMGKWLR
Bac_Bac_Bac_4      GLNRN-EDIEDYSSPKGLVLTLTNIVARGGNLLLGIAPDVNGKIPPVMQERLLQMGKWLA
Bac_Bac_Bac_1      GYNQN-EDLEDYTSPKALILTLANIVSQGGNLLLDIGPNANGKIPPIMQERLLQIGKWLQ
Bac_Bac_Bac_2      GFNQN-EDLEDYTLPQALVLTLVNVVSQGGNLLLGIGPNANGKIPPIMQERLLQIGDWLR
Bac_Pro_Gam_1      GYNRA-EQLEDYCTSQQLILQLVGIVSKGGNFLLNVGPTADGRIPVIQQERLRDIGRWMA
Bac_Len_Len_1      GFNRN-EDYTQYNSTRKLVFMLVDLVSRGGNLLLNIGPTGDGRIPVVMQNRLIDMGKWLE
Bac_Bac_Bac_3      GYNRN-ENLENYETSESLIRILIDKVSMGGNLLLNVGPTADGRIPVIMQQRLKDIGDWLS
Bac_Bac_Cyt_3      GYSRN-ENLEMYSSAEKLVHMLVEIVSKGGNLLLNIGPRADGGIPVIMQQRLAEIGAWLK
Bac_Bac_Sph_5      GYNRN-ENLEQYQSSKSLVHMLIDIVSRGGNLLLNIGPAADGTIPVIMQQRLKDMGDWQK
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      GYNRF-ERAEDYLSSKELIRLLVRTVANGGNLLLDVGPEANGLIPVIMQERLLDMGKWLE
Bac_Bac_Sph_1      GYNRF-ETTEDYFTSKQLIDLLIDKVSNGGNLLLNVGPTADGRIPVIMQERLLDMGKWLA
Bac_Bac_Sph_3      GFNRF-ETLEHYFTSKQLVDLLIDKVSNGGNLLLNIGPDANGLIPIIMQERLLDIGAWLK
Bac_Bac_Cyt_2      GYNRF-ETTDHYFTSKQLIDLLIDKVSNGGNLLLNIGPKADGLIPVIMQERLLDMGAWLK
Bac_Pla_Pla_1      GYSRT-ERFEDYNSSESLVLMLIDIVSRGGNFLLDIGPTADGRIPPLMEERLAEIGQWLS
Bac_Bac_Sph_6      GYNRM-ETVNDYKKSNDLVVLLVDIVSRGGNLLLDIGPTADGRIPVIMQQRLVDIGAWLE
Bac_Ver_Opi_1      GLNRA-ERVDDYKTGREFILILADLVSRGGNLLLDIGPAADGTIPPLMEQRLLEIGDWLR
Bac_Aci_Aci_1      GYNRA-ERLQDYHTSWELIIMLTDIVSRGGNLLLDIGPKADGTIPPIMQDRLHAMGSWLR
Bac_Aci_Sol_1      GYNRQ-ETLADYHSDRELLMMLLDIVARGGNLLLDIGPTADGRIPVVMEERLIQLGNFLR
Bac_Bac_Sph_4      HYDRRVYEENGYKTAKTVIHTLADVVSKNGNLMLNVPLRGDGSMDEKERAVVDNIGQWMQ
Bac_Bac_Sph_8      HYDRGLYERNGYKTAKSVIQTLVDIVSKNGNLMLNIPVRGDGTIDEKERKLVEEIGNWMK
Bac_Bac_Cyt_4      CYVTN----WESKDANTLLDDLIDIVSKNGNMLLNVGPKADGTIPEDQAAILLEMGEWLS
Bac_Bac_Fla_4      SYVSN----WQSKTANQIVDDLVDIVSKNGNLLLNVGPKSDGTIPEDQKEILLQIGDWLT
Bac_Ten_Mol_1      CYTNN----LDYKTENDVLTLLIDVVSKNGNLLLNIGPKGDGSIPQYEEKMLENIGKWLE
Bac_Act_Act_2      GYTEN----NRYRPAGEILQDMVDIISKNGNLLLNVGPKPDGTIGDEDRAVLTAIGGWLK
Bac_Pro_Alp_1      GYVEN----DTYKSPQALIHLLADVVSKNGNLLLNIGPRADGSIPQGAQDTLMAMGGWLT
Bac_Dic_Dic_1      GYIEN----DIYKPAKEIIWELVDIVSKNGNLLLNVGPKADGTIPEPAQKTLLEIGEWLL
Bac_Arm_Cht_1      GYVTQ----QNFKTPEQVVHELVDIVSKNGCLLLNIGPKSDGTIPQEEVDVLLDMGKWLR
Bac_Bac_Sph_7      GYMVK-------------------------CQL---------------------------
                                                                               

Bac_Cya_Chr_1      RYGESIIDTQPGLLPWQFYG--------------------------------------PS
Bac_Bac_Sph_2      LHKEAVYGTRAGI-PFEHYQGKSALSKDGKTVYLYLDAVKRTEHLTGISTSLKGVTVVGQ
Bac_Pro_Bet_1      MNGQGIYGSK----AWVRLGEGENGKLRTLPAGKLGREQ----------ADF------KF
Bac_Spi_Spi_1      SKTPSQGCAK----KLCKKLNLD-------------LPQDSILELNGEKNEI------PF
Bac_Act_Act_1      INGDGIYGTR----FWKVQ------------------------------RGT------TT
Bac_Chl_Chl_1      VNGEAIYGTR----PWTRA------------------------------EGV------TD
Bac_The_The_1      KYGDAIYGTS----VWERC------------------------------CAK------TE
Bac_Fir_Clo_1      VNHDGIYGTR----CSDRE------------------------------SEL------LE
Bac_Fir_Clo_2      VNHDGIYGTR----CSDRE------------------------------SEL------LE
Bac_Bac_Cyt_1      KNGEAIYGTR----PWKQSVQWSEGDRTIDHSG-SYLGGDYILKQTV-DKQD------GK
Bac_Bac_Fla_1      VNDEAIYGTR----PWKESFQWSKGEKK-VKADVHYLGGDFILKQTL-NPHL------GQ
Bac_Bac_Fla_2      VNGEAIYNTR----PWKDSFQWSKGEQNYKPKQ-HYLGGDFILKQTI-DPEP------GY
Bac_Bac_Fla_3      VNGEAIYNTT----PWNSSFQWSEGERNFKPKQ-HYLGGDFILKQTV-DPEP------GY
Bac_Bac_Bac_4      VNGEAIYDTH----KWRESFQWSAGAREGLKKGKYYVSGDAILAQTV-CPEK------GQ
Bac_Bac_Bac_1      INGEAIYGTR----AWNRSCQWTKGNREWKSKEKHYVSGDAILKQTV-DPEP------GY
Bac_Bac_Bac_2      VNGEAIYGTR----MWKQSFQWSKGNREWKPKGKHYVSGNEILKQTI-HPEP------GY
Bac_Pro_Gam_1      VNGDAIYGSE----ICTRL---------------------------------------QC
Bac_Len_Len_1      VNGEAIYDSV----VWKKACQWSEGTLP-KFTASDFKSGFPIYEMTL-EPKP------GN
Bac_Bac_Bac_3      VNGDAIYGTH----AWKYT------------------------------AKE------KK
Bac_Bac_Cyt_3      VNGEAIYGTR----ALAD----------------------------------------AP
Bac_Bac_Sph_5      VNGDAIYGTT----AWR--------------------------------EAP------KQ
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      VNGEAIYSSR----P---C------------------------------RSL------TV
Bac_Bac_Sph_1      VNGEAIYGTR----AWA-S------------------------------RPN------NS
Bac_Bac_Sph_3      VNGEAIYGSS----SWI-G------------------------------GAA------NQ
Bac_Bac_Cyt_2      VNGAAIYGTT----AWD-K------------------------------RPK------NR
Bac_Pla_Pla_1      VNGEAIYDTT----THSQTCQWTTGQEEELG-KGNYRVKYDVNKLMK-NPDE------GK
Bac_Bac_Sph_6      TNGEAIYNTT----PWKETRQWSVGNRP-VVKEASFMSDYNVAKMIK--PSK------EY
Bac_Ver_Opi_1      VNGEAIYGTR----PAARSYQWTAGERP-KQEYGEYRVAYSLLEQVGQAPRD------GQ
Bac_Aci_Aci_1      VNGEAIYGTR----PWKQNLQWNEGKRPDVKYNSEFESAYDVSKLAG-PPEP------GN
Bac_Aci_Sol_1      PNGEAIYGTH----AHRNPRQWSKGSIPKLE-EKEFMSDYDITKLVD-TPPA------GY
Bac_Bac_Sph_4      VNSEAIYGTR----PWTVFGEGPAIESAAPLSAQGFNEG----------KGK------PF
Bac_Bac_Sph_8      ANSESIYATR----PWKIFGEGPAQEAAAQLNAQGFNEG----------KGK------PF
Bac_Bac_Cyt_4      VNGDAIYGTR----PWTIFGEGPTEVKTGHHTEG---------------KNP------DL
Bac_Bac_Fla_4      INGDAIYDTT----YWKTFGEGPTEVKKGHHSEG---------------NNK------GL
Bac_Ten_Mol_1      KNGEAIYESI----PYLIFGEGSTIEIEGKFSE----------------KKI------EY
Bac_Act_Act_2      ANGEAIYGSK----PWKRFGEGPTQIVEGQFTDG---------------TKK------GF
Bac_Pro_Alp_1      VNGEAIYGTR----PWRQFGEGPTEVASGSFQET---------------KTK------PY
Bac_Dic_Dic_1      INGEAIYGSR----PWRIYGEGPTKGNVGSFSE----------------KEV------IY
Bac_Arm_Cht_1      INGEAIYGTR----PWVIYGEGPTKIKGGAFSDTSHG---------------------AY
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      TRKDNFYY----------------------------------------------------
Bac_Bac_Sph_2      SGIKVPYTQNASSITLDLNTLKFDPAVTVLALHFQNTPTFIKAEPVATEIRTLLKSKNAD
Bac_Pro_Bet_1      GPHDFRFTVG--------------------------------------------------
Bac_Spi_Spi_1      TKKLYRFTGK--------------------------------------------------
Bac_Act_Act_1      DGIDVRYTAK--------------------------------------------------
Bac_Chl_Chl_1      SGIGMRFTRK--------------------------------------------------
Bac_The_The_1      DGTEIRFTRK--------------------------------------------------
Bac_Fir_Clo_1      SGIELHYTQK--------------------------------------------------
Bac_Fir_Clo_2      SGIELHYTQK--------------------------------------------------
Bac_Bac_Cyt_1      AVKEVFFTQN--------------------------------------------------
Bac_Bac_Fla_1      AVKEFFFTQN--------------------------------------------------
Bac_Bac_Fla_2      AVKELFFTQN--------------------------------------------------
Bac_Bac_Fla_3      AVKEVFFTQT--------------------------------------------------
Bac_Bac_Bac_4      AVKEAFFTQS--------------------------------------------------
Bac_Bac_Bac_1      AVKEVFFTQK--------------------------------------------------
Bac_Bac_Bac_2      AVKEVFFTKK--------------------------------------------------
Bac_Pro_Gam_1      NDEHTFLTSV--------------------------------------------------
Bac_Len_Len_1      AHKELYFTKK--------------------------------------------------
Bac_Bac_Bac_3      KEQTIFFTAK--------------------------------------------------
Bac_Bac_Cyt_3      KVDNVFFTEK--------------------------------------------------
Bac_Bac_Sph_5      PDSTIRFTKK--------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      RNNNVYLTQA--------------------------------------------------
Bac_Bac_Sph_1      KDTHRYFTAK--------------------------------------------------
Bac_Bac_Sph_3      KDKGIFYTQK--------------------------------------------------
Bac_Bac_Cyt_2      KDQTVYYTVK--------------------------------------------------
Bac_Pla_Pla_1      ARKEAVFTRK--------------------------------------------------
Bac_Bac_Sph_6      AHIEMFFTKK--------------------------------------------------
Bac_Ver_Opi_1      AVKQVFFTQK--------------------------------------------------
Bac_Aci_Aci_1      AAIEAFFTSK--------------------------------------------------
Bac_Aci_Sol_1      ARADAFFTAK--------------------------------------------------
Bac_Bac_Sph_4      TADDMRFTSK--------------------------------------------------
Bac_Bac_Sph_8      TYEDIRFATK--------------------------------------------------
Bac_Bac_Cyt_4      TSADFRFTQK--------------------------------------------------
Bac_Bac_Fla_4      SSKDIRFTTK--------------------------------------------------
Bac_Ten_Mol_1      KNDDFRFTAN--------------------------------------------------
Bac_Act_Act_2      TSRDVRYTVN--------------------------------------------------
Bac_Pro_Alp_1      TAQDFRFTTK--------------------------------------------------
Bac_Dic_Dic_1      TDKDFRFTTK--------------------------------------------------
Bac_Arm_Cht_1      TPEDIRFTTK--------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      EAVYQITKHLYSGDNLLKNNGLTADGLNMNLPDQKQANPAILNWISKHAEALYETGAGIP
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      ------------------------------------------------------------
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      ------------------------------------------------------------
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ----------------LHLLMKPY-E-----TVSVRGIP-----------IKQIESVKVV
Bac_Bac_Sph_2      EGHYAGLTALSADRQTLYLFVEGK-PT-G--PVAVKGLK------------NTIARIRIV
Bac_Pro_Bet_1      -----------RDGS-LYAFTMMV-PAPGA-TLKITSLG-----SRENLLGKPVTSVSLV
Bac_Spi_Spi_1      -----------DYYS-SHFICTEL-EL-N--LKISKGLYKTNFWTISLVRKKPLSQDEVL
Bac_Act_Act_1      -----------DDGDRVYAFLLSR-PH-G--SVSLASAE--------LPDLQAGDQVRLL
Bac_Chl_Chl_1      -----------GD-D-LYAILLDT-PQQP--NVTLLDVT-----------VSPGSRVILT
Bac_The_The_1      -----------CN-R-IFVIFLGI-PTGE--KIVIEDLN-----------LSAGTVRHFL
Bac_Fir_Clo_1      -----------DG-N-LNVFADHL-KE-GANEFLIKGY---------------HGALRPF
Bac_Fir_Clo_2      -----------DG-N-LNVFADHL-KE-GANEFLIKGY---------------HGALRPF
Bac_Bac_Cyt_1      -----------DK-S-VFAIIPDG-SK-Q--ELVLKGLK-----------ADKRTTVRHL
Bac_Bac_Fla_1      -----------EY-S-YFAIVPKW-PG-K--EMRIKDFQ-----------PKDNARITLL
Bac_Bac_Fla_2      -----------DE-A-YYVILPKWYPK----EIMVKGFE-----------SSKPSKVTFL
Bac_Bac_Fla_3      -----------NS-A-YYAIVPRW-SD-K--EIVLENVV-----------LNKSSLITLL
Bac_Bac_Bac_4      -----------AKGD-VYAILPVL-KS-G--KFVLKNIQ-----------STNNTRISML
Bac_Bac_Bac_1      -----------GE-N-VYAILPQY-PK-N--KIVLKNVQ-----------IRNKTKITLL
Bac_Bac_Bac_2      -----------GN-D-VYAILPQY-PK-P--TVILKGIK-----------VTNKTRISML
Bac_Pro_Gam_1      -----------GS-D-DYLIVTDW-PT-Q--PLSLRIVT-----------GAVPAACILL
Bac_Len_Len_1      -----------AD-T-IYGLLPVW-PDSG--KIEIRDIE-----------VSSDTKVTML
Bac_Bac_Bac_3      -----------GD-D-LYVIITRW-QN-Q--PIKIEGV-------------SKTDAVNML
Bac_Bac_Cyt_3      -----------GS-D-HYLIATDW-------RDVIETSW-----------AKKPKKVSML
Bac_Bac_Sph_5      -----------GA-T-LYAIATQW-RE----VLTIKGIR-------------QPAKVQLL
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      -----------HG-N-LYVIGTEC-PD-G--PVVIDGI-------------SKAGHSSLL
Bac_Bac_Sph_1      -----------GK-D-LYLICTEW-QN-G--TFHIPLP-------------RKPVRVSLL
Bac_Bac_Sph_3      -----------GK-D-IYIICTKW-PQ-T--DMTIGTI-------------KKAGKVSLL
Bac_Bac_Cyt_2      -----------GN-D-LYVICTKW-PE-N--SIAVPGI-------------SQAGKVNML
Bac_Pla_Pla_1      -----------GE-T-LYAICAVF-PD-G--QLTLNNIK-----------ASPDAVVTML
Bac_Bac_Sph_6      -----------DD-A-LYCIATSYTP-----QLRIKNFT-----------PAKQAKAVIL
Bac_Ver_Opi_1      -----------PD-A-LYAITAGW-PG-R--ELVLRGVR-----------VPESPVVTLL
Bac_Aci_Aci_1      -----------GN-D-VYAILPRW-PG-N--SFVLKGVS-------------DANSVSLL
Bac_Aci_Sol_1      -----------KD-A-VYAILPRR-PM-K--EVVLEDIE-----------APSGVRVTLL
Bac_Bac_Sph_4      -----------GK-T-LYAILLGW-PADH--AVTIKSLG---------EGVRQPGRVSLL
Bac_Bac_Sph_8      -----------GD-V-LYATALGW-PQDG--KLIIKSLA-----KNSRHFPKEIQKVEWV
Bac_Bac_Cyt_4      -----------DG-K-IYVIAMDV-AEDG--KYMVKSLG-----SANDVFKGKIKSVKPL
Bac_Bac_Fla_4      -----------DN-K-LYAIVLDW-PKDG--VVVIESLA----KEATYAKDLNITNARVL
Bac_Ten_Mol_1      -----------NG-A-VYVFVLNP-RDTK--RFNVKTLR--KATEKTEGIFSSIKKVVLL
Bac_Act_Act_2      -----------GG-N-LYAIVMRP-SDDG--VYRFTRLR-KGDAAHNADFHGFISRIDLL
Bac_Pro_Alp_1      -----------GA-A-LYAIELGW-PAEG--EAVIHSLK----------VEDKVKAVTLL
Bac_Dic_Dic_1      -----------GD-I-LYAILMNK-PEKD--EVIIKSLS-----TDLTLYQKEIAKVEIL
Bac_Arm_Cht_1      -----------GN-T-LYAIVMAW-PQDG--EVRIRSLG-----ANAHFATGSVHSVQLL
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      --G------SDRP---LSYSGRCSIIDELTQNPQPLGELTI-------------TVPESA
Bac_Bac_Sph_2      GEGSMIDHDIYNK---LYWS-------------AIPGIVYI-------------NVPNER
Bac_Pro_Bet_1      --G-----HEGAP---ITWR-------------QEADGLVI-------------TTPSTM
Bac_Spi_Spi_1      --E-----INGKE---FCFP-------------ANKKELEIFKNIKIESVLKISVSTGGT
Bac_Act_Act_1      --G------HPGA---LRWQ-------------RQGPRVVV-------------DIPAAA
Bac_Chl_Chl_1      ---------GYGE---IAAA-------------QHDHGLTI-------------TLPASL
Bac_The_The_1      ---------TGER---LSFK-------------NVGKNLEI-------------TVPKKL
Bac_Fir_Clo_1      --D------PAVK---VETE-------------DTAEGLLV-------------KIPEYK
Bac_Fir_Clo_2      --D------PAVK---VETE-------------DTAEGLLV-------------KIPEYK
Bac_Bac_Cyt_1      --G------SGKT---LTYK-------------QKGDDLHI-------------MVPE--
Bac_Bac_Fla_1      --A------TDQN---LKWN-------------QEGNDIVV-------------ELPDYD
Bac_Bac_Fla_2      --A------TGEE---LKWK-------------KSENNLSI-------------QMPDYY
Bac_Bac_Fla_3      --A------TGET---INWK-------------QQGNNIVL-------------EGSTYD
Bac_Bac_Bac_4      --G------LNKT---LLWK-------------QKGKNIEV-------------TIPVIE
Bac_Bac_Bac_1      --G------SDKK---VLWK-------------QKGNDLEI-------------TMPSLY
Bac_Bac_Bac_2      --G------LDKK---IVWK-------------QKGEDIVI-------------TVPSLY
Bac_Pro_Gam_1      CQG------QQIP---VPFE--------------FEDGLVI-------------VHPVPW
Bac_Len_Len_1      --G------VEGQ---LKFA-------------KTAKGIEV-------------ILPQLN
Bac_Bac_Bac_3      --G------FNRK---INYT-------------VSKNSITI-------------HLPEVS
Bac_Bac_Cyt_3      --G------VDSP---VKFE-------------YKGGKLRV-------------IAPHLT
Bac_Bac_Sph_5      --G------VPDR---ISYQ-------------STKGGIRI-------------RAPHIT
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      --G-----ETKGR---IIAT-------------LRKGRLTV-------------NIPPLS
Bac_Bac_Sph_1      --G------HSGA---ISSD-------------FQKQQLTI-------------EAPPFN
Bac_Bac_Sph_3      --G------SATP---VKSE-------------IKRGELHI-------------IPPILN
Bac_Bac_Cyt_2      --G------TNKE---VKYD-------------LKNNTLTI-------------TAPELN
Bac_Pla_Pla_1      --G------HEGE---LPWT-------------QKGNNVVI-------------DMPSLN
Bac_Bac_Sph_6      --G------SDKA---ITWK-------------QQGKDCVV-------------DLSGLR
Bac_Ver_Opi_1      --G------VPGR---LPAK-------------VMNGTLVI-------------TAPRLE
Bac_Aci_Aci_1      --G------LNQK---LTHK-------------TQANGLRI-------------DLPPLP
Bac_Aci_Sol_1      --D------GGQQ---LQSK-------------LQGRQLRI-------------TVPDGL
Bac_Bac_Sph_4      --G------HGGN---LVYS-------------QSAQGLKV-------------TMPEQA
Bac_Bac_Sph_8      --P------AGQP---LLFQ-------------RTETELVV-------------SLPENN
Bac_Bac_Cyt_4      --S------SDKG---CDWR-------------IESDGLYL-------------TLKGNC
Bac_Bac_Fla_4      --G------SKEK---IKWS-------------QEKDGFKV-------------TMPKEK
Bac_Ten_Mol_1      --E------TQKE---VSFK-------------HNEEFLTI-------------ELDKSY
Bac_Act_Act_2      --GGPTDGEGDGKGKGLEWT-------------RDEHALEV-------------HAPAVP
Bac_Pro_Alp_1      --G-----VGGGT---LTFR-------------QDADGLHL-------------TLPQRP
Bac_Dic_Dic_1      --E------LKGE---VGFE-------------RSEEGLKV-------------KIPKVE
Bac_Arm_Cht_1      --G------SSAR---LHWE-------------QTPDALVV-------------QLPPQK
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      IDPL----ATVLVIQLAQA-----------------------------------------
Bac_Bac_Sph_2      LDNNLSVIAVLLDKPIELYREKVGAIESNL------------------------------
Bac_Pro_Bet_1      PF------ATAVAFNIR-------------------------------------------
Bac_Spi_Spi_1      PSLRKALKQDNLILRVEGK-----------------------------------------
Bac_Act_Act_1      TVDQP---VHTLLFRRERRGHRS-------------------------------------
Bac_Chl_Chl_1      AD------APAHAIRIVGGASAASGGGR--------------------------------
Bac_The_The_1      LE------TDSITLVLEAVEE---------------------------------------
Bac_Fir_Clo_1      --------EDMYVVGLTNRF----------------------------------------
Bac_Fir_Clo_2      --------EDMYVVGLTNRF----------------------------------------
Bac_Bac_Cyt_1      EVLLGSKMNLPYSIKLQNVQ----------------------------------------
Bac_Bac_Fla_1      PNNFKPEEEFAYAFKISKY-----------------------------------------
Bac_Bac_Fla_2      PSKVES--DYAFVFKIWK------------------------------------------
Bac_Bac_Fla_3      PNKIQPGLDYAYVFKITKE-----------------------------------------
Bac_Bac_Bac_4      YGEAPC--DYAWTLKMENVK----------------------------------------
Bac_Bac_Bac_1      ADELPC--DYAWVLKLNNLENK--------------------------------------
Bac_Bac_Bac_2      YDEMPC--NYAWTLKLENVI----------------------------------------
Bac_Pro_Gam_1      RFDLGL--EFAYTFKLSY------------------------------------------
Bac_Len_Len_1      PTKLPC--KDIFTLKVTKAK----------------------------------------
Bac_Bac_Bac_3      PADNLS--SYAWVFKVTGGAK---------------------------------------
Bac_Bac_Cyt_3      PKTNPC--QYAWAYKIEY------------------------------------------
Bac_Bac_Sph_5      PANNPS--PYAWVYKIEGAF----------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      IFHLPS--PLAWVVKVEGVY----------------------------------------
Bac_Bac_Sph_1      PNTAPC--NYAWVYKLEGVLE---------------------------------------
Bac_Bac_Sph_3      PATMPC--QYAWVFKVKVI-----------------------------------------
Bac_Bac_Cyt_2      PATIPC--NHAWVFRVANFK----------------------------------------
Bac_Pla_Pla_1      PSRMPC--DFAWTFKISSIEDDIQ------------------------------------
Bac_Bac_Sph_6      PGDLG---NNLFVVKIQ-------------------------------------------
Bac_Ver_Opi_1      PDAAPC--RHAFAFKIAGGEVLPE------------------------------------
Bac_Aci_Aci_1      DELVH---QPCWVLKVSLAKTQ--------------------------------------
Bac_Aci_Sol_1      SAALPS--SQAYVLKLAGAR----------------------------------------
Bac_Bac_Sph_4      PC------KDAFVLKIEGLIG---------------------------------------
Bac_Bac_Sph_8      AD------TYACVLKIL-------------------------------------------
Bac_Bac_Cyt_4      KS------DYACAFEIEVE-----------------------------------------
Bac_Bac_Fla_4      PG------DFAYVIELEM------------------------------------------
Bac_Ten_Mol_1      D-------NYPIVFKVEME-----------------------------------------
Bac_Act_Act_2      GSG-----DSPITFRIVIG-----------------------------------------
Bac_Pro_Alp_1      AGA-----IAAYVYRIEMQ-----------------------------------------
Bac_Dic_Dic_1      KL------NYPITFKILGR-----------------------------------------
Bac_Arm_Cht_1      PC------DYAYTLKITGLRPASQPPITANGLMLDADHAQLHGNQIQVEDNYGKSDVGYW
Bac_Bac_Sph_7      ---------YRFYFRM--------------------------------------------
                                                                               

Bac_Cya_Chr_1      ------------------------------------------------------------
Bac_Bac_Sph_2      ------------------------------------------------------------
Bac_Pro_Bet_1      ------------------------------------------------------------
Bac_Spi_Spi_1      ------------------------------------------------------------
Bac_Act_Act_1      ------------------------------------------------------------
Bac_Chl_Chl_1      ------------------------------------------------------------
Bac_The_The_1      ------------------------------------------------------------
Bac_Fir_Clo_1      ------------------------------------------------------------
Bac_Fir_Clo_2      ------------------------------------------------------------
Bac_Bac_Cyt_1      ------------------------------------------------------------
Bac_Bac_Fla_1      ------------------------------------------------------------
Bac_Bac_Fla_2      ------------------------------------------------------------
Bac_Bac_Fla_3      ------------------------------------------------------------
Bac_Bac_Bac_4      ------------------------------------------------------------
Bac_Bac_Bac_1      ------------------------------------------------------------
Bac_Bac_Bac_2      ------------------------------------------------------------
Bac_Pro_Gam_1      ------------------------------------------------------------
Bac_Len_Len_1      ------------------------------------------------------------
Bac_Bac_Bac_3      ------------------------------------------------------------
Bac_Bac_Cyt_3      ------------------------------------------------------------
Bac_Bac_Sph_5      ------------------------------------------------------------
ORF                ------------------------------------------------------------
Bac_Bac_Bac_5      ------------------------------------------------------------
Bac_Bac_Sph_1      ------------------------------------------------------------
Bac_Bac_Sph_3      ------------------------------------------------------------
Bac_Bac_Cyt_2      ------------------------------------------------------------
Bac_Pla_Pla_1      ------------------------------------------------------------
Bac_Bac_Sph_6      ------------------------------------------------------------
Bac_Ver_Opi_1      ------------------------------------------------------------
Bac_Aci_Aci_1      ------------------------------------------------------------
Bac_Aci_Sol_1      ------------------------------------------------------------
Bac_Bac_Sph_4      ------------------------------------------------------------
Bac_Bac_Sph_8      ------------------------------------------------------------
Bac_Bac_Cyt_4      ------------------------------------------------------------
Bac_Bac_Fla_4      ------------------------------------------------------------
Bac_Ten_Mol_1      ------------------------------------------------------------
Bac_Act_Act_2      ------------------------------------------------------------
Bac_Pro_Alp_1      ------------------------------------------------------------
Bac_Dic_Dic_1      ------------------------------------------------------------
Bac_Arm_Cht_1      NDPTDWVSWKVHLPAGVYRIEARVSAVAPSAITLEMADKRFTLQVPATGGWGDAKDVPVG
Bac_Bac_Sph_7      ------------------------------------------------------------
                                                                               

Bac_Cya_Chr_1      ---------------------------------------
Bac_Bac_Sph_2      ---------------------------------------
Bac_Pro_Bet_1      ---------------------------------------
Bac_Spi_Spi_1      ---------------------------------------
Bac_Act_Act_1      ---------------------------------------
Bac_Chl_Chl_1      ---------------------------------------
Bac_The_The_1      ---------------------------------------
Bac_Fir_Clo_1      ---------------------------------------
Bac_Fir_Clo_2      ---------------------------------------
Bac_Bac_Cyt_1      ---------------------------------------
Bac_Bac_Fla_1      ---------------------------------------
Bac_Bac_Fla_2      ---------------------------------------
Bac_Bac_Fla_3      ---------------------------------------
Bac_Bac_Bac_4      ---------------------------------------
Bac_Bac_Bac_1      ---------------------------------------
Bac_Bac_Bac_2      ---------------------------------------
Bac_Pro_Gam_1      ---------------------------------------
Bac_Len_Len_1      ---------------------------------------
Bac_Bac_Bac_3      ---------------------------------------
Bac_Bac_Cyt_3      ---------------------------------------
Bac_Bac_Sph_5      ---------------------------------------
ORF                ---------------------------------------
Bac_Bac_Bac_5      ---------------------------------------
Bac_Bac_Sph_1      ---------------------------------------
Bac_Bac_Sph_3      ---------------------------------------
Bac_Bac_Cyt_2      ---------------------------------------
Bac_Pla_Pla_1      ---------------------------------------
Bac_Bac_Sph_6      ---------------------------------------
Bac_Ver_Opi_1      ---------------------------------------
Bac_Aci_Aci_1      ---------------------------------------
Bac_Aci_Sol_1      ---------------------------------------
Bac_Bac_Sph_4      ---------------------------------------
Bac_Bac_Sph_8      ---------------------------------------
Bac_Bac_Cyt_4      ---------------------------------------
Bac_Bac_Fla_4      ---------------------------------------
Bac_Ten_Mol_1      ---------------------------------------
Bac_Act_Act_2      ---------------------------------------
Bac_Pro_Alp_1      ---------------------------------------
Bac_Dic_Dic_1      ---------------------------------------
Bac_Arm_Cht_1      TLTVPHAGDYELTVRAADAAHWRAVNLFGVRLVPEKGAT  <------------------------- Séquence M

===========================================================================================================
b) Alignement Gblocks :

    Processed file: input.fasta
Number of sequences: 41
Alignment assumed to be: Protein
New number of positions: 78 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  MKFAKFLLKLSFAAGSFAAIAAEQPNILFIMSDDHTTQGIGAYGGRLAKFNPTPTIDTLA
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  EEGALLSNTFCTNGICTPSRASIMTGQYSAVNGAPILADSLPKEKQYLAQEMKKAGYSTA
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  VIGKWHLHDRPDAFDYYKVLKGQGKYFDPSFFETGKKGMVKMQGHSSDCITDSVLDYLEN
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ----------------------------------------------------------MK
Bac_Pro_Bet_1_[  -----------------------------------------------------PMPALPA
Bac_Spi_Spi_1_[  ----------------------------------------------------------ML
Bac_Act_Act_1_[  ----------------------------------------------MPKDPQHAGTSRIT
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ----------------------------------------------------------MK
Bac_Bac_Fla_1_[  ----------------------------------------------------------MI
Bac_Bac_Fla_2_[  ----------------------------------------------------------MR
Bac_Bac_Fla_3_[  ----------------------------------------------------------ML
Bac_Bac_Bac_4_[  ----------------------------------------------------------MK
Bac_Bac_Bac_1_[  ----------------------------------------------------------M-
Bac_Bac_Bac_2_[  ----------------------------------------------------------MK
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  RDKTKPFFLKYHFKAPHDMFENAPRYDSYLKDAVIPEPANMWERGNHGSIATRGHNDELI
Bac_Bac_Bac_3_[  ----------------------------------------------------------MK
Bac_Bac_Cyt_3_[  ----------------------------------------------------------MK
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ----------------------------------------------------------DF
Bac_Bac_Bac_5_[  ----------------------------------------------------------MR
Bac_Bac_Sph_1_[  ----------------------------------------------------------MK
Bac_Bac_Sph_3_[  ----------------------------------------------------------MK
Bac_Bac_Cyt_2_[  ----------------------------------------------------------MK
Bac_Pla_Pla_1_[  ----------------------------------------------------------ML
Bac_Bac_Sph_6_[  ----------------------------------------------------------MK
Bac_Ver_Opi_1_[  ----------------------------------------------------------MK
Bac_Aci_Aci_1_[  ----------------------------------------------------------MM
Bac_Aci_Sol_1_[  ----------------------------------------------------------MR
Bac_Bac_Sph_4_[  ----------------------------------------------------------MK
Bac_Bac_Sph_8_[  ----------------------------------------------------------MK
Bac_Bac_Cyt_4_[  ----------------------------------------------------------MK
Bac_Bac_Fla_4_[  ---------------------------------------------------------MKS
Bac_Ten_Mol_1_[  ----------------------------------------------------------MY
Bac_Act_Act_2_[  ----------------------------------------------------------ME
Bac_Pro_Alp_1_[  ---------------------------------------------------------MIR
Bac_Dic_Dic_1_[  ----------------------------------------------------------MK
Bac_Arm_Cht_1_[  ----------------------------------------------------------MS
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  KRAI-----------MAALLGLTVH-----------------------------------
Bac_Pro_Bet_1_[  KQAPDSVA-------MGDAQSAPVV-----------------------------------
Bac_Spi_Spi_1_[  NFFGFKPL-------FAHLKSLILS-----------------------------------
Bac_Act_Act_1_[  RRSLFAGSVAVGLSALSLSSARASV-----------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  IKYIA----------LAFTLLLAYS-----------------------------------
Bac_Bac_Fla_1_[  KKVRRKLF-------VCLMGSLFLC-----------------------------------
Bac_Bac_Fla_2_[  KIWVF----------VLIMMLLFGS-----------------------------------
Bac_Bac_Fla_3_[  KKVTI----------LFVFLCIVYS-----------------------------------
Bac_Bac_Bac_4_[  KVIS-----------LSIMLAFVLM-----------------------------------
Bac_Bac_Bac_1_[  ---------------FCLLVAISSM-----------------------------------
Bac_Bac_Bac_2_[  THLIA----------IFCLVSISLM-----------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  HKIGTSIGKRNPRRNMGLDLSKVFPDEAISQELSDKQYKKQAYQTYIKKYLRCVKGVDDN
Bac_Bac_Bac_3_[  KTLFIS---------FILSLGLHYS-----------------------------------
Bac_Bac_Cyt_3_[  KSL------------FFLLLFFAFT-----------------------------------
Bac_Bac_Sph_5_[  ---------------MLPAMLMVLT-----------------------------------
ORF_SELECTIONNE  MRYFG----------LILLSVMSLI-----------------------------------
Bac_Bac_Bac_5_[  TKIAS----------LVMLLLLLPM-----------------------------------
Bac_Bac_Sph_1_[  KIVKY----------LLLCMFLFSQ-----------------------------------
Bac_Bac_Sph_3_[  KHTFY----------ITLSVSLFLM-----------------------------------
Bac_Bac_Cyt_2_[  KLLV-----------LGLLLNLSLI-----------------------------------
Bac_Pla_Pla_1_[  NRVPQ----------LCLLTLSLFC-----------------------------------
Bac_Bac_Sph_6_[  KII------------LYAAAFLLGC-----------------------------------
Bac_Ver_Opi_1_[  T--------------LACALLLCVS-----------------------------------
Bac_Aci_Aci_1_[  KRWLL----------LTLMSAVPLF-----------------------------------
Bac_Aci_Sol_1_[  RRDILR---------ACAAAPLALA-----------------------------------
Bac_Bac_Sph_4_[  RRTLIKGG-------LAAASSLWLS-----------------------------------
Bac_Bac_Sph_8_[  RRTLIKGM-------AATLPSMWLS-----------------------------------
Bac_Bac_Cyt_4_[  KSIFIV---------MLFAVLLTAC-----------------------------------
Bac_Bac_Fla_4_[  GKYIVLSF-------FILSLTILSC-----------------------------------
Bac_Ten_Mol_1_[  KKIS--------------------------------------------------------
Bac_Act_Act_2_[  TD-------------EDMRRDLAAI-----------------------------------
Bac_Pro_Alp_1_[  RSSRLTGGRLIRACLLATALSVPAG-----------------------------------
Bac_Dic_Dic_1_[  YKMP--------------------------------------------------------
Bac_Arm_Cht_1_[  SRRRLSPRWRWREIGAAALFLLLPC-----------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  VKRVVDYLKKEGLYDNTVIIYTGDQGFMLGEHDYIDKRWAYEETMRMPMIIRYPKSVKAG
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  SKYDFINENVDFAPTMLDFAGVATPEYMQGSSFKDELETGKENASTKQAAYYHYWMNMFH
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  HDNPAHIAIRTKTHKLIMFYGSSWSNEPLTPPAWELYDLVKDPSEMNNVYDKSENVELIK
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  --------------------------------------------------LTAPAQQPT-
Bac_Pro_Bet_1_[  ---------------------------------------------KLDLPVTAGPFQPTW
Bac_Spi_Spi_1_[  -------------------------------------------------------YILNI
Bac_Act_Act_1_[  ---------------------------------------------LHREAPFPGVYQPTW
Bac_Chl_Chl_1_[  -----------------------------------------------------MMYEPTL
Bac_The_The_1_[  ------------------------------------------------MISMKPRYKPDW
Bac_Fir_Clo_1_[  --------------------------------------------------MGDVRFTGNW
Bac_Fir_Clo_2_[  --------------------------------------------------MGDVRFTGNW
Bac_Bac_Cyt_1_[  ------------------------------------------------QMATAQKYEADW
Bac_Bac_Fla_1_[  ----------------------------------------------IGSLQAQENYKPTW
Bac_Bac_Fla_2_[  -----------------------------------------------EKLTAQKKYEPTW
Bac_Bac_Fla_3_[  -----------------------------------------------GVAQTQKQYQPTW
Bac_Bac_Bac_4_[  ------------------------------------------------MKAQEKVYQPTW
Bac_Bac_Bac_1_[  ---------------------------------------------------AQNSYQPNW
Bac_Bac_Bac_2_[  ---------------------------------------------------GQKTYAPAW
Bac_Pro_Gam_1_[  --------------------------------------------------MTNKTYQPDW
Bac_Len_Len_1_[  QLKDQLKQMRADYKEDDKKFPFNEIIEDFWDYDEEDRRKALEISKRFAASPMKERYSADW
Bac_Bac_Bac_3_[  ---------------------------------------------------YAQEYKSTW
Bac_Bac_Cyt_3_[  ---------------------------------------------------TKAQYAPQW
Bac_Bac_Sph_5_[  --------------------------------------------------VSSQQYQPTW
ORF_SELECTIONNE  ----------------------------------------------------AKDYEPNW
Bac_Bac_Bac_5_[  ------------------------------------------------AGVRAQDKIKTW
Bac_Bac_Sph_1_[  -------------------------------------------------SLRAQDYQANW
Bac_Bac_Sph_3_[  ---------------------------------------------TISPGNFAQTYQPEW
Bac_Bac_Cyt_2_[  -------------------------------------------------KVEAQTYKPKW
Bac_Pla_Pla_1_[  ----------------------------------VCAANAQQTASVETESQSAQREADAW
Bac_Bac_Sph_6_[  ------------------------------------------------APLAAQQYSADW
Bac_Ver_Opi_1_[  ---------------------------------------------WSAFAGAPTTYQPTW
Bac_Aci_Aci_1_[  ----------------------------------------------------AQTYQPDW
Bac_Aci_Sol_1_[  ---------------------------------------------AGQRAFGQTRYQPTW
Bac_Bac_Sph_4_[  ------------------------------------KSSANNLFLSGEGVKAAGPFQPTW
Bac_Bac_Sph_8_[  ----------------------------------GAFGSNFLKEQHLGEPIAKGPFNPSW
Bac_Bac_Cyt_4_[  ------------------------------------------QTKDVNKTVNNTPFEANW
Bac_Bac_Fla_4_[  --------------------------------------ADKKDKKEEIAQETKPVYEANW
Bac_Ten_Mol_1_[  ---------------------------------------------EIEKVINEGPFKDTW
Bac_Act_Act_2_[  -----------------------------------------------DEVIERGRFKPDW
Bac_Pro_Alp_1_[  AALAAKQPSAPATAPTADTLSPAQIDLQWEKRGAKHVSDIAAELKQVEQGDGQGPFRPDW
Bac_Dic_Dic_1_[  ----------------------------------------------------EGPFEPTW
Bac_Arm_Cht_1_[  -------LAWGQGEGSTQNQLINPSQPYWLQWKSMYPSRVEAILQKADAVIARGPFQANW
Bac_Bac_Sph_7_[  -------------------------------------------------------YQSNW
                                                                             
                          <--------ZONE I-------->           POSITION       C

                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ----------MNWFESARLGMFIHWGHSSSRGW--------------------------E
Bac_Bac_Sph_2_[  ----ENKA-KMEWFEDAKLGIFIHWGIYSVQGISE------------------------S <------
Bac_Pro_Bet_1_[  ESIAQQYPGTPAWLREAKFGIWVHFGPQAAGMSGD------------------------- <------
Bac_Spi_Spi_1_[  MKP-DK---ITQW-QKLGFGMFIHYGLYSLCGGV--------------------------
Bac_Act_Act_1_[  ASL-DSHP-LPTWFDDAKLGIFIHWGIFSVPAWAP-----------RGE--------YAE
Bac_Chl_Chl_1_[  ESV-RAHI-VPDWFHDAKLGIFIHWGLYSVPGWAPTTGPLHDVVAKEGWKEWFRRNPYAE
Bac_The_The_1_[  ESL-REHT-VPKWFDKAKFGIFIHWGIYSVPGWATPTGEL----GKVPMDAWFFQNPYAE
Bac_Fir_Clo_1_[  NSV-NAHT-VPKWYEDCKFGIFIHWGIYSVPAFAPHTWEL----GEVDSKEWFADNPYAE
Bac_Fir_Clo_2_[  NSV-NAHT-VPKWYEDCKFGIFIHWGIYSVPAFAPHTWEL----GEVDSKEWFADNPYAE
Bac_Bac_Cyt_1_[  ASL-DQRP-IPGWFEDAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_1_[  ESL-DSRP-VPDWFHDAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_2_[  ESI-DSRK-TPDWFGNAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Fla_3_[  ESI-DSRS-VPNWFGGAKFGIFIHWGPYSVPAWSP-----------KGT--------YSE
Bac_Bac_Bac_4_[  ESL-DSRP-VPSWFGNAKFGIFIHWGLYSVPAWSP-----------KGT--------YAE
Bac_Bac_Bac_1_[  ESL-DKRP-VPAWFENAKFGIFIHWGLYSVPAWSP-----------KGT--------YSE
Bac_Bac_Bac_2_[  ESL-DTRP-VPSWFENAKFGIFIHWGLYSVPMWSP-----------KGT--------YSE
Bac_Pro_Gam_1_[  ASL-DSRE-MPQWFNEARFGIFIHWGVYSVPSWRKINNTL------FGS--------YAE
Bac_Len_Len_1_[  DSL-DSRP-VPAWYNKAKFGIFIHWGLYSVPAFAP-----------HGT--------YAE
Bac_Bac_Bac_3_[  ESI-DSRP-IPEWFSEAKFGIFIHWGLYSVPAWAPTNGPV------YEK--------YSE
Bac_Bac_Cyt_3_[  SSL-DQRP-TPAWFEDAKFGIFIHWGLYSVPAWATLSNAD----GFGSY--------YSE
Bac_Bac_Sph_5_[  ESL-ESRP-IPQWYPNAKFGIFIHWGLYSVPAWATNSNAD----GFGSN--------YAE
ORF_SELECTIONNE  ESL-DSRP-TPQWYKDAKFGIFIHWGLYSVPAWGP-----------RGS--------YAE
Bac_Bac_Bac_5_[  DEL-DRRP-IPKWWTDAKFGIFIHWGVYSVPAYAPVKEVK----GVYEK--------YAE
Bac_Bac_Sph_1_[  QSI-DQRE-IPQWWQDAKFGIFIHWGPYSVPAYAPIKEVE----GVYEK--------YAE
Bac_Bac_Sph_3_[  QSL-DKRQ-TPSWWTDAKFGIFIHWGLYSVPAYAPVNEVK----GVYEK--------YAE
Bac_Bac_Cyt_2_[  ESL-DKRE-TPTWWTDAKFGIFIHWGPYSVPAYAPVNEVE----GVYEK--------YAE
Bac_Pla_Pla_1_[  KAI-DARP-TPQWWRDAKFGIFIHWGPYSVPAFSEVGR-------------------YSE
Bac_Bac_Sph_6_[  ASL-NKRG-IPAWFNQAKFGIFIHWGVYAVPSFAVV---G------PGG--------YSE
Bac_Ver_Opi_1_[  ESL-DQRP-MPAWYREAKFGVFIHWGVYSVPAWGQ-----------HGE--------YAE
Bac_Aci_Aci_1_[  NSL-DKRP-TPAWFSDAKFGIFIHWGVYSVPAYAPVIP-G------KLA--------YAE
Bac_Aci_Sol_1_[  ESI-DARP-SPAWYTDSKFGIFIHWGVYSVPSYAPVKSKG------ETM--------YAE
Bac_Bac_Sph_4_[  ESL-AKYQ-VPDWFRDAKFGMWAHWGPQCQPERGD------------------------- <-------
Bac_Bac_Sph_8_[  ESL-QHYK-TPEWFRDAKFGIWAHWGPQCQPEAGD------------------------- <-------
Bac_Bac_Cyt_4_[  ESL-KTYQ-TPPWFQDAKLGIFIHWGPYSVPAFGS------------------------E
Bac_Bac_Fla_4_[  ESIKKNYK-DPTWFNKKKFGIFIHWGAYSVPEYSS------------------------E
Bac_Ten_Mol_1_[  ESL-QKKN-IPSWFKNSKFGIFIHWGLYSVPAFNN------------------------E
Bac_Act_Act_2_[  ESL-QQHR-TPRWFEEAKFGIFIHWGVYSVPAFGS------------------------E
Bac_Pro_Alp_1_[  ASL-KNYQ-VPQWYADAKFGVFIHWGLYSVPAFGS------------------------E
Bac_Dic_Dic_1_[  ESL-KNYK-IPEWYKDAKFGIFIHYGVYAVPAFGS------------------------E
Bac_Arm_Cht_1_[  ASL-VRYQ-IPKWYLDAKLGIFIHWGVYSVPAFGS------------------------E
Bac_Bac_Sph_7_[  ESL-KKYQ-VPDWFRDAKFGIFIHWGVYSVPAFKN------------------------E
                                ################                             


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  LSWPLVGGV--------------------FSLPYCQDVAIAEYHQNASNFKPTD--YNPR
Bac_Bac_Sph_2_[  WAFFNNYIN------------------------------HENYMKQLNGFTASK--YKPN
Bac_Pro_Bet_1_[  WYARRMYVP-----------G---TTAYANHLKDYGHPSQVGYKELLRDWNPRK--LDPA
Bac_Spi_Spi_1_[  WKGEPIKRG------------------YSEQILSHGKIPKEEYKALQNKFTCKN--FDAE
Bac_Act_Act_1_[  WYPESMRDP-----------N---NPTYTYHRQTYGA--DFKYRDFIPMFRAQR--WDPE
Bac_Chl_Chl_1_[  WYMNSLRIP-----------G---SPTVDYHAQHFGA--DFPYERFAETFNRETAAWDPA
Bac_The_The_1_[  WYENSLRIK-----------E---SPTWEYHVKTYGE--NFEYEKFADLFTAEK--WDPQ
Bac_Fir_Clo_1_[  WYYNSLNIG-----------K---GPTYKHHIEKYGK--DFKYEDFIPMWKAEN--WDPK
Bac_Fir_Clo_2_[  WYYNSLNIG-----------K---GPTYKHHIEKYGK--DFKYEDFIPMWKAEN--WDPK
Bac_Bac_Cyt_1_[  WYQYWLQSK--SLFGNGDFKG---DEVYEYHKKTYGD--DFTYYDFGPEFTADL--FDPE
Bac_Bac_Fla_1_[  WYQYWLQDE--TLFGNGDFTG---KEIVDFHNETYGE--DYSYYDFGKEFKADL--FEPD
Bac_Bac_Fla_2_[  WYQYWLQNK--TLFGNGNFKG---DEVVNYHEKTYGK--DFTYYDFGEMFTADL--FEPD
Bac_Bac_Fla_3_[  WYQYWLQSE--ALFGNGDFKG---DEVTKYHHKTYGK--NFDYYKFGEMFKADL--FEPD
Bac_Bac_Bac_4_[  WYKHWADKK--DLFGNGDFKG---DEVYEYHKKMYGE--K-SYADFAAMFKALD--YNPV
Bac_Bac_Bac_1_[  WYKYWLDKK--TLMGNGDFKG---TEVYDYHVEMYGR--DFTYADFAPMFRALS--YNPD
Bac_Bac_Bac_2_[  WYKYWLDRK--TLLGNGDFTG---TEVYDYHKKMYGE--DFTYADFAPMFKAMS--YDAN
Bac_Pro_Gam_1_[  WYYASVYGQ----------YR---NNDDDFHQRNYAP--DFLYRDFAPQFKAEL--FQPE
Bac_Len_Len_1_[  WYWNALKVKPVGKKEIKMSRH---LKVNEFHNRVYGK--DFGYEDFREQFTCEM--FDPN
Bac_Bac_Bac_3_[  WYWARQNPS-----------DKPFPAFTDFHNKMYGE--KIGYTDFVSGFKAEM--FDPA
Bac_Bac_Cyt_3_[  WYWERLNNS-------KLKIH---KEFVDFHQRVYSG--K-PYQEFAHDFKAEL--FEPS
Bac_Bac_Sph_5_[  WYWQRLIND-------KLKIH---KEFVDFQNRVYGP--NFKYPDFAPMFKAEL--FDPS
ORF_SELECTIONNE  WYLNGLKSG-----------D---STRLKYHEENYGK--DFPYRDFIKLFKSEK--YEPE
Bac_Bac_Bac_5_[  HYEARLKSG-----------N---KLFTDFHNRTYGK--NFKYADFAPMFKAEY--FRAD
Bac_Bac_Sph_1_[  HYENRLKTK-----------N---KLFLDFHNKTYGP--NFTYQDFAPLFKAEH--FKPE
Bac_Bac_Sph_3_[  HYENRLIQG-----------N---KLFTDHHKQFYGE--QFKYSDFAAMFKAEY--FKPE
Bac_Bac_Cyt_2_[  HYENRLLQK-----------N---KLFTDHHNRYFGE--NFTYQDFAPQFKAEY--FNPD
Bac_Pla_Pla_1_[  WYWMDLANP-------KRRSH---KIVKKFHNRVYGE--RFTYPDFVPMFTCEL--FDAD
Bac_Bac_Sph_6_[  WYWYQLDGA-------NDETH---KKVRAFHDKNYGK--DFGYQQFESQFKAEL--FDPA
Bac_Ver_Opi_1_[  WYWERVKSP-----------KPEHAAWAEFHRQNYGP--RFDYMDFAPRFTAEL--FDAK
Bac_Aci_Aci_1_[  WYWHQMTEG-----RDNPKANPIETGTWAYHQKMYGA--DYKYQNFAPQFRAQL--FDPD
Bac_Aci_Sol_1_[  WYWNSLNKA-----------N---SSTRKFHDRVYGT--DFKYFDFAPLFRAEL--YDPA
Bac_Bac_Sph_4_[  WYARGMYQE-----------G---SDQYKYHCKKYGHPSKFGFKDVINEWKAER--WDPE
Bac_Bac_Sph_8_[  WYARNMYEE-----------G---SRQYKFHLKKYGHPSKFGFKDVINEWKAEK--WDPE
Bac_Bac_Cyt_4_[  WYPRWMYMDSVQWNPDGEVTSEEPSWVYQHHVDTYGSPAEFGYKDFIPMFKAEK--FNAT
Bac_Bac_Fla_4_[  WYPRKMYMDTATFSAQLNLEKKGPSDVYLHHKKEWGDQKKFGYKDFIPMFKGEN--FDAN
Bac_Ten_Mol_1_[  WYSRNMYIE-----------G---MEEFKHHIETYGAHKGFGYKDFIPMFKADK--FDPS
Bac_Act_Act_2_[  WYSRNMHVQ-----------G---SPEFEHHVKTYGPQKDFGYKDFIPMFKAER--FDPD
Bac_Pro_Alp_1_[  WYSRLMYTK-----------G---TKEYDHHIKTFGPQDKFGYKDFIPLFKAEK--YDPR
Bac_Dic_Dic_1_[  WYSRNMYVE-----------G---SPEYEHHLKTYGEHKKFGYKDFIPLFKAEK--FDPY
Bac_Arm_Cht_1_[  WYPREMYLQ-----------N---SATFKHHVATYGPQNRFGYKDFIPMFKAEK--FDPM
Bac_Bac_Sph_7_[  WYPRNMYQQ-----------G---SEEYKHQVEKYGPMDKFGYKDFIPQFKAEK--FNAD
                                                           ###########   ####

                                               < INDEL >
                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  LWASLAKRLGVEYVILTTKHHDGFSLFPTTTSD------FCYGGGNSQQDLVKQFVEAMR
Bac_Bac_Sph_2_[  EWAQLIHDSGAKYSVITTKHHDGVSLWDSKADKAI----TIKKDAQARQDVLDPFVKALQ
Bac_Pro_Bet_1_[  KLTALYKEAGARFLLVQGVHHDNFDLWDSRYQP------WNSVRLGPKRDLLGEWAAAAR
Bac_Spi_Spi_1_[  KICALAKAAGMKYIIITAKHHDGFCLFDTKTTG------YNSVKAPAKRDLIAELSQACK
Bac_Act_Act_1_[  EWADLFASAGARYVVPVGAHHDGFPLWNTRTTE------WNSVTMGPKRDILQQLGAAVR
Bac_Chl_Chl_1_[  VWADLFKRAGAQYVVLTTKHHDGFLLWPSARPN------PFRAGYHATRDLVGDLTSAVR
Bac_The_The_1_[  EWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTD------FNSVKRGPKRDLVGDLAKAVR
Bac_Fir_Clo_1_[  QWAEIFKEAGAEYVVLTTKHHDGFCLFPSKYTH------FNSVEMGPKRNITGELTEAVR
Bac_Fir_Clo_2_[  QWAEIFKEAGAEYVVLTTKHHDGFCLFPSKYTH------FNSVEMGPKRNITGELTEAVR
Bac_Bac_Cyt_1_[  AWASLFEKAGAKYIVLTSKHHDGFTLWPNEQAN-DRGFAWNSMEVGAKRDLVGELTQAVR
Bac_Bac_Fla_1_[  QWASLFKESGARYVILTSKHHDGFALWPSEEAND-RGFPWNSKEVGARKDLLGELSESVK
Bac_Bac_Fla_2_[  AWATLFKNSGAKYIVLTSKHHDGYTLWPNKEAND-RGFAWNSMEVGAKRDLVGELSKSVK
Bac_Bac_Fla_3_[  KWASLFEEAGAKYVVLTSKHHDGFTLWPNKEAND-RGFAWNSMEVGSKKDLVGELSNAVK
Bac_Bac_Bac_4_[  QWAELFEKAGAKYVVLTTKHHDGYALWPSKEASRDFGRPWNSMDIGPGRDLVGEFTEAVR
Bac_Bac_Bac_1_[  EWAKLFERSGAKYVVLTTKHHDGFALWPSKEASSSYGRPWNSMEIGAHRDLVGEYVDALR
Bac_Bac_Bac_2_[  EWADLFKRAGAKYIVLTTKHHEGFALWPSKEASKSYGRPWNSMEIGAHRDLVGEYVNALR
Bac_Pro_Gam_1_[  AWAALFKSSGAKYVVLTTKHHDGFCLWPTENRHKKG---WNSGDTGPKRDLLGDITQAVR
Bac_Len_Len_1_[  QWADIFKKSGAKYVVLTAKHHDGYTLWPNKEASKSFGMPWNTVDSGPGRDLCQELGDAVR
Bac_Bac_Bac_3_[  KWAEIFKQSGAKYIVLTSKHHDGFALWPSEQAWN-----WNSEEVGPHRDLAGDLSEAIK
Bac_Bac_Cyt_3_[  KWADILENSGAKYVVLTSKHHEGFTMWPSKYSWN-----WNAGDIGPRRDLLGDLTKAVK
Bac_Bac_Sph_5_[  KWAQIFKDAGAKYVVLTSKHHDGFALWPSRESWN-----WNAMDAGPHRDLAGDLSKAVK
ORF_SELECTIONNE  KWAELFKESGAKYIVLTSKHHDGFCLWPSKESNG-----YNSVEGAAKRDLLGDLNTAVK
Bac_Bac_Bac_5_[  DWAKLFRKAGARYVVLTSKHHDGFCLWNSRYSPH-----WNSVVMGPHMDIMDSISRAVT
Bac_Bac_Sph_1_[  QWAELFKKAGAKYVVLTSKHHDGFCLWPSKYSPN-----WNSVDIGAHRDLAGDLTKAVR
Bac_Bac_Sph_3_[  EWADLFAKSGAKYVVLTSKHHDGFCLWPSAESNK-----WNSVDAGPHRDLAGDLTNAVK
Bac_Bac_Cyt_2_[  AWADLFQKAGAKYVVLTSKHHDGFSLWPSAFSPR-----WNSVAIGAHRDLAGDLTEAVR
Bac_Pla_Pla_1_[  QWAKAFEESGAKYVVLTSKHHDGYCLWPSEEADLAWGRPWNSTNSGPGRDLVGELTEAVR
Bac_Bac_Sph_6_[  QWADVFKRSGAKYVVLTSKHHEGYCLWDNKQADSVWGRPWNAVTGTPKRDLLGDLTSEVR
Bac_Ver_Opi_1_[  QWADLFARAGVRYVVPTSKHHDGFALWPSAEASRTWGRPWNAAEIGPKRDLLRELADATR
Bac_Aci_Aci_1_[  QWAATLADSGAKYVVLTSKHHEGFALWPSKEASATWDRPWNAVEVGPKRDLLGDVSDAVR
Bac_Aci_Sol_1_[  HWADVFERSGAKYVALTSKHHEGFTLWRNQQANQTWGRPWNAADIGPKRDIALDLMEAGR
Bac_Bac_Sph_4_[  ELVSLYKKTGARYFMALANHHDNLDLYNSKYQS------WNSTKVGPKKDLIGGWAKAAK
Bac_Bac_Sph_8_[  ELVSLYKSAGAQYFMALANHHDNFDLYNSKYQKD-----WNATKIGPKKDLIGGWAKAAR
Bac_Bac_Cyt_4_[  EWIKLFKKAGAKYVVPVAEHHDGFAMYNSNYTR------WNAVNMGPQRDVLGELSKASK
Bac_Bac_Fla_4_[  EWIDLFKKSGAKYVIPVAEHHDGFAMYKSNVTR------WNAVDMGPKRDILGELFKAGR
Bac_Ten_Mol_1_[  HWAKIIKKSGAKYVFPVAEHHDGFQMYKSDISK------WNSYEMGPKKDILGELKNAFN
Bac_Act_Act_2_[  AWADLFVDAGARYVVPVAEHHDGFQMYASRLSH------WNAAEMGPKRDVLGELTEAFH
Bac_Pro_Alp_1_[  AWAALFRAAGAQYVVPVAEHHDGFAMYDTKLSD------WSAVRMGPKRDLIGDLARAVR
Bac_Dic_Dic_1_[  EWADLFKKAGAKYVVPVAEHHDGFAMYDCSFTR------WCASKMGPKRDIIGELAKAVR
Bac_Arm_Cht_1_[  AWAKLFKAAGAKYVVPVAEHHDGFAMYNSDLTT------WCAAKMGPKRDIIGELAQAVR
Bac_Bac_Sph_7_[  DWATLFAKAGAKYVVPVAEHHDGFAMYKTTLSK------WNATEMGPKRDIVGELAEAIR
                 ##########################             #####################

                       <FIN ORF -----------------------------------------------------------...>
                        730       740       750       760       770       780
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  E-AGLRVGFYFS-L-IDW---HHPDY---------------------------------P
Bac_Bac_Sph_2_[  K-TGLKTGLYYS-L-PDW---SH------------------------------------P
Bac_Pro_Bet_1_[  A-SGLRYGVAFHHE-YTWWW-WQTAFESDPTGAYAGKPYDGALTLADGKGKWWEGLDPRL
Bac_Spi_Spi_1_[  K-NGLKFGLYFS-W-IDWNCEFAL-----------------------------------P
Bac_Act_Act_1_[  A-KKMHYAPSYHQL-LNY---YT------------------------------------P
Bac_Chl_Chl_1_[  A-AGLRMGLYYSGG-LDWT--FNDRVIADIV----------------------------D
Bac_The_The_1_[  E-AGLRFGVYYSGG-LDWRFTTE------------------------------------P
Bac_Fir_Clo_1_[  D-AGIRMGLYYSGL-IDWQYAND------------------------------------P
Bac_Fir_Clo_2_[  D-EGIRMGLYYSGL-IDWQYAND------------------------------------P
Bac_Bac_Cyt_1_[  Q-TEVKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_1_[  S-AGLKMGYYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_2_[  A-VGLKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Fla_3_[  K-KGIKMGLYYS-L-YEW---YH------------------------------------P
Bac_Bac_Bac_4_[  G-KGLRVGLYYS-M-IEW---DS------------------------------------P
Bac_Bac_Bac_1_[  K-TDIKVGCYFS-L-REW---DN------------------------------------P
Bac_Bac_Bac_2_[  K-TDLKVGCYFS-L-REW---DN------------------------------------P
Bac_Pro_Gam_1_[  D-CGLKMGVYYS-S-VEWETNSSHRPES-------------------------------G
Bac_Len_Len_1_[  SVGGMKMGYYYS-I-WDW---FN------------------------------------P
Bac_Bac_Bac_3_[  Q-SGMHMGFYYS-L-YEW---YN------------------------------------P
Bac_Bac_Cyt_3_[  S-KGLKMGYYYS-L-YEW---FN------------------------------------P
Bac_Bac_Sph_5_[  A-AGLHMGFYYS-L-YEW---YN------------------------------------P
ORF_SELECTIONNE  K-SGLKS-----------------------------------------------------
Bac_Bac_Bac_5_[  C-QGMHFGFYYS-L-LEW---SH------------------------------------P
Bac_Bac_Sph_1_[  T-SGLRMGFYYS-L-LEW---SH------------------------------------P
Bac_Bac_Sph_3_[  D-KGLKMGFYYS-L-LEW---NN------------------------------------P
Bac_Bac_Cyt_2_[  K-KGLRMGFYYS-L-LEW---NH------------------------------------P
Bac_Pla_Pla_1_[  K-TDVKMGLYYS-I-YEW---FN------------------------------------P
Bac_Bac_Sph_6_[  K-AGLKMGYYYS-L-YEW---FN------------------------------------P
Bac_Ver_Opi_1_[  E-RGLKFGFYYS-L-YEW---FN------------------------------------P
Bac_Aci_Aci_1_[  S-RGLRMGYYYS-L-YEW---YN------------------------------------P
Bac_Aci_Sol_1_[  A-KGLHMGIYYS-L-YEW---YN------------------------------------P
Bac_Bac_Sph_4_[  N-AGLPFGVSVHAA-HAWSW-YETAQRADKNGPLAGVPYDGKLTASDGAGKWWNKFDPQE
Bac_Bac_Sph_8_[  N-NGLPFGVSIHAS-HAWRW-YEMAQRADKTGQYSGIPYDGKLTQADGKGKWWSGLDPQE
Bac_Bac_Cyt_4_[  E-QGLYFGASSHFA-FNWNY-YNHKEGFDTADPEYA-----------------------D
Bac_Bac_Fla_4_[  Q-KGMIMGASSHFA-FNWSF-FNKKDHFDTTNPAYA-----------------------D
Bac_Ten_Mol_1_[  N-ENLIFCTSTHRA-EHWFFMSHGKKFESDIPQESRKG---------------------D
Bac_Act_Act_2_[  R-RGLVDGASSHRV-EHWFF-MGHGKDFDSDIHEPLKRG--------------------D
Bac_Pro_Alp_1_[  A-QGLHLGLSSHRAEHDWF--FDEGRKIPSDVNDPRYA---------------------D
Bac_Dic_Dic_1_[  D-NFLTFGVSYHRA-EHWWF-FHEGMKFDSDVRDKEYF---------------------D
Bac_Arm_Cht_1_[  K-EGLVFGLSTHRE-EHWWF-YNGGMQFDSDVRDPEYY---------------------S
Bac_Bac_Sph_7_[  K-QNLVFGLSSHRI-EHWFF-MNGGRKFMSDVIDPKYA---------------------D
                                                                             


                        790       800       810       820       830       840
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  AFTEADK--------------PYRFDKIPQPTPQQWERFSEVMFEQIRELLTLYGRIDII
Bac_Bac_Sph_2_[  YYDVNTR---------------TRKRYTLKEEPQRWENYVKYYQTQLNELSERYHP-DLI
Bac_Pro_Bet_1_[  LYG-PDLREYKGVTAAAHTDWNTPPAGIFSRHTAYAEWYAKRWALRMMDVVDRYDP-DFI
Bac_Spi_Spi_1_[  ISDHNSD--------------------------KIPPKHQKVNIEQLKELFTNYGPLCEL
Bac_Act_Act_1_[  EYDGPHP------------------------DYLSEKYLREWMLPQMRELVEDVGT-EML
Bac_Chl_Chl_1_[  LFMGVPQ----------------------------QLEYVEYANAHWKELIDRYQP-SIL
Bac_The_The_1_[  IRY-PED---------------LSYIRPN------TYEYADYAYKQVMELVDLYLP-DVL
Bac_Fir_Clo_1_[  IFE-DDD---------------LFGTASP------TFAYADYSYNQMKELVDDYAP-SVF
Bac_Fir_Clo_2_[  IFE-DDD---------------LFGTASP------TFAYADYSYNQMKELVDDYAP-SVF
Bac_Bac_Cyt_1_[  LWL-SDK----------------------------DKFVDQHYLPQVKDLVQRYQP-DIL
Bac_Bac_Fla_1_[  WWQ-NDK----------------------------ERFVNEHFLPQIKDLVKTYKP-DVL
Bac_Bac_Fla_2_[  WWQ-QDK----------------------------ERFVNDHFLPQVKDLVTKYEP-DVL
Bac_Bac_Fla_3_[  WWQ-NDK----------------------------ERFVDEHFLPQVKDLVQNYQP-DIL
Bac_Bac_Bac_4_[  LCM-RGR---------------M------------DCYVKEHLFPQCKELVTNYKP-DLL
Bac_Bac_Bac_1_[  LYN-KET---------------M------------DLFYERHFFPQLKDLVNRYKP-DLI
Bac_Bac_Bac_2_[  LYN-RET---------------M------------DLFYERHFFPQLKDLVNNYKP-DLI
Bac_Pro_Gam_1_[  YFI-PQR-------------------DREKFGIAEQSYPDEILIPQLKELVTNYQP-CLI
Bac_Len_Len_1_[  YDD-RID---------------IKKKAKYIDMKKHNKYVREVMYPQFRELVKKYKP-ALI
Bac_Bac_Bac_3_[  LYK-KD----------------L------------PKYVSDHMIPQMKDLVNRYQP-DIV
Bac_Bac_Cyt_3_[  LYK-TDP----------------------------DKYIEERMLLQMRELVDQYEP-DIL
Bac_Bac_Sph_5_[  LYK-TDV----------------------------KKYVAQHMLPQLKDLVTRYQP-DIV
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  LYD-KKT---------------I------------GRWVDEHMLPQLQELVVKYKP-DVI
Bac_Bac_Sph_1_[  LYK-KES---------------I------------EQWVDRHMIPQMQELVNAYQP-EVI
Bac_Bac_Sph_3_[  LYK-PQT---------------I------------DNYVENHMSPQMKDLVTRYKP-EVI
Bac_Bac_Cyt_2_[  LYK-TAT---------------I------------NQWVEEHMLPQMKELVMAYKP-EVI
Bac_Pla_Pla_1_[  LYT-ADV----------------------------DLFVDKHLIPQFKDMVNRYHP-AVI
Bac_Bac_Sph_6_[  LWK-KDK----------------------------ASYVKNVMTPQFKDLVTRYKP-SVI
Bac_Ver_Opi_1_[  LWL-KER----------------------------PRYVTQHMIPQFKDVVTRYQP-AII
Bac_Aci_Aci_1_[  LYL-SDK----------------------------QRYVRQHMFPQFKDLVTRYKP-AII
Bac_Aci_Sol_1_[  LWL-TDN----------------------------KRYVAEHMFPQFKDAVTHLKP-SII
Bac_Bac_Sph_4_[  LYA-QNH---ALSEKSDIDGTIHRQWNWGNGVCPPSKEYCEKFYKRTIELIDNYEP-EFI
Bac_Bac_Sph_8_[  LYA-QNH---PLSQNSLDNNFDTRQWDWGNGVYPPSKAYIDKFYNRTVDLINKYNP-DVV
Bac_Bac_Cyt_4_[  LYS-RNH----------------------PHYAPADKEFLELWWNRTKDIIDNYHP-DIL
Bac_Bac_Fla_4_[  LYSTKGK----------------------DLNEPVSKEFKELWWARTKDIIDNYQP-DIM
Bac_Ten_Mol_1_[  FYW-PSF--------------EEKGAYDFQSEPKPSKEFLEDWLERTVEIIDKYDP-KIL
Bac_Act_Act_2_[  FYW-PAM--------------PEPDHWDQHSKPEPTHEYLDDWLLRCCEIVDRYRP-KVL
Bac_Pro_Alp_1_[  FYG-PAQ--------LRVKEKGSDDADVFGDFTPVSQAWLSDWLARSAELVDLYHP-DLI
Bac_Dic_Dic_1_[  LYG-PAQ----------------------PESMQPNEEFLEDWLLRLFEIVDKYQP-QLV
Bac_Arm_Cht_1_[  FYG-PAA----------------------PENVPPTKAFLDDWLARDCELVDKYHP-QIV
Bac_Bac_Sph_7_[  FYG-PAR----------------------EENETMTPEYMNDWLLRCTELVDKYQP-QLV
                                                                             


                        850       860       870       880       890       900
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  WFD-GS---WERTPSQWRS--------SELAQMIR---QLQPDILIND-RL---------
Bac_Bac_Sph_2_[  WFD-GD---WEHNSEEWKT--Q-----QTLSNLR----KYNPNIIINS-RL---------
Bac_Pro_Bet_1_[  YTD-GTSD-QPFSGNGTGTGMKSDAIQHVMADFYNRTLKNRGKVD----TF---------
Bac_Spi_Spi_1_[  WMD------MGYPTKKQSEEVR-----ALAQ-------KLQLDMMINGRIW---------
Bac_Act_Act_1_[  WLD-GD---WMNPAEDFRT--K-----EFVAWYYNRALARREEVLVND-RL---------
Bac_Chl_Chl_1_[  WND------IGYPAAANLV--------ELFSFYYNTI----PEGVIND-RFTQASIGDGP
Bac_The_The_1_[  WND-MG---WPEKGKE-DL--K-----YLFAYYYNKH-P---EGSVND-RW---------
Bac_Fir_Clo_1_[  WND-IG---WPTQSEEM-M--P-----YFFAHYYNKV-P---EGVVND-RF---------
Bac_Fir_Clo_2_[  WND-IG---WPTQSEEM-M--P-----YFFAHYYNKV-P---EGVVND-RF---------
Bac_Bac_Cyt_1_[  WTD-GE---WEIEDTQWRS--E-----EFLAWLYNES-AAKDYILVND-RW---------
Bac_Bac_Fla_1_[  WGD-GE---WDITSDDWKS--K-----QFLAWLFNES-EVKKSIVIND-RW---------
Bac_Bac_Fla_2_[  WAD-GE---WDMDADKWKS--K-----ELLAWLFNES-KVKNSIVIND-RW---------
Bac_Bac_Fla_3_[  WAD-GE---WDMEAEKWKS--K-----EFLAWLFNES-KIKNTVVVND-RW---------
Bac_Bac_Bac_4_[  WSD-GN---GGYSEDIYKI--K-----DFLAWLYSAT-DVKDKVVVND-RW---------
Bac_Bac_Bac_1_[  WSD-GP---DQLNDKQWQA--E-----RTLAWLYSES-PVKDSIVVND-RW---------
Bac_Bac_Bac_2_[  WAD-GP---DSMNDKIWQV--E-----RTLSWLYSES-PVKDSIVVND-RW---------
Bac_Pro_Gam_1_[  FSDGGE---WDFSEEYSQT--K-----EFLSWLYNEA-PNKDEVVVND-RF---------
Bac_Len_Len_1_[  FSD-GD---WWADDNFWQT--K-----PLLAQLFNGA-MNRDEVVIND-RW---------
Bac_Bac_Bac_3_[  WTD-GE---WELTSDQWKS--T-----DFLAWLYNES-PVKNTVVVND-RW---------
Bac_Bac_Cyt_3_[  WGD-GE---WDKPTKDWKI--E-----PFMAWLFNES-KVKNHIVIND-RW---------
Bac_Bac_Sph_5_[  WPD-GE---WDHSDTIWRS--R-----EFIAWLYNDS-PVKNTVVVND-RW---------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  YAD-GE---WDYDSETLKS--R-----KFLSWLYDES-PVRNSVVVND-RW---------
Bac_Bac_Sph_1_[  FAD-GE---WDYPSETLKS--T-----TFLSWLYNES-PVRQQVVVND-RW---------
Bac_Bac_Sph_3_[  FAD-GE---WDYPSEKLRS--P-----QFLSWLYNES-AVKNTVVVND-RW---------
Bac_Bac_Cyt_2_[  FSD-GE---WDYASNQFKS--E-----KFLAWLYNES-PVKQTVVVND-RW---------
Bac_Pla_Pla_1_[  FTD-GE---WDHPAATWRT--S-----EMLTWLFNES-PCKEEVVIND-RW---------
Bac_Bac_Sph_6_[  FSD-GE---WEQSDTAWHS--A-----ELLAWLFNES-PVKDEVAVDD-RW---------
Bac_Ver_Opi_1_[  FSD-GE---WEMTAKEWRS--E-----ELLAWLFNES-AVKDEVVVND-RW---------
Bac_Aci_Aci_1_[  FSD-GE---WDLDSSEWHS--P-----ELLAWLFNDS-PVKDDVVIND-RW---------
Bac_Aci_Sol_1_[  FSD-GE---WELTSAEWNS--P-----ELLAWLFNES-PVRDEVVIDD-RW---------
Bac_Bac_Sph_4_[  YFDDTALPLWPASDAGL----------RIAAHLYNTN--LKRHGKLNAGIF---------
Bac_Bac_Sph_8_[  YFDDDKLPFWPVNDAGL----------RIAAHLYNKS--IEEHGVLRAVLN---------
Bac_Bac_Cyt_4_[  WFD------FVLDHEEFDPYHP-----LLAQYYYNKGIEWGKDVVLQTKNF---------
Bac_Bac_Fla_4_[  WFD------FYLDIPDFADQRP-----KLAAYYYNKGIEWGKEVVLQDKNF---------
Bac_Ten_Mol_1_[  YFD------WWIQHEAFKPYLK-----KVAAYYYNNAFKNNKDVII---AY---------
Bac_Act_Act_2_[  YFD------WWILHEAVQPYLR-----RFVAYYYDRADEWGEEVTV---CY---------
Bac_Pro_Alp_1_[  YFD------WWIGHPTFRSTLP-----KFLAYYYNSQAKLGGSAIVNY-KI---------
Bac_Dic_Dic_1_[  YFD------WWIEQPAFEPYLK-----KFFAYYYNRAHEWGKGVVINY-KL---------
Bac_Arm_Cht_1_[  WFD------WWINTPAFRPYLQ-----RFAAYYYDRAAQWHKGVVINY-KY---------
Bac_Bac_Sph_7_[  WFD------WWIEQPALDAYKK-----SFASYYYNKALEWNKGVVINY-KN---------
                                                                             


                        910       920       930       940       950       960
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------P------GQGD--FATPEQF------IPPKPPDGL-WEVCLTIND-SW
Bac_Bac_Sph_2_[  ------------N------HHGD--YDTPEQG------IPVVRPSAPYWELCYTMND-SW
Bac_Pro_Bet_1_[  ------------SVIKFHPKFNG--TVSTEEG----SIPAGIRNDEA-WIAETPVG--DW
Bac_Spi_Spi_1_[  ------------N------DCGD--FCTMGDN-----KFPDKSLNVP-WQTPASIYHETW
Bac_Act_Act_1_[  ------------G--MVRSKHGD--FYTQEYD-----YDVGQGPEHK-WENTRGCGL-SF
Bac_Chl_Chl_1_[  PDPAAIMQALAQG-MLPTPPHFD--FRTPEYA------VFPDIKAEK-WESCRGLGY-SF
Bac_The_The_1_[  ------------G-V----PHWD--FKTAEYH----VNYPGDLPGYK-WEFTRGIGL-SF
Bac_Fir_Clo_1_[  -----------------NGRYHD--FLTKEYK------AGSVNRNEK-WEMCRGMGL-SF
Bac_Fir_Clo_2_[  -----------------NGRYHD--FLTKEYK------SGSVNRNEK-WEMCRGMGL-SF
Bac_Bac_Cyt_1_[  ------------G-KGLRQKHGG--YYTTEYE------A-GKVFDKP-WEECRGMGF-SF
Bac_Bac_Fla_1_[  ------------G-KETRKNHGG--YFTTEYE------AEAPEFDRP-WEETRGMGF-SF
Bac_Bac_Fla_2_[  ------------G-KGVRKHHGG--FFTTEYE------SEAPEFTRP-WEECRGMGF-SF
Bac_Bac_Fla_3_[  ------------G-KGVRKKHGG--YFTTEYE------SEAPEFEKP-WEECRGMGF-SF
Bac_Bac_Bac_4_[  ------------A-KGMKHVHGD--FFTSEYS------TSDLDVEKP-WEECRGIGF-SF
Bac_Bac_Bac_1_[  ------------A-NNTGRKHGD--YYTREYS------STNSTFDKP-WEECRGIGL-SF
Bac_Bac_Bac_2_[  ------------A-NNTGRKHGD--YYTREYS------NTNSTYNKP-WEECRGIGF-SF
Bac_Pro_Gam_1_[  ------------C-KEMPGEHGD--YYSTEYN-----DKEGFGKLHP-WEESRGIGK-SY
Bac_Len_Len_1_[  ------------G-KGRG-KHGG--YFTTEYG------SGFEGIDKP-WEENRGMGH-SF
Bac_Bac_Bac_3_[  ------------G-KETRGKHGG--IYTTEYDLVGDLAADRVKPGHP-WEECRGIGG-SF
Bac_Bac_Cyt_3_[  ------------G-SDTRSKYGS--FYTTEYA-----DVSKVKFTRP-WEECRGIGE-SF
Bac_Bac_Sph_5_[  ------------G-SGGR-KYGS--FNTTEYG------HGTASLEKP-WEECRGIGE-SF
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------G-YETRSKHGD--YYTTEYNLVHQKEGIGDKASHP-WEESRGIGT-SY
Bac_Bac_Sph_1_[  ------------G-KETRSKHGG--YYTTEYDLVHDQKGIGDQASHP-WEESRGIGT-SY
Bac_Bac_Sph_3_[  ------------G-KETRSKHGG--YYTTEYDLVHDAKGIGEKAAHP-WEESRGIGT-SY
Bac_Bac_Cyt_2_[  ------------G-KETRSKHGD--YYTTEYDLVGDKLGFGDKATHP-WEESRGIGT-SY
Bac_Pla_Pla_1_[  ------------G-KGDRHKHGG--YYTTEYG------AGLPNAENP-WEENRGMAH-SF
Bac_Bac_Sph_6_[  ------------G-SNTRGHNNGATYLTSEYG-------SGMQPGVV-WEESQGIGN-SY
Bac_Ver_Opi_1_[  ------------G-SDTRHRHGG--YWTTEYA------AGLSDGSHA-WEESRGMAF-SY
Bac_Aci_Aci_1_[  ------------G-KDTRHKHGG--YWTTEYT------AGMSGMDHP-WEESRGMGF-SY
Bac_Aci_Sol_1_[  ------------G-KDTRHKHGG--YYTTEYT------SGMQQAAHP-WEESRGMGY-SY
Bac_Bac_Sph_4_[  ------------G-KILDEQQRKCMIWDIERG------QSNKIEPEP-WQTDTCIG--QW
Bac_Bac_Sph_8_[  ------------G-KMLNEDQRKAMVWDIERG------QANDIQPLP-WQTDTCIG--GW
Bac_Bac_Cyt_4_[  ------------G-RRTFPEGTN--VWDIERG------KSADILEFP-WQTDTSIGKNSW
Bac_Bac_Fla_4_[  ------------S-HEAFPEGTV--IYDLERG------KLPGIRKLP-WQTDTSIGKNSW
Bac_Ten_Mol_1_[  ------------K-HDAFVYGSG--IVEIERG------RFKELKHFP-WQTETAIANNSW
Bac_Act_Act_2_[  ------------K-QDSMMFGTA--VPDVERG------QLAEAKPYH-WQTDTAIALNSW
Bac_Pro_Alp_1_[  ------------G---AFPEGAG--VLDIERG------QLPGIQPRV-WQTCTSISNDSW
Bac_Dic_Dic_1_[  ---------------NAVPRECA--VFDVERG------KLGDIDPIY-WQTDTSISRLSW
Bac_Arm_Cht_1_[  ---------------AAFPSQAA--VLDLERG------EMGGIRPQF-WQTDTSISNNSW
Bac_Bac_Sph_7_[  ---------------TAFPEGSA--VLDIERG------KLAGIRQMA-WQTDDAVGFKSW
                                                                             


                        970       980       990      1000      1010      1020
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  GYNKA---DNNYKDARTLVHKLCEIAAKGGKLLLNVSPMGNGQIPPPQQECLESVAEWMS
Bac_Bac_Sph_2_[  GYQAF---DKHYKTPNMIVRTLVDCISMGGNLLLDIGPKEDGTIPQEQVAILKELGRWTG
Bac_Pro_Bet_1_[  YY-----GPWFTYDAGAVIRYLLEQVARDGNVAICISPLPDGSLDEGSVRMLKEVGAWMR
Bac_Spi_Spi_1_[  GYRSWQRRGDKNKKAQELIESLIRVRAMGGNYLLNIGPKGDGSVVAFEAEVLKKIGSFFK
Bac_Act_Act_1_[  GYNQA-EPLADYMTIEQLITMFVDNVANWGNLLLNVGPRADGTINDIQVDLLKGLGRWLE
Bac_Chl_Chl_1_[  GYNRN-ETVDDMLSPVKLIRSFVDIVSKNGNLLINVGPMGDGTIPPEQAERLEALGAWLS
Bac_The_The_1_[  GYNRN-EGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLR
Bac_Fir_Clo_1_[  GYNAN-EGDDKLISVPDLISLLVGTVANNGNLLLNIGPKADGTIPEEQVRRLKILGAWLK
Bac_Fir_Clo_2_[  GYNAN-EGDDKLISVPDLISLLVGTVANNGNLLLNIGPKADGTIPEEQVRRLKILGAWLK
Bac_Bac_Cyt_1_[  GYNQN-EDAWDYNSTQALLLMLIDIVSNGGNLLLDIGPDHRGNIPPIMQERLMEMGEWLA
Bac_Bac_Fla_1_[  GYNQN-EDSGDYNSPQALILMLVNVVSTGGNLLLDVGPDARGNIPPIMQERLLQMGKWLK
Bac_Bac_Fla_2_[  GYNQN-EDAQDYNSSKSLVLMLINVVSTGGNLLLDIGPDARGNIPPIMQDRLLDIGKWLK
Bac_Bac_Fla_3_[  GYNQN-EDSEDYNTPKALVLMLVNIVSTGGNLLLDIGPDSRGRIPVIMQERLKQMGKWLR
Bac_Bac_Bac_4_[  GLNRN-EDIEDYSSPKGLVLTLTNIVARGGNLLLGIAPDVNGKIPPVMQERLLQMGKWLA
Bac_Bac_Bac_1_[  GYNQN-EDLEDYTSPKALILTLANIVSQGGNLLLDIGPNANGKIPPIMQERLLQIGKWLQ
Bac_Bac_Bac_2_[  GFNQN-EDLEDYTLPQALVLTLVNVVSQGGNLLLGIGPNANGKIPPIMQERLLQIGDWLR
Bac_Pro_Gam_1_[  GYNRA-EQLEDYCTSQQLILQLVGIVSKGGNFLLNVGPTADGRIPVIQQERLRDIGRWMA
Bac_Len_Len_1_[  GFNRN-EDYTQYNSTRKLVFMLVDLVSRGGNLLLNIGPTGDGRIPVVMQNRLIDMGKWLE
Bac_Bac_Bac_3_[  GYNRN-ENLENYETSESLIRILIDKVSMGGNLLLNVGPTADGRIPVIMQQRLKDIGDWLS
Bac_Bac_Cyt_3_[  GYSRN-ENLEMYSSAEKLVHMLVEIVSKGGNLLLNIGPRADGGIPVIMQQRLAEIGAWLK
Bac_Bac_Sph_5_[  GYNRN-ENLEQYQSSKSLVHMLIDIVSRGGNLLLNIGPAADGTIPVIMQQRLKDMGDWQK
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  GYNRF-ERAEDYLSSKELIRLLVRTVANGGNLLLDVGPEANGLIPVIMQERLLDMGKWLE
Bac_Bac_Sph_1_[  GYNRF-ETTEDYFTSKQLIDLLIDKVSNGGNLLLNVGPTADGRIPVIMQERLLDMGKWLA
Bac_Bac_Sph_3_[  GFNRF-ETLEHYFTSKQLVDLLIDKVSNGGNLLLNIGPDANGLIPIIMQERLLDIGAWLK
Bac_Bac_Cyt_2_[  GYNRF-ETTDHYFTSKQLIDLLIDKVSNGGNLLLNIGPKADGLIPVIMQERLLDMGAWLK
Bac_Pla_Pla_1_[  GYSRT-ERFEDYNSSESLVLMLIDIVSRGGNFLLDIGPTADGRIPPLMEERLAEIGQWLS
Bac_Bac_Sph_6_[  GYNRM-ETVNDYKKSNDLVVLLVDIVSRGGNLLLDIGPTADGRIPVIMQQRLVDIGAWLE
Bac_Ver_Opi_1_[  GLNRA-ERVDDYKTGREFILILADLVSRGGNLLLDIGPAADGTIPPLMEQRLLEIGDWLR
Bac_Aci_Aci_1_[  GYNRA-ERLQDYHTSWELIIMLTDIVSRGGNLLLDIGPKADGTIPPIMQDRLHAMGSWLR
Bac_Aci_Sol_1_[  GYNRQ-ETLADYHSDRELLMMLLDIVARGGNLLLDIGPTADGRIPVVMEERLIQLGNFLR
Bac_Bac_Sph_4_[  HYDRRVYEENGYKTAKTVIHTLADVVSKNGNLMLNVPLRGDGSMDEKERAVVDNIGQWMQ
Bac_Bac_Sph_8_[  HYDRGLYERNGYKTAKSVIQTLVDIVSKNGNLMLNIPVRGDGTIDEKERKLVEEIGNWMK
Bac_Bac_Cyt_4_[  CYVTN----WESKDANTLLDDLIDIVSKNGNMLLNVGPKADGTIPEDQAAILLEMGEWLS
Bac_Bac_Fla_4_[  SYVSN----WQSKTANQIVDDLVDIVSKNGNLLLNVGPKSDGTIPEDQKEILLQIGDWLT
Bac_Ten_Mol_1_[  CYTNN----LDYKTENDVLTLLIDVVSKNGNLLLNIGPKGDGSIPQYEEKMLENIGKWLE
Bac_Act_Act_2_[  GYTEN----NRYRPAGEILQDMVDIISKNGNLLLNVGPKPDGTIGDEDRAVLTAIGGWLK
Bac_Pro_Alp_1_[  GYVEN----DTYKSPQALIHLLADVVSKNGNLLLNIGPRADGSIPQGAQDTLMAMGGWLT
Bac_Dic_Dic_1_[  GYIEN----DIYKPAKEIIWELVDIVSKNGNLLLNVGPKADGTIPEPAQKTLLEIGEWLL
Bac_Arm_Cht_1_[  GYVTQ----QNFKTPEQVVHELVDIVSKNGCLLLNIGPKSDGTIPQEEVDVLLDMGKWLR
Bac_Bac_Sph_7_[  GYMVK-------------------------CQL---------------------------
                                                                             


                       1030      1040      1050      1060      1070      1080
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  RYGESIIDTQPGLLPWQFYG--------------------------------------PS
Bac_Bac_Sph_2_[  LHKEAVYGTRAGI-PFEHYQGKSALSKDGKTVYLYLDAVKRTEHLTGISTSLKGVTVVGQ
Bac_Pro_Bet_1_[  MNGQGIYGSK----AWVRLGEGENGKLRTLPAGKLGREQ----------ADF------KF
Bac_Spi_Spi_1_[  SKTPSQGCAK----KLCKKLNLD-------------LPQDSILELNGEKNEI------PF
Bac_Act_Act_1_[  INGDGIYGTR----FWKVQ------------------------------RGT------TT
Bac_Chl_Chl_1_[  VNGEAIYGTR----PWTRA------------------------------EGV------TD
Bac_The_The_1_[  KYGDAIYGTS----VWERC------------------------------CAK------TE
Bac_Fir_Clo_1_[  VNHDGIYGTR----CSDRE------------------------------SEL------LE
Bac_Fir_Clo_2_[  VNHDGIYGTR----CSDRE------------------------------SEL------LE
Bac_Bac_Cyt_1_[  KNGEAIYGTR----PWKQSVQWSEGDRTIDHSG-SYLGGDYILKQTV-DKQD------GK
Bac_Bac_Fla_1_[  VNDEAIYGTR----PWKESFQWSKGEKK-VKADVHYLGGDFILKQTL-NPHL------GQ
Bac_Bac_Fla_2_[  VNGEAIYNTR----PWKDSFQWSKGEQNYKPKQ-HYLGGDFILKQTI-DPEP------GY
Bac_Bac_Fla_3_[  VNGEAIYNTT----PWNSSFQWSEGERNFKPKQ-HYLGGDFILKQTV-DPEP------GY
Bac_Bac_Bac_4_[  VNGEAIYDTH----KWRESFQWSAGAREGLKKGKYYVSGDAILAQTV-CPEK------GQ
Bac_Bac_Bac_1_[  INGEAIYGTR----AWNRSCQWTKGNREWKSKEKHYVSGDAILKQTV-DPEP------GY
Bac_Bac_Bac_2_[  VNGEAIYGTR----MWKQSFQWSKGNREWKPKGKHYVSGNEILKQTI-HPEP------GY
Bac_Pro_Gam_1_[  VNGDAIYGSE----ICTRL---------------------------------------QC
Bac_Len_Len_1_[  VNGEAIYDSV----VWKKACQWSEGTLP-KFTASDFKSGFPIYEMTL-EPKP------GN
Bac_Bac_Bac_3_[  VNGDAIYGTH----AWKYT------------------------------AKE------KK
Bac_Bac_Cyt_3_[  VNGEAIYGTR----ALAD----------------------------------------AP
Bac_Bac_Sph_5_[  VNGDAIYGTT----AWR--------------------------------EAP------KQ
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  VNGEAIYSSR----P---C------------------------------RSL------TV
Bac_Bac_Sph_1_[  VNGEAIYGTR----AWA-S------------------------------RPN------NS
Bac_Bac_Sph_3_[  VNGEAIYGSS----SWI-G------------------------------GAA------NQ
Bac_Bac_Cyt_2_[  VNGAAIYGTT----AWD-K------------------------------RPK------NR
Bac_Pla_Pla_1_[  VNGEAIYDTT----THSQTCQWTTGQEEELG-KGNYRVKYDVNKLMK-NPDE------GK
Bac_Bac_Sph_6_[  TNGEAIYNTT----PWKETRQWSVGNRP-VVKEASFMSDYNVAKMIK--PSK------EY
Bac_Ver_Opi_1_[  VNGEAIYGTR----PAARSYQWTAGERP-KQEYGEYRVAYSLLEQVGQAPRD------GQ
Bac_Aci_Aci_1_[  VNGEAIYGTR----PWKQNLQWNEGKRPDVKYNSEFESAYDVSKLAG-PPEP------GN
Bac_Aci_Sol_1_[  PNGEAIYGTH----AHRNPRQWSKGSIPKLE-EKEFMSDYDITKLVD-TPPA------GY
Bac_Bac_Sph_4_[  VNSEAIYGTR----PWTVFGEGPAIESAAPLSAQGFNEG----------KGK------PF
Bac_Bac_Sph_8_[  ANSESIYATR----PWKIFGEGPAQEAAAQLNAQGFNEG----------KGK------PF
Bac_Bac_Cyt_4_[  VNGDAIYGTR----PWTIFGEGPTEVKTGHHTEG---------------KNP------DL
Bac_Bac_Fla_4_[  INGDAIYDTT----YWKTFGEGPTEVKKGHHSEG---------------NNK------GL
Bac_Ten_Mol_1_[  KNGEAIYESI----PYLIFGEGSTIEIEGKFSE----------------KKI------EY
Bac_Act_Act_2_[  ANGEAIYGSK----PWKRFGEGPTQIVEGQFTDG---------------TKK------GF
Bac_Pro_Alp_1_[  VNGEAIYGTR----PWRQFGEGPTEVASGSFQET---------------KTK------PY
Bac_Dic_Dic_1_[  INGEAIYGSR----PWRIYGEGPTKGNVGSFSE----------------KEV------IY
Bac_Arm_Cht_1_[  INGEAIYGTR----PWVIYGEGPTKIKGGAFSDTSHG---------------------AY
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             
                          <---------------------------------------B----------

                       1090      1100      1110      1120      1130      1140
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  TRKDNFYY----------------------------------------------------
Bac_Bac_Sph_2_[  SGIKVPYTQNASSITLDLNTLKFDPAVTVLALHFQNTPTFIKAEPVATEIRTLLKSKNAD
Bac_Pro_Bet_1_[  GPHDFRFTVG--------------------------------------------------
Bac_Spi_Spi_1_[  TKKLYRFTGK--------------------------------------------------
Bac_Act_Act_1_[  DGIDVRYTAK--------------------------------------------------
Bac_Chl_Chl_1_[  SGIGMRFTRK--------------------------------------------------
Bac_The_The_1_[  DGTEIRFTRK--------------------------------------------------
Bac_Fir_Clo_1_[  SGIELHYTQK--------------------------------------------------
Bac_Fir_Clo_2_[  SGIELHYTQK--------------------------------------------------
Bac_Bac_Cyt_1_[  AVKEVFFTQN--------------------------------------------------
Bac_Bac_Fla_1_[  AVKEFFFTQN--------------------------------------------------
Bac_Bac_Fla_2_[  AVKELFFTQN--------------------------------------------------
Bac_Bac_Fla_3_[  AVKEVFFTQT--------------------------------------------------
Bac_Bac_Bac_4_[  AVKEAFFTQS--------------------------------------------------
Bac_Bac_Bac_1_[  AVKEVFFTQK--------------------------------------------------
Bac_Bac_Bac_2_[  AVKEVFFTKK--------------------------------------------------
Bac_Pro_Gam_1_[  NDEHTFLTSV--------------------------------------------------
Bac_Len_Len_1_[  AHKELYFTKK--------------------------------------------------
Bac_Bac_Bac_3_[  KEQTIFFTAK--------------------------------------------------
Bac_Bac_Cyt_3_[  KVDNVFFTEK--------------------------------------------------
Bac_Bac_Sph_5_[  PDSTIRFTKK--------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  RNNNVYLTQA--------------------------------------------------
Bac_Bac_Sph_1_[  KDTHRYFTAK--------------------------------------------------
Bac_Bac_Sph_3_[  KDKGIFYTQK--------------------------------------------------
Bac_Bac_Cyt_2_[  KDQTVYYTVK--------------------------------------------------
Bac_Pla_Pla_1_[  ARKEAVFTRK--------------------------------------------------
Bac_Bac_Sph_6_[  AHIEMFFTKK--------------------------------------------------
Bac_Ver_Opi_1_[  AVKQVFFTQK--------------------------------------------------
Bac_Aci_Aci_1_[  AAIEAFFTSK--------------------------------------------------
Bac_Aci_Sol_1_[  ARADAFFTAK--------------------------------------------------
Bac_Bac_Sph_4_[  TADDMRFTSK--------------------------------------------------
Bac_Bac_Sph_8_[  TYEDIRFATK--------------------------------------------------
Bac_Bac_Cyt_4_[  TSADFRFTQK--------------------------------------------------
Bac_Bac_Fla_4_[  SSKDIRFTTK--------------------------------------------------
Bac_Ten_Mol_1_[  KNDDFRFTAN--------------------------------------------------
Bac_Act_Act_2_[  TSRDVRYTVN--------------------------------------------------
Bac_Pro_Alp_1_[  TAQDFRFTTK--------------------------------------------------
Bac_Dic_Dic_1_[  TDKDFRFTTK--------------------------------------------------
Bac_Arm_Cht_1_[  TPEDIRFTTK--------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             

                 ------------------------------B-----------------------------
                       1150      1160      1170      1180      1190      1200
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  EAVYQITKHLYSGDNLLKNNGLTADGLNMNLPDQKQANPAILNWISKHAEALYETGAGIP
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  ------------------------------------------------------------
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  ------------------------------------------------------------
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             

                 --B-------->
                       1210      1220      1230      1240      1250      1260
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ----------------LHLLMKPY-E-----TVSVRGIP-----------IKQIESVKVV
Bac_Bac_Sph_2_[  EGHYAGLTALSADRQTLYLFVEGK-PT-G--PVAVKGLK------------NTIARIRIV
Bac_Pro_Bet_1_[  -----------RDGS-LYAFTMMV-PAPGA-TLKITSLG-----SRENLLGKPVTSVSLV
Bac_Spi_Spi_1_[  -----------DYYS-SHFICTEL-EL-N--LKISKGLYKTNFWTISLVRKKPLSQDEVL
Bac_Act_Act_1_[  -----------DDGDRVYAFLLSR-PH-G--SVSLASAE--------LPDLQAGDQVRLL
Bac_Chl_Chl_1_[  -----------GD-D-LYAILLDT-PQQP--NVTLLDVT-----------VSPGSRVILT
Bac_The_The_1_[  -----------CN-R-IFVIFLGI-PTGE--KIVIEDLN-----------LSAGTVRHFL
Bac_Fir_Clo_1_[  -----------DG-N-LNVFADHL-KE-GANEFLIKGY---------------HGALRPF
Bac_Fir_Clo_2_[  -----------DG-N-LNVFADHL-KE-GANEFLIKGY---------------HGALRPF
Bac_Bac_Cyt_1_[  -----------DK-S-VFAIIPDG-SK-Q--ELVLKGLK-----------ADKRTTVRHL
Bac_Bac_Fla_1_[  -----------EY-S-YFAIVPKW-PG-K--EMRIKDFQ-----------PKDNARITLL
Bac_Bac_Fla_2_[  -----------DE-A-YYVILPKWYPK----EIMVKGFE-----------SSKPSKVTFL
Bac_Bac_Fla_3_[  -----------NS-A-YYAIVPRW-SD-K--EIVLENVV-----------LNKSSLITLL
Bac_Bac_Bac_4_[  -----------AKGD-VYAILPVL-KS-G--KFVLKNIQ-----------STNNTRISML
Bac_Bac_Bac_1_[  -----------GE-N-VYAILPQY-PK-N--KIVLKNVQ-----------IRNKTKITLL
Bac_Bac_Bac_2_[  -----------GN-D-VYAILPQY-PK-P--TVILKGIK-----------VTNKTRISML
Bac_Pro_Gam_1_[  -----------GS-D-DYLIVTDW-PT-Q--PLSLRIVT-----------GAVPAACILL
Bac_Len_Len_1_[  -----------AD-T-IYGLLPVW-PDSG--KIEIRDIE-----------VSSDTKVTML
Bac_Bac_Bac_3_[  -----------GD-D-LYVIITRW-QN-Q--PIKIEGV-------------SKTDAVNML
Bac_Bac_Cyt_3_[  -----------GS-D-HYLIATDW-------RDVIETSW-----------AKKPKKVSML
Bac_Bac_Sph_5_[  -----------GA-T-LYAIATQW-RE----VLTIKGIR-------------QPAKVQLL
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  -----------HG-N-LYVIGTEC-PD-G--PVVIDGI-------------SKAGHSSLL
Bac_Bac_Sph_1_[  -----------GK-D-LYLICTEW-QN-G--TFHIPLP-------------RKPVRVSLL
Bac_Bac_Sph_3_[  -----------GK-D-IYIICTKW-PQ-T--DMTIGTI-------------KKAGKVSLL
Bac_Bac_Cyt_2_[  -----------GN-D-LYVICTKW-PE-N--SIAVPGI-------------SQAGKVNML
Bac_Pla_Pla_1_[  -----------GE-T-LYAICAVF-PD-G--QLTLNNIK-----------ASPDAVVTML
Bac_Bac_Sph_6_[  -----------DD-A-LYCIATSYTP-----QLRIKNFT-----------PAKQAKAVIL
Bac_Ver_Opi_1_[  -----------PD-A-LYAITAGW-PG-R--ELVLRGVR-----------VPESPVVTLL
Bac_Aci_Aci_1_[  -----------GN-D-VYAILPRW-PG-N--SFVLKGVS-------------DANSVSLL
Bac_Aci_Sol_1_[  -----------KD-A-VYAILPRR-PM-K--EVVLEDIE-----------APSGVRVTLL
Bac_Bac_Sph_4_[  -----------GK-T-LYAILLGW-PADH--AVTIKSLG---------EGVRQPGRVSLL
Bac_Bac_Sph_8_[  -----------GD-V-LYATALGW-PQDG--KLIIKSLA-----KNSRHFPKEIQKVEWV
Bac_Bac_Cyt_4_[  -----------DG-K-IYVIAMDV-AEDG--KYMVKSLG-----SANDVFKGKIKSVKPL
Bac_Bac_Fla_4_[  -----------DN-K-LYAIVLDW-PKDG--VVVIESLA----KEATYAKDLNITNARVL
Bac_Ten_Mol_1_[  -----------NG-A-VYVFVLNP-RDTK--RFNVKTLR--KATEKTEGIFSSIKKVVLL
Bac_Act_Act_2_[  -----------GG-N-LYAIVMRP-SDDG--VYRFTRLR-KGDAAHNADFHGFISRIDLL
Bac_Pro_Alp_1_[  -----------GA-A-LYAIELGW-PAEG--EAVIHSLK----------VEDKVKAVTLL
Bac_Dic_Dic_1_[  -----------GD-I-LYAILMNK-PEKD--EVIIKSLS-----TDLTLYQKEIAKVEIL
Bac_Arm_Cht_1_[  -----------GN-T-LYAIVMAW-PQDG--EVRIRSLG-----ANAHFATGSVHSVQLL
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                       1270      1280      1290      1300      1310      1320
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  --G------SDRP---LSYSGRCSIIDELTQNPQPLGELTI-------------TVPESA
Bac_Bac_Sph_2_[  GEGSMIDHDIYNK---LYWS-------------AIPGIVYI-------------NVPNER
Bac_Pro_Bet_1_[  --G-----HEGAP---ITWR-------------QEADGLVI-------------TTPSTM
Bac_Spi_Spi_1_[  --E-----INGKE---FCFP-------------ANKKELEIFKNIKIESVLKISVSTGGT
Bac_Act_Act_1_[  --G------HPGA---LRWQ-------------RQGPRVVV-------------DIPAAA
Bac_Chl_Chl_1_[  ---------GYGE---IAAA-------------QHDHGLTI-------------TLPASL
Bac_The_The_1_[  ---------TGER---LSFK-------------NVGKNLEI-------------TVPKKL
Bac_Fir_Clo_1_[  --D------PAVK---VETE-------------DTAEGLLV-------------KIPEYK
Bac_Fir_Clo_2_[  --D------PAVK---VETE-------------DTAEGLLV-------------KIPEYK
Bac_Bac_Cyt_1_[  --G------SGKT---LTYK-------------QKGDDLHI-------------MVPE--
Bac_Bac_Fla_1_[  --A------TDQN---LKWN-------------QEGNDIVV-------------ELPDYD
Bac_Bac_Fla_2_[  --A------TGEE---LKWK-------------KSENNLSI-------------QMPDYY
Bac_Bac_Fla_3_[  --A------TGET---INWK-------------QQGNNIVL-------------EGSTYD
Bac_Bac_Bac_4_[  --G------LNKT---LLWK-------------QKGKNIEV-------------TIPVIE
Bac_Bac_Bac_1_[  --G------SDKK---VLWK-------------QKGNDLEI-------------TMPSLY
Bac_Bac_Bac_2_[  --G------LDKK---IVWK-------------QKGEDIVI-------------TVPSLY
Bac_Pro_Gam_1_[  CQG------QQIP---VPFE--------------FEDGLVI-------------VHPVPW
Bac_Len_Len_1_[  --G------VEGQ---LKFA-------------KTAKGIEV-------------ILPQLN
Bac_Bac_Bac_3_[  --G------FNRK---INYT-------------VSKNSITI-------------HLPEVS
Bac_Bac_Cyt_3_[  --G------VDSP---VKFE-------------YKGGKLRV-------------IAPHLT
Bac_Bac_Sph_5_[  --G------VPDR---ISYQ-------------STKGGIRI-------------RAPHIT
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  --G-----ETKGR---IIAT-------------LRKGRLTV-------------NIPPLS
Bac_Bac_Sph_1_[  --G------HSGA---ISSD-------------FQKQQLTI-------------EAPPFN
Bac_Bac_Sph_3_[  --G------SATP---VKSE-------------IKRGELHI-------------IPPILN
Bac_Bac_Cyt_2_[  --G------TNKE---VKYD-------------LKNNTLTI-------------TAPELN
Bac_Pla_Pla_1_[  --G------HEGE---LPWT-------------QKGNNVVI-------------DMPSLN
Bac_Bac_Sph_6_[  --G------SDKA---ITWK-------------QQGKDCVV-------------DLSGLR
Bac_Ver_Opi_1_[  --G------VPGR---LPAK-------------VMNGTLVI-------------TAPRLE
Bac_Aci_Aci_1_[  --G------LNQK---LTHK-------------TQANGLRI-------------DLPPLP
Bac_Aci_Sol_1_[  --D------GGQQ---LQSK-------------LQGRQLRI-------------TVPDGL
Bac_Bac_Sph_4_[  --G------HGGN---LVYS-------------QSAQGLKV-------------TMPEQA
Bac_Bac_Sph_8_[  --P------AGQP---LLFQ-------------RTETELVV-------------SLPENN
Bac_Bac_Cyt_4_[  --S------SDKG---CDWR-------------IESDGLYL-------------TLKGNC
Bac_Bac_Fla_4_[  --G------SKEK---IKWS-------------QEKDGFKV-------------TMPKEK
Bac_Ten_Mol_1_[  --E------TQKE---VSFK-------------HNEEFLTI-------------ELDKSY
Bac_Act_Act_2_[  --GGPTDGEGDGKGKGLEWT-------------RDEHALEV-------------HAPAVP
Bac_Pro_Alp_1_[  --G-----VGGGT---LTFR-------------QDADGLHL-------------TLPQRP
Bac_Dic_Dic_1_[  --E------LKGE---VGFE-------------RSEEGLKV-------------KIPKVE
Bac_Arm_Cht_1_[  --G------SSAR---LHWE-------------QTPDALVV-------------QLPPQK
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                       1330      1340      1350      1360      1370      1380
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  IDPL----ATVLVIQLAQA-----------------------------------------
Bac_Bac_Sph_2_[  LDNNLSVIAVLLDKPIELYREKVGAIESNL------------------------------
Bac_Pro_Bet_1_[  PF------ATAVAFNIR-------------------------------------------
Bac_Spi_Spi_1_[  PSLRKALKQDNLILRVEGK-----------------------------------------
Bac_Act_Act_1_[  TVDQP---VHTLLFRRERRGHRS-------------------------------------
Bac_Chl_Chl_1_[  AD------APAHAIRIVGGASAASGGGR--------------------------------
Bac_The_The_1_[  LE------TDSITLVLEAVEE---------------------------------------
Bac_Fir_Clo_1_[  --------EDMYVVGLTNRF----------------------------------------
Bac_Fir_Clo_2_[  --------EDMYVVGLTNRF----------------------------------------
Bac_Bac_Cyt_1_[  EVLLGSKMNLPYSIKLQNVQ----------------------------------------
Bac_Bac_Fla_1_[  PNNFKPEEEFAYAFKISKY-----------------------------------------
Bac_Bac_Fla_2_[  PSKVES--DYAFVFKIWK------------------------------------------
Bac_Bac_Fla_3_[  PNKIQPGLDYAYVFKITKE-----------------------------------------
Bac_Bac_Bac_4_[  YGEAPC--DYAWTLKMENVK----------------------------------------
Bac_Bac_Bac_1_[  ADELPC--DYAWVLKLNNLENK--------------------------------------
Bac_Bac_Bac_2_[  YDEMPC--NYAWTLKLENVI----------------------------------------
Bac_Pro_Gam_1_[  RFDLGL--EFAYTFKLSY------------------------------------------
Bac_Len_Len_1_[  PTKLPC--KDIFTLKVTKAK----------------------------------------
Bac_Bac_Bac_3_[  PADNLS--SYAWVFKVTGGAK---------------------------------------
Bac_Bac_Cyt_3_[  PKTNPC--QYAWAYKIEY------------------------------------------
Bac_Bac_Sph_5_[  PANNPS--PYAWVYKIEGAF----------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  IFHLPS--PLAWVVKVEGVY----------------------------------------
Bac_Bac_Sph_1_[  PNTAPC--NYAWVYKLEGVLE---------------------------------------
Bac_Bac_Sph_3_[  PATMPC--QYAWVFKVKVI-----------------------------------------
Bac_Bac_Cyt_2_[  PATIPC--NHAWVFRVANFK----------------------------------------
Bac_Pla_Pla_1_[  PSRMPC--DFAWTFKISSIEDDIQ------------------------------------
Bac_Bac_Sph_6_[  PGDLG---NNLFVVKIQ-------------------------------------------
Bac_Ver_Opi_1_[  PDAAPC--RHAFAFKIAGGEVLPE------------------------------------
Bac_Aci_Aci_1_[  DELVH---QPCWVLKVSLAKTQ--------------------------------------
Bac_Aci_Sol_1_[  SAALPS--SQAYVLKLAGAR----------------------------------------
Bac_Bac_Sph_4_[  PC------KDAFVLKIEGLIG---------------------------------------
Bac_Bac_Sph_8_[  AD------TYACVLKIL-------------------------------------------
Bac_Bac_Cyt_4_[  KS------DYACAFEIEVE-----------------------------------------
Bac_Bac_Fla_4_[  PG------DFAYVIELEM------------------------------------------
Bac_Ten_Mol_1_[  D-------NYPIVFKVEME-----------------------------------------
Bac_Act_Act_2_[  GSG-----DSPITFRIVIG-----------------------------------------
Bac_Pro_Alp_1_[  AGA-----IAAYVYRIEMQ-----------------------------------------
Bac_Dic_Dic_1_[  KL------NYPITFKILGR-----------------------------------------
Bac_Arm_Cht_1_[  PC------DYAYTLKITGLRPASQPPITANGLMLDADHAQLHGNQIQVEDNYGKSDVGYW
Bac_Bac_Sph_7_[  ---------YRFYFRM--------------------------------------------
                                                                             


                       1390      1400      1410      1420      1430      1440
                 =========+=========+=========+=========+=========+=========+
Bac_Cya_Chr_1_[  ------------------------------------------------------------
Bac_Bac_Sph_2_[  ------------------------------------------------------------
Bac_Pro_Bet_1_[  ------------------------------------------------------------
Bac_Spi_Spi_1_[  ------------------------------------------------------------
Bac_Act_Act_1_[  ------------------------------------------------------------
Bac_Chl_Chl_1_[  ------------------------------------------------------------
Bac_The_The_1_[  ------------------------------------------------------------
Bac_Fir_Clo_1_[  ------------------------------------------------------------
Bac_Fir_Clo_2_[  ------------------------------------------------------------
Bac_Bac_Cyt_1_[  ------------------------------------------------------------
Bac_Bac_Fla_1_[  ------------------------------------------------------------
Bac_Bac_Fla_2_[  ------------------------------------------------------------
Bac_Bac_Fla_3_[  ------------------------------------------------------------
Bac_Bac_Bac_4_[  ------------------------------------------------------------
Bac_Bac_Bac_1_[  ------------------------------------------------------------
Bac_Bac_Bac_2_[  ------------------------------------------------------------
Bac_Pro_Gam_1_[  ------------------------------------------------------------
Bac_Len_Len_1_[  ------------------------------------------------------------
Bac_Bac_Bac_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_3_[  ------------------------------------------------------------
Bac_Bac_Sph_5_[  ------------------------------------------------------------
ORF_SELECTIONNE  ------------------------------------------------------------
Bac_Bac_Bac_5_[  ------------------------------------------------------------
Bac_Bac_Sph_1_[  ------------------------------------------------------------
Bac_Bac_Sph_3_[  ------------------------------------------------------------
Bac_Bac_Cyt_2_[  ------------------------------------------------------------
Bac_Pla_Pla_1_[  ------------------------------------------------------------
Bac_Bac_Sph_6_[  ------------------------------------------------------------
Bac_Ver_Opi_1_[  ------------------------------------------------------------
Bac_Aci_Aci_1_[  ------------------------------------------------------------
Bac_Aci_Sol_1_[  ------------------------------------------------------------
Bac_Bac_Sph_4_[  ------------------------------------------------------------
Bac_Bac_Sph_8_[  ------------------------------------------------------------
Bac_Bac_Cyt_4_[  ------------------------------------------------------------
Bac_Bac_Fla_4_[  ------------------------------------------------------------
Bac_Ten_Mol_1_[  ------------------------------------------------------------
Bac_Act_Act_2_[  ------------------------------------------------------------
Bac_Pro_Alp_1_[  ------------------------------------------------------------
Bac_Dic_Dic_1_[  ------------------------------------------------------------
Bac_Arm_Cht_1_[  NDPTDWVSWKVHLPAGVYRIEARVSAVAPSAITLEMADKRFTLQVPATGGWGDAKDVPVG
Bac_Bac_Sph_7_[  ------------------------------------------------------------
                                                                             


                       1450      1460      1470
                 =========+=========+=========+=========
Bac_Cya_Chr_1_[  ---------------------------------------
Bac_Bac_Sph_2_[  ---------------------------------------
Bac_Pro_Bet_1_[  ---------------------------------------
Bac_Spi_Spi_1_[  ---------------------------------------
Bac_Act_Act_1_[  ---------------------------------------
Bac_Chl_Chl_1_[  ---------------------------------------
Bac_The_The_1_[  ---------------------------------------
Bac_Fir_Clo_1_[  ---------------------------------------
Bac_Fir_Clo_2_[  ---------------------------------------
Bac_Bac_Cyt_1_[  ---------------------------------------
Bac_Bac_Fla_1_[  ---------------------------------------
Bac_Bac_Fla_2_[  ---------------------------------------
Bac_Bac_Fla_3_[  ---------------------------------------
Bac_Bac_Bac_4_[  ---------------------------------------
Bac_Bac_Bac_1_[  ---------------------------------------
Bac_Bac_Bac_2_[  ---------------------------------------
Bac_Pro_Gam_1_[  ---------------------------------------
Bac_Len_Len_1_[  ---------------------------------------
Bac_Bac_Bac_3_[  ---------------------------------------
Bac_Bac_Cyt_3_[  ---------------------------------------
Bac_Bac_Sph_5_[  ---------------------------------------
ORF_SELECTIONNE  ---------------------------------------
Bac_Bac_Bac_5_[  ---------------------------------------
Bac_Bac_Sph_1_[  ---------------------------------------
Bac_Bac_Sph_3_[  ---------------------------------------
Bac_Bac_Cyt_2_[  ---------------------------------------
Bac_Pla_Pla_1_[  ---------------------------------------
Bac_Bac_Sph_6_[  ---------------------------------------
Bac_Ver_Opi_1_[  ---------------------------------------
Bac_Aci_Aci_1_[  ---------------------------------------
Bac_Aci_Sol_1_[  ---------------------------------------
Bac_Bac_Sph_4_[  ---------------------------------------
Bac_Bac_Sph_8_[  ---------------------------------------
Bac_Bac_Cyt_4_[  ---------------------------------------
Bac_Bac_Fla_4_[  ---------------------------------------
Bac_Ten_Mol_1_[  ---------------------------------------
Bac_Act_Act_2_[  ---------------------------------------
Bac_Pro_Alp_1_[  ---------------------------------------
Bac_Dic_Dic_1_[  ---------------------------------------
Bac_Arm_Cht_1_[  TLTVPHAGDYELTVRAADAAHWRAVNLFGVRLVPEKGAT
Bac_Bac_Sph_7_[  ---------------------------------------
                                                        






Parameters used
Minimum Number Of Sequences For A Conserved Position: 21
Minimum Number Of Sequences For A Flanking Position: 34
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 5
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 4 selected block(s)
Flanks: [556  571]  [643  653]  [657  686]  [700  720]  

New number of positions in input.fasta-gb:  78  (5% of the original 1479 positions)






Protein Domains

PROTOCOLE:

Site : EMBL-EBI ; Outil : INTERPRO ; Paramètre par défaut ; Format texte : TSV



ANALYSE DES RÉSULTATS:


Voici les résultats obtenus pour la recherche de Domaine Protéique :

____________________________________________________________________________________________________________________________
| Code Interpro  |    Banque   |  position  |  position  |  E-value  |  Intitulé banque d'origine |   Intitulé Interpro    | 
|  (IPRxxxxxx)   |  d'origine  |  de début  |   de fin   |           |  (premier sur la ligne)    |   (en fin de ligne)    |
|________________|_____________|____________|____________|___________|____________________________|________________________|
|     Néant      |   Phobius   |     15     |     18     |   Néant   |   Signal Peptide C Region  |         Néant          | A
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR016286     |   PRINTS    |     138    |     156    | 9.53E-12  |       PR00741              |  Alpha-L-fucosidase    | B
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR016286     |   PRINTS    |     80     |     95     | 9.53E-12  |       PR00741              |  Alpha-L-fucosidase    | C
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR016286     |   PRINTS    |     119    |     135    | 9.53E-12  |       PR00741              |  Alpha-L-fucosidase    | D
|________________|_____________|____________|____________|___________|____________________________|________________________|
|    Néant       |    Phobius  |     19     |     167    |  Néant    |   NON_CYTOPLASMIC_DOMAIN   |        Néant           | E
|________________|_____________|____________|____________|___________|____________________________|________________________|
|     Néant      |   Phobius   |      6     |     14     |   Néant   |   Signal Peptide H Region  |         Néant          | F
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR000933     |   PANTHER   |      3     |     166    | 5.0E-67   |      PTHR10030             |   Glycoside hydrolase  | G
|________________|_____________|____________|____________|___________|____________________________|________________________|
|    Néant       |   Phobius   |      1     |     5      |  Néant    |  Signal Peptide N Region   |         Néant          | H
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR000933     |    Pfam     |     17     |     166    | 2.1E-56   |       PF01120              |  Glycoside hydrolase   | I
|________________|_____________|____________|____________|___________|____________________________|________________________|
|    Néant       |    Phobius  |      1     |     18     |  Néant    |     Signal Peptide         |        Néant           | J
|________________|_____________|____________|____________|___________|____________________________|________________________|
|    Néant       |   PANTHER   |      3     |    166     |  5.0E-67  |     PTHR10030:SF26         |         Néant          | K
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR017853     | SUPERFAMILY |     21     |     166    | 2.32E-55  |       SSF51445             |  Glycoside hydrolase   | L
|________________|_____________|____________|____________|___________|____________________________|________________________|
|    Néant       | SignalP_Euk |      1     |     18     |  Néant    |     SignalP-noTM           |        Néant           | M
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR013781     |    Gene3D   |     18     |     166    | 3.8E-60   |       G3DSA:3.20.20.80     |  Glycoside hydrolase   | N
|________________|_____________|____________|____________|___________|____________________________|________________________|
|  IPR000933     |    SMART    |     20     |     167    | 1.3E-17   |         SM00812            |  Glycoside hydrolase   | O
|________________|_____________|____________|____________|___________|____________________________|________________________|


[Affichage tableau vu et validé en TP par l'enseignant référant ]

[Nous avons numéroté les résultats obtenus afin de faciliter les explications]




Domaine sélectionné :

PANTHER PTHR10030 3 166 5.0E-67 T 30-09-2014 IPR000933 Glycoside hydrolase, family 29 GO:0004560|GO:0005975 KEGG: 00511+3.2.1.51


Nous avons retenu ce domaine (PTHR10030) car il présentait la meilleure E value : 5.0e-67, contrairement aux autres domaines qui ont une E value plus élevée. Un autre domaine avait une E value similaire à 5e-67, mais celle ci n'avait pas de description sur sa fonction. C'est pourquoi nous l'avons éliminée. De plus, le domaine sélectionné est de taille convenable (163 AA) par rapport aux autres résultats obtenus qui sont de plus petites tailles. On remarque également que ce domaine recouvre totalement notre ORF (de la position 1 à 165), ce qui nous conforte dans l'idée que notre ORF est bien codant pour une protéine.


La fonction ainsi trouvée est une Glycoside hydrolase, ce qui concorde avec nos résultats BLAST. Avec l'outils BLAST, nous avions trouvé un grand nombre d'homologues dont la fonction était : alpha L-fucosidase. Or cette protéine fait partie de la famille des Glycosides hydrolases.


Concernant les domaines A, E, F, H, J et M, INTERPRO n'a pas trouvé d'E-value correspond à ces domaines. C'est pourquoi nous les avons éliminé, car il est impossible de juger de leur fiabilité.

Pour les domaines B, C et D nous pouvons voir qu'ils proviennent tous de la même banque : PRINT. De plus, le positionnement de ces domaines semblent indiquer qu'ils se suivent (dans l'ordre C->D->B). Nous n'avons pas gardé ces domaines puisqu'ils possèdent une E value de 9.53e-12, qui est plus grande que celle du domaine sélectionné (5e-67). De plus le recouvrement de ces domaines est semblable à celui du domaine sélectionné, et légèrement plus court.

Quant aux domaines I, L, N et O, on peut voir qu'ils ont une bonne E value (2e-56, 2e-55, 3e-60, 1e-17), bien qu'elles soient plus faible que celle du domaine selectionné (5e-67). On remarque de plus qu'elles ont un bon recouvrement, qui est superposé à celui de notre domaine selectionné. Cependant, le recouvrement de chacun de ces domaines est légèrement plus petit que celui du domaine gardé.

Pour le domaine K, nous pouvons voir qu'il provient de la même banque que notre domaine sélectionné, qu'il possède la même E value et le même recouvrement. Cependant, il n'y a pas de description (fonction) du domaine (dernière colonne du tableau) c'est pourquoi nous avons préféré prendre le domaine similaire possédant cette description.


Les glycosides hydrolases sont des protéines catalysant l'hydrolyse des liaisons glycosidiques. Elles peuvent avoir des rôles divers comme la dégradation des glucides complexes, le métabolisme cellulaire, ou encore la défense anti-bactérienne.



RÉSULTATS BRUTS:

ORF 3

Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.	15	18	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	PRINTS	PR00741	Glycosyl hydrolase family 29 signature	138	156	9.525106E-12	T	30-09-2014	IPR016286	Alpha-L-fucosidase, metazoa-type	GO:0004560|GO:0006004	KEGG: 00511+3.2.1.51
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	PRINTS	PR00741	Glycosyl hydrolase family 29 signature	80	95	9.525106E-12	T	30-09-2014	IPR016286	Alpha-L-fucosidase, metazoa-type	GO:0004560|GO:0006004	KEGG: 00511+3.2.1.51
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	PRINTS	PR00741	Glycosyl hydrolase family 29 signature	119	135	9.525106E-12	T	30-09-2014	IPR016286	Alpha-L-fucosidase, metazoa-type	GO:0004560|GO:0006004	KEGG: 00511+3.2.1.51
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	19	167	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.	6	14	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	PANTHER	PTHR10030		3	166	5.0E-67	T	30-09-2014	IPR000933	Glycoside hydrolase, family 29	GO:0004560|GO:0005975	KEGG: 00511+3.2.1.51
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.	1	5	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Pfam	PF01120	Alpha-L-fucosidase	17	166	2.1E-56	T	30-09-2014	IPR000933	Glycoside hydrolase, family 29	GO:0004560|GO:0005975	KEGG: 00511+3.2.1.51
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Phobius	SIGNAL_PEPTIDE	Signal peptide region	1	18	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	PANTHER	PTHR10030:SF26		3	166	5.0E-67	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	SUPERFAMILY	SSF51445		21	166	2.32E-55	T	30-09-2014	IPR017853	Glycoside hydrolase, superfamily		
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	SignalP_EUK	SignalP-noTM		1	18	-	T	30-09-2014
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	Gene3D	G3DSA:3.20.20.80		18	166	3.8E-60	T	30-09-2014	IPR013781	Glycoside hydrolase, catalytic domain	GO:0005975	
Translation	69645b5ce751a6ea309b1e4e58e9a033	167	SMART	SM00812	Alpha-L-fucosidase	20	167	1.3E-17	T	30-09-2014	IPR000933	Glycoside hydrolase, family 29	GO:0004560|GO:0005975	KEGG: 00511+3.2.1.51

Phylogeny

PROTOCOLE:

a) Site : Phylogeny.fr ; Outils : PhyML ; Paramètres par défaut

b) Site : Phylogeny.fr ; Outils : PhyML ; Paramètres par défaut (ajout de séquences eucaryotes à l'arbre A)


ANALYSE DES RÉSULTATS :


Avec l'arbre obtenu par PhyML, on ne peut distinguer correctement le groupe extérieur du groupe d'étude. L'histoire évolutive que nous donne cet arbre ne correspond pas à l'histoire évolutive de l'arbre de la vie : par exemple, le noeud A correspond à un hypothétique ancêtre commun entre une acidobactérie et une bacteroidetes. Or cette bacteroidete devrait être regroupée avec les autres bacteroidetes. Nous avons enraciné notre arbre au point R. La plupart des espèces présentent sous ce point sont des espèces du groupe extérieur c'est pourquoi nous avons choisi de raciner l'arbre ici. On retrouve donc un bloc contenant une majorité des espèces du groupe extérieur, et deux grands blocs contenant une majorité de Bacteroidetes (notre groupe d'étude).


L'ORF sélectionné (branche B) est directement apparenté à une Spirochaetes (qui appartient au groupe extérieur). L'histoire évolutive de cet arbre nous donne des hypothétiques liens de parentés dans l'ordre suivant (en partant de notre ORF et en remontant) : ORF ; Spirochaetes ; Thermotogae ; Chloroflexi ; avant d'arriver à l'embranchement des Cyanobacteria et Bacteroidetes. Or nos précédentes analyses (BLAST et TaxRepport) ne prédisaient absolument pas ce résultat.

Les deux groupes contenant majoritairement des Bacteroidetes (C et D) semblent être en miroir. Ceci nous fait pensait qu'il y a pu avoir duplication de notre gène à la base. Il existerait donc une forme A et une forme A' du gène. Il faudrait donc pousser nos analyses plus loin (en essayant de sélectionner une seule forme du gène dans chaque espèce) pour pouvoir affiner notre arbre, ce qui est très compliqué à notre niveau et avec le peu de temps dont nous disposons. De plus, d'après les prédictions de fonction que nous avons fait il s'agirait d'une Glycoside hydrolase. Or ce type de protéine fait partie de la base du métabolisme de tout les organismes vivants, ce qui expliquerait que le gène existe sous différentes formes.  

Avec cet arbre, nous avons fait l'hypothèse que notre ORF appartient aux groupes des bactéries. En effet, au vu des résultats, il est impossible d'aller plus loin dans la phylogénie.


Nous avons ainsi fait un deuxième arbre avec l'outil PhyML en y ajoutant des séquences eucaryotes. Le but étant d'avoir nos séquences eucaryotes regroupées formant le groupe extérieur, toutes les autres bactéries et notre ORF ensemble pour former le groupe d'étude. Cet arbre nous aurait permis d'affirmer que notre ORF appartient aux bactéries.

Or, comme vous pouvez le voir en B, les eucaryotes se sont insérés au milieu des groupes bactériens. Nous avons donc placé la racine de manière à retrouver la même structure que pour le premier arbre.

On ne peut donc même pas affirmer que notre ORF appartient au groupe des bactéries, ou à celui des eucaryotes ou encore des archées. On ne peut donc pas prédire la taxonomie.



[Reconstruction de l'arbre avec la méthode Neighbor Joining impossible, car l'outil n'est pas fonctionnel sur le site miroir de Montpellier de phylogeny.fr]


RESULTAT BRUT :
a) Arbre PhyML
                                                                                                       -----0.5----
 
         +41_Bac_Fir_Clo_1_Bacteria_Firmicutes_Clostridia_Evalue6e47_Bacte
  +------+
  |      +40_Bac_Fir_Clo_2_Bacteria_Firmicutes_Clostridia_Evalue1e46_Bacte
  |
R++----------39_Bac_Bac_Bac_5_Bacteria_Bacteroidetes_Bacteroidia_Evalue4e41_B
 ||
 || +---------38_Bac_Ver_Opi_1_Bacteria_Verrucomicrobia_Opitutae_Evalue2e45_Ba
 || |
 || |  +----------37_Bac_Act_Act_1_Bacteria_Actinobacteria_Actinobacteridae_Evalue4
 || |  |
 |+-+  |  +---36_Bac_Act_Act_2_Bacteria_Actinobacteria_Actinobacteridae_Evalue6
 |  |  |+-+
 |  |  || +----------35_Bac_Ten_Mol_1_Bacteria_Tenericutes_Mollicutes_Evalue3e31_Bact
 |  +--+|
 |     ||
 |     ||  +-----34_Bac_Bac_Cyt_4_Bacteria_Bacteroidetes_Cytophagia_Evalue3e31_Ba
 |     ||--+
 |     ||  +----33_Bac_Bac_Fla_4_Bacteria_Bacteroidetes_Flavobacteriia_Evalue7e2
 |     ++
 |      | +--32_Bac_Dic_Dic_1_Bacteria_Dictyoglomi_Dictyoglomales_Evalue2e33
 |      |-+
 |      | | +------31_Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 |      | +-+
 |      |   +-30_Bac_Arm_Cht_1_Bacteria_Armatimonadetes_Chthonomonadetes_Evalue
 |      |
 |      +----29_Bac_Bac_Sph_7_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue4e
 |
 |   +--28_Bac_Bac_Sph_1_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue7e
 |  ++
 | C|+---27_Bac_Bac_Cyt_2_Bacteria_Bacteroidetes_Cytophagia_Evalue2e45_Ba
 |+-+
 || |+---26_Bac_Bac_Sph_3_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue2e
 || ||
 || ++   +------25_Bac_Bac_Bac_3_Bacteria_Bacteroidetes_Bacteroidia_Evalue8e48_B
 ||  +---+
 ||      +---24_Bac_Bac_Sph_5_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue2e
 ||
 || +------23_Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 || |
 || |+-------22_Bac_Bac_Sph_6_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
 ||-+|
 || ||-------21_Bac_Aci_Aci_1_Bacteria_Acidobacteria_Acidobacteriales_Evalue1e
 || ||
 || ++
 ||  | +--------20_Bac_Bac_Cyt_3_Bacteria_Bacteroidetes_Cytophagia_Evalue8e43_Ba
 ||  +-+A
 ||    +--------19_Bac_Aci_Sol_1_Bacteria_Acidobacteria_Solibacteres_Evalue1e44
 ||
 ||     +-----18_Bac_The_The_1_Bacteria_Thermotogae_Thermotogales_Evalue1e44_B
 ||     |
 ||+----+                  +----------------------------17_Bac_Cya_Chr_1_Bacteria_Cyanobacteria_Chroococcales_Evalue1e11
 |||    |      +-----------+
 |||    +------+           +---------------------------16_Bac_Bac_Sph_2_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue3e
 |||           |
 ||+           +-------15_Bac_Chl_Chl_1_Bacteria_Chloroflexi_Chloroflexales_Evalue2e42
 |||
 ++|       +-----------------------------14_Bac_Spi_Spi_1_Bacteria_Spirochaetes_Spirochaetales_Evalue3e19
  |+-------+
  |       B+----13_ORF_SELECTIONNE_Translation_of_ORF_number_2_in_reading_frame_1_o
  |
  |                                     +--12_Bac_Bac_Sph_4_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
  |                          +----------+
  |                          |          +-11_Bac_Bac_Sph_8_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
  |--------------------------+
  |                          +---------------10_Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
  |
  |     +----------9_Bac_Len_Len_1_Bacteria_Lentisphaerae_Lentisphaerales_Evalue5e
  | +---+
  | |   +---8_Bac_Pla_Pla_1_Bacteria_Planctomycetes_Planctomycetacia_Evalue2
  | |
  |++
  |||     +-7_Bac_Bac_Bac_4_Bacteria_Bacteroidetes_Bacteroidia_Evalue9e47_B
  ||+-----+
  ||      |   +-6_Bac_Bac_Bac_1_Bacteria_Bacteroidetes_Bacteroidia_Evalue7e52_B
 D++      +---+
   |          +----5_Bac_Bac_Bac_2_Bacteria_Bacteroidetes_Bacteroidia_Evalue2e49_B
   |
   |    +--4_Bac_Bac_Cyt_1_Bacteria_Bacteroidetes_Cytophagia_Evalue6e50_Ba
   |    |
   +----+ +---3_Bac_Bac_Fla_3_Bacteria_Bacteroidetes_Flavobacteriia_Evalue3e5
        +-+
          | +---2_Bac_Bac_Fla_2_Bacteria_Bacteroidetes_Flavobacteriia_Evalue6e5
          +-+
            +-----1_Bac_Bac_Fla_1_Bacteria_Bacteroidetes_Flavobacteriia_Evalue1e5

______________________________________________________________________________________________________________=
b) Arbre PhyML (ajout de 3 séquences eucaryotes)

                                                                                                      ------0.5----
 
     +----------44_Euk_Met_Mol_1_Eukaryota_Metazoa_Mollusca_Evalue6e42_Eukaryota <-------
   +-+
   | +-----43_Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |
   |  +-------42_Bac_Aci_Aci_1_Bacteria_Acidobacteria_Acidobacteriales_Evalue1e
 +-+ ++
 | | |+---------41_Bac_Bac_Cyt_3_Bacteria_Bacteroidetes_Cytophagia_Evalue8e43_Ba
 | |++
 | ||| +---------40_Bac_Aci_Sol_1_Bacteria_Acidobacteria_Solibacteres_Evalue1e44
 | ||+-+
 | ++  +---------39_Euk_Ich_Cap_1_Eukaryota_Ichthyosporea_Capsaspora_Evalue9e47_E  <--------------------
 |  |
 |  +--------38_Bac_Bac_Sph_6_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
 |
 |  +--------37_Euk_Met_Art_1_Eukaryota_Metazoa_Arthropoda_Evalue4e45_Eukaryo   <---------------------
 |  |
 |  |
 |  |        +----36_Bac_Act_Act_2_Bacteria_Actinobacteria_Actinobacteridae_Evalue6
 |  |      +-+
 |  |      | +-----------35_Bac_Ten_Mol_1_Bacteria_Tenericutes_Mollicutes_Evalue3e31_Bact
 |  |      |
 |  |      |  +-----34_Bac_Bac_Cyt_4_Bacteria_Bacteroidetes_Cytophagia_Evalue3e31_Ba
 |  |      |--+
 |  |      |  +----33_Bac_Bac_Fla_4_Bacteria_Bacteroidetes_Flavobacteriia_Evalue7e2
 |  |    +-+
 |  |    | |  +--32_Bac_Dic_Dic_1_Bacteria_Dictyoglomi_Dictyoglomales_Evalue2e33
 |  |    | |+-+
 |  |    | || | +------31_Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 |  |    | || +-+
 |  | +--+ ++   +-30_Bac_Arm_Cht_1_Bacteria_Armatimonadetes_Chthonomonadetes_Evalue
 |--+ |  |  |
 |  | |  |  +----29_Bac_Bac_Sph_7_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue4e
 |  |-+  |
 |  | |  +-----------28_Bac_Act_Act_1_Bacteria_Actinobacteria_Actinobacteridae_Evalue4
 |  | |
 |  | +----------27_Bac_Ver_Opi_1_Bacteria_Verrucomicrobia_Opitutae_Evalue2e45_Ba
 |  |
 |  +----------26_Bac_Bac_Bac_5_Bacteria_Bacteroidetes_Bacteroidia_Evalue4e41_B
 |
 |     +-------25_Bac_Bac_Bac_3_Bacteria_Bacteroidetes_Bacteroidia_Evalue8e48_B
 | +---+
 | |   +---24_Bac_Bac_Sph_5_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue2e
 | |
 |-+----23_Bac_Bac_Sph_3_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue2e
 | |
 | |
 | | +22_Bac_Bac_Sph_1_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue7e
 | +-+
 |   +---21_Bac_Bac_Cyt_2_Bacteria_Bacteroidetes_Cytophagia_Evalue2e45_Ba
 |
 |                                        +---20_Bac_Bac_Sph_4_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
 |                             +----------+
 |   +-------------------------+          +-19_Bac_Bac_Sph_8_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue1e
 |   |                         |
 |+--+                         +-----------------18_Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 ||  |
 ||  +--------------------------------17_Bac_Spi_Spi_1_Bacteria_Spirochaetes_Spirochaetales_Evalue3e19
 ||
 ||    +-----16_Bac_Pla_Pla_1_Bacteria_Planctomycetes_Planctomycetacia_Evalue2
 || +--+
 |+ |  +----------15_Bac_Len_Len_1_Bacteria_Lentisphaerae_Lentisphaerales_Evalue5e
 ||++
 ||||    +--14_Bac_Bac_Bac_4_Bacteria_Bacteroidetes_Bacteroidia_Evalue9e47_B
 ||||    |
 |||+----+    +--13_Bac_Bac_Bac_1_Bacteria_Bacteroidetes_Bacteroidia_Evalue7e52_B
 |||     +----+
 |++          +----12_Bac_Bac_Bac_2_Bacteria_Bacteroidetes_Bacteroidia_Evalue2e49_B
 | |
 | |    +--11_Bac_Bac_Cyt_1_Bacteria_Bacteroidetes_Cytophagia_Evalue6e50_Ba
 | |    |
 | +----+  +---10_Bac_Bac_Fla_3_Bacteria_Bacteroidetes_Flavobacteriia_Evalue3e5
 |      |  |
 |      +--+ +---9_Bac_Bac_Fla_2_Bacteria_Bacteroidetes_Flavobacteriia_Evalue6e5
 |         +-+
 |           |
 |           +-----8_Bac_Bac_Fla_1_Bacteria_Bacteroidetes_Flavobacteriia_Evalue1e5
 |
 |+------------7_ORF_SELECTIONNE_Translation_of_ORF_number_2_in_reading_frame_1_o
 ||
 ||                       +-----------------------------6_Bac_Cya_Chr_1_Bacteria_Cyanobacteria_Chroococcales_Evalue1e11
 ||          +------------+
 ++   +------+            +-----------------------------5_Bac_Bac_Sph_2_Bacteria_Bacteroidetes_Sphingobacteriia_Evalue3e
  |   |      |
  | +-+      +--------4_Bac_Chl_Chl_1_Bacteria_Chloroflexi_Chloroflexales_Evalue2e42
  | | |
  | | +------3_Bac_The_The_1_Bacteria_Thermotogae_Thermotogales_Evalue1e44_B
  +-+
    |       +2_Bac_Fir_Clo_1_Bacteria_Firmicutes_Clostridia_Evalue6e47_Bacte
    +-------+
            +1_Bac_Fir_Clo_2_Bacteria_Firmicutes_Clostridia_Evalue1e46_Bacte

Taxonomy report

PROTOCOLE :

Site : Annotathon ; Outils : TaxReport ; Paramètre : "exclure les séquences environnementales"




ANALYSE DES RÉSULTATS :


Voici le tableau répertoriant les principales espèces trouvées dans le TaxReport :


|                       |                   |                          |                  |                     |        

| phylum                | classe            | Ordre                    | gamme de e-value | nombre de résultats |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Bacteroidetes]       | [Sphingobacteriia]|  [Sphingobacteriales]    |  7e-56 - 4e-12   |          18         |

|                       |___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |[Bacteroidia]      |  [Bacteroidales]         |   7e-52 - 6e-11  |         112         |

|                       |___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Cytophagia]      |   [Cytophagales]         |  6e-47 - 7e-11   |          16         |

|                       |___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Flavobacteria]   |  [Flavobacteriales]      |   6e-46 - 2e-11  |          25         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Actinobacteria]      |  [Actinobacteria] |   [Actinomycetales]      |   7e-46 - 1e-10  |          65         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Proteobacteria]      [Gammaprotebacteria]|  [Xanthomonadales]       |    9e-34 - 6e-25 |         15          |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   |   [Alteromonadales]      |    9e-32 - 1e-18 |         8           |

|                       |___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       [Alphaproteobacteria]  [Rhizobiales]           |   9e-17 - 3e-14  |         12          |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Firmicutes]          |    [Clostridia]   |   [Clostridiales]        |   1e-45 - 2e-16  |          25         |

|                       |___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |  [Bacilli]        |    [Lactobacillales]     |   2e-34 -1e-10   |          48         |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   | [Bacilliales]            |  1e-33 - 5e-11   |          21         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|  [Acidobacteria]      | [Acidobacteriales]|                          |   6e-40 - 2e-11  |          7          |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Spirochaetes]        | [Spirochaetia]    | [Spirochaetales]         |   5e-19 - 4e-11  |          72         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|  [Arthropoda]         |  [Insecta]        |                          |  4e-45 - 2e-33   |          16         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|  [Chordata]           |   [Mammalia]      |    [Primates]            |    2e-38 -3e-32  |          8          |

|_______________________|___________________|__________________________|__________________|_____________________|




_

Groupe d'étude :

>Bac_Bac_Sph_1 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_7e-56  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Sphingobacteriaceae;Sphingobacterium; gi|503430393|ref|WP_013665054.1| alpha-L-fucosidase [Sphingobacterium sp. 21]


>Bac_Bac_Sph_2 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_3e-20  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Sphingobacteriaceae;Sphingobacterium; gi|489085273|ref|WP_002995182.1| alpha-L-fucosidase [Sphingobacterium spiritivorum]


>Bac_Bac_Sph_3 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_2e-53  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Sphingobacteriaceae;Pedobacter; gi|506288645|ref|WP_015808420.1| alpha-L-fucosidase [Pedobacter heparinus]


>Bac_Bac_Sph_4 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_1e-21  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Sphingobacteriaceae;Mucilaginibacter; gi|495780440|ref|WP_008505019.1| alpha-L-fucosidase [Mucilaginibacter paludis]


>Bac_Bac_Sph_5 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_2e-51  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Niabella; gi|517456030|ref|WP_018626805.1| hypothetical protein [Niabella aurantiaca]


>Bac_Bac_Sph_6 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_1e-46  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Chitinophaga; gi|502446319|ref|WP_012789156.1| alpha-L-fucosidase [Chitinophaga pinensis]


>Bac_Bac_Sph_7 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_4e-33  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;unclassified Chitinophagaceae; gi|658438103|ref|WP_029664438.1| alpha-L-fucosidase, partial [Chitinophagaceae bacterium JGI 0001002-J12]


>Bac_Bac_Sph_8 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_1e-22  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Sediminibacterium; gi|652372506|ref|WP_026768462.1| alpha-L-fucosidase [Sediminibacterium sp. OR53]


>Bac_Bac_Fla_1 [Bacteria Bacteroidetes Flavobacteriia]  E-value_1e-54  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Gelidibacter; gi|652850651|ref|WP_027126168.1| alpha-L-fucosidase [Gelidibacter mesophilus]


>Bac_Bac_Fla_2 [Bacteria Bacteroidetes Flavobacteriia]  E-value_6e-54  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Zhouia; gi|568803670|gb|ETN95141.1| alpha-L-fucosidase [Zhouia amylolytica AD3]


>Bac_Bac_Fla_3 [Bacteria Bacteroidetes Flavobacteriia]  E-value_3e-53  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Maribacter; gi|503070157|ref|WP_013305118.1| alpha-L-fucosidase [Maribacter sp. HTCC2170]


>Bac_Bac_Bac_1 [Bacteria Bacteroidetes Bacteroidia]  E-value_7e-52  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Bacteroidaceae;Bacteroides; gi|492204777|ref|WP_005776506.1| glycoside hydrolase family 29, partial [Bacteroides fragilis]


>Bac_Bac_Cyt_1 [Bacteria Bacteroidetes Cytophagia]  E-value_6e-50  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cyclobacteriaceae;Echinicola; gi|517285784|ref|WP_018474602.1| hypothetical protein [Echinicola pacifica]


>Bac_Bac_Bac_2 [Bacteria Bacteroidetes Bacteroidia]  E-value_2e-49  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Bacteroidaceae;Bacteroides; gi|491936501|ref|WP_005681133.1| alpha-L-fucosidase [Bacteroides caccae]


>Bac_Bac_Bac_3 [Bacteria Bacteroidetes Bacteroidia]  E-value_8e-48  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Porphyromonadaceae;Dysgonomonas; gi|651639876|ref|WP_026625730.1| alpha-L-fucosidase [Dysgonomonas capnocytophagoides]


>Bac_Bac_Bac_4 [Bacteria Bacteroidetes Bacteroidia]  E-value_9e-47  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Bacteroidaceae;Bacteroides; gi|490418295|ref|WP_004290624.1| alpha-L-fucosidase [Bacteroides eggerthii]


>Bac_Bac_Cyt_2 [Bacteria Bacteroidetes Cytophagia]  E-value_2e-45  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cytophagaceae;Adhaeribacter; gi|651341238|ref|WP_026464224.1| alpha-L-fucosidase [Adhaeribacter aquaticus]


>Bac_Bac_Cyt_3 [Bacteria Bacteroidetes Cytophagia]  E-value_8e-43  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cytophagaceae;Leadbetterella; gi|503173760|ref|WP_013408421.1| alpha-L-fucosidase [Leadbetterella byssophila]


>Bac_Bac_Bac_5 [Bacteria Bacteroidetes Bacteroidia]  E-value_4e-41  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Prevotellaceae;Prevotella; gi|496099428|ref|WP_008823935.1| alpha-L-fucosidase [Prevotella histicola]


>Bac_Bac_Cyt_4 [Bacteria Bacteroidetes Cytophagia]  E-value_3e-31  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cytophagaceae;Cytophaga; gi|653272606|ref|WP_027470540.1| alpha-L-fucosidase [Cytophaga fermentans]


>Bac_Bac_Fla_4 [Bacteria Bacteroidetes Flavobacteriia]  E-value_7e-28  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Cellulophaga; gi|503385364|ref|WP_013620025.1| alpha-L-fucosidase [Cellulophaga lytica]


_

Groupe Extérieur :


>Bac_Aci_Aci_1 [Bacteria Acidobacteria Acidobacteriales]  E-value_1e-49  Bacteria;Acidobacteria;Acidobacteriales;Acidobacteriaceae; gi|651320937|ref|WP_026445326.1| alpha-L-fucosidase [Acidobacteriaceae bacterium URHE0068]


>Bac_Aci_Sol_1 [Bacteria Acidobacteria Solibacteres]  E-value_1e-44  Bacteria;Acidobacteria;Solibacteres;Solibacterales;Solibacteraceae;Candidatus Solibacter; gi|500008022|ref|WP_011688740.1| alpha-L-fucosidase [Candidatus Solibacter usitatus]


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_5e-49  Bacteria;Proteobacteria;Gammaproteobacteria;Enterobacteriales;Enterobacteriaceae;Mangrovibacter; gi|653404137|gb|KEA53002.1| alpha-L-fucosidase [Mangrovibacter sp. MFB070]


>Bac_Pro_Alp_1 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_1e-36  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodospirillales;Rhodospirillaceae;Azospirillum; gi|490393195|ref|WP_004271650.1| alpha-L-fucosidase [Nitrospirillum amazonense]


>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-18  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderiales;Oxalobacteraceae; gi|658610989|ref|WP_029757435.1| alpha-L-fucosidase, partial [Oxalobacteraceae bacterium JGI 001010-B17]


>Bac_Act_Act_1 [Bacteria Actinobacteria Actinobacteridae]  E-value_4e-47  Bacteria;Actinobacteria;Actinobacteridae;Actinomycetales;Pseudonocardineae;Pseudonocardiaceae;Saccharomonospora; gi|640360108|ref|WP_024876829.1| hypothetical protein [Saccharomonospora sp. CNQ490]


>Bac_Act_Act_2 [Bacteria Actinobacteria Actinobacteridae]  E-value_6e-38  Bacteria;Actinobacteria;Actinobacteridae;Bifidobacteriales;Bifidobacteriaceae;Bifidobacterium; gi|672958571|gb|KFI54157.1| alpha-L-fucosidase [Bifidobacterium callitrichos DSM 23973]


>Bac_Fir_Clo_1 [Bacteria Firmicutes Clostridia]  E-value_6e-47  Bacteria;Firmicutes;Clostridia;Clostridiales;Ruminococcaceae;Ruminococcus; gi|505339483|ref|WP_015526585.1| Alpha-L-fucosidase [Ruminococcus sp. SR1/5]


>Bac_Fir_Clo_2 [Bacteria Firmicutes Clostridia]  E-value_1e-46  Bacteria;Firmicutes;Clostridia;Clostridiales;Blautia; gi|545412639|ref|WP_021651687.1| Alpha-L-fucosidase [Blautia sp. KLE 1732]


>Bac_Ver_Opi_1 [Bacteria Verrucomicrobia Opitutae]  E-value_2e-45  Bacteria;Verrucomicrobia;Opitutae;Opitutales;Opitutaceae;Opitutus; gi|501344153|ref|WP_012375788.1| alpha-L-fucosidase [Opitutus terrae]


>Bac_Len_Len_1 [Bacteria Lentisphaerae Lentisphaerales]  E-value_5e-44  Bacteria;Lentisphaerae;Lentisphaerales;Lentisphaeraceae;Lentisphaera; gi|494487231|ref|WP_007276704.1| mucin-desulfating sulfatase (N-acetylglucosamine-6-sulfatase) [Lentisphaera araneosa]


>Bac_The_The_1 [Bacteria Thermotogae Thermotogales]  E-value_1e-44  Bacteria;Thermotogae;Thermotogales;Thermotogaceae;Thermotoga; gi|499163246|ref|WP_010865090.1| alpha-L-fucosidase [Thermotoga maritima]


>Bac_Pla_Pla_1 [Bacteria Planctomycetes Planctomycetacia]  E-value_2e-43  Bacteria;Planctomycetes;Planctomycetacia;Planctomycetales;Planctomycetaceae;Rhodopirellula; gi|495955601|ref|WP_008680180.1| Plasma alpha-L-fucosidase [Rhodopirellula sallentina]


>Bac_Chl_Chl_1 [Bacteria Chloroflexi Chloroflexales]  E-value_2e-42  Bacteria;Chloroflexi;Chloroflexales;Chloroflexaceae;Roseiflexus; gi|501069997|ref|WP_012121056.1| alpha-L-fucosidase [Roseiflexus castenholzii]


>Bac_Dic_Dic_1 [Bacteria Dictyoglomi Dictyoglomales]  E-value_2e-33  Bacteria;Dictyoglomi;Dictyoglomales;Dictyoglomaceae;Dictyoglomus; gi|501543592|ref|WP_012548705.1| alpha-L-fucosidase [Dictyoglomus thermophilum]


>Bac_Arm_Cht_1 [Bacteria Armatimonadetes Chthonomonadetes]  E-value_1e-32  Bacteria;Armatimonadetes;Chthonomonadetes;Chthonomonadales;Chthonomonadaceae;Chthonomonas; gi|512725264|ref|WP_016483270.1| Alpha-L-fucosidase [Chthonomonas calidirosea]


>Bac_Ten_Mol_1 [Bacteria Tenericutes Mollicutes]  E-value_3e-31  Bacteria;Tenericutes;Mollicutes;Acholeplasmatales;Acholeplasmataceae;Acholeplasma; gi|651256871|ref|WP_026390300.1| alpha-L-fucosidase [Acholeplasma axanthum]


>Bac_Spi_Spi_1 [Bacteria Spirochaetes Spirochaetales]  E-value_3e-19  Bacteria;Spirochaetes;Spirochaetales;Spirochaetaceae;Treponema; gi|488780068|ref|WP_002692475.1| hypothetical protein [Treponema denticola]


>Bac_Cya_Chr_1 [Bacteria Cyanobacteria Chroococcales]  E-value_1e-11  Bacteria;Cyanobacteria;Chroococcales;Cyanothece; gi|506435738|ref|WP_015955455.1| alpha-L-fucosidase [Cyanothece sp. PCC 7424]


_

_



On retrouve des homologues à notre ORF dans tout le domaine du vivant : des bactéries aux eucaryotes en passant par les archées. On trouve principalement des homologues dans la branche des bacteroidetes (autour de 170 homologues trouvés). Nous avons donc choisi les Bacteroidetes comme groupe d'étude. Nous étions tentés de prendre comme groupe d'étude seulement les Sphingobacteriales puisque leur E value est de 7e-56 pour le meilleur hit. Or cela aurait été trop restreint puisque les Bacteroidales ont une E valeur de 7e-52 pour leur meilleur hit. Le différentiel entre ces deux E valeur n'est pas suffisant pour exclure les Bacteroidales du groupe d'étude, qui sont d'ailleurs très nombreux. Il faut donc que nous ayons les Bacteroidales et les Sphingobacteriales dans notre groupe d'étude. Or d'après l'arbre de la vie, la branche des Bacteroidetes n'est pas résolue : il nous faut donc inclure les Cytophagales et les Flavobacteriales à notre sélection. Notre groupe d'étude est donc composé de toutes les Bacteroidetes.


Le groupe exterieur découle alors du groupe d'étude. En regardant l'arbre de la vie, le meilleur groupe extérieur serait les Green Sulfur Bacteria. Or nous n'avons pas ces bactéries dans nos résultats. Il nous faut donc remonter au noeud précédent, ce qui nous donne comme groupe extérieur toutes les autres bactéries.


_


(Nous avons fait un deuxième arbre en ajoutant 3 séquences d'eucaryotes à notre alignement afin de déterminer la phylogénie de notre ORF. Voici donc les 3 séquences sélectionnées pour être notre groupe extérieur - le groupe d'étude devenant toutes les séquences de bactéries sélectionnées ci dessus : )


>Euk_Ich_Cap_1 [Eukaryota Ichthyosporea Capsaspora]  E-value_9e-47  Eukaryota;Ichthyosporea;Capsaspora;


>Euk_Met_Art_1 [Eukaryota Metazoa Arthropoda]  E-value_4e-45  


>Euk_Met_Mol_1 [Eukaryota Metazoa Mollusca]  E-value_6e-42  

RESULTATS BRUTS : 


.LUCA
. Bacteria
. .Hydrogenedentes
. . Candidatus Hydrogenedens
. . .Candidatus Hydrogenedens terephthalicus...... 203  5e-60  1 hit   Bacteria::                               hypothetical protein [Candidatus Hydrogen...   
. . Hydrogenedentes bacterium JGI 0000039-J10..... 203  5e-60  1 hit   Bacteria::                               alpha-L-fucosidase [candidate division NK...   
. . Hydrogenedentes............................... 99.8 1e-21  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Hydro... 
. .Sphingobacterium sp. 21........................ 193  7e-56  24 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium sp. 21]   
. .Sphingobacterium sp. H1ai...................... 107  8e-24  8 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium sp. ...   
. .Sphingobacterium sp. PM2-P1-29................. 102  3e-22  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: putative alpha-L-fucosidase [Sphingobacterium...   
. .Sphingobacterium thalpophilum.................. 100  1e-21  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium thal...   
. .Sphingobacterium antarcticus 4BY............... 100  2e-21  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium antarctic...   
. .Sphingobacterium sp. ML3W...................... 97.1 3e-20  3 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium sp. ML3W]    
. .Sphingobacterium spiritivorum.................. 97.1 3e-20  10 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium spir... 
. .Sphingobacterium spiritivorum ATCC 33861....... 92.4 5e-19  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium spir... 
. .Sphingobacterium spiritivorum ATCC 33300....... 92.4 1e-18  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sphingobacterium spir... 
. .Sphingobacterium paucimobilis.................. 90.5 6e-18  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Sphingobacterium pa... 
. .Sphingobacterium paucimobilis HER1398.......... 90.5 6e-18  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein M472_15570 [Sphingobacter... 
. .Arcticibacter svalbardensis MN12-7............. 89.7 9e-18  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: Alpha-L-fucosidase [Arcticibacter svalbar... 
. .Sphingobacterium sp. IITKGP-BTPF85............. 82.0 1e-15  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein L950_23390 [Sphingobacter... 
. .Pedobacter heparinus........................... 186  2e-53  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter heparinus]      
. .Pedobacter glucosidilyticus.................... 177  2e-49  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Pedobacter glucosid...   
. .Pedobacter sp. V48............................. 107  5e-24  9 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein N824_00740 [Pedobacter sp...   
. .Mucilaginibacter paludis....................... 100  1e-21  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Mucilaginibacter palu...   
. .Pedobacter sp. A12............................. 99.8 1e-21  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Pedobacter arcticus]   
. .Pedobacter borealis............................ 99.0 6e-21  7 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter borealis]     
. .Pedobacter agri................................ 98.2 1e-20  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter agri]         
. .Pedobacter sp. R20-19.......................... 97.4 2e-20  3 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter sp. R20-19]   
. .Solitalea canadensis........................... 95.9 3e-20  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Solitalea canadensis]    
. .Olivibacter sitiensis.......................... 92.4 5e-19  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Olivibacter sitiensis]   
. .Pedobacter heparinus DSM 2366.................. 90.5 6e-18  10 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter heparinus]    
. .Arcticibacter svalbardensis.................... 87.8 1e-17  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: Alpha-L-fucosidase [Arcticibacter svalbar... 
. .Pedobacter saltans............................. 86.3 1e-16  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glycoside hydrolase family protein [Pedob... 
. .Pedobacter sp. BAL39........................... 82.8 1e-15  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Pedobacter sp. BAL39]    
. .Pedobacter saltans DSM 12145................... 80.1 1e-14  10 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glycoside hydrolase family protein [Pedob... 
. .Solitalea canadensis DSM 3403.................. 75.1 7e-13  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Solitalea canadensis]    
. .Mucilaginibacter paludis DSM 18603............. 73.6 4e-12  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glycoside hydrolase family 29 (alpha-L-fu... 
. .Niabella aurantiaca............................ 181  2e-51  10 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Niabella aurantiaca]     
. .Chitinophaga pinensis.......................... 169  1e-46  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Chitinophaga pinensis]     
. .Segetibacter koreensis......................... 169  2e-46  5 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Segetibacter koreen...   
. .Niabella soli DSM 19437........................ 158  1e-42  8 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Niabella soli DSM 19437]        
. .Chitinophagaceae bacterium JGI 0001002-J12..... 129  4e-33  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Chitinophagaceae bact...   
. .Niastella koreensis............................ 105  3e-23  10 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Niastella koreensis]       
. .Sediminibacterium sp. OR53..................... 103  1e-22  7 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sediminibacterium sp....   
. .Lewinella persica.............................. 102  2e-22  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Lewinella persica]       
. .Sediminibacterium sp. OR43..................... 102  3e-22  6 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sediminibacterium sp....   
. .Chitinophaga pinensis DSM 2588................. 99.4 1e-21  12 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Chitinophaga pinensis]   
. .Niastella koreensis GR20-10.................... 97.4 8e-21  20 hits Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Niastella koreensis]     
. .Chitinophaga sp. JGI 0001002-D04............... 85.9 2e-16  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Chitinophaga sp. JGI ... 
. .Sediminibacterium sp. C3....................... 73.9 2e-12  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Sediminibacterium s... 
. .Sediminibacterium salmoneum.................... 70.9 2e-11  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: alpha-L-fucosidase [Sediminibacterium sal... 
. .Gelidibacter mesophilus........................ 191  1e-54  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Gelidibacter mesophilus]   
. .Zhouia amylolytica AD3......................... 188  6e-54  7 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Zhouia amylolytica AD3]         
. .Echinicola vietnamensis........................ 187  1e-53  3 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Echinicola vietnamensis]   
. .Maribacter sp. HTCC2170........................ 187  3e-53  12 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Maribacter sp. HTCC2170]   
. .Bacteroidetes bacterium FH5.................... 185  8e-53  5 hits  Bacteria:Bacteroidetes:                  alpha-L-fucosidase [Bacteroidetes bacterium FH5]    
. .Bacteroides fragilis........................... 183  7e-52  46 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glycoside hydrolase family 29 [Bacteroide...   
. .Bacteroides fragilis HMW 616................... 183  8e-52  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Bacteroides fragilis HMW 610................... 182  2e-51  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Echinicola pacifica............................ 178  6e-50  9 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Echinicola pacifica]     
. .Bacteroides fragilis YCH46..................... 177  7e-50  8 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Bacteroides caccae............................. 176  2e-49  13 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides caccae]        
. .Bacteroides fragilis str. 3986 N(B) 19......... 174  7e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. 3397 T10............. 174  8e-49  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis HMW 615................... 174  9e-49  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Bacteroides fragilis str. DS-208............... 174  9e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. 2-F-2 #5............. 174  9e-49  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis CL05T00C42................ 174  9e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Bacteroides fragilis str. 3719 T6.............. 174  9e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. Ds-233............... 174  9e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. J-143-4.............. 174  9e-49  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. 3976T8............... 174  1e-48  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis str. Korea 419............ 174  1e-48  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: tissue alpha-L-fucosidase [Bacteroides fragili...   
. .Bacteroides fragilis CL07T00C01................ 174  1e-48  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]      
. .Bacteroides sp. 2_1_56FAA...................... 174  1e-48  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 2_1_5...   
. .Bacteroides fluxus............................. 172  6e-48  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fluxus]        
. .Bacteroides caccae ATCC 43185.................. 172  6e-48  7 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides caccae]        
. .Dysgonomonas capnocytophagoides................ 172  8e-48  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Dysgonomonas capnocyt...   
. .Bacteroides vulgatus........................... 172  1e-47  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides vulgatus]      
. .Flectobacillus major........................... 170  3e-47  3 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Flectobacillus major]      
. .Emticicia oligotrophica........................ 169  6e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Emticicia oligotrophica]   
. .Bacteroidales.................................. 169  7e-47  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero...   
. .Bacteroides eggerthii.......................... 169  9e-47  12 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides eggerthii]     
. .Bacteroides eggerthii 1_2_48FAA................ 169  9e-47  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides eggerthii]     
. .Bacteroides massiliensis....................... 168  3e-46  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides massili...   
. .Zobellia galactanivorans....................... 167  6e-46  30 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Zobellia galactanivor...   
. .Adhaeribacter aquaticus........................ 166  2e-45  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Adhaeribacter aquaticus]   
. .Fibrisoma limi................................. 164  8e-45  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Fibrisoma limi]            
. .Runella limosa................................. 159  3e-43  3 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Runella limosa]            
. .Leadbetterella byssophila...................... 158  8e-43  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Leadbetterella byssop...   
. .Fibrella aestuarina............................ 158  1e-42  6 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Fibrella aestuarina]       
. .Runella slithyformis........................... 155  1e-41  3 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Runella slithyformis]      
. .Prevotella denticola........................... 154  4e-41  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella denticola]      
. .Prevotella histicola........................... 154  4e-41  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella histicola]      
. .Prevotella multisaccharivorax.................. 153  5e-41  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella multisacch...   
. .Flexithrix dorotheae........................... 145  7e-38  11 hits Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Flexithrix dorotheae]    
. .Bacteroides.................................... 138  1e-34  35 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: hypothetical protein [Bacte...   
. .Bacteroides cellulosilyticus................... 137  2e-34  16 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides cellulo...   
. .Bacteroides fragilis str. 2-F-2 #7............. 135  3e-34  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides...   
. .Bacteroides eggerthii DSM 20697................ 131  8e-33  6 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides eggerthii]   
. .Flavobacteriaceae bacterium S85................ 130  1e-32  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacteriaceae bac...   
. .Proteiniphilum acetatigenes.................... 130  2e-32  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Proteiniphilum acet...   
. .Joostella marina............................... 129  3e-32  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Joostella marina]          
. .Bacteroides cellulosilyticus CL02T12C19........ 129  3e-32  7 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides cellulo...   
. .Bacteroides cellulosilyticus DSM 14838......... 129  3e-32  7 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides cellulo...   
. .Bacteroides sp. 14(A).......................... 129  3e-32  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides sp. 14(A)]   
. .Bacteroides gallinarum......................... 129  6e-32  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides gallina...   
. .Cellulophaga algicola.......................... 127  1e-31  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga algicola]     
. .Gramella forsetii.............................. 127  2e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Gramella forsetii]         
. .Joostella marina DSM 19592..................... 127  3e-31  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Joostella marina]          
. .Bacteroides plebeius........................... 127  3e-31  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides plebeius]    
. .Cytophaga fermentans........................... 126  3e-31  7 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Cytophaga fermentans]      
. .Dyadobacter sp. Y620-1......................... 124  2e-30  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Dyadobacter sp. Y620-1]    
. .Bacteroides coprophilus........................ 123  6e-30  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides coproph...   
. .Aquimarina agarilytica......................... 123  7e-30  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Aquimarina agarilytica]    
. .Bacteroides ovatus............................. 122  1e-29  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides ovatus]      
. .Cellulophaga algicola DSM 14237................ 118  3e-28  10 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga algicola]     
. .Anaerophaga sp. HS1............................ 118  3e-28  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Anaerophaga sp. HS1]       
. .Cellulophaga baltica........................... 118  4e-28  19 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga baltica]      
. .Flavobacteriaceae bacterium HQM9............... 118  4e-28  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacteriaceae bac...   
. .Cytophaga fermentans DSM 9555.................. 118  4e-28  15 hits Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Cytophaga fermentans]      
. .Formosa agariphila KMM 3901.................... 117  6e-28  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase (GH29) [Formosa agariphila...   
. .Cellulophaga lytica............................ 117  7e-28  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga lytica]       
. .Cellulophaga geojensis KL-A.................... 117  7e-28  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga geojensis KL-A]    
. .Dyadobacter alkalitolerans..................... 116  2e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Dyadobacter alkalit...   
. .Flavobacterium subsaxonicum.................... 113  2e-26  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium subsax...   
. .Leeuwenhoekiella sp. MAR_2009_132.............. 111  9e-26  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Leeuwenhoekiella sp. ...   
. .Salinimicrobium xinjiangense................... 111  1e-25  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Salinimicrobium xinji...   
. .Flavobacterium rivuli.......................... 110  3e-25  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Flavobacterium rivuli]   
. .Cellulophaga lytica DSM 7489................... 109  5e-25  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Cellulophaga lytica]       
. .Flavobacterium sp. EM1321...................... 107  3e-24  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium sp. EM1321]      
. .Aquiflexum sp. LW9............................. 107  4e-24  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Cecembia lonarensis]       
. .Flavobacterium sp. CF136....................... 107  6e-24  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium sp. CF...   
. .Prevotella ruminicola.......................... 105  1e-23  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella ruminicola]     
. .Hymenobacter norwichensis...................... 105  2e-23  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Hymenobacter norwiche...   
. .Chryseobacterium sp. StRB126................... 104  9e-23  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: putative alpha-L-fucosidase [Chryseobacterium...   
. .Flavobacterium chungangense.................... 103  1e-22  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium chunga...   
. .Bacteroides uniformis str. 3978 T3 ii.......... 102  3e-22  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides...   
. .Bacteroides sp. 4_1_36......................... 102  3e-22  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 4_1_36]    
. .Bacteroides sp. D20............................ 102  3e-22  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero...   
. .Bacteroides uniformis.......................... 102  3e-22  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides uniformis]     
. .Bacteroides uniformis ATCC 8492................ 102  3e-22  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides uniformis]     
. .Cytophagales bacterium B6...................... 102  3e-22  4 hits  Bacteria:Bacteroidetes:                  alpha-L-fucosidase [Cytophagales str. B6]      
. .Prevotella sp. MA2016.......................... 101  6e-22  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. MA2016]     
. .Flavobacterium daejeonense..................... 101  7e-22  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium daejeo...   
. .Prevotella bergensis........................... 101  8e-22  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella bergensis]      
. .Zunongwangia profunda.......................... 101  8e-22  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Zunongwangia profunda]     
. .Bacteroides uniformis dnLKV2................... 100  2e-21  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides uniformis]   
. .Bacteroides salanitronis....................... 100  2e-21  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides salanitro...   
. .Cecembia lonarensis LW9........................ 100  2e-21  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Cecembia lonarensis]       
. .Prevotella oris................................ 100  2e-21  9 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella oris]           
. .Bacteroides sp. 3_1_33FAA...................... 99.4 3e-21  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides vulgatus ATCC 8482................. 99.4 4e-21  8 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides vulgatus]    
. .Bacteroides dorei.............................. 99.4 4e-21  9 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides dorei]       
. .Bacteroides sp. 4_3_47FAA...................... 99.4 4e-21  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides vulgatus dnLKV7.................... 99.4 4e-21  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides vulgatus]    
. .Chryseobacterium gleum......................... 99.4 5e-21  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium gleum]  
. .Bacteroides graminisolvens..................... 99.0 6e-21  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides graminiso... 
. .Elizabethkingia anophelis...................... 99.0 6e-21  24 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: Alpha-L-fucosidase [Elizabethkingia anophelis]   
. .Elizabethkingia meningoseptica................. 98.6 1e-20  14 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia menin... 
. .Elizabethkingia anophelis Ag1.................. 98.6 1e-20  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia anoph... 
. .Chryseobacterium sp. UNC8MFCol................. 97.8 2e-20  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium sp. ... 
. .Elizabethkingia anophelis NUHP1................ 97.4 2e-20  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia anoph... 
. .Chryseobacterium indologenes NBRC 14944........ 97.1 3e-20  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: putative glycosidase [Chryseobacterium indolo... 
. .Prevotella oris F0302.......................... 96.7 4e-20  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella oris]         
. .Prevotella oris C735........................... 96.7 4e-20  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella oris]         
. .Paraprevotella................................. 96.3 5e-20  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Parapre... 
. .Prevotella maculosa............................ 95.9 7e-20  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella maculosa]     
. .Bacteroides thetaiotaomicron VPI-5482.......... 95.5 8e-20  54 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides thetaiotaomicron................... 95.5 8e-20  8 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides thetaiota... 
. .Prevotella maculosa OT 289..................... 95.5 9e-20  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella maculosa]     
. .Chryseobacterium piperi........................ 95.5 1e-19  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium sp. CTM]     
. .Bacteroides intestinalis DSM 17393............. 95.1 1e-19  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Flavobacterium sp. JGI 0001001-D01............. 94.4 2e-19  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium sp. JG... 
. .Paraprevotella xylaniphila..................... 94.4 2e-19  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Paraprevotella xylani... 
. .Prevotella albensis............................ 94.4 2e-19  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella albensis]     
. .Chryseobacterium sp. JM1....................... 94.0 3e-19  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium sp. JM1]     
. .Prevotella dentalis............................ 94.0 8e-19  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella dentalis]     
. .Prevotella dentalis DSM 3688................... 94.0 8e-19  6 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella dentalis]     
. .Bacteroides dorei 5_1_36/D4.................... 93.6 2e-19  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides sp. 9_1_42FAA...................... 93.6 2e-19  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 9_1_4... 
. .Arenibacter algicola........................... 93.6 2e-19  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Arenibacter sp. TG409]   
. .Chryseobacterium daeguense..................... 93.6 6e-19  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium daeg... 
. .Hallella seregens.............................. 93.6 9e-19  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Hallella seregens]       
. .Parabacteroides................................ 92.8 6e-19  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: hypothetical protein [Parab... 
. .Bacteroides ovatus ATCC 8483................... 92.4 4e-19  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides ovatus SD CMC 3f................... 92.4 4e-19  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides helcogenes......................... 92.4 5e-19  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides helcogenes]  
. .Bacteroides sp. 2_2_4.......................... 92.0 6e-19  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 2_2_4]   
. .Arenibacter latericius......................... 92.0 7e-19  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Arenibacter latericius]  
. .Butyricimonas virosa........................... 92.0 7e-19  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Butyricimonas virosa]    
. .Bacteroides plebeius DSM 17135................. 92.0 7e-19  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides plebeius]    
. .Prevotella sp. oral taxon 302.................. 91.7 9e-19  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Alloprevotella rava]     
. .Prolixibacter bellariivorans................... 91.7 1e-18  3 hits  Bacteria:Bacteroidetes:                  alpha-L-fucosidase [Prolixibacter bellari... 
. .Bacteroides salyersiae CL02T12C01.............. 91.7 2e-18  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides dorei DSM 17855.................... 91.3 1e-18  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides dorei]       
. .Bacteroides ovatus 3_8_47FAA................... 91.3 1e-18  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides ovatus]      
. .Butyricimonas synergistica..................... 90.9 1e-18  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Butyricimonas synergi... 
. .Bacteroides sp. D1............................. 90.5 2e-18  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides coprocola.......................... 90.5 2e-18  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides coprocola]   
. .Prevotella nanceiensis......................... 90.5 2e-18  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella nanceiensis]  
. .Bacteroides paurosaccharolyticus............... 90.5 4e-18  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides paurosacc... 
. .Paraprevotella xylaniphila YIT 11841........... 90.5 9e-18  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Paraprevotella xylani... 
. .Capnocytophaga canimorsus...................... 90.1 4e-18  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Capnocytophaga canimo... 
. .Bacteroides finegoldii......................... 90.1 8e-18  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides finegoldii]  
. .Prevotella bivia............................... 89.7 7e-18  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella bivia]        
. .Fibrella aestuarina BUZ 2...................... 89.7 1e-17  12 hits Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Fibrella aestuarina]     
. .Bacteroides caccae CL03T12C61.................. 89.0 7e-18  8 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides coprophilus DSM 18228.............. 89.0 9e-18  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroidetes bacterium oral taxon 272......... 89.0 1e-17  1 hit   Bacteria:Bacteroidetes:                  alpha-L-fucosidase [Bacteroidetes bacteri... 
. .Bacteroides clarus............................. 89.0 2e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-amylase [Bacteroides clarus]           
. .Bacteroides massiliensis dnLKV3................ 88.6 1e-17  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides massilien... 
. .Prevotella baroniae............................ 88.6 1e-17  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella baroniae]     
. .Microscilla sp. PRE1........................... 88.6 2e-17  6 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: MS119, putative fucosidase [Microscilla s... 
. .Prevotella melaninogenica...................... 87.8 2e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella melaninoge... 
. .Bacteroides pyogenes........................... 87.4 3e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Bacteroides pyogenes]    
. .Flavobacterium sp. EM1308...................... 87.4 3e-17  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium sp. EM1308]    
. .Prevotella sp. C561............................ 87.4 3e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. C561]     
. .Prevotella timonensis.......................... 87.4 3e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella timonensis]   
. .Bacteroides vulgatus CL09T03C04................ 87.4 3e-17  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides sp. 3_1_40A........................ 87.4 3e-17  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 3_1_40A] 
. .Bacteroides vulgatus PC510..................... 87.4 3e-17  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides vulgatus]    
. .Prevotella micans.............................. 87.4 3e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella micans]       
. .Prevotella sp. BV3P1........................... 87.4 3e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. BV3P1]    
. .Bacteroides faecis............................. 87.4 3e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides faecis]      
. .Gillisia sp. ck-I2-15.......................... 87.4 4e-17  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Galbibacter sp. ck-I2... 
. .Prevotella sp. ICM33........................... 87.0 4e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. ICM33]         
. .Flavobacteria bacterium MS024-2A............... 87.0 4e-17  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   alpha-L-fucosidase [Flavobacteria bacteri... 
. .Bacteroides dorei CL02T00C15................... 87.0 4e-17  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Prevotella stercorea........................... 87.0 5e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella stercorea]    
. .Bacteroides ovatus CL02T12C04.................. 87.0 6e-17  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides ovatus]      
. .Bacteroides vulgatus str. 3775 SL(B) 10 (iv)... 86.7 6e-17  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Muricauda ruestringensis....................... 86.7 6e-17  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Muricauda ruestringen... 
. .Bacteroides vulgatus str. 3975 RP4............. 86.7 6e-17  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Prevotella baroniae F0026...................... 86.7 6e-17  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella baroniae]     
. .Bacteroides uniformis CL03T00C23............... 86.7 7e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides uniformis str. 3978 T3 i........... 86.3 7e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Prevotella multiformis......................... 86.3 7e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella multiformis]  
. .Bacteroides acidifaciens....................... 86.3 8e-17  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides acidifaci... 
. .Prevotella genomosp. T8........................ 86.3 9e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella scopos]       
. .Porphyromonas sp. KLE 1280..................... 86.3 9e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas sp. KLE 1280]   
. .Bacteroides pyogenes JCM 6294.................. 86.3 9e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides pyogenes JCM ... 
. .Porphyromonas sp. oral taxon 279............... 86.3 9e-17  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas sp. ora... 
. .Bacteroides thetaiotaomicron dnLKV9............ 86.3 1e-16  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: hypothetical protein [Bacte... 
. .Bacteroides sp. 1_1_6.......................... 86.3 1e-16  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Prevotella sp. AGR2160......................... 86.3 1e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. AGR2160]  
. .Bacteroides sp. 1_1_14......................... 85.9 1e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 1_1_14]  
. .Bacteroides fragilis NCTC 9343................. 85.9 1e-16  8 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides fragilis str. 1007-1-F #8.......... 85.5 1e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 3783N2-1............. 85.5 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 1007-1-F #7.......... 85.5 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. S23 R14.............. 85.5 2e-16  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis 3_1_12.................... 85.5 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Prevotella denticola CRIS 18C-A................ 85.5 2e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella denticola]    
. .Bacteroides fragilis str. 3996 N(B) 6.......... 85.5 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 3774 T13............. 85.1 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Prevotella melaninogenica D18.................. 85.1 2e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella melaninoge... 
. .Prevotella denticola F0289..................... 84.7 2e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella denticola]    
. .Bacteroides helcogenes P 36-108................ 84.7 3e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides helcogenes]  
. .Prevotella pleuritidis......................... 84.3 3e-16  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella pleuritidis]  
. .Prevotella sp. HJM029.......................... 84.3 3e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. HJM029]   
. .Prevotella salivae............................. 84.3 4e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella salivae]      
. .Prevotella oulorum............................. 84.0 5e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella oulorum]      
. .Tannerella sp. oral taxon BU063 isolate Cell 2. 84.0 5e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Tannerella sp. oral taxon ... 
. .Porphyromonas asaccharolytica.................. 84.0 6e-16  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas asaccha... 
. .Bacteroides fragilis str. S23L17............... 83.6 7e-16  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 3397 N2.............. 83.6 7e-16  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides coprocola DSM 17136................ 83.6 7e-16  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides coprocola]   
. .Porphyromonas asaccharolytica PR426713P-I...... 83.6 7e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas asaccha... 
. .Bacteroides intestinalis....................... 83.6 7e-16  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides intestina... 
. .Capnocytophaga canimorsus Cc5.................. 83.6 8e-16  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Capnocytophaga canimo... 
. .Porphyromonas catoniae ATCC 51270.............. 83.6 8e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas catoniae ATC... 
. .Prevotella salivae F0493....................... 83.6 8e-16  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella salivae]      
. .Tannerella forsythia........................... 83.6 8e-16  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Tannerella forsythia]    
. .Porphyromonas levii............................ 83.6 2e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Porphyromonas levii]   
. .Bacteroides fragilis CL05T12C13................ 83.2 1e-15  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Bacteroides fragilis 638R...................... 83.2 1e-15  6 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides fragilis CL07T12C05................ 83.2 1e-15  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Porphyromonas catoniae......................... 83.2 1e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas catoniae]  
. .Bacteroides fragilis str. 3988T(B)14........... 83.2 1e-15  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: putative uncharacterized protein [Bactero... 
. .Bacteroides stercoris.......................... 83.2 1e-15  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides stercoris]   
. .Bacteroides fragilis CL03T00C08................ 83.2 1e-15  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Bacteroides oleiciplenus....................... 83.2 1e-15  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides oleicip... 
. .Bacteroides fragilis str. DS-166............... 83.2 1e-15  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Mesoflavibacter zeaxanthinifaciens............. 83.2 2e-15  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Mesoflavibacter zeaxa... 
. .Maribacter sp. Hel_I_7......................... 82.4 2e-15  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Maribacter sp. Hel_I_7]  
. .Marinilabilia salmonicolor..................... 82.4 3e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Marinilabilia salmoni... 
. .Xylanibacter oryzae DSM 17970.................. 82.4 3e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Xylanibacter oryzae DSM 17... 
. .Paraprevotella clara........................... 82.4 6e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Paraprevotella clara]    
. .Bacteroides ovatus CL03T12C18.................. 82.0 8e-15  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides ovatus]    
. .Prevotella loescheii........................... 81.6 4e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella loescheii]    
. .Prevotella sp. oral taxon 472.................. 81.6 4e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. oral t... 
. .Bacteroides stercoris ATCC 43183............... 81.6 4e-15  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides stercoris]   
. .Prevotella loescheii DSM 19665................. 81.6 4e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Prevotella loescheii DSM 1... 
. .Bacteroides oleiciplenus YIT 12058............. 81.6 1e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides oleicip... 
. .Prevotella paludivivens........................ 81.3 8e-15  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Prevotella paludivi... 
. .Capnocytophaga cynodegmi....................... 80.9 8e-15  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Capnocytophaga cynode... 
. .Flavobacterium denitrificans................... 80.9 8e-15  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Flavobacterium denitr... 
. .Bacteroides xylanisolvens...................... 80.9 8e-15  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides xylanisol... 
. .Porphyromonas gingivalis....................... 80.9 1e-14  12 hits Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas gingiva... 
. .Porphyromonas gingivalis F0185................. 80.9 1e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas gingiva... 
. .Prevotella nigrescens.......................... 80.5 1e-14  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Prevotella nigrescens] 
. .Indibacter alkaliphilus........................ 80.5 1e-14  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Indibacter alkaliphilus] 
. .Prevotella shahii.............................. 80.1 1e-14  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella shahii]       
. .Prevotella sp. oral taxon 317.................. 80.1 1e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella sp. oral t... 
. .Bacteroides sp. 3_2_5.......................... 80.1 1e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 3_2_5]   
. .Prevotella pallens............................. 80.1 2e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella pallens]      
. .Porphyromonas gingivalis F0570................. 80.1 2e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas gingiva... 
. .Bacteroides fragilis str. S38L3................ 79.7 2e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Prevotella aurantiaca.......................... 79.7 2e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella aurantiaca]   
. .Porphyromonas gingivalis TDC60................. 79.7 4e-14  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Porphyromonas gingivalis F0568................. 79.7 4e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas gingiva... 
. .Prevotella intermedia.......................... 79.3 3e-14  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella intermedia]   
. .Fluviicola taffensis........................... 79.3 3e-14  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Fluviicola taffensis]    
. .Bacteroides sp. 2_1_16......................... 79.0 4e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides sp. 2_1_16]  
. .Bacteroides fragilis str. 3783N1-2............. 79.0 4e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Alkaliflexus imshenetskii...................... 79.0 5e-14  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Alkaliflexus imshenet... 
. .Porphyromonas gingivalis JCVI SC001............ 79.0 7e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Porphyromonas gingivalis SJD2.................. 78.6 8e-14  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Porphyromonas gingivalis ATCC 33277............ 78.6 8e-14  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Bacteroides fragilis str. S13 L11.............. 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. B1 (UDC16-1)......... 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 3397 T14............. 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. A7 (UDC12-2)......... 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Bacteroides fragilis str. 3988 T1.............. 78.2 7e-14  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis ... 
. .Bacteroides fragilis str. DS-71................ 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Bacteroides fragilis CL03T12C07................ 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides fragilis str. 3719 A10............. 78.2 7e-14  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fragilis]    
. .Bacteroides fragilis str. 3986T(B)10........... 78.2 7e-14  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Bacteroides nordii............................. 77.8 1e-13  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides nordii]    
. .Elizabethkingia meningoseptica NBRC 12535...... 77.4 1e-13  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia menin... 
. .Bacteroides fragilis str. 20793-3.............. 77.4 1e-13  5 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase family protein [Bacteroides... 
. .Porphyromonas gingivalis F0569................. 77.4 2e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Porphyromonas gingiva... 
. .Bacteroides salyersiae......................... 77.0 2e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides salyers... 
. .Bacteroides nordii CL02T12C05.................. 77.0 3e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides nordii]    
. .Odoribacter.................................... 76.6 2e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Odoriba... 
. .Prevotella salivae DSM 15606................... 76.6 2e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella salivae]      
. .Porphyromonas gingivalis W50................... 76.6 4e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Porphyromonas somerae.......................... 76.3 5e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Porphyromonas somerae] 
. .Alistipes indistinctus......................... 75.9 4e-13  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Alistipes indistinc... 
. .Spirosoma panaciterrae......................... 75.9 4e-13  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Spirosoma panaciter... 
. .Prevotella ruminicola 23....................... 75.9 5e-13  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella ruminicola]   
. .Porphyromonas gingivalis W83................... 75.9 7e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gingiva... 
. .Alistipes finegoldii........................... 75.5 5e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Alistipes finegoldii]    
. .Leadbetterella byssophila DSM 17132............ 75.5 5e-13  4 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Leadbetterella byssop... 
. .Elizabethkingia anophelis R26.................. 75.5 5e-13  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia anoph... 
. .Alistipes onderdonkii.......................... 75.5 5e-13  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Alistipes onderdonkii]   
. .Bacteroides sp. CC31F.......................... 75.5 5e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides stercoris]   
. .Prevotella stercorea DSM 18206................. 75.5 6e-13  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Prevotella stercorea]    
. .Elizabethkingia meningoseptica 502............. 75.5 6e-13  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Elizabethkingia menin... 
. .Runella slithyformis DSM 19594................. 75.1 1e-12  6 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Runella slithyformis]    
. .Bacteroides xylanisolvens CL03T12C04........... 75.1 1e-12  4 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Bactero... 
. .Porphyromonas gulae............................ 74.7 2e-12  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Porphyromonas gulae]     
. .Chryseobacterium luteum........................ 72.8 6e-12  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium luteum]      
. .Porphyromonas endodontalis..................... 72.8 7e-12  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glycoside hydrolase family 29, candidate ... 
. .Alistipes indistinctus YIT 12060............... 72.4 8e-12  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Alistipes indistinc... 
. .Bacteroides rodentium.......................... 72.0 8e-12  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides rodentium]   
. .Anaerophaga thermohalophila.................... 71.6 1e-11  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Anaerophaga thermohal... 
. .Rudanella lutea................................ 71.6 1e-11  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Rudanella lutea]         
. .Dyadobacter beijingensis....................... 71.6 2e-11  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Dyadobacter beijing... 
. .Alistipes shahii............................... 71.2 2e-11  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Alpha-L-fucosidase [Alistipes shahii]        
. .Chryseobacterium formosense.................... 71.2 2e-11  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium formosense]  
. .Chryseobacterium sp. CF314..................... 71.2 2e-11  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium sp. ... 
. .Chryseobacterium hispalense.................... 70.1 4e-11  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: alpha-L-fucosidase [Chryseobacterium hisp... 
. .Elizabethkingia................................ 70.1 5e-11  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: MULTISPECIES: alpha-L-fucosidase [Elizabe... 
. .Bacteroides reticulotermitis JCM 10512......... 69.7 5e-11  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides reticulotermi... 
. .Runella zeae................................... 69.7 5e-11  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Runella zeae]            
. .Parabacteroides goldsteinii CL02T12C30......... 69.7 6e-11  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: alpha-L-fucosidase [Parabac... 
. .Bacteroides barnesiae.......................... 69.3 6e-11  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides barnesiae]   
. .Fibrisoma limi BUZ 3........................... 69.3 7e-11  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: alpha-L-fucosidase [Fibrisoma limi]          
. .Bacteroides fluxus YIT 12057................... 69.3 8e-11  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: alpha-L-fucosidase [Bacteroides fluxus]      
. .Porphyromonas macacae.......................... 69.3 9e-11  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Porphyromonas macacae] 
. .Aminicenantes bacterium SCGC AAA252-K06........ 185  9e-53  1 hit   Bacteria::                               alpha-L-fucosidase [candidate division OP...   
. .unclassified Aminicenantes..................... 90.5 3e-18  3 hits  Bacteria::                               MULTISPECIES: alpha-L-fucosidase [unclass... 
. .Aminicenantes.................................. 78.2 7e-14  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Amini... 
. .Aminicenantes bacterium SCGC AAA252-G04........ 78.2 7e-14  1 hit   Bacteria::                               alpha-L-fucosidase [candidate division OP... 
. .Acidobacteriaceae bacterium URHE0068........... 177  1e-49  5 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Acidobacteriaceae bac...   
. .Acidobacteriaceae bacterium KBS 96............. 169  9e-47  5 hits  Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Acidobacteriaceae bacterium KBS 83............. 153  9e-41  3 hits  Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Granulicella sp. MP5ACTX9...................... 150  6e-40  3 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Granulicella tundricola]   
. .Acidobacterium sp. PMMR2....................... 137  5e-35  1 hit   Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Acidobacterium sp. PM...   
. .Granulicella tundricola MP5ACTX9............... 127  2e-31  6 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Granulicella tundricola]   
. .Acidobacteriaceae bacterium KBS 89............. 92.8 7e-19  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b... 
. .Acidobacterium capsulatum...................... 90.5 4e-18  2 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Acidobacterium capsul... 
. .Acidobacteria bacterium KBS 146................ 89.4 1e-17  2 hits  Bacteria:Acidobacteria:Acidobacteriales: glycoside hydrolase [Acidobacteria bacter... 
. .Acidobacterium capsulatum ATCC 51196........... 88.6 3e-17  4 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Acidobacterium capsul... 
. .Terriglobus roseus............................. 83.6 1e-15  1 hit   Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Terriglobus roseus]      
. .Terriglobus saanensis.......................... 80.5 2e-14  2 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Terriglobus saanensis]   
. .Terriglobus saanensis SP1PR4................... 71.6 2e-11  4 hits  Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Terriglobus saanensis]   
. .Acidobacteriaceae bacterium TAA166............. 70.1 4e-11  1 hit   Bacteria:Acidobacteria:Acidobacteriales: alpha-L-fucosidase [Acidobacteriaceae bac... 
. .Candidatus Solibacter usitatus................. 164  1e-44  5 hits  Bacteria:Acidobacteria:Solibacteres:Solibacterales: alpha-L-fucosidase [Candidatus Solibacter...   
. .Candidatus Koribacter versatilis............... 123  4e-30  1 hit   Bacteria:Acidobacteria:                  alpha-L-fucosidase [Candidatus Koribacter...   
. .Candidatus Solibacter usitatus Ellin6076....... 90.9 2e-18  10 hits Bacteria:Acidobacteria:Solibacteres:Solibacterales: alpha-L-fucosidase [Candidatus Solibacter... 
. .Bryobacter aggregatus.......................... 83.2 1e-15  1 hit   Bacteria:Acidobacteria:                  hypothetical protein [Bryobacter aggregatus] 
. .Mangrovibacter sp. MFB070...................... 175  5e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: alpha-L-fucosidase [Mangrovibacter sp. MFB070]      
. .Haemophilus parasuis........................... 166  8e-46  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Haemophilus parasuis]           
. .Haemophilus parasuis str. Nagasaki............. 166  8e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase family protein [Haemop...   
. .Haemophilus parasuis ZJ0906.................... 166  9e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Haemophilus parasuis]      
. .Haemophilus parasuis SH0165.................... 166  9e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Haemophilus parasuis]      
. .Haemophilus parasuis 84-15995.................. 166  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase, putative [Haemophilus...   
. .Haemophilus parasuis 29755..................... 166  9e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Haemophilus parasuis]      
. .Haemophilus parasuis MN-H...................... 166  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase family protein [Haemop...   
. .Haemophilus parasuis HPS10..................... 164  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Haemophilus parasuis HPS10]     
. .Mannheimia haemolytica......................... 161  6e-44  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Mannheimia haemolytica]    
. .Mannheimia haemolytica D171.................... 161  7e-44  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: alpha-L-fucosidase [Mannheimia haemolytica]    
. .Colwellia piezophila........................... 153  8e-41  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Colwellia piezophila]    
. .Dyella japonica................................ 136  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Dyella japonica]           
. .Xanthomonas albilineans........................ 134  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas albilineans]   
. .Xylella fastidiosa............................. 134  8e-34  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa]        
. .Xylella fastidiosa M12......................... 134  9e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa]        
. .Xylella fastidiosa Dixon....................... 134  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa]        
. .Xylella fastidiosa subsp. sandyi Ann-1......... 134  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Alpha-L-fucosidase [Xylella fastidiosa]        
. .Xylella fastidiosa 6c.......................... 133  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa]        
. .Xylella fastidiosa Temecula1................... 133  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa]        
. .Dyella jiangningensis.......................... 132  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Dyella jiangningensis]          
. .Xylella fastidiosa Mul-MD...................... 132  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Alpha-L-fucosidase [Xylella fastidiosa Mul-MD]      
. .Xylella fastidiosa XfPE........................ 132  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xylella fastidiosa PLS229]      
. .Xanthomonas sp. SHU308......................... 131  9e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas sp. SHU308]    
. .Xanthomonas sacchari........................... 131  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas sacchari]      
. .Xanthomonas vesicatoria........................ 130  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas vesicatoria]   
. .Xanthomonas campestris......................... 130  1e-32  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas campestris]    
. .Xanthomonas campestris pv. campestris str. ATCC 130  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas campestris]    
. .Xanthomonas campestris pv. raphani 756C........ 130  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas campestris]    
. .Xanthomonas sp. SHU199......................... 130  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas sp. SHU199]    
. .Xanthomonas arboricola pv. celebensis.......... 129  5e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas arboricola pv....   
. .Xanthomonas vasicola........................... 129  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas vasicola]      
. .Xanthomonas fragariae.......................... 129  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas fragariae]     
. .Xanthomonas oryzae............................. 129  6e-32  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas oryzae]        
. .Xanthomonas oryzae pv. oryzae KACC 10331....... 129  7e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas oryzae]        
. .Xanthomonas oryzae pv. oryzae PXO99A........... 128  8e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas oryzae]        
. .Xanthomonas oryzae pv. oryzicola BLS256........ 128  9e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas oryzae]        
. .Glaciecola chathamensis........................ 128  9e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola chathamensis]   
. .Glaciecola sp. 4H-3-7+YE-5..................... 128  9e-32  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola sp. 4H-3-7...   
. .Dyella sp. A8.................................. 128  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Dyella japonica A8]             
. .Glaciecola agarilytica......................... 128  1e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola agarilytica]    
. .Xanthomonas translucens........................ 128  1e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas translucens]   
. .Xanthomonas axonopodis......................... 128  1e-31  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis]    
. .Xanthomonas hortorum........................... 128  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas hortorum]      
. .Xanthomonas translucens pv. translucens DSM 189 127  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas translucens]   
. .Xanthomonas perforans.......................... 127  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas perforans]     
. .Xanthomonas axonopodis pv. malvacearum str. GSP 127  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis]    
. .Xanthomonas alfalfae........................... 127  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas alfalfae]      
. .Xanthomonas axonopodis pv. citrumelo F1........ 127  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas alfalfae]      
. .Xanthomonas fuscans............................ 127  4e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas fuscans]       
. .Xanthomonas fuscans subsp. aurantifolii str. IC 127  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas fuscans]       
. .Xanthomonas axonopodis pv. punicae str. LMG 859 127  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis]    
. .Xanthomonas citri.............................. 127  4e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas citri]         
. .Xanthomonas fuscans subsp. fuscans............. 126  4e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas fuscans]       
. .Xanthomonas axonopodis Xac29-1................. 126  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis]    
. .Catenovulum agarivorans DS-2................... 126  5e-31  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Catenovulum agarivorans DS-2]   
. .Xanthomonas gardneri........................... 126  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas gardneri]      
. .Xanthomonas citri subsp. citri Aw.............. 126  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Alpha-L-fucosidase [Xanthomonas citri]         
. .Xanthomonas euvesicatoria...................... 126  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas euvesicat...   
. .Xanthomonas axonopodis pv. vasculorum.......... 126  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis pv....   
. .Xanthomonas arboricola......................... 126  6e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas arboricola]    
. .Xanthomonas arboricola pv. pruni MAFF 301420... 126  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein XPR_2198 [Xanthomonas ar...   
. .Xanthomonas arboricola pv. pruni str. MAFF 3115 126  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas arboricola pv...   
. .Xanthomonas axonopodis pv. glycines str. 8ra... 125  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas axonopodis pv....   
. .Xanthomonas cassavae........................... 125  9e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Xanthomonas cassavae]      
. .Gayadomonas joobiniege......................... 124  2e-30  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Gayadomonas joobini...   
. .Pseudoalteromonas atlantica.................... 124  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Pseudoalteromonas atl...   
. .Glaciecola lipolytica.......................... 117  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola lipolytica]     
. .Mannheimia varigena USDA-ARS-USMARC-1296....... 112  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Alpha-L-fucosidase [Mannheimia varigena USDA-A...   
. .Mannheimia varigena USDA-ARS-USMARC-1312....... 111  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Alpha-L-fucosidase [Mannheimia varigena USDA-A...   
. .Rhodanobacter denitrificans.................... 110  6e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Rhodanobacter sp. 2AP...   
. .Rhodanobacter sp. OR87......................... 109  8e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: alpha-L-fucosidase [Rhodanobacter sp. OR87]    
. .Glaciecola agarilytica NO2..................... 108  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola agarilytica]    
. .Glaciecola chathamensis S18K6.................. 108  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Glaciecola chathamensis]   
. .Cellvibrio sp. BR.............................. 106  7e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: alpha-L-fucosidase [Cellvibrio sp. BR]         
. .Pseudoalteromonas atlantica T6c................ 105  2e-23  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: alpha-L-fucosidase [Pseudoalteromonas atl...   
. .Vibrio natriegens.............................. 94.0 1e-19  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio natriegens]     
. .Rudaea cellulosilytica......................... 91.7 1e-18  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Rudaea cellulosilyt... 
. .Catenovulum agarivorans........................ 90.5 5e-18  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Catenovulum agarivo... 
. .Vibrio mimicus................................. 86.7 5e-17  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase [Vibrio mimicus]          
. .Vibrio nigripulchritudo........................ 86.7 7e-17  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Alpha-L-fucosidase protein [Vibrio nigrip... 
. .Vibrio mimicus MB451........................... 82.8 1e-15  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase [Vibrio mimicus]          
. .Vibrio mimicus VM603........................... 82.8 2e-15  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase [Vibrio mimicus]          
. .Vibrio mimicus VM223........................... 82.4 2e-15  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase [Vibrio mimicus]          
. .Vibrio mimicus VM573........................... 82.4 2e-15  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase [Vibrio mimicus]          
. .Lysobacter antibioticus........................ 77.0 1e-13  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Lysobacter antibiot... 
. .Vibrio mimicus CAIM 1882....................... 74.3 3e-13  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein P780_07745 [Vibrio mimicu... 
. .Vibrio cholerae................................ 74.3 1e-12  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: alpha-L-fucosidase family protein [Vibrio chol... 
. .Azospirillum amazonense........................ 142  1e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: alpha-L-fucosidase [Azospirillum amazonense]   
. .Henriciella marina............................. 141  2e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Henriciella marina]      
. .Azospirillum amazonense Y2..................... 141  2e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: alpha-L-fucosidase [Azospirillum amazonense]   
. .Hyphomonas sp. BH-BN04-4....................... 140  2e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY30_09665 [Hyphomonas sp...   
. .Asticcacaulis sp. AC466........................ 140  6e-36  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis sp. AC466]   
. .Hyphomonas adhaerens MHS-3..................... 135  2e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: alpha-L-fucosidase [Hyphomonas adhaerens MHS-3]     
. .Asticcacaulis benevestitus..................... 135  2e-34  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Asticcacaulis benev...   
. .Asticcacaulis benevestitus DSM 16100........... 135  2e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein ABENE_07450 [Asticcacauli...   
. .Hyphomonas sp. T16B2........................... 134  4e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY2_16180 [Hyphomonas sp....   
. .Asticcacaulis sp. AC460........................ 132  2e-33  6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein ABAC460_12515 [Asticcacau...   
. .Caulobacter sp. JGI 0001010-J14................ 124  2e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter sp. JGI 0...   
. .Sphingobium yanoikuyae......................... 124  4e-30  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingobium yanoikuyae]         
. .Sphingobium yanoikuyae ATCC 51230.............. 123  6e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sphingobium yanoiku...   
. .Caulobacter sp. URHA0033....................... 122  2e-29  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter sp. URHA0...   
. .Hyphomonas neptunium........................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: putative alpha-L-fucosidase [Hyphomonas n...   
. .Hyphomonas polymorpha PS728.................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: putative alpha-L-fucosidase [Hyphomonas polymo...   
. .alpha proteobacterium JLT2015.................. 112  7e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Alpha-L-fucosidase [alpha proteobacterium...   
. .Caulobacter sp. AP07........................... 108  1e-24  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: glycoside hydrolase family 29 [Caulobacte...   
. .Asticcacaulis sp. AC402........................ 103  7e-23  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis sp. AC402]   
. .Sphingomonas sp. RIT328........................ 103  9e-23  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Alpha-L-fucosidase family protein [Sphingomona...   
. .Asticcacaulis excentricus...................... 103  1e-22  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis excentr...   
. .Asticcacaulis biprosthecium.................... 102  3e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis biprost...   
. .Sphingomonas sp. ATCC 31555.................... 100  9e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sphingomonas sp. AT...   
. .Sphingomonas................................... 100  1e-21  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: MULTISPECIES: alpha-L-fucosidase [Sphingo...   
. .Sphingomonas sp. PAMC 26617.................... 99.8 2e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. PAMC... 
. .Sphingomonas sp. PAMC 26621.................... 99.0 5e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. PAMC... 
. .Oxalobacteraceae bacterium AB_14............... 99.0 6e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: alpha-L-fucosidase [Oxalobacteraceae bact... 
. .Sphingomonas sp. PAMC 26605.................... 97.4 1e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. PAMC... 
. .Sphingobium sp. C100........................... 97.1 2e-20  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingobium sp. C100]    
. .Caulobacter sp. K31............................ 94.4 2e-19  6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter sp. K31]     
. .Sphingobium sp. DS20........................... 93.6 3e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingobium lactosutens] 
. .Sphingomonas sp. JGI 0001003-D23............... 93.2 5e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. JGI ... 
. .Caulobacter sp. JGI 0001013-O16................ 92.8 8e-19  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter sp. JGI 0... 
. .Oxalobacteraceae bacterium JGI 001010-B17...... 91.7 2e-18  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: alpha-L-fucosidase [Oxalobacteraceae bact... 
. .Sphingomonas sp. FUKUSWIS1..................... 91.7 2e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. FUKU... 
. .Sphingomonas sp. STIS6.2....................... 90.5 3e-18  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. STIS... 
. .Caulobacter segnis............................. 90.5 5e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter segnis]      
. .alpha proteobacterium L41A..................... 88.2 3e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri... 
. .Asticcacaulis sp. YBE204....................... 88.2 4e-17  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Asticcacaulis sp. Y... 
. .Sphingomonas sp. PR090111-T3T-6A............... 87.0 7e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sphingomonas sp. PR... 
. .Caulobacter vibrioides......................... 86.7 1e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter vibrioides]  
. .Inquilinus limosus............................. 85.9 1e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: alpha-L-fucosidase [Inquilinus limosus]      
. .Caulobacter sp. UNC358MFTsu5.1................. 85.9 2e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Caulobacter sp. UNC35... 
. .Asticcacaulis excentricus CB 48................ 84.7 5e-16  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis excentr... 
. .Rhizobium leguminosarum........................ 84.3 4e-16  35 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Rhizobium leguminosarum bv. viciae WSM1455..... 84.3 5e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Rhizobium leguminosarum bv. viciae 3841........ 84.3 5e-16  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Sphingomonas phyllosphaerae.................... 84.3 8e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas phyllosp... 
. .Asticcacaulis biprosthecum C19................. 83.6 1e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Asticcacaulis biprost... 
. .Rhizobium leguminosarum bv. trifolii WSM2012... 82.8 2e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Caulobacter.................................... 82.8 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: MULTISPECIES: alpha-L-fucosidase [Cauloba... 
. .Rhizobium sullae............................... 82.4 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sullae]        
. .Rhizobium leguminosarum bv. trifolii WSM2304... 82.4 2e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Rhizobium sp. LPU83............................ 82.0 3e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sp. LPU83]         
. .Rhizobium sp. OR191............................ 82.0 3e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sp. OR191]     
. .Proteobacteria................................. 81.6 4e-15  1 hit   Bacteria:Proteobacteria:                 MULTISPECIES: alpha-L-fucosidase [Proteob... 
. .Rhizobium gallicum............................. 81.6 4e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium gallicum]      
. .Rhizobium leguminosarum bv. trifolii WSM2297... 81.3 5e-15  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Rhizobium sp. CCGE 510......................... 81.3 5e-15  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sp. CCGE 510]  
. .Sphingobium japonicum.......................... 81.3 8e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Alpha-L-fucosidase [Sphingobium japonicum]   
. .Rhizobium etli bv. mimosae str. IE4771......... 80.9 8e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase protein [Rhizobium etli bv.... 
. .Rhizobium phaseoli............................. 80.5 1e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium phaseoli]      
. .Rhizobium sp. JGI 001013-F22................... 80.1 1e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sp. JGI 001... 
. .Rhizobium leguminosarum bv. trifolii CB782..... 79.7 2e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum] 
. .Rhizobium leguminosarum bv. trifolii WSM1689... 79.7 2e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum bv... 
. .Rhizobium etli................................. 79.7 2e-14  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium etli]          
. .Devosia sp. 17-2-E-8........................... 79.3 2e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Devosia sp. 17-2-E-8]         
. .Rhizobium leguminosarum bv. phaseoli CCGM1..... 79.0 3e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium leguminosarum bv... 
. .Rhizobium sp. Pop5............................. 79.0 3e-14  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium sp. Pop5]      
. .Rhizobium etli CNPAF512........................ 79.0 3e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative fucosidase [Rhizobium etli CNPAF512]     
. .Devosia riboflavina............................ 78.6 5e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Devosia riboflavina]          
. .Rhizobium freirei.............................. 78.2 6e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative alpha-L-fucosidase protein [Rhiz... 
. .Sphingomonas elodea............................ 77.8 1e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas elodea]     
. .Brevundimonas abyssalis........................ 77.4 1e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: alpha-L-fucosidase [Brevundimonas abyssalis] 
. .Sphingomonas sp. UNC305MFCol5.2................ 77.4 2e-13  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. UNC3... 
. .Novosphingobium sp. AP12....................... 76.6 3e-13  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Novosphingobium sp. A... 
. .Sphingomonas sp. S17........................... 75.9 5e-13  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sp. S17]    
. .alpha proteobacterium JGI 0001002-C12.......... 74.3 2e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: alpha-L-fucosidase [alpha proteobacterium... 
. .Sphingobium lactosutens DS20................... 73.9 2e-12  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingobium lactosutens DS20] 
. .Rhizobium etli bv. mimosae str. Mim1........... 73.2 3e-12  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase protein [Rhizobium etli]  
. .Rhizobium etli CFN 42.......................... 72.8 4e-12  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: alpha-L-fucosidase [Rhizobium etli]          
. .alpha proteobacterium LLX12A................... 72.8 6e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: alpha-L-fucosidase [alpha proteobacterium... 
. .Sphingobium sp. AP49........................... 72.4 8e-12  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingobium sp. AP49]    
. .Novosphingobium lindaniclasticum............... 71.2 2e-11  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Novosphingobium linda... 
. .Devosia sp. DBB001............................. 69.7 5e-11  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Alpha-L-fucosidase [Devosia sp. DBB001]          
. .Sphingomonas sanxanigenens DSM 19645........... 69.7 6e-11  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: alpha-L-fucosidase [Sphingomonas sanxanigenens... 
. .Saccharomonospora sp. CNQ490................... 170  4e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Saccharomonospora s...   
. .Saccharomonospora cyanea....................... 125  6e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Saccharomonospora cya...   
. .Kutzneria albida............................... 152  9e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Kutzneria albida]          
. .Amycolatopsis benzoatilytica................... 149  1e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis benzoat...   
. .Amycolatopsis balhimycina...................... 149  2e-38  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis balhimy...   
. .Amycolatopsis mediterranei..................... 148  4e-38  9 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis mediter...   
. .Kutzneria sp. 744.............................. 145  3e-37  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Kutzneria sp. 744]              
. .Amycolatopsis vancoresmycina................... 143  3e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis vancore...   
. .Sciscionella sp. SE31.......................... 131  5e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Sciscionella sp. SE31]     
. .Amycolatopsis vancoresmycina DSM 44592......... 106  1e-23  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis vancore...   
. .Amycolatopsis rifamycinica..................... 106  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis rifamycinica]     
. .Amycolatopsis mediterranei U32................. 103  1e-22  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis mediter...   
. .Amycolatopsis mediterranei S699................ 99.8 6e-21  12 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis mediter... 
. .Amycolatopsis sp. MJM2582...................... 86.3 7e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis sp. MJM2582]    
. .Amycolatopsis orientalis....................... 86.3 8e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis orienta... 
. .Amycolatopsis japonica......................... 86.3 8e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Hypothetical protein AJAP_21740 [Amycolatopsis... 
. .Amycolatopsis lurida NRRL 2430................. 86.3 8e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis lurida NRRL ... 
. .Amycolatopsis azurea........................... 83.6 8e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Amycolatopsis azurea]    
. .Amycolatopsis decaplanina...................... 83.2 9e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Amycolatopsis decapla... 
. .Amycolatopsis alba............................. 82.4 2e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Amycolatopsis alba]      
. .Actinoalloteichus cyanogriseus................. 78.2 6e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinoalloteichus cya... 
. .Actinoalloteichus spitiensis................... 77.8 7e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinoalloteichus s... 
. .Lechevalieria aerocolonigenes.................. 152  9e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Lechevalieria aerocol...   
. .Streptosporangium roseum....................... 169  7e-47  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptosporangium r...   
. .Streptosporangium roseum DSM 43021............. 169  7e-46  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptosporangium ros...   
. .Streptomyces bingchenggensis................... 161  1e-43  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces bingchen...   
. .Streptomyces sp. CNQ329........................ 161  7e-43  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. CNQ329]   
. .Streptomyces sp. HGB0020....................... 161  8e-43  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. HG...   
. .Streptomyces sp. CNH099........................ 160  2e-42  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. CNH099]   
. .Streptomyces sp. 142MFCol3.1................... 159  4e-42  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. 142M...   
. .Streptomyces sp. CNT371........................ 159  5e-42  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. CNT371]   
. .Streptomyces violaceoruber..................... 159  6e-42  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces violaceo...   
. .Streptomyces cellulosae........................ 159  6e-42  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces cellulosae]   
. .Streptomyces scopuliridis...................... 158  1e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces scopulir...   
. .Streptomyces sp. CNS335........................ 157  2e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. CNS335]   
. .Streptomyces sp. NRRL WC-3774.................. 157  2e-41  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. CNQ865........................ 157  2e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. CNQ865]   
. .Streptomyces sp. CNQ766........................ 157  2e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN...   
. .Streptomyces sp. CNY243........................ 157  2e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN...   
. .Streptomyces sp. R1-NS-10...................... 156  3e-41  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. R1...   
. .Streptomyces roseochromogenus.................. 156  4e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces roseoc...   
. .Streptomyces canus............................. 155  1e-40  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces canus]      
. .Streptomyces vitaminophilus.................... 155  1e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces vitamino...   
. .Streptomyces sp. NRRL B-24720.................. 154  2e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Nakamurella lactea............................. 154  2e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Saxeibacter lacteus]       
. .Streptomyces sp. NRRL S-646.................... 154  2e-40  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-1824................... 153  5e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Mycobacterium kansasii 732..................... 150  2e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative alpha-L-fucosidase [Mycobacterium kan...   
. .Mycobacterium marinum.......................... 139  1e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Mycobacterium marinum]     
. .Mycobacterium marinum str. Europe.............. 139  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Mycobacterium marinum]     
. .Streptomyces sp. AA4........................... 138  2e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. AA4]    
. .Streptomyces varsoviensis...................... 137  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces varsov...   
. .Actinomyces suimastitidis...................... 136  9e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces suimastit...   
. .Actinocatenispora sera......................... 136  9e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinocatenispora sera]    
. .Mycobacterium ulcerans......................... 135  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Mycobacterium ulcerans]    
. .Actinomyces sp. oral taxon 171................. 132  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. oral ...   
. .Mycobacterium sp. 012931....................... 132  5e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Mycobacterium sp. 012...   
. .Mycobacterium liflandii........................ 130  1e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Mycobacterium liflandii]   
. .Mycobacterium ulcerans str. Harvey............. 129  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative alpha-L-fucosidase [Mycobacterium ulc...   
. .Kineococcus radiotolerans...................... 129  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Kineococcus radiotole...   
. .Mycobacterium rhodesiae........................ 129  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Mycobacterium rhodesiae]   
. .Actinomyces naeslundii......................... 128  6e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces naeslundii]    
. .Arthrobacter sp. UNC362MFTsu5.1................ 127  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sp. UNC3...   
. .Arthrobacter sp. 162MFSha1.1................... 127  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Arthrobacter sp. 16...   
. .Brachybacterium paraconglomeratum.............. 126  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Brachybacterium parac...   
. .Microbacterium sp. 292MF....................... 124  3e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium sp. ...   
. .Corynebacterium-like bacterium B27............. 123  3e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Corynebacterium-like ...   
. .Actinomyces georgiae........................... 123  3e-30  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces georgiae]      
. .Actinomyces sp. oral taxon 877................. 123  3e-30  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Actinomyces sp. oral ...   
. .Actinomyces slackii............................ 123  3e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces slackii]       
. .Actinomyces sp. oral taxon 178................. 123  4e-30  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. oral ...   
. .Cryocola sp. 109............................... 122  1e-29  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Leifsonia sp. 109]       
. .Cryocola sp. 340MFSha3.1....................... 122  1e-29  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Cryocola sp. 340MFS...   
. .Leifsonia aquatica............................. 121  2e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Leifsonia aquatica]        
. .Actinomyces sp. oral taxon 172................. 121  2e-29  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Actinomyces sp. oral ...   
. .Actinomyces odontolyticus...................... 121  3e-29  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomyces odontol...   
. .Actinomyces vaccimaxillae...................... 119  7e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces vaccimaxi...   
. .Dietzia cinnamea............................... 119  1e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Dietzia cinnamea]          
. .Streptomyces sp. NRRL F-5123................... 119  2e-28  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Brachybacterium muris.......................... 119  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Brachybacterium muris]   
. .Actinomyces sp. ICM54.......................... 118  2e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. ICM54]          
. .Actinomyces odontolyticus F0309................ 118  2e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative alpha-L-fucosidase [Actinomyces ...   
. .Curtobacterium sp. B18......................... 118  4e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Curtobacterium sp. B18]    
. .Microbacterium paraoxydans..................... 117  5e-28  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium para...   
. .Curtobacterium sp. B8.......................... 117  7e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Curtobacterium sp. B8]     
. .Microbacterium sp. 11MF........................ 117  1e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium sp. ...   
. .Microbacterium oleivorans...................... 116  2e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Microbacterium oleivorans]      
. .Actinomyces coleocanis......................... 115  3e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase precursor [Actinomyces...   
. .Propionibacterium propionicum.................. 114  7e-27  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Propionibacterium pro...   
. .Microbacterium barkeri......................... 114  9e-27  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium bark...   
. .Streptomyces turgidiscabies.................... 114  4e-26  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Tat pathway signal sequence domain protei...   
. .Agromyces subbeticus........................... 112  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Agromyces subbeticus]      
. .Propionibacterium acnes JCM 18909.............. 112  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Propionibacterium acnes J...   
. .Actinomyces turicensis......................... 112  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomyces turicen...   
. .Propionibacterium sp. 434-HC2.................. 112  3e-26  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Propionibacterium sp....   
. .Propionibacterium acnes HL201PA1............... 112  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Propionibacterium acnes HL...   
. .Propionibacterium sp. KPL2008.................. 112  3e-26  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Propionibacterium s...   
. .Propionibacterium acnes........................ 112  4e-26  11 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Propionibacterium acnes]   
. .Streptomyces himastatinicus.................... 112  2e-25  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces himastat...   
. .Streptomyces sp. PRh5.......................... 111  4e-25  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. PRh5]          
. .Streptomyces sviceus........................... 110  8e-25  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sviceus]      
. .Streptomyces sp. 351MFTsu5.1................... 110  8e-25  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. 351M...   
. .Streptomyces peruviensis....................... 110  1e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces peruvien...   
. .Streptomyces scabiei........................... 109  2e-24  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces scabiei]           
. .Streptomyces rapamycinicus..................... 109  2e-24  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces rapamyci...   
. .Streptomyces afghaniensis...................... 108  3e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Tissue alpha-L-fucosidase [Strep...   
. .Streptomyces chartreusis....................... 108  4e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces chartreu...   
. .Streptomyces bingchenggensis BCW-1............. 108  6e-24  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces bingchen...   
. .Streptomyces viridochromogenes................. 108  6e-24  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Alpha-L-fucosidase [Streptomyces...   
. .Streptomyces sviceus ATCC 29083................ 107  7e-24  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sviceus]      
. .Streptomyces sp. NRRL S-813.................... 107  8e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces scabiei 87.22..................... 106  2e-23  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces scabiei]      
. .Streptomyces sp. NRRL S-475.................... 106  3e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces mediolani......................... 105  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces mediolani]    
. .Streptomyces sp. JS01.......................... 105  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. JS01]          
. .Streptomyces cyaneofuscatus.................... 105  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces cyaneofu...   
. .Streptomyces anulatus.......................... 105  6e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces anulatus]     
. .Streptomyces filamentosus...................... 105  7e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces filament...   
. .Streptomyces hygroscopicus..................... 105  3e-23  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces hygrosco...   
. .Streptomyces sp. NRRL S-350.................... 105  4e-23  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL F-2305................... 105  4e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-31..................... 105  5e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL...   
. .Streptomyces viridochromogenes DSM 40736....... 105  6e-23  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces viridoch...   
. .Streptomyces acidiscabies...................... 104  1e-22  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces acidisca...   
. .Mobiluncus mulieris............................ 103  5e-23  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Mobiluncus mulieris]       
. .Streptomyces turgidiscabies Car8............... 103  3e-22  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: ricin-type beta-trefoil lectin domain pro...   
. .Catenulispora acidiphila....................... 102  5e-22  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-fucosidase [Catenulispora acidiphila]    
. .Streptomyces bicolor........................... 102  7e-22  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces bicolor]      
. .Actinoplanes sp. RP-AC33....................... 101  1e-21  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinoplanes sp. RP-A...   
. .Actinoplanes globisporus....................... 100  3e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinoplanes globis...   
. .Streptomyces ipomoeae.......................... 100  3e-21  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Tat pathway signal sequence domain protei...   
. .Streptomyces prunicolor........................ 100  4e-21  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces prunic...   
. .Microbispora sp. ATCC PTA-5024................. 99.8 5e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Microbispora sp. ATCC PTA-... 
. .Catellatospora tsunoense....................... 99.4 5e-21  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Hamadaea tsunoensis]     
. .Streptomyces bottropensis...................... 99.4 7e-21  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces bottrope... 
. .Streptomyces pyridomyceticus................... 99.4 7e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces pyridomy... 
. .Streptomyces sp. NRRL B-3229................... 99.4 7e-21  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Tat pathway signal protein [Streptomyces ... 
. .Streptomyces lavenduligriseus.................. 98.6 1e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces lavendul... 
. .Catenulispora acidiphila DSM 44928............. 98.2 2e-20  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Catenulispora acidiph... 
. .Streptomyces rapamycinicus NRRL 5491........... 95.1 4e-20  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces rapamyci... 
. .Arthrobacter sp. 161MFSha2.1................... 94.4 9e-20  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sp. 161M... 
. .Streptomyces iranensis......................... 93.2 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Streptomyces iranensis]      
. .Arthrobacter sp. 35W........................... 92.0 6e-19  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sp. 35W]    
. .Arthrobacter sp. M2012083...................... 92.0 6e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sp. M201... 
. .Arthrobacter................................... 91.7 8e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: alpha-L-fucosidase [Arthrob... 
. .Arthrobacter sp. 31Y........................... 91.7 9e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sp. 31Y]    
. .Streptomyces flavochromogenes.................. 91.7 1e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces flavochr... 
. .Arthrobacter nicotinovorans.................... 91.3 1e-18  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter nicotino... 
. .Trueperella pyogenes........................... 89.7 4e-18  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Trueperella pyogenes]  
. .Streptomyces sp. NRRL F-5727................... 89.7 5e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces sp. W007.......................... 87.4 3e-17  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. W007]   
. .Streptomyces sp. NRRL F-6131................... 87.0 5e-17  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces xanthophaeus...................... 85.1 2e-16  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces xanthoph... 
. .Arthrobacter sanguinis......................... 84.7 3e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Arthrobacter sanguinis]  
. .Streptomyces himastatinicus ATCC 53653......... 83.2 8e-16  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces himastat... 
. .Streptomyces violaceusniger.................... 83.2 9e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces violaceu... 
. .Nocardioidaceae bacterium Broad-1.............. 82.4 2e-15  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Nocardioidaceae bacte... 
. .Streptomyces venezuelae........................ 82.0 2e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces venezuelae] 
. .Brachybacterium faecium........................ 82.0 3e-15  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Brachybacterium faecium] 
. .Streptomyces sp. NRRL WC-3742.................. 81.6 4e-15  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces zinciresistens.................... 81.3 4e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces zincires... 
. .Streptomyces hygroscopicus subsp. jinggangensis 81.3 4e-15  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces hygrosco... 
. .Catellatospora koreensis....................... 81.3 5e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Catelliglobosispora k... 
. .Streptomyces sp. NRRL F-5135................... 80.9 7e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces sp. BoleA5........................ 80.1 1e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. BoleA5] 
. .Streptomyces sp. NRRL WC-3641.................. 79.7 2e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces afghaniensis 772.................. 79.7 2e-14  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Tissue alpha-L-fucosidase [Strep... 
. .Streptomyces olindensis........................ 79.3 2e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces olindensis]      
. .Streptomyces scabrisporus...................... 79.3 3e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces scabrisp... 
. .Streptomyces sp. NRRL F-5140................... 77.8 7e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces ipomoeae 91-03.................... 77.8 8e-14  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces ipomoeae]   
. .Promicromonospora sukumoe...................... 77.8 1e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Promicromonospora s... 
. .Streptomyces sp. NRRL S-146.................... 77.0 1e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Streptomyces laceyi............................ 77.0 2e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces niveus]     
. .Streptomyces................................... 76.6 2e-13  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: alpha-L-fucosidase [Strepto... 
. .Streptomyces hygroscopicus subsp. jinggangensis 76.3 2e-13  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces hygrosco... 
. .Microbacterium oxydans UCD-TDU................. 76.3 2e-13  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Microbacterium sp. UC... 
. .Humibacter albus............................... 76.3 3e-13  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Humibacter albus]        
. .Streptomyces sp. HmicA12....................... 76.3 3e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. Hm... 
. .Actinopolymorpha alba.......................... 75.9 3e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolymorpha alba] 
. .Microbacterium testaceum....................... 75.9 4e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Microbacterium testac... 
. .Streptomyces avermitilis....................... 75.5 5e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces avermiti... 
. .Streptomyces bottropensis ATCC 25435........... 75.5 5e-13  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Streptomyces bottrope... 
. .Microbacterium sp. Cr-K29...................... 75.5 5e-13  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Microbacterium sp. Cr... 
. .Kribbella catacumbae........................... 75.5 5e-13  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Kribbella catacumbae]    
. .Microbacterium................................. 75.5 5e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: alpha-L-fucosidase [Microba... 
. .Streptomyces resistomycificus.................. 75.1 7e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces resistom... 
. .Streptomyces coelicolor........................ 75.1 7e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces coelicolor] 
. .Microbacterium sp. URHA0036.................... 75.1 8e-13  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Microbacterium sp. UR... 
. .Streptomyces sp. NRRL WC-3725.................. 74.7 8e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces sp. NRRL... 
. .Actinomyces sp. ICM39.......................... 74.7 2e-12  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. ICM39]   
. .Streptomyces fulvoviolaceus.................... 74.3 1e-12  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Streptomyces fulvovio... 
. .Aestuariimicrobium kwangyangense............... 74.3 1e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Aestuariimicrobium kw... 
. .Curtobacterium flaccumfaciens.................. 73.6 3e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Curtobacterium flaccu... 
. .Arcanobacterium haemolyticum................... 73.2 3e-12  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Arcanobacterium haemo... 
. .Streptomyces coelicoflavus ZG0656.............. 72.8 4e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Streptomyces coelicoflavus... 
. .Kribbella flavida.............................. 72.8 4e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Kribbella flavida]       
. .Actinomyces sp. oral taxon 180................. 72.8 9e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomyces sp. ora... 
. .Actinomyces sp. HPA0247........................ 72.4 1e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomyces sp. HPA... 
. .Actinomyces georgiae F0490..................... 71.6 2e-11  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces georgiae]    
. .Actinomyces sp. oral taxon 172 str. F0311...... 71.6 2e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Alpha-L-fucosidase [Actinomyces sp. oral ... 
. .Actinomyces sp. ICM47.......................... 71.6 2e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. ICM47]   
. .Actinomyces odontolyticus ATCC 17982........... 70.9 4e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomyces odontol... 
. .Propionibacterium acnes P6..................... 70.1 4e-11  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase, putative alpha-L-fuco... 
. .Propionibacterium.............................. 70.1 4e-11  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycosyl hydrolase [Propion... 
. .Propionibacterium acnes HL025PA1............... 70.1 4e-11  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycosyl hydrolase [Propion... 
. .Propionibacterium acnes SK187.................. 70.1 4e-11  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Propionibacterium acnes] 
. .Propionibacterium acnes 266.................... 69.7 5e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycosyl hydrolase [Propion... 
. .Propionibacterium sp. 5_U_42AFAA............... 69.7 5e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Propionibacterium sp.... 
. .Propionibacterium acnes HL046PA2............... 69.7 5e-11  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Propionibacterium acnes] 
. .Actinomyces sp. oral taxon 178 str. F0338...... 69.7 8e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: alpha-L-fucosidase [Actinomyces sp. oral ... 
. .Actinomyces sp. oral taxon 877 str. F0543...... 69.7 8e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: LPXTG-motif protein cell wall anchor doma... 
. .Propionibacterium acnes TypeIA2 P.acn17........ 68.9 8e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycosyl hydrolase [Propion... 
. .Propionibacterium acnes TypeIA2 P.acn31........ 68.9 8e-11  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Propionibacterium acnes] 
. .Propionibacterium acnes HL110PA1............... 68.9 8e-11  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycosyl hydrolase [Propionibacterium acnes] 
. .Bifidobacterium callitrichos DSM 23973......... 145  6e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium callitrich...   
. .Bifidobacterium biavatii DSM 23969............. 138  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium biavatii D...   
. .Parascardovia denticolens...................... 125  8e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Parascardovia dentico...   
. .Bifidobacterium bohemicum DSM 22767............ 124  2e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium bohemicum ...   
. .Bifidobacterium pseudolongum................... 124  2e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium pseud...   
. .Scardovia inopinata............................ 124  3e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Scardovia inopinata]       
. .Parascardovia denticolens F0305................ 123  4e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: hypothetical protein HMPREF9017_00615 [Parasca...   
. .Bifidobacterium longum......................... 122  1e-29  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium longum]    
. .Bifidobacterium kashiwanohense JCM 15439....... 122  1e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium kashiwanoh...   
. .Bifidobacterium longum subsp. infantis ATCC 156 122  1e-29  8 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium longum]    
. .Bifidobacterium longum subsp. infantis EK3..... 120  2e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium longum sub...   
. .Metascardovia criceti.......................... 120  5e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: hypothetical protein [Metascardovia criceti]   
. .Bifidobacterium psychraerophilum............... 119  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium psychraero...   
. .Bifidobacterium asteroides..................... 118  3e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium aster...   
. .Bifidobacterium dentium........................ 118  4e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium dentium]   
. .Bifidobacterium sp. 7101....................... 118  4e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium sp. 7...   
. .Bifidobacterium dentium Bd1.................... 117  4e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium dentium]   
. .Bifidobacterium sp. MSTE12..................... 117  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium sp. MSTE12]     
. .Bifidobacterium saguini DSM 23967.............. 117  8e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium saguini DS...   
. .Bifidobacterium cuniculi....................... 117  8e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium cuniculi]       
. .Bifidobacterium moukalabense DSM 27321......... 115  2e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium moukalaben...   
. .Bifidobacterium tsurumiense.................... 114  6e-27  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium tsuru...   
. .Bifidobacterium choerinum...................... 112  4e-26  2 hits  Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium choer...   
. .Bifidobacterium pullorum....................... 87.8 2e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium pullorum]     
. .Bifidobacterium gallinarum..................... 87.8 2e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium gallinarum]   
. .Bifidobacterium scardovii...................... 81.3 5e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Bifidobacterium scardovii]    
. .Bifidobacterium actinocoloniiforme DSM 22766... 73.9 1e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: Alpha-L-fucosidase [Bifidobacterium actinocolo... 
. .Parascardovia denticolens IPLA 20019........... 73.9 2e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: alpha-L-fucosidase [Parascardovia dentico... 
. .Atopobium sp. ICM58............................ 121  2e-29  4 hits  Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: alpha-L-fucosidase [Atopobium sp. ICM58]       
. .Candidatus Microthrix parvicella RN1........... 102  2e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:  Glycoside hydrolase family 29 (Alpha-L-fucosi...   
. .Candidatus Microthrix parvicella............... 102  3e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:  hypothetical protein [Candidatus Microthr...   
. .Acidimicrobidae bacterium YM16-304............. 82.8 3e-15  1 hit   Bacteria:Actinobacteria:Actinobacteria:  putative glycosidase [Ilumatobacter cocci... 
. .Olsenella sp. oral taxon 809................... 75.9 4e-13  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: alpha-L-fucosidase [Olsenella sp. oral ta... 
. .Coriobacteriaceae bacterium BV3Ac1............. 73.2 3e-12  2 hits  Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: alpha-L-fucosidase [Coriobacteriaceae bac... 
. .Coriobacterium glomerans....................... 72.4 5e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: alpha-L-fucosidase [Coriobacterium glomer... 
. .Ruminococcus sp. SR1/5......................... 169  6e-47  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Ruminococcus sp. SR1/5]    
. .Ruminococcus sp. JC304......................... 100  5e-22  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Ruminococcus sp. JC304]    
. .Ruminococcus sp. 5_1_39BFAA.................... 98.6 3e-21  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Ruminococcus sp. 5_1_... 
. .Ruminococcus gnavus............................ 89.4 7e-18  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [[Ruminococcus] gnavus] 
. .Ruminococcaceae bacterium AB4001............... 130  1e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Ruminococcaceae bacte...   
. .Subdoligranulum sp. 4_3_54A2FAA................ 94.0 1e-19  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Subdoligranulum sp. 4... 
. .Blautia sp. KLE 1732........................... 168  1e-46  7 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Blautia sp. KLE 1732]      
. .Clostridium sp. D5............................. 166  1e-45  11 hits Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium sp. D5]        
. .Robinsoniella sp. KNHs210...................... 161  6e-44  10 hits Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Robinsoniella sp. KNH...   
. .Lachnospiraceae bacterium M18-1................ 158  6e-43  8 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Lachnospiraceae bac...   
. .Clostridium sp. ASF502......................... 154  2e-41  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium sp. ASF...   
. .Anaerococcus obesiensis........................ 154  3e-41  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Anaerococcus obesie...   
. .Clostridiales bacterium VE202-08............... 150  6e-40  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiales bacte...   
. .Clostridiaceae bacterium JC13.................. 150  8e-40  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiaceae bact...   
. .Blautia producta............................... 141  1e-36  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Blautia producta]        
. .Clostridiales.................................. 139  1e-35  13 hits Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: alpha-L-fucosidase [Clostri...   
. .Clostridium leptum............................. 139  1e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Clostridium leptum]      
. .Clostridium leptum DSM 753..................... 139  1e-35  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: alpha-L-fucosidase [Clostri...   
. .Clostridiales bacterium VE202-21............... 138  2e-35  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridiales bacteri...   
. .Eubacterium siraeum............................ 138  2e-35  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Eubacterium siraeum]     
. .Clostridium sp. KNHs209........................ 136  1e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium sp. KNHs209]   
. .Clostridium saccharoperbutylacetonicum......... 136  1e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium saccharop...   
. .Clostridiales bacterium VE202-27............... 135  3e-34  8 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridiales bacteri...   
. .Clostridium sp. KLE 1755....................... 135  3e-34  18 hits Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Clostridium sp. KLE 1...   
. .Clostridium stercorarium....................... 134  6e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [[Clostridium] sterc...   
. .Butyrivibrio sp. MC2021........................ 134  8e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. MC2021]   
. .Roseburia intestinalis......................... 132  3e-33  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Roseburia intestinalis]    
. .Lachnospiraceae bacterium 3_1_57FAA_CT1........ 132  3e-33  18 hits Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte...   
. .Roseburia intestinalis XB6B4................... 132  4e-33  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Roseburia intestinalis]    
. .Roseburia intestinalis M50/1................... 132  4e-33  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Roseburia intestinalis]    
. .Epulopiscium sp. 'N.t. morphotype B'........... 131  6e-33  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Epulopiscium sp. 'N.t...   
. .Anaerococcus sp. ph9........................... 130  1e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Anaerococcus sp. PH9]    
. .Butyrivibrio sp. XBB1001....................... 129  5e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. XBB1...   
. .Butyrivibrio sp. VCB2006....................... 128  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. VCB2...   
. .Clostridium hathewayi.......................... 127  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [ [Clostridium hathe...   
. .Butyrivibrio sp. NC3005........................ 127  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. NC3005]   
. .Butyrivibrio sp. AC2005........................ 127  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. AC2005]   
. .Butyrivibrio sp. FC2001........................ 126  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. FC2001]   
. .Butyrivibrio sp. XPD2002....................... 126  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. XPD2...   
. .Butyrivibrio proteoclasticus................... 124  2e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio proteocl...   
. .Butyrivibrio proteoclasticus B316.............. 124  3e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio proteocl...   
. .Butyrivibrio fibrisolvens...................... 120  4e-29  5 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio fibrisol...   
. .Clostridiales bacterium VE202-06............... 117  5e-28  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiales bacte...   
. .Lachnospiraceae bacterium AC2028............... 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte...   
. .Lachnospiraceae bacterium P6A3................. 106  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Lachnospiraceae bac...   
. .Clostridium phytofermentans.................... 104  2e-23  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium phytoferm...   
. .Eubacterium saburreum.......................... 103  5e-23  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnoanaerobaculum s...   
. .Lachnoanaerobaculum sp. ICM7................... 102  7e-23  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte...   
. .Lachnospiraceae bacterium MSX33................ 102  7e-23  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacterium ...   
. .Lachnoanaerobaculum sp. OBRC5-5................ 102  1e-22  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte...   
. .Eubacterium saburreum DSM 3986................. 101  2e-22  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnoanaerobaculum s...   
. .Lachnospiraceae oral taxon 107................. 100  4e-22  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae oral ...   
. .Clostridium phytofermentans ISDg............... 100  7e-22  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium phytoferm...   
. .Blautia wexlerae............................... 98.6 3e-21  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Blautia wexlerae]        
. .Catonella morbi................................ 97.1 1e-20  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [Catonella morbi]         
. .Roseburia inulinivorans........................ 96.7 1e-20  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Roseburia inulinivorans] 
. .Clostridium sp. BL8............................ 95.1 4e-20  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium sp. BL8]   
. .Coprococcus sp. HPP0074........................ 94.0 1e-19  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Coprococcus sp. HPP... 
. .Lachnospiraceae bacterium 9_1_43BFAA........... 94.0 1e-19  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte... 
. .Lachnospiraceae bacterium 4_1_37FAA............ 94.0 1e-19  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte... 
. .Clostridium cadaveris.......................... 94.0 1e-19  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium cadaveris]   
. .Coprococcus sp. HPP0048........................ 93.6 2e-19  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Coprococcus sp. HPP... 
. .Clostridiales genomosp. BVAB3 str. S7-24-11.... 92.4 4e-19  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridiales genomosp. BV... 
. .Clostridiales genomosp. BVAB3.................. 92.4 4e-19  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridiales genomos... 
. .Lachnospiraceae bacterium 6_1_37FAA............ 92.4 2e-18  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Lachnospiraceae bac... 
. .Butyrivibrio sp. AE3006........................ 92.0 1e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. AE3006] 
. .Butyrivibrio sp. MB2005........................ 92.0 1e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. MB2005] 
. .Clostridium perfringens........................ 90.5 2e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium perfringens] 
. .Clostridium tunisiense......................... 89.7 4e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium tunisiense]  
. .Lachnospiraceae bacterium 2_1_58FAA............ 89.4 7e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: alpha-L-fucosidase [Clostri... 
. .Lachnospiraceae bacterium 5_1_57FAA............ 88.2 2e-17  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Lachnospiraceae bacte... 
. .Clostridium scindens........................... 88.2 2e-17  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Clostridium scindens]  
. .Lachnospiraceae bacterium A4................... 85.9 1e-16  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Lachnospiraceae bac... 
. .Helcococcus kunzii............................. 84.7 2e-16  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Helcococcus kunzii]      
. .Lachnospiraceae bacterium 10-1................. 83.6 7e-16  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Lachnospiraceae bac... 
. .Shuttleworthia sp. MSX8B....................... 81.6 3e-15  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Shuttleworthia sp. MSX8B]     
. .Clostridium sp. MSTE9.......................... 81.3 5e-15  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridium sp. MSTE9]   
. .Clostridiales bacterium VE202-29............... 80.5 8e-15  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Clostridiales bacteri... 
. .unclassified Lachnospiraceae................... 79.7 2e-14  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: alpha-L-fucosidase [unclass... 
. .Lachnospiraceae bacterium VE202-12............. 79.3 3e-14  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glycoside hydrolase family 29 [Lachnospir... 
. .Eubacterium plexicaudatum...................... 78.2 4e-14  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Eubacterium plexica... 
. .Clostridium sporosphaeroides................... 77.4 9e-14  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Clostridium sporosp... 
. .Caldicoprobacter oshimai....................... 75.1 8e-13  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Caldicoprobacter oshi... 
. .Clostridium cellobioparum...................... 72.8 4e-12  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Clostridium cellobi... 
. .Clostridium termitidis......................... 72.4 5e-12  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Alpha-L-fucosidase [ [Clostridium termiti... 
. .Butyrivibrio sp. LC3010........................ 70.9 2e-11  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [Butyrivibrio sp. LC3010] 
. .Lachnoclostridium.............................. 70.1 3e-11  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: alpha-L-fucosidase [Lachnoc... 
. .Clostridium methoxybenzovorans................. 70.1 3e-11  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: alpha-L-fucosidase [ [Clostridium methoxy... 
. .Caldanaerobius polysaccharolyticus............. 130  9e-33  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldanaerobius polysa...   
. .Thermoanaerobacterium thermosaccharolyticum.... 128  7e-32  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Thermoanaerobacterium...   
. .Caldicellulosiruptor acetigenus................ 101  5e-22  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ...   
. .Caldicellulosiruptor saccharolyticus........... 99.0 3e-21  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Caldicellulosiruptor obsidiansis............... 98.6 5e-21  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Caldicellulosiruptor kronotskyensis............ 96.7 2e-20  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Caldicellulosiruptor bescii.................... 96.3 3e-20  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Caldicellulosiruptor hydrothermalis............ 95.5 5e-20  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Mahella australiensis.......................... 95.1 7e-20  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Mahella australiensis]   
. .Mahella australiensis 50-1 BON................. 94.4 8e-20  6 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Mahella australiensis]   
. .Caldicellulosiruptor owensensis................ 94.0 2e-19  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Caldicellulosiruptor ... 
. .Thermoanaerobacterium saccharolyticum.......... 92.0 5e-19  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: alpha-L-fucosidase [Thermoanaerobacterium... 
. .Staphylococcus delphini........................ 160  2e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus delp...   
. .Staphylococcus intermedius..................... 159  4e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus inte...   
. .Paenibacillus forsythiae....................... 146  3e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus forsy...   
. .Paenibacillus durus............................ 146  3e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus durus]     
. .Bacillus sp. J37............................... 138  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. J37]          
. .Turicibacter sanguinis......................... 136  1e-34  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: alpha-L-fucosidase [Turicibacter sanguinis]    
. .Allofustis seminis............................. 136  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Allofustis seminis]      
. .Turicibacter sp. HGF1.......................... 136  1e-34  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: alpha-L-fucosidase [Turicibacter sp. HGF1]     
. .Paenibacillus sp. FSL H7-689................... 136  1e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL H7-689]   
. .Streptococcus cristatus........................ 135  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus cristatus]   
. .Paenibacillus sp. PAMC 26794................... 135  3e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. PAM...   
. .Paenibacillus.................................. 135  3e-34  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: alpha-L-fucosidase [Paeniba...   
. .Streptococcus sp. 2_1_36FAA.................... 134  5e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus sp. 2_1...   
. .Streptococcus gordonii......................... 134  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus gordonii]    
. .Paenibacillus sp. HW567........................ 134  6e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. HW567]   
. .Thermobacillus composti........................ 133  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Thermobacillus composti]   
. .Streptococcus parasanguinis.................... 133  2e-33  8 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Paenibacillus sp. FSL R5-192................... 133  2e-33  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL R5-192]   
. .Paenibacillus sp. FSL R7-277................... 133  2e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL R7-277]   
. .Streptococcus parasanguinis ATCC 15912......... 133  2e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Streptococcus parasanguinis F0449.............. 132  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Streptococcus parasanguinis CC87K.............. 132  3e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus paras...   
. .Cohnella panacarvi............................. 132  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Cohnella panacarvi]        
. .Streptococcus parasanguinis SK236.............. 131  8e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Streptococcus sp. oral taxon 056............... 131  8e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus sp. ora...   
. .Streptococcus parasanguinis ATCC 903........... 130  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Paenibacillus sp. FSL H8-237................... 130  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL H8-237]   
. .Streptococcus oligofermentans.................. 130  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus oligofe...   
. .Streptococcus sp. HSISM1....................... 130  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Streptococcus sp. HSI...   
. .Paenibacillus lactis........................... 129  3e-32  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus lactis]      
. .Bacillus sp. J13............................... 129  4e-32  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. J13]          
. .Streptococcus sp. F0442........................ 129  4e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus sp. F...   
. .Paenibacillus sp. JDR-2........................ 128  7e-32  12 hits Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. JDR-2]   
. .Bacillus sp. TS-2.............................. 128  7e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. TS-2]             
. .Streptococcus parasanguinis F0405.............. 128  7e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus parasan...   
. .Enterococcus phoeniculicola.................... 126  5e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus phoeni...   
. .Paenibacillus sanguinis........................ 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus sangu...   
. .Enterococcus casseliflavus..................... 120  3e-29  8 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Enterococcus casselif...   
. .Enterococcus casseliflavus EC30................ 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus casselif...   
. .Enterococcus faecalis.......................... 118  3e-28  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Enterococcus faecalis]     
. .Enterococcus faecium........................... 118  3e-28  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Enterococcus faecium]      
. .Enterococcus................................... 118  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Enteroc...   
. .Lactobacillus shenzhenensis.................... 117  5e-28  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus shenzhe...   
. .Lactobacillus harbinensis...................... 116  1e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus harbine...   
. .Enterococcus casseliflavus EC20................ 115  2e-27  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus casselif...   
. .Lactobacillus rhamnosus........................ 112  2e-26  18 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus]   
. .Lactobacillus rhamnosus Lc 705................. 112  2e-26  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus]   
. .Lactobacillus rhamnosus GG..................... 112  2e-26  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus]   
. .Lactobacillus rhamnosus K32.................... 112  2e-26  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus K32]    
. .Lactobacillus rhamnosus R0011.................. 110  1e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus]   
. .Paenibacillus pasadenensis..................... 107  4e-24  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus pasaden...   
. .Paenibacillus ehimensis........................ 103  2e-23  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus ehime...   
. .Lactobacillus casei............................ 101  7e-23  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus casei]       
. .Lactobacillus paracasei subsp. paracasei Lpp48. 100  2e-22  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus paracasei su...   
. .Lactobacillus paracasei subsp. paracasei Lpp126 100  3e-22  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus paracasei su...   
. .Lactobacillus casei group...................... 100  3e-22  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Lactoba...   
. .Lactobacillus casei CRF28...................... 100  3e-22  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus casei]       
. .Lactobacillus paracasei........................ 99.8 7e-22  20 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus paracasei] 
. .Lactobacillus paracasei subsp. paracasei Lpp225 99.8 7e-22  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Lactobacillus paracasei] 
. .Streptococcus pneumoniae....................... 99.0 2e-21  13 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Paenibacillus harenae.......................... 99.0 4e-21  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus harenae]   
. .Lactobacillus casei UW1........................ 98.6 2e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus casei]     
. .Streptococcus pneumoniae BS455................. 98.2 4e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Streptococcus pneumoniae 845................... 98.2 4e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Streptococcus pneumoniae CGSP14................ 98.2 4e-21  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Streptococcus pneumoniae MNZ11................. 98.2 4e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Streptococcus pneumoniae 2082239............... 98.2 4e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Streptococcus pneumoniae GA47283............... 98.2 4e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Paenibacillus mucilaginosus.................... 98.2 7e-21  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus mucilag... 
. .Streptococcus pneumoniae CDC1087-00............ 97.8 5e-21  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumon... 
. .Paenibacillus mucilaginosus 3016............... 97.8 9e-21  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus mucilag... 
. .Lactobacillus rhamnosus LRHMDP3................ 96.7 8e-21  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Lactobacillus rhamnosus] 
. .Streptococcus mitis............................ 96.3 2e-20  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus mitis]     
. .Lactobacillus rhamnosus LOCK900................ 94.7 3e-20  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Lactobacillus rhamnosus] 
. .Streptococcus pneumoniae 1488.................. 94.0 1e-19  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus pneumoniae 1... 
. .Abiotrophia defectiva.......................... 93.6 2e-19  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Abiotrophia defectiva]   
. .Lactobacillus sp. KACC 16878................... 92.8 3e-19  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus shenzhe... 
. .Streptococcus equinus.......................... 91.7 9e-19  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus equinus]   
. .Streptococcus suis............................. 91.3 2e-18  18 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: putative alpha-L-fucosidase [Streptococcu... 
. .Paenibacillus terrigena........................ 89.7 5e-18  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus terrigena] 
. .Paenibacillus taiwanensis...................... 88.6 1e-17  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus taiwane... 
. .Streptococcus minor............................ 88.2 2e-17  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus minor]     
. .Paenibacillus vortex........................... 87.8 2e-17  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus vortex]    
. .Paenibacillus sp. FSL R5-808................... 87.8 2e-17  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808] 
. .Paenibacillus ginsengihumi..................... 87.8 2e-17  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus ginseng... 
. .Paenibacillus mucilaginosus KNP414............. 87.4 3e-17  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus mucilag... 
. .Paenibacillus sp. Y412MC10..................... 87.0 5e-17  15 hits Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. Y41... 
. .Paenibacillus sp. HGF5......................... 86.7 6e-17  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. HGF5]  
. .Paenibacillus sp. FSL H8-457................... 86.7 6e-17  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457] 
. .Paenibacillus alginolyticus.................... 86.7 7e-17  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus alginol... 
. .Streptococcus suis R61......................... 86.3 8e-17  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus suis]      
. .Streptococcus suis 6407........................ 86.3 1e-16  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus suis]      
. .Granulicatella adiacens........................ 85.5 2e-16  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Granulicatella adiacens] 
. .Paenibacillus pinihumi......................... 85.5 2e-16  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus pinihumi]  
. .Virgibacillus sp. Vm-5......................... 85.1 2e-16  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Alpha-L-fucosidase [Virgibacillus sp. Vm-5]      
. .Streptococcus suis 05HAS68..................... 85.1 2e-16  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus suis]      
. .Lactobacillus casei UCD174..................... 84.7 2e-16  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus casei]     
. .Virgibacillus sp. CM-4......................... 84.7 3e-16  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein M948_05810 [Virgibacillus... 
. .Streptococcus suis A7.......................... 84.7 3e-16  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Streptococcus suis]      
. .Paenibacillus sp. UNC451MF..................... 84.7 3e-16  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. UNC... 
. .Enterococcus hirae............................. 84.3 4e-16  10 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus hirae]      
. .Paenibacillus sp. JCM 10914.................... 84.3 5e-16  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. JCM... 
. .Paenibacillus lactis 154....................... 84.3 5e-16  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus lactis]    
. .Enterococcus faecium 2006-70-121............... 83.6 7e-16  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus faeciu... 
. .Lactobacillus paracasei subsp. paracasei Lpp229 83.2 5e-16  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus parac... 
. .Enterococcus casseliflavus ATCC 12755.......... 83.2 1e-15  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus casselif... 
. .Dolosigranulum pigrum.......................... 82.8 2e-15  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Dolosigranulum pigrum] 
. .Paenibacillus dendritiformis................... 82.8 2e-15  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus dendrit... 
. .Enterococcus sp. TR............................ 82.4 2e-15  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus sp. TR]     
. .Paenibacillus alvei............................ 82.4 3e-15  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus alvei]     
. .Paenibacillus alvei DSM 29..................... 81.6 2e-15  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus alvei]     
. .Paenibacillus alvei A6-6i-x.................... 81.6 3e-15  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: alpha-L-fucosidase [Paeniba... 
. .Paenibacillus alvei TS-15...................... 81.6 4e-15  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus alvei]     
. .Bacillales..................................... 81.6 6e-15  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: alpha-L-fucosidase [Bacilla... 
. .Bacillus bataviensis........................... 81.3 4e-15  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus bataviensis]    
. .Streptococcus pneumoniae GA40028............... 80.9 6e-15  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase family protein [Streptococc... 
. .Paenibacillus sp. OSY-SE....................... 80.9 7e-15  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. OSY... 
. .Lactobacillus gigeriorum....................... 80.1 1e-14  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus gigerio... 
. .Enterococcus hirae ATCC 9790................... 80.1 1e-14  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus hirae]      
. .Paenibacillus vortex V453...................... 80.1 1e-14  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus vortex]    
. .Paenibacillus sp. TCA20........................ 79.7 1e-14  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. TCA20]     
. .Paenibacillus sp. UNC217MF..................... 79.7 2e-14  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. UNC... 
. .Lactobacillus paracasei subsp. paracasei Lpp230 79.3 1e-14  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Lactobacillus paracasei] 
. .Lactobacillus casei 32G........................ 79.3 1e-14  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus casei]     
. .Lactobacillus casei BL23....................... 79.3 1e-14  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Lactoba... 
. .Lactobacillus casei M36........................ 79.3 1e-14  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Lactoba... 
. .Paenibacillus sp. oral taxon 786............... 79.3 2e-14  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. ora... 
. .Paenibacillus barengoltzii..................... 79.3 2e-14  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus barengo... 
. .Paenibacillus sp. MSt1......................... 79.3 4e-14  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. MSt1]       
. .Alicyclobacillus herbarius..................... 79.0 3e-14  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Alicyclobacillus herb... 
. .Paenibacillus dendritiformis C454.............. 78.6 4e-14  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus dendrit... 
. .Bacillus sp. JCM 19045......................... 78.6 4e-14  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. JCM 19045]      
. .Enterococcus gallinarum EG2.................... 78.6 4e-14  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Enteroc... 
. .Bacillus sp. JCM 19046......................... 78.6 4e-14  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. JCM 19046]      
. .Lactobacillus rhamnosus HN001.................. 78.2 5e-14  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus] 
. .Lactobacillus rhamnosus LRHMDP2................ 78.2 6e-14  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Lactobacillus rhamnosus] 
. .Bacillus megaterium............................ 77.8 8e-14  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus megaterium]     
. .Lactobacillus fabifermentans T30PCM01.......... 76.6 2e-13  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus fabifermenta... 
. .Lactobacillus fabifermentans................... 76.3 2e-13  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus fabifer... 
. .Lactobacillus casei Lpc-37..................... 76.3 2e-13  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Lactoba... 
. .Lactobacillus paracasei subsp. paracasei CNCM I 76.3 3e-13  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus parac... 
. .Lactobacillus paracasei subsp. tolerans Lpl7... 75.9 3e-13  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus parac... 
. .Lactobacillus casei LC2W....................... 75.9 4e-13  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: alpha-L-fucosidase [Lactoba... 
. .Paenibacillus sp. A9........................... 75.9 4e-13  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. A9]    
. .Lactobacillus rhamnosus ATCC 21052............. 74.7 4e-13  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Lactobacillus rhamnosus] 
. .Paenibacillus elgii............................ 74.7 2e-12  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus elgii]     
. .Lactobacillus paracasei subsp. paracasei Lpp14. 73.6 2e-12  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus parac... 
. .Bacillus lehensis G1........................... 72.8 4e-12  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus lehensis G1]         
. .Enterococcus casseliflavus EC10................ 72.4 6e-12  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus cassel... 
. .Paenibacillus sp. HGF7......................... 72.4 9e-12  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: alpha-L-fucosidase [Paeniba... 
. .Paenibacillus daejeonensis..................... 72.0 9e-12  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus daeje... 
. .Paenibacillus sp. HGH0039...................... 72.0 1e-11  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: alpha-L-fucosidase [Paeniba... 
. .Bacillus sp. JCM 19047......................... 71.6 1e-11  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Bacillus sp. JCM 19047]      
. .Enterococcus faecalis 06-MB-DW-09.............. 71.6 1e-11  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Enterococcus faecalis]   
. .Enterococcus faecium 13.SD.W.09................ 71.2 2e-11  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Alpha-L-fucosidase [Enterococcus faecium]    
. .Enterococcus sp. C1............................ 71.2 2e-11  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: alpha-L-fucosidase [Enterococcus sp. C1]     
. .Vagococcus lutrae.............................. 70.9 2e-11  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Vagococcus lutrae]     
. .Paenibacillus barengoltzii G22................. 70.5 3e-11  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus barengo... 
. .Paenibacillus sp. J14.......................... 70.5 3e-11  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. J14]   
. .Enterococcus durans............................ 70.5 3e-11  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus durans]   
. .Streptococcus pneumoniae SP3-BS71.............. 69.7 4e-11  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: probable glycosyl hydrolase [Streptococcus pne... 
. .Paenibacillus sp. oral taxon 786 str. D14...... 69.7 5e-11  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  alpha-L-fucosidase [Paenibacillus sp. ora... 
. .Opitutus terrae................................ 166  2e-45  3 hits  Bacteria:Verrucomicrobia:Opitutae:       alpha-L-fucosidase [Opitutus terrae]           
. .Opitutus terrae PB90-1......................... 112  3e-25  6 hits  Bacteria:Verrucomicrobia:Opitutae:       alpha-L-fucosidase [Opitutus terrae]           
. .Opitutaceae bacterium TAV1..................... 79.3 4e-14  2 hits  Bacteria:Verrucomicrobia:Opitutae:       glycoside hydrolase [Opitutaceae bacteriu... 
. .Coraliomargarita akajimensis................... 138  6e-35  7 hits  Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: alpha-L-fucosidase [Coraliomargarita akaj...   
. .Coraliomargarita akajimensis DSM 45221......... 133  2e-33  14 hits Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: alpha-L-fucosidase [Coraliomargarita akaj...   
. .Verrucomicrobiae bacterium DG1235.............. 108  1e-24  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: Alpha-L-fucosidase superfamily [Verrucomi...   
. .Akkermansia muciniphila........................ 80.1 2e-14  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: alpha-L-fucosidase [Akkermansia muciniphila] 
. .Akkermansia muciniphila ATCC BAA-835........... 75.5 8e-13  4 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: alpha-L-fucosidase [Akkermansia muciniphila] 
. .Lentisphaera araneosa.......................... 166  5e-44  7 hits  Bacteria:Lentisphaerae:Lentisphaerales:  mucin-desulfating sulfatase (N-acetylgluc...   
. .Lentisphaera araneosa HTCC2155................. 121  1e-28  7 hits  Bacteria:Lentisphaerae:Lentisphaerales:  alpha-L-fucosidase [Lentisphaera araneosa]     
. .Thermotoga maritima............................ 163  1e-44  22 hits Bacteria:Thermotogae:Thermotogae:Thermotogales: alpha-L-fucosidase [Thermotoga maritima]       
. .Thermotoga sp. RQ2............................. 162  2e-44  3 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: alpha-L-fucosidase [Thermotoga sp. RQ2]        
. .Thermotoga maritima MSB8....................... 162  2e-44  14 hits Bacteria:Thermotogae:Thermotogae:Thermotogales: Chain A, Thermotoga Maritima Alpha-L-Fucosynthase,...   
. .Thermotoga petrophila.......................... 161  6e-44  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: alpha-L-fucosidase [Thermotoga petrophila]     
. .Thermotoga neapolitana......................... 151  2e-40  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: alpha-L-fucosidase [Thermotoga neapolitana]    
. .Thermotoga sp. EMP............................. 114  6e-27  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: alpha-L-fucosidase [Thermotoga sp. EMP]        
. .Rhodopirellula sallentina...................... 160  2e-43  15 hits Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Plasma alpha-L-fucosidase [Rhodopirellula...   
. .Rhodopirellula sp. SWK7........................ 160  3e-43  38 hits Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: fucosidase, alpha-L- 2, plasma [Rhodopire...   
. .Rhodopirellula sallentina SM41................. 137  7e-35  15 hits Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Rhodopirellula maiorica........................ 135  3e-34  6 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Rhodopirellula europaea........................ 134  5e-34  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Rhodopirellula europaea SH398.................. 134  8e-34  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Rhodopirellula baltica......................... 131  7e-33  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Rhodopirellula baltica WH47.................... 131  7e-33  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: alpha-fucosidase [Rhodopirellula baltica]      
. .Rhodopirellula baltica SH 1.................... 131  2e-32  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: alpha-fucosidase [Rhodopirellula baltica]      
. .Rhodopirellula maiorica SM1.................... 125  1e-30  6 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Glycoside hydrolase, family 29, subgroup ...   
. .Planctomyces brasiliensis...................... 140  4e-36  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: alpha-fucosidase [Planctomyces brasiliensis]   
. .Phycisphaera mikrensis......................... 112  3e-26  1 hit   Bacteria:Planctomycetes:Phycisphaerae:Phycisphaerales: alpha-L-fucosidase [Phycisphaera mikurensis]   
. .Roseiflexus castenholzii....................... 157  2e-42  2 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: alpha-L-fucosidase [Roseiflexus castenhol...   
. .Roseiflexus sp. RS-1........................... 155  1e-41  6 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: alpha-L-fucosidase [Roseiflexus sp. RS-1]      
. .Roseiflexus castenholzii DSM 13941............. 73.9 2e-12  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: alpha-L-fucosidase [Roseiflexus castenhol... 
. .Caldilinea aerophila........................... 143  4e-37  3 hits  Bacteria:Chloroflexi:Caldilineae:Caldilineales: alpha-L-fucosidase [Caldilinea aerophila]      
. .Caldilinea aerophila DSM 14535................. 130  9e-33  6 hits  Bacteria:Chloroflexi:Caldilineae:Caldilineales: alpha-L-fucosidase [Caldilinea aerophila]      
. .Herpetosiphon aurantiacus...................... 89.0 9e-18  1 hit   Bacteria:Chloroflexi:Chloroflexi:Herpetosiphonales: alpha-L-fucosidase [Herpetosiphon auranti... 
. .Anaerolinea thermophila........................ 88.2 2e-17  1 hit   Bacteria:Chloroflexi:Anaerolineae:Anaerolineales: alpha-L-fucosidase [Anaerolinea thermophila] 
. .Ktedonobacter racemifer........................ 87.8 3e-17  1 hit   Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: alpha-L-fucosidase [Ktedonobacter racemifer] 
. .Candidate division OctSpa1-106................. 140  4e-36  2 hits  Bacteria::                               MULTISPECIES: hypothetical protein [Fervi...   
. .unclassified Fervidibacteria................... 84.3 5e-16  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [uncla... 
. .bacterium Ec32................................. 137  5e-35  1 hit   Bacteria::                               Alpha-L-fucosidase|GH29 [bacterium Ec32]           
. .Dictyoglomus thermophilum...................... 132  2e-33  1 hit   Bacteria:Dictyoglomi:Dictyoglomia:Dictyoglomales: alpha-L-fucosidase [Dictyoglomus thermoph...   
. .Dictyoglomus turgidum.......................... 127  2e-31  1 hit   Bacteria:Dictyoglomi:Dictyoglomia:Dictyoglomales: alpha-L-fucosidase [Dictyoglomus turgidum]     
. .Candidatus Latescibacter anaerobius............ 132  3e-33  2 hits  Bacteria::                               alpha-L-fucosidase [Candidatus Latescibac...   
. .Latescibacteria bacterium SCGC AAA252-D10...... 98.2 3e-21  1 hit   Bacteria::                               hypothetical protein [candidate division ... 
. .Chthonomonas calidirosea....................... 132  1e-32  2 hits  Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: Alpha-L-fucosidase [Chthonomonas calidiro...   
. .Chthonomonas calidirosea T49................... 97.8 2e-20  4 hits  Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: Alpha-L-fucosidase [Chthonomonas calidiro... 
. .Fimbriimonas ginsengisoli Gsoil 348............ 116  1e-27  7 hits  Bacteria:Armatimonadetes:                alpha-L-fucosidase [Fimbriimonas ginsengisoli ...   
. .Armatimonadetes bacterium JGI 0000077-K19...... 75.9 4e-13  1 hit   Bacteria:Armatimonadetes:                hypothetical protein [Armatimonadetes bac... 
. .Bacteria....................................... 128  8e-32  1 hit   Bacteria::                               MULTISPECIES: alpha-L-fucosidase [Bacteria]    
. .Acholeplasma axanthum.......................... 126  3e-31  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: alpha-L-fucosidase [Acholeplasma axanthum]     
. .Thermobaculum terrenum......................... 125  5e-31  2 hits  Bacteria::                               alpha-L-fucosidase [Thermobaculum terrenum]    
. .bacterium UASB14............................... 122  1e-29  1 hit   Bacteria::                               alpha-L-fucosidase [bacterium UASB14]              
. .bacterium JKG1................................. 114  9e-27  1 hit   Bacteria::                               hypothetical protein [bacterium JKG1]          
. .Treponema denticola............................ 93.6 3e-19  9 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola SP37....................... 93.6 3e-19  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola H-22....................... 92.8 5e-19  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola ASLM....................... 92.8 5e-19  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola F0402...................... 92.8 5e-19  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: alpha-L-fucosidase [Treponema denticola]     
. .Gemmatimonadetes bacterium KBS708.............. 92.4 5e-19  3 hits  Bacteria:Gemmatimonadetes:Gemmatimonadetes: glycoside hydrolase family 29 (alpha-L-fucosid... 
. .Treponema azotonutricium....................... 91.7 1e-18  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: alpha-L-fucosidase [Treponema azotonutric... 
. .Treponema denticola ATCC 33520................. 90.9 3e-18  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola SP33....................... 90.5 3e-18  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Candidatus Caldatribacterium saccharofermentans 89.7 4e-18  1 hit   Bacteria::                               hypothetical protein [Candidatus Caldatri... 
. .Treponema denticola MYR-T...................... 89.7 8e-18  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema denticola]   
. .Treponema denticola ATCC 35405................. 87.8 3e-17  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: alpha-L-fucosidase [Treponema denticola]     
. .Treponema maltophilum.......................... 87.4 4e-17  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema maltophilum] 
. .Treponema phagedenis........................... 86.3 8e-17  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: alpha-L-fucosidase [Treponema phagedenis]    
. .Treponema medium............................... 85.1 3e-16  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema medium]      
. .BRC1 bacterium SCGC AAA257-C11................. 83.6 8e-16  1 hit   Bacteria::                               alpha-L-fucosidase [candidate division BR... 
. .Melioribacter roseus........................... 82.8 1e-15  1 hit   Bacteria:Chlorobi:Ignavibacteria:Ignavibacteriales: alpha-L-fucosidase [Melioribacter roseus]    
. .Sphaerochaeta globus........................... 82.0 3e-15  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glycoside hydrolase family protein [Sphae... 
. .Treponema lecithinolyticum..................... 82.0 4e-15  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: Alpha-L-fucosidase [Treponema lecithinoly... 
. .Treponema azotonutricium ZAS-9................. 79.0 3e-14  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: alpha-L-fucosidase [Treponema azotonutric... 
. .Thermobaculum terrenum ATCC BAA-798............ 75.9 4e-13  4 hits  Bacteria::                               alpha-L-fucosidase [Thermobaculum terrenum]  
. .Cyanothece sp. PCC 7424........................ 71.2 1e-11  3 hits  Bacteria:Cyanobacteria:Chroococcales:    alpha-L-fucosidase [Cyanothece sp. PCC 7424] 
. .Sphaerochaeta coccoides........................ 70.1 4e-11  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glycoside hydrolase 29 (alpha-L-fucosidas... 
. .Nostoc punctiforme............................. 69.3 5e-11  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycoside hydrolase family alpha-L-fucosi... 
. Capsaspora owczarzaki ATCC 30864................ 169  9e-47  2 hits  Eukaryota::Ichthyosporea:                alpha-L-fucosidase [Capsaspora owczarzaki...   
. Polysphondylium pallidum PN500.................. 166  1e-45  5 hits  Eukaryota::Dictyosteliida:               hypothetical protein PPL_02299 [Polysphondyliu...   
. Papilio xuthus.................................. 165  4e-45  1 hit   Eukaryota:Arthropoda:Insecta:Lepidoptera: alpha-L-fucosidase [Papilio xuthus]                
. Danaus plexippus................................ 159  2e-44  1 hit   Eukaryota:Arthropoda:Insecta:Lepidoptera: hypothetical protein KGM_17236 [Danaus plexippus]   
. Tribolium castaneum............................. 159  3e-43  9 hits  Eukaryota:Arthropoda:Insecta:Coleoptera: PREDICTED: alpha-L-fucosidase-like [Triboliu...   
. Bombyx mori..................................... 159  8e-43  1 hit   Eukaryota:Arthropoda:Insecta:Lepidoptera: PREDICTED: putative alpha-L-fucosidase-li...   
. Capitella teleta................................ 158  1e-42  10 hits Eukaryota:Annelida:Polychaeta:Capitellida: hypothetical protein CAPTEDRAFT_177977 [Capite...   
. Stegodyphus mimosarum........................... 157  1e-42  1 hit   Eukaryota:Arthropoda:Arachnida:Araneae:  Alpha-L-fucosidase [Stegodyphus mimosarum]          
. Dictyostelium purpureum......................... 157  2e-42  4 hits  Eukaryota::Dictyosteliida:               hypothetical protein DICPUDRAFT_88361 [Di...   
. Strongylocentrotus purpuratus................... 157  2e-42  4 hits  Eukaryota:Echinodermata:Echinoidea:Echinoida: PREDICTED: alpha-L-fucosidase-like [Strongyl...   
. Trichoplax adhaerens............................ 157  3e-42  4 hits  Eukaryota:Placozoa:                      hypothetical protein TRIADDRAFT_37144 [Tr...   
. Dictyostelium fasciculatum...................... 156  4e-42  2 hits  Eukaryota::Dictyosteliida:               alpha-fucosidase [Dictyostelium fascicula...   
. Crassostrea gigas............................... 156  5e-42  11 hits Eukaryota:Mollusca:Bivalvia:Ostreoida:   Plasma alpha-L-fucosidase [Crassostrea gigas]       
. Spodoptera litura............................... 156  6e-42  1 hit   Eukaryota:Arthropoda:Insecta:Lepidoptera: alpha-L-fucoside fucohydrolase [Spodoptera lit...   
. Dendroctonus ponderosae......................... 156  6e-42  6 hits  Eukaryota:Arthropoda:Insecta:Coleoptera: unknown [Dendroctonus ponderosae]                   
. Aplysia californica............................. 156  6e-42  12 hits Eukaryota:Mollusca:Gastropoda:           PREDICTED: alpha-L-fucosidase-like [Aplys...   
. Amphimedon queenslandica........................ 155  7e-42  6 hits  Eukaryota:Porifera:Demospongiae:Haplosclerida: PREDICTED: alpha-L-fucosidase-like [Amphi...   
. Daphnia pulex................................... 155  1e-41  3 hits  Eukaryota:Arthropoda:Branchiopoda:Diplostraca: hypothetical protein DAPPUDRAFT_55824 [Daphnia...   
. Metaseiulus occidentalis........................ 155  2e-41  3 hits  Eukaryota:Arthropoda:Arachnida:Mesostigmata: PREDICTED: putative alpha-L-fucosidase-li...   
. Anopheles gambiae str. PEST..................... 155  2e-41  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    AGAP007285-PA [Anopheles gambiae str. PEST]       
. Danio rerio..................................... 154  2e-41  7 hits  Eukaryota:Chordata:Actinopterygii:Cypriniformes: fucosidase, alpha-L-1, tissue precursor [Dan...   
. Cynoglossus semilaevis.......................... 153  5e-41  2 hits  Eukaryota:Chordata:Actinopterygii:Pleuronectiformes: PREDICTED: tissue alpha-L-fucosidase [Cyn...   
. Drosophila sechellia............................ 152  1e-40  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GM24746 [Drosophila sechellia]                 
. Drosophila melanogaster......................... 152  1e-40  4 hits  Eukaryota:Arthropoda:Insecta:Diptera:    alpha-L-fucosidase [Drosophila melanogaster]      
. Drosophila erecta............................... 152  2e-40  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GG13916 [Drosophila erecta]                    
. Musca domestica................................. 152  2e-40  1 hit   Eukaryota:Arthropoda:Insecta:Diptera:    PREDICTED: putative alpha-L-fucosidase-li...   
. Drosophila yakuba............................... 152  2e-40  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GE20211 [Drosophila yakuba]                    
. Schistosoma mansoni............................. 152  3e-40  1 hit   Eukaryota:Platyhelminthes:Trematoda:Strigeidida: alpha-l-fucosidase, putative [Schistosoma man...   
. Tetraodon nigroviridis.......................... 152  6e-39  4 hits  Eukaryota:Chordata:Actinopterygii:Tetraodontiformes: unnamed protein product [Tetraodon nigroviridis]   
. Zootermopsis nevadensis......................... 151  5e-40  2 hits  Eukaryota:Arthropoda:Insecta:Isoptera:   Plasma alpha-L-fucosidase [Zootermopsis nevade...   
. Drosophila simulans............................. 151  6e-40  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GD17581 [Drosophila simulans]                  
. Lottia gigantea................................. 150  7e-40  26 hits Eukaryota:Mollusca:Gastropoda:           hypothetical protein LOTGIDRAFT_217885 [L...   
. Haplochromis burtoni............................ 150  7e-40  2 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: tissue alpha-L-fucosidase-like...   
. Schistosoma japonicum........................... 150  1e-39  1 hit   Eukaryota:Platyhelminthes:Trematoda:Strigeidida: similar to alpha-L-fucosidase [Schistosoma jap...   
. Drosophila mojavensis........................... 150  1e-39  4 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GI11597 [Drosophila mojavensis]                
. Saccoglossus kowalevskii........................ 149  2e-39  2 hits  Eukaryota:Hemichordata:Enteropneusta:    PREDICTED: alpha-L-fucosidase-like [Sacco...   
. Nasonia vitripennis............................. 149  2e-39  2 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Nason...   
. Acromyrmex echinatior........................... 149  2e-39  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: Plasma alpha-L-fucosidase [Acromyrmex echinatior]   
. Takifugu rubripes............................... 149  3e-39  4 hits  Eukaryota:Chordata:Actinopterygii:Tetraodontiformes: PREDICTED: tissue alpha-L-fucosidase-like...   
. Dictyostelium discoideum AX4.................... 148  4e-39  4 hits  Eukaryota::Dictyosteliida:               hypothetical protein DDB_G0274391 [Dictyoste...   
. Apis mellifera.................................. 148  4e-39  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase [Apis mellifera]    
. Megachile rotundata............................. 148  4e-39  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Megac...   
. Oreochromis niloticus........................... 148  4e-39  2 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Aedes aegypti................................... 148  4e-39  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    alpha-l-fucosidase [Aedes aegypti]             
. Apis dorsata.................................... 148  4e-39  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Apis ...   
. Rattus norvegicus............................... 148  4e-39  10 hits Eukaryota:Chordata:Mammalia:Rodentia:    tissue alpha-L-fucosidase precursor [Rattus ...   
. Pundamilia nyererei............................. 148  4e-39  2 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Maylandia zebra................................. 148  4e-39  2 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Xenopus laevis.................................. 148  5e-39  11 hits Eukaryota:Chordata:Amphibia:Anura:       fucosidase, alpha-L- 2, plasma precursor ...   
. Drosophila virilis.............................. 148  5e-39  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GJ11276 [Drosophila virilis]                   
. Diaphorina citri................................ 148  6e-39  2 hits  Eukaryota:Arthropoda:Insecta:Hemiptera:  PREDICTED: alpha-L-fucosidase-like [Diaph...   
. Xenopus (Silurana) tropicalis................... 148  6e-39  6 hits  Eukaryota:Chordata:Amphibia:Anura:       tissue alpha-L-fucosidase precursor [Xeno...   
. Ciona intestinalis.............................. 148  6e-39  5 hits  Eukaryota:Chordata:Ascidiacea:Enterogona: PREDICTED: alpha-L-fucosidase-like [Ciona...   
. Drosophila ananassae............................ 148  7e-39  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GF24545 [Drosophila ananassae]                 
. Solenopsis invicta.............................. 148  8e-38  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: hypothetical protein SINV_07990 [Solenopsis in...   
. Oncorhynchus mykiss............................. 147  1e-38  2 hits  Eukaryota:Chordata:Actinopterygii:Salmoniformes: unnamed protein product [Oncorhynchus mykiss]      
. Stegastes partitus.............................. 147  1e-38  3 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: plasma alpha-L-fucosidase [Ste...   
. Callorhinchus milii............................. 147  1e-38  4 hits  Eukaryota:Chordata:Chondrichthyes:Chimaeriformes: PREDICTED: tissue alpha-L-fucosidase [Cal...   
. Halocynthia roretzi............................. 147  1e-38  1 hit   Eukaryota:Chordata:Ascidiacea:Stolidobranchia: a-L-fucosidase [Halocynthia roretzi]               
. Helobdella robusta.............................. 147  2e-38  8 hits  Eukaryota:Annelida:Hirudinida:Rhynchobdellida: hypothetical protein HELRODRAFT_79486 [He...   
. Otolemur garnettii.............................. 147  2e-38  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Oto...   
. Oryzias latipes................................. 146  2e-38  2 hits  Eukaryota:Chordata:Actinopterygii:Beloniformes: PREDICTED: tissue alpha-L-fucosidase-like...   
. Ixodes scapularis............................... 146  2e-38  8 hits  Eukaryota:Arthropoda:Arachnida:Ixodida:  alpha-L-fucosidase, putative [Ixodes scap...   
. Poecilia formosa................................ 146  2e-38  2 hits  Eukaryota:Chordata:Actinopterygii:Cyprinodontiformes: PREDICTED: tissue alpha-L-fucosidase [Poe...   
. Sus scrofa...................................... 146  3e-38  4 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Sus...   
. Culex quinquefasciatus.......................... 146  3e-38  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    plasma alpha-L-fucosidase [Culex quinquef...   
. Anopheles darlingi.............................. 146  3e-38  1 hit   Eukaryota:Arthropoda:Insecta:Diptera:    alpha-l-fucosidase [Anopheles darlingi]             
. Nematostella vectensis.......................... 145  3e-38  18 hits Eukaryota:Cnidaria:Anthozoa:Actiniaria:  predicted protein [Nematostella vectensis]     
. Eptesicus fuscus................................ 145  3e-38  2 hits  Eukaryota:Chordata:Mammalia:Chiroptera:  PREDICTED: tissue alpha-L-fucosidase [Ept...   
. Ictidomys tridecemlineatus...................... 145  4e-38  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Ict...   
. Lepisosteus oculatus............................ 145  4e-38  2 hits  Eukaryota:Chordata:Actinopterygii:Semionotiformes: PREDICTED: tissue alpha-L-fucosidase-like...   
. Apis florea..................................... 145  5e-38  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Apis ...   
. Trichuris suis.................................. 145  5e-38  4 hits  Eukaryota:Nematoda:Enoplea:Trichocephalida: hypothetical protein M513_02208 [Trichuris suis]    
. Ceratitis capitata.............................. 145  5e-38  3 hits  Eukaryota:Arthropoda:Insecta:Diptera:    PREDICTED: putative alpha-L-fucosidase-li...   
. Drosophila grimshawi............................ 145  6e-38  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GH16641 [Drosophila grimshawi]                 
. Neolamprologus brichardi........................ 145  6e-38  2 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Myotis lucifugus................................ 145  7e-38  2 hits  Eukaryota:Chordata:Mammalia:Chiroptera:  PREDICTED: tissue alpha-L-fucosidase [Myo...   
. Drosophila pseudoobscura pseudoobscura.......... 145  7e-38  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GA23876 [Drosophila pseudoobscura pseudoo...   
. Bombus impatiens................................ 145  9e-38  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Bombu...   
. Astyanax mexicanus.............................. 144  9e-38  4 hits  Eukaryota:Chordata:Actinopterygii:Characiformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Macaca mulatta.................................. 144  9e-38  4 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Mac...   
. Bubalus bubalis................................. 144  1e-37  2 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Bub...   
. Erinaceus europaeus............................. 144  1e-37  2 hits  Eukaryota:Chordata:Mammalia:Insectivora: PREDICTED: tissue alpha-L-fucosidase [Eri...   
. Macaca fascicularis............................. 144  1e-37  9 hits  Eukaryota:Chordata:Mammalia:Primates:    hypothetical protein EGM_00346 [Macaca fascicu...   
. Drosophila willistoni........................... 144  1e-37  2 hits  Eukaryota:Arthropoda:Insecta:Diptera:    GK17022 [Drosophila willistoni]                
. Papio anubis.................................... 144  1e-37  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Pap...   
. Bos grunniens mutus............................. 144  2e-37  4 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Bos...   
. Bos taurus...................................... 144  2e-37  6 hits  Eukaryota:Chordata:Mammalia:             tissue alpha-L-fucosidase precursor [Bos ...   
. Chlorocebus sabaeus............................. 144  2e-37  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Chl...   
. Callithrix jacchus.............................. 144  2e-37  6 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Cal...   
. Cerapachys biroi................................ 144  2e-37  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: Alpha-L-fucosidase [Cerapachys biroi]               
. Xiphophorus maculatus........................... 144  2e-37  2 hits  Eukaryota:Chordata:Actinopterygii:Cyprinodontiformes: PREDICTED: plasma alpha-L-fucosidase-like...   
. Galeopterus variegatus.......................... 144  2e-37  2 hits  Eukaryota:Chordata:Mammalia:Dermoptera:  PREDICTED: tissue alpha-L-fucosidase [Gal...   
. Elephantulus edwardii........................... 144  2e-37  2 hits  Eukaryota:Chordata:Mammalia:Macroscelidea: PREDICTED: tissue alpha-L-fucosidase [Ele...   
. Poecilia reticulata............................. 143  2e-37  2 hits  Eukaryota:Chordata:Actinopterygii:Cyprinodontiformes: PREDICTED: plasma alpha-L-fucosidase [Poe...   
. Mus musculus.................................... 143  2e-37  29 hits Eukaryota:Chordata:Mammalia:Rodentia:    unnamed protein product [Mus musculus]             
. Orycteropus afer afer........................... 143  3e-37  2 hits  Eukaryota:Chordata:Mammalia:Tubulidentata: PREDICTED: tissue alpha-L-fucosidase [Ory...   
. Tupaia chinensis................................ 143  3e-37  4 hits  Eukaryota:Chordata:Mammalia:Scandentia:  PREDICTED: tissue alpha-L-fucosidase [Tup...   
. Myotis brandtii................................. 143  3e-37  5 hits  Eukaryota:Chordata:Mammalia:Chiroptera:  PREDICTED: tissue alpha-L-fucosidase isof...   
. Caenorhabditis elegans.......................... 143  3e-37  3 hits  Eukaryota:Nematoda:Chromadorea:Rhabditida: Protein W03G11.3 [Caenorhabditis elegans]         
. Microtus ochrogaster............................ 143  4e-37  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Mic...   
. Gorilla gorilla gorilla......................... 143  4e-37  3 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Gor...   
. Oryctolagus cuniculus........................... 142  4e-37  2 hits  Eukaryota:Chordata:Mammalia:Lagomorpha:  PREDICTED: tissue alpha-L-fucosidase [Ory...   
. Homo sapiens.................................... 142  4e-37  19 hits Eukaryota:Chordata:Mammalia:Primates:    alpha-L-fucosidase [Homo sapiens]                   
. Pan paniscus.................................... 142  4e-37  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Pan...   
. Cricetulus griseus.............................. 142  5e-37  7 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Cri...   
. Loxodonta africana.............................. 142  6e-37  2 hits  Eukaryota:Chordata:Mammalia:Proboscidea: PREDICTED: tissue alpha-L-fucosidase [Lox...   
. Latimeria chalumnae............................. 142  7e-37  2 hits  Eukaryota:Chordata:Coelacanthiformes:    PREDICTED: LOW QUALITY PROTEIN: tissue al...   
. Microplitis demolitor........................... 142  8e-37  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase [Micropliti...   
. Melopsittacus undulatus......................... 142  1e-36  1 hit   Eukaryota:Chordata:Aves:Psittaciformes:  PREDICTED: plasma alpha-L-fucosidase [Mel...   
. Trichuris trichiura............................. 141  1e-36  2 hits  Eukaryota:Nematoda:Enoplea:Trichocephalida: alpha L fucosidase [Trichuris trichiura]           
. Ailuropoda melanoleuca.......................... 141  1e-36  4 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: tissue alpha-L-fucosidase-like...   
. Nomascus leucogenys............................. 141  1e-36  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Nom...   
. Nannospalax galili.............................. 141  2e-36  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Nan...   
. Taeniopygia guttata............................. 141  2e-36  2 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Tae...   
. Vicugna pacos................................... 141  2e-36  2 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Vic...   
. Harpegnathos saltator........................... 141  2e-36  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: Plasma alpha-L-fucosidase [Harpegnathos saltator]   
. Felis catus..................................... 141  2e-36  4 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: tissue alpha-L-fucosidase [Fel...   
. Ancylostoma ceylanicum.......................... 141  2e-36  2 hits  Eukaryota:Nematoda:Chromadorea:Rhabditida: hypothetical protein Y032_0028g1723 [Ancylosto...   
. Trichechus manatus latirostris.................. 140  2e-36  2 hits  Eukaryota:Chordata:Mammalia:Sirenia:     PREDICTED: tissue alpha-L-fucosidase [Tri...   
. Mustela putorius furo........................... 140  3e-36  4 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: tissue alpha-L-fucosidase [Mus...   
. Pseudopodoces humilis........................... 140  3e-36  2 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Pse...   
. Echinococcus multilocularis..................... 140  3e-36  2 hits  Eukaryota:Platyhelminthes:Cestoda:Cyclophyllidea: fucosidase, alpha L 1, tissue [Echinococcus m...   
. Echinococcus granulosus......................... 140  3e-36  2 hits  Eukaryota:Platyhelminthes:Cestoda:Cyclophyllidea: Tissue alpha-L-fucosidase [Echinococcus granul...   
. Branchiostoma floridae.......................... 140  4e-36  3 hits  Eukaryota:Chordata:                      RecName: Full=Alpha-L-fucosidase; AltN...   
. Equus caballus.................................. 140  4e-36  3 hits  Eukaryota:Chordata:Mammalia:Perissodactyla: PREDICTED: tissue alpha-L-fucosidase isof...   
. Peromyscus maniculatus bairdii.................. 140  4e-36  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Per...   
. Falco peregrinus................................ 140  4e-36  2 hits  Eukaryota:Chordata:Aves:Falconiformes:   PREDICTED: plasma alpha-L-fucosidase [Fal...   
. Jaculus jaculus................................. 140  5e-36  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Jac...   
. Ovis aries...................................... 140  5e-36  2 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Ovi...   
. Gallus gallus................................... 139  5e-36  4 hits  Eukaryota:Chordata:Aves:Galliformes:     PREDICTED: plasma alpha-L-fucosidase [Gallus...   
. Chrysochloris asiatica.......................... 139  5e-36  2 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: tissue alpha-L-fucosidase [Chr...   
. Manacus vitellinus.............................. 139  6e-36  4 hits  Eukaryota:Chordata:Aves:Passeriformes:   Plasma alpha-L-fucosidase [Manacus vitellinus]      
. Cuculus canorus................................. 139  6e-36  1 hit   Eukaryota:Chordata:Aves:Cuculiformes:    Plasma alpha-L-fucosidase [Cuculus canorus]         
. Cavia porcellus................................. 139  7e-36  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: tissue alpha-L-fucosidase [Cav...   
. Canis lupus familiaris.......................... 139  8e-36  7 hits  Eukaryota:Chordata:Mammalia:Carnivora:   tissue alpha-L-fucosidase precursor [Cani...   
. Sorex araneus................................... 139  8e-36  2 hits  Eukaryota:Chordata:Mammalia:Insectivora: PREDICTED: tissue alpha-L-fucosidase [Sor...   
. Hydra vulgaris.................................. 139  9e-36  4 hits  Eukaryota:Cnidaria:Hydrozoa:Hydroida:    PREDICTED: alpha-L-fucosidase-like [Hydra...   
. Ursus maritimus................................. 139  1e-35  3 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: tissue alpha-L-fucosidase isof...   
. Odobenus rosmarus divergens..................... 139  1e-35  2 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: tissue alpha-L-fucosidase [Odo...   
. Zonotrichia albicollis.......................... 139  1e-35  1 hit   Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Zon...   
. Chelonia mydas.................................. 139  1e-35  2 hits  Eukaryota:Chordata:Testudines:           PREDICTED: plasma alpha-L-fucosidase [Che...   
. Setosphaeria turcica Et28A...................... 139  3e-35  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: glycoside hydrolase family 29 protein [Se...   
. Oikopleura dioica............................... 139  7e-35  1 hit   Eukaryota:Chordata:Appendicularia:       unnamed protein product [Oikopleura dioica]        
. Ascaris suum.................................... 138  3e-35  1 hit   Eukaryota:Nematoda:Chromadorea:Ascaridida: alpha-l-fucosidase [Ascaris suum]                   
. Piriformospora indica DSM 11827................. 138  2e-34  1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Sebacinales: hypothetical protein PIIN_08231 [Piriformospo...   
. Pteropus alecto................................. 137  3e-35  4 hits  Eukaryota:Chordata:Mammalia:Chiroptera:  Plasma alpha-L-fucosidase [Pteropus alecto]         
. Chrysemys picta bellii.......................... 137  3e-35  4 hits  Eukaryota:Chordata:Testudines:           PREDICTED: plasma alpha-L-fucosidase isof...   
. Heterocephalus glaber........................... 137  4e-35  13 hits Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: plasma alpha-L-fucosidase isof...   
. Lipotes vexillifer.............................. 137  4e-35  2 hits  Eukaryota:Chordata:Mammalia:Cetacea:     PREDICTED: tissue alpha-L-fucosidase [Lip...   
. Caenorhabditis briggsae......................... 137  5e-35  2 hits  Eukaryota:Nematoda:Chromadorea:Rhabditida: Protein CBG16208 [Caenorhabditis briggsae]         
. Hymenolepis microstoma.......................... 137  5e-35  1 hit   Eukaryota:Platyhelminthes:Cestoda:Cyclophyllidea: fucosidase, alpha L 1, tissue [Hymenolepis mi...   
. Ficedula albicollis............................. 137  6e-35  2 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Fic...   
. Pantholops hodgsonii............................ 137  6e-35  3 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: LOW QUALITY PROTEIN: tissue al...   
. Anolis carolinensis............................. 137  6e-35  2 hits  Eukaryota:Chordata:Squamata:             PREDICTED: tissue alpha-L-fucosidase [Ano...   
. Myotis davidii.................................. 137  8e-35  3 hits  Eukaryota:Chordata:Mammalia:Chiroptera:  PREDICTED: plasma alpha-L-fucosidase [Myo...   
. Magnaporthe oryzae Y34.......................... 137  4e-34  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: alpha-L-fucosidase precursor [Magnaporthe oryz...   
. Balaenoptera acutorostrata scammoni............. 136  1e-34  2 hits  Eukaryota:Chordata:Mammalia:Cetacea:     PREDICTED: tissue alpha-L-fucosidase [Bal...   
. Heterobasidion irregulare TC 32-1............... 136  6e-34  2 hits  Eukaryota:Basidiomycota:Agaricomycetes:Russulales: glycoside hydrolase family 29 protein [Heterob...   
. Magnaporthe oryzae P131......................... 136  7e-34  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: alpha-L-fucosidase precursor [Magnaporthe oryz...   
. Auricularia delicata TFB-10046 SS5.............. 136  8e-34  4 hits  Eukaryota:Basidiomycota:Agaricomycetes:Auriculariales: glycoside hydrolase [Auricularia delicata...   
. Monodelphis domestica........................... 135  2e-34  4 hits  Eukaryota:Chordata:Mammalia:Didelphimorphia: PREDICTED: tissue alpha-L-fucosidase isof...   
. Alligator mississippiensis...................... 135  3e-34  2 hits  Eukaryota:Chordata:                      PREDICTED: plasma alpha-L-fucosidase [All...   
. Magnaporthe oryzae 70-15........................ 135  5e-34  6 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: hypothetical protein MGG_00042 [Magnaport...   
. Ochotona princeps............................... 135  2e-33  1 hit   Eukaryota:Chordata:Mammalia:Lagomorpha:  PREDICTED: plasma alpha-L-fucosidase [Och...   
. Ophiophagus hannah.............................. 134  5e-34  1 hit   Eukaryota:Chordata:Squamata:             Plasma alpha-L-fucosidase [Ophiophagus hannah]      
. Chinchilla lanigera............................. 134  6e-34  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: plasma alpha-L-fucosidase [Chi...   
. Acanthamoeba castellanii str. Neff.............. 134  6e-34  4 hits  Eukaryota::                              alpha-l-fucosidase family protein [Acanth...   
. Equus przewalskii............................... 134  8e-34  3 hits  Eukaryota:Chordata:Mammalia:Perissodactyla: PREDICTED: plasma alpha-L-fucosidase [Equ...   
. Nipponia nippon................................. 133  1e-33  2 hits  Eukaryota:Chordata:Aves:Ciconiiformes:   Tissue alpha-L-fucosidase [Nipponia nippon]         
. Python bivittatus............................... 133  2e-33  2 hits  Eukaryota:Chordata:Squamata:             PREDICTED: tissue alpha-L-fucosidase [Pyt...   
. Bombus terrestris............................... 133  2e-33  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: alpha-L-fucosidase-like [Bombu...   
. Caenorhabditis remanei.......................... 133  2e-33  2 hits  Eukaryota:Nematoda:Chromadorea:Rhabditida: hypothetical protein CRE_16614 [Caenorhab...   
. Condylura cristata.............................. 133  6e-33  2 hits  Eukaryota:Chordata:Mammalia:Insectivora: PREDICTED: plasma alpha-L-fucosidase [Con...   
. Saimiri boliviensis boliviensis................. 131  5e-33  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: plasma alpha-L-fucosidase [Sai...   
. Falco cherrug................................... 131  7e-33  2 hits  Eukaryota:Chordata:Aves:Falconiformes:   PREDICTED: tissue alpha-L-fucosidase [Fal...   
. Mesocricetus auratus............................ 130  1e-32  2 hits  Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: plasma alpha-L-fucosidase [Mes...   
. Sarcophilus harrisii............................ 130  2e-32  2 hits  Eukaryota:Chordata:Mammalia:Dasyuromorphia: PREDICTED: plasma alpha-L-fucosidase [Sar...   
. Eutypa lata UCREL1.............................. 130  3e-32  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Xylariales: putative glycoside hydrolase family 29 pr...   
. Pestalotiopsis fici W106-1...................... 130  9e-32  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Xylariales: hypothetical protein PFICI_14024 [Pestalo...   
. Stereum hirsutum FP-91666 SS1................... 130  1e-31  6 hits  Eukaryota:Basidiomycota:Agaricomycetes:Russulales: glycoside hydrolase family 29 protein [St...   
. Orcinus orca.................................... 129  4e-32  2 hits  Eukaryota:Chordata:Mammalia:Cetacea:     PREDICTED: plasma alpha-L-fucosidase [Orc...   
. Tursiops truncatus.............................. 129  4e-32  2 hits  Eukaryota:Chordata:Mammalia:Cetacea:     PREDICTED: plasma alpha-L-fucosidase-like...   
. Galerina marginata CBS 339.88................... 129  8e-32  1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: hypothetical protein GALMADRAFT_218912 [Galeri...   
. Trichosporon asahii var. asahii CBS 8904........ 129  2e-31  1 hit   Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: alpha-L-fucosidase [Trichosporon asahii var. a...   
. Trichosporon asahii var. asahii CBS 2479........ 129  3e-31  1 hit   Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: alpha-L-fucosidase [Trichosporon asahii var. a...   
. Gloeophyllum trabeum ATCC 11539................. 128  3e-31  2 hits  Eukaryota:Basidiomycota:Agaricomycetes:Gloeophyllales: glycoside hydrolase [Gloeophyllum trabeum...   
. Neofusicoccum parvum UCRNP2..................... 128  5e-31  4 hits  Eukaryota:Ascomycota:Dothideomycetes:Botryosphaeriales: putative tissue alpha-l-fucosidase protei...   
. Phaeodactylum tricornutum CCAP 1055/1........... 127  2e-31  6 hits  Eukaryota:Bacillariophyta:Bacillariophyceae:Naviculales: predicted protein [Phaeodactylum tricornu...   
. Jaapia argillacea MUCL 33604.................... 126  4e-31  1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Jaapiales: glycoside hydrolase family 29 protein [Jaapia ...   
. Rhizoctonia solani 123E......................... 126  3e-30  3 hits  Eukaryota:Basidiomycota:Agaricomycetes:Cantharellales: alpha-L-fucosidase [Rhizoctonia solani 123E]        
. Serpula lacrymans var. lacrymans S7.9........... 125  9e-31  2 hits  Eukaryota:Basidiomycota:Agaricomycetes:Boletales: glycoside hydrolase family 29 protein [Se...   
. Mycosphaerella graminicola IPO323............... 125  2e-30  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: hypothetical protein MYCGRDRAFT_38237 [Zy...   
. Cordyceps militaris CM01........................ 125  2e-30  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-L-fucosidase, putative [Cordyceps m...   
. Moniliophthora roreri MCA 2997.................. 125  9e-30  6 hits  Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: glycoside hydrolase family 29 protein [Mo...   
. Cochliobolus heterostrophus C5.................. 124  6e-30  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: glycoside hydrolase family 29 protein [Bipolar...   
. Macrophomina phaseolina MS6..................... 124  1e-29  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Botryosphaeriales: Glycoside hydrolase family 29 [Macrophomina ph...   
. Rhizoctonia solani AG-3 Rhs1AP.................. 124  2e-29  2 hits  Eukaryota:Basidiomycota:Agaricomycetes:Cantharellales: alpha-L-fucosidase [Rhizoctonia solani AG-3 Rh...   
. Coniophora puteana RWD-64-598 SS2............... 123  2e-29  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Boletales: glycoside hydrolase family 29 protein [Co...   
. Mucor sp. 1006PhL............................... 123  3e-29  2 hits  Eukaryota::Mucorales:                    hypothetical protein HMPREF1544_09198 [Mucor c...   
. Dacryopinax sp. DJM-731 SS1..................... 123  4e-29  2 hits  Eukaryota:Basidiomycota:Dacrymycetes:Dacrymycetales: glycoside hydrolase [Dacryopinax sp. DJM-731 SS1]   
. Guillardia theta CCMP2712....................... 122  4e-29  4 hits  Eukaryota::Cryptophyta:Pyrenomonadales:  hypothetical protein GUITHDRAFT_140413 [G...   
. Bipolaris victoriae FI3......................... 121  7e-29  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: glycoside hydrolase family 29 protein [Bipolar...   
. Agaricus bisporus var. bisporus H97............. 120  9e-29  2 hits  Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: hypothetical protein AGABI2DRAFT_209111 [...   
. Bipolaris oryzae ATCC 44560..................... 120  1e-28  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: glycoside hydrolase family 29 protein [Bi...   
. Metarhizium anisopliae ARSEF 23................. 120  2e-28  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-L-fucosidase, putative [Metarhizium...   
. Mycosphaerella populorum SO2202................. 120  2e-28  3 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: glycoside hydrolase family 29 protein [Sphaeru...   
. Absidia idahoensis var. thermophila............. 120  2e-28  2 hits  Eukaryota::Mucorales:                    hypothetical protein LRAMOSA09407 [Absidia id...   
. Colletotrichum fioriniae PJ7.................... 119  7e-28  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: alpha-L-fucosidase [Colletotrichum fiorin...   
. Aspergillus kawachii IFO 4308................... 119  7e-28  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: alpha-L-fucosidase [Aspergillus kawachii IFO ...   
. Aureobasidium pullulans var. subglaciale EXF-24. 118  1e-27  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: glycoside hydrolase family 29 protein [Aureoba...   
. Colletotrichum higginsianum..................... 117  1e-27  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: alpha-L-fucosidase [Colletotrichum higginsianum]   
. Metarhizium anisopliae.......................... 117  1e-27  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: putative alpha-L-fucosidase [Metarhizium aniso...   
. Colletotrichum orbiculare MAFF 240422........... 117  4e-27  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: glycoside hydrolase family 29 protein [Colleto...   
. Gaeumannomyces graminis var. tritici R3-111a-1.. 117  5e-27  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: tissue alpha-L-fucosidase [Gaeumannomyces gram...   
. Mycosphaerella fijiensis CIRAD86................ 116  6e-27  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: glycoside hydrolase family 29 protein [Ps...   
. Aureobasidium pullulans EXF-150................. 116  7e-27  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: glycoside hydrolase [Aureobasidium pullulans E...   
. Dothistroma septosporum NZE10................... 116  9e-27  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: glycoside hydrolase family 29 protein [Dothist...   
. Fusarium oxysporum f. sp. vasinfectum 25433..... 116  9e-27  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOTG_13459 [Fusarium oxys...   
. Aspergillus niger CBS 513.88.................... 115  2e-26  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: alpha-L-fucosidase [Aspergillus niger CBS...   
. Aureobasidium melanogenum CBS 110374............ 115  2e-26  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: glycoside hydrolase [Aureobasidium melanogenum...   
. Talaromyces stipitatus ATCC 10500............... 115  2e-26  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: alpha-L-fucosidase, putative [Talaromyces...   
. Aureobasidium namibiae CBS 147.97............... 114  2e-26  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: glycoside hydrolase [Aureobasidium pullulans v...   
. Lichtheimia corymbifera JMRC:FSU:9682........... 114  4e-26  1 hit   Eukaryota::Mucorales:                    glycoside hydrolase family 29 protein [Lichth...   
. Fusarium fujikuroi IMI 58289.................... 113  7e-26  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: related to putative alpha-L-fucosidase precur...   
. Leptosphaeria maculans JN3...................... 113  8e-26  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein LEMA_P074490.1 [Lept...   
. Togninia minima UCRPA7.......................... 113  9e-26  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Calosphaeriales: putative tissue alpha-l-fucosidase protei...   
. Grosmannia clavigera kw1407..................... 112  3e-25  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Ophiostomatales: alpha-l-fucosidase [Grosmannia clavigera kw1407]    
. Ophiostoma piceae UAMH 11346.................... 111  4e-25  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Ophiostomatales: alpha-l-fucosidase [Ophiostoma piceae UAMH 11346]   
. Colletotrichum gloeosporioides Cg-14............ 111  5e-25  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: alpha-L-fucosidase [Colletotrichum gloeosporio...   
. Colletotrichum gloeosporioides Nara gc5......... 111  6e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: glycoside hydrolase family 29 protein [Co...   
. Fusarium oxysporum FOSC 3-a..................... 110  6e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOYG_03929 [Fusarium oxys...   
. Fusarium oxysporum Fo47......................... 110  6e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOZG_06226 [Fusarium oxys...   
. Fusarium oxysporum f. sp. lycopersici MN25...... 110  6e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOWG_16245 [Fusarium oxys...   
. Fusarium oxysporum f. sp. radicis-lycopersici 2. 110  6e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOCG_01731 [Fusarium oxys...   
. Colletotrichum sublineola....................... 110  7e-25  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: putative alpha-L-fucosidase [Colletotrichum su...   
. Fusarium oxysporum f. sp. melonis 26406......... 109  1e-24  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOMG_16525 [Fusarium oxys...   
. Colletotrichum graminicola M1.001............... 109  2e-24  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: alpha-L-fucosidase [Colletotrichum graminicola...   
. Fusarium oxysporum.............................. 108  3e-24  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-fucosidase GH29 [Fusarium oxysporum]          
. Fusarium oxysporum Fo5176....................... 108  3e-24  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOXB_05755 [Fusarium oxys...   
. Fusarium oxysporum f. sp. cubense tropical race. 107  5e-24  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOIG_16193 [Fusarium oxys...   
. Schizophyllum commune H4-8...................... 105  4e-23  4 hits  Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: glycoside hydrolase family 29 protein [Sc...   
. Byssochlamys spectabilis No. 5.................. 104  2e-22  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: alpha-L-fucosidase, putative [Byssochlamys sp...   
. Pan troglodytes................................. 100  9e-22  2 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: tissue alpha-L-fucosidase [Pan tr...   
. Meleagris gallopavo............................. 96.3 1e-20  1 hit   Eukaryota:Chordata:Aves:Galliformes:     PREDICTED: plasma alpha-L-fucosidase-like... 
. Stachybotrys chartarum IBT 40288................ 94.0 3e-19  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S40288_08834 [Stachybotry... 
. Stachybotrys chartarum IBT 7711................. 94.0 4e-19  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S7711_05844 [Stachybotrys... 
. Anas platyrhynchos.............................. 92.8 2e-19  3 hits  Eukaryota:Chordata:Aves:Anseriformes:    Plasma alpha-L-fucosidase [Anas platyrhynchos]    
. Tyto alba....................................... 92.4 3e-19  1 hit   Eukaryota:Chordata:Aves:Strigiformes:    Plasma alpha-L-fucosidase [Tyto alba]             
. Pterocles gutturalis............................ 92.4 3e-19  1 hit   Eukaryota:Chordata:Aves:Ciconiiformes:   Plasma alpha-L-fucosidase [Pterocles gutturalis]  
. Physeter catodon................................ 92.4 5e-19  3 hits  Eukaryota:Chordata:Mammalia:Cetacea:     PREDICTED: tissue alpha-L-fucosidase [Phy... 
. Egretta garzetta................................ 92.0 4e-19  2 hits  Eukaryota:Chordata:Aves:Ciconiiformes:   Plasma alpha-L-fucosidase [Egretta garzetta]      
. Cariama cristata................................ 92.0 5e-19  1 hit   Eukaryota:Chordata:Aves:Gruiformes:      Plasma alpha-L-fucosidase [Cariama cristata]      
. Pygoscelis adeliae.............................. 92.0 5e-19  1 hit   Eukaryota:Chordata:Aves:Sphenisciformes: Plasma alpha-L-fucosidase [Pygoscelis adeliae]    
. Leptosomus discolor............................. 92.0 5e-19  1 hit   Eukaryota:Chordata:Aves:Coraciiformes:   Plasma alpha-L-fucosidase [Leptosomus discolor]   
. Columba livia................................... 92.0 5e-19  4 hits  Eukaryota:Chordata:Aves:Columbiformes:   PREDICTED: plasma alpha-L-fucosidase [Col... 
. Caenorhabditis brenneri......................... 92.0 6e-19  1 hit   Eukaryota:Nematoda:Chromadorea:Rhabditida: hypothetical protein CAEBREN_05420 [Caenorhabd... 
. Aptenodytes forsteri............................ 91.7 5e-19  1 hit   Eukaryota:Chordata:Aves:Sphenisciformes: Plasma alpha-L-fucosidase [Aptenodytes forsteri]  
. Corvus brachyrhynchos........................... 91.7 5e-19  4 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Cor... 
. Buceros rhinoceros silvestris................... 91.7 5e-19  2 hits  Eukaryota:Chordata:Aves:Bucerotiformes:  Plasma alpha-L-fucosidase [Buceros rhinoceros ... 
. Gavia stellata.................................. 91.7 5e-19  1 hit   Eukaryota:Chordata:Aves:Gaviiformes:     Plasma alpha-L-fucosidase [Gavia stellata]        
. Balearica pavonina gibbericeps.................. 91.3 7e-19  1 hit   Eukaryota:Chordata:Aves:Gruiformes:      Plasma alpha-L-fucosidase [Balearica pavonina ... 
. Fulmarus glacialis.............................. 91.3 8e-19  1 hit   Eukaryota:Chordata:Aves:Procellariiformes: Plasma alpha-L-fucosidase [Fulmarus glacialis]    
. Phaethon lepturus............................... 90.9 1e-18  1 hit   Eukaryota:Chordata:Aves:Pelecaniformes:  Plasma alpha-L-fucosidase [Phaethon lepturus]     
. Geospiza fortis................................. 90.9 1e-18  2 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Geo... 
. Aspergillus terreus NIH2624..................... 90.9 4e-18  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: conserved hypothetical protein [Aspergill... 
. Chaetura pelagica............................... 90.5 2e-18  1 hit   Eukaryota:Chordata:Aves:Apodiformes:     Plasma alpha-L-fucosidase [Chaetura pelagica]     
. Picoides pubescens.............................. 90.5 2e-18  1 hit   Eukaryota:Chordata:Aves:Piciformes:      Plasma alpha-L-fucosidase [Picoides pubescens]    
. Apaloderma vittatum............................. 90.1 2e-18  1 hit   Eukaryota:Chordata:Aves:Trogoniformes:   Plasma alpha-L-fucosidase [Apaloderma vittatum]   
. Phalacrocorax carbo............................. 90.1 2e-18  1 hit   Eukaryota:Chordata:Aves:Pelecaniformes:  Plasma alpha-L-fucosidase [Phalacrocorax carbo]   
. Opisthocomus hoazin............................. 90.1 2e-18  1 hit   Eukaryota:Chordata:Aves:Opisthocomiformes: Plasma alpha-L-fucosidase [Opisthocomus hoazin]   
. Pelecanus crispus............................... 90.1 2e-18  1 hit   Eukaryota:Chordata:Aves:Pelecaniformes:  Plasma alpha-L-fucosidase [Pelecanus crispus]     
. Podiceps cristatus.............................. 90.1 2e-18  1 hit   Eukaryota:Chordata:Aves:Podicipediformes: Plasma alpha-L-fucosidase [Podiceps cristatus]    
. Haliaeetus albicilla............................ 89.7 3e-18  1 hit   Eukaryota:Chordata:Aves:Falconiformes:   Plasma alpha-L-fucosidase [Haliaeetus albicilla]  
. Phoenicopterus ruber ruber...................... 89.7 3e-18  1 hit   Eukaryota:Chordata:Aves:Phoenicopteriformes: Plasma alpha-L-fucosidase [Phoenicopterus rube... 
. Acanthisitta chloris............................ 89.4 4e-18  2 hits  Eukaryota:Chordata:Aves:Passeriformes:   PREDICTED: plasma alpha-L-fucosidase [Aca... 
. Mesitornis unicolor............................. 89.0 5e-18  2 hits  Eukaryota:Chordata:Aves:Gruiformes:      Plasma alpha-L-fucosidase [Mesitornis unicolor]   
. Tauraco erythrolophus........................... 89.0 6e-18  1 hit   Eukaryota:Chordata:Aves:Musophagiformes: Plasma alpha-L-fucosidase [Tauraco erythrolophus] 
. Rhizoctonia solani AG-8 WAC10335................ 88.6 1e-17  1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Cantharellales: hypothetical protein RSAG8_12764 [Rhizoctonia ... 
. Fusarium pseudograminearum CS3096............... 88.6 3e-17  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FPSE_02401 [Fusarium pseu... 
. Pseudogymnoascus pannorum VKM F-4519 (FW-2642).. 87.8 7e-17  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V501_00636 [Pseudogymnoas... 
. Fusarium oxysporum f. sp. pisi HDV247........... 87.0 9e-17  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-L-fucosidase [Fusarium oxysporum f. sp. ... 
. Fusarium verticillioides 7600................... 87.0 9e-17  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-L-fucosidase [Fusarium verticillioides 7... 
. Fusarium oxysporum f. sp. cubense race 4........ 87.0 1e-16  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: Plasma alpha-L-fucosidase [Fusarium oxysporum ... 
. Fusarium graminearum............................ 86.7 1e-16  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: Chain A, Crystal Structure Of Gh29 Family Alpha-l-... 
. Fusarium graminearum PH-1....................... 86.7 1e-16  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FG11254.1 [Fusarium gra... 
. Fusarium oxysporum f. sp. conglutinans race 2 5. 86.7 1e-16  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: alpha-L-fucosidase [Fusarium oxysporum f. sp. ... 
. Fusarium oxysporum f. sp. cubense race 1........ 86.7 1e-16  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: hypothetical protein FOXB_12119 [Fusarium oxys... 
. Merops nubicus.................................. 85.1 1e-16  2 hits  Eukaryota:Chordata:Aves:Coraciiformes:   Plasma alpha-L-fucosidase [Merops nubicus]        
. Eurypyga helias................................. 84.3 3e-16  1 hit   Eukaryota:Chordata:Aves:Gruiformes:      Tissue alpha-L-fucosidase [Eurypyga helias]       
. Camelus ferus................................... 82.8 6e-16  4 hits  Eukaryota:Chordata:Mammalia:             fucosidase, alpha-L- 2, plasma [Camelus ferus]    
. Tarsius syrichta................................ 82.8 9e-16  1 hit   Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: plasma alpha-L-fucosidase [Tar... 
. Emiliania huxleyi CCMP1516...................... 82.4 6e-15  2 hits  Eukaryota::Isochrysidales:               hypothetical protein EMIHUDRAFT_469809 [E... 
. Fukomys damarensis.............................. 79.0 2e-14  1 hit   Eukaryota:Chordata:Mammalia:Rodentia:    Plasma alpha-L-fucosidase [Fukomys damarensis]    
. Caprimulgus carolinensis........................ 77.8 5e-14  2 hits  Eukaryota:Chordata:Aves:Caprimulgiformes: Tissue alpha-L-fucosidase [Caprimulgus carolin... 
. Colius striatus................................. 73.9 1e-12  2 hits  Eukaryota:Chordata:Aves:Coliiformes:     Tissue alpha-L-fucosidase [Colius striatus]       
. Kuraishia capsulata CBS 1993.................... 73.6 2e-12  1 hit   Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: unnamed protein product [Kuraishia capsulata ... 
. Loa loa......................................... 70.1 5e-11  2 hits  Eukaryota:Nematoda:Chromadorea:Spirurida: alpha-L-fucosidase [Loa loa]                 
. Ignisphaera aggregans........................... 151  4e-40  1 hit   Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: alpha-L-fucosidase [Ignisphaera aggregans]     
. Sulfolobus islandicus........................... 128  7e-32  7 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Sulfolobus islandicus HVE10/4................... 127  2e-31  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Sulfolobus islandicus REY15A.................... 127  2e-31  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Sulfolobus islandicus Y.G.57.14................. 125  6e-31  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Sulfolobus islandicus M.14.25................... 125  7e-31  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Sulfolobus...................................... 125  1e-30  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: MULTISPECIES: alpha-L-fucosidase [Sulfolo...   
. Sulfolobus islandicus Y.N.15.51................. 125  1e-30  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: alpha-L-fucosidase [Sulfolobus islandicus]     
. Caldivirga maquilingensis....................... 121  2e-29  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: alpha-L-fucosidase [Caldivirga maquilinge...   
. Halosarcina pallida............................. 147  1e-38  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: alpha-L-fucosidase [Halosarcina pallida]       
. Natrialba asiatica.............................. 124  7e-30  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: alpha-L-fucosidase [Natrialba asiatica]        
. Haloterrigena salina............................ 117  1e-27  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: alpha-L-fucosidase [Haloterrigena salina]      
. Halostagnicola larsenii XH-48................... 115  6e-27  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: hypothetical protein HALLA_01250 [Halostagnico...   
. Halosarcina pallida JCM 14848................... 95.1 6e-20  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: alpha-L-fucosidase [Halosarcina pallida]     
. synthetic construct............................. 129  3e-32  6 hits  ::                                       Fucosidase, alpha-L- 2, plasma [Homo sapiens]       

Erreurs:

Sequence retrieval failure : ref|XP_003780547.1| PREDICTED: LOW QUALITY PROTEIN: tissue al... 143 3e-37 

BLAST

PROTOCOLE:

a)Site : NCBI ; Outil : BLASTp contre nr ; max target sequences _ 10000 pour ORF 3

b)Site : NCBI ; Outil : BLASTp contre swissprot ; max target _ 5000 pour ORF 3


ANALYSE DES RÉSULTATS:


Dans NR, nous avons obtenu très peu d'homologues pour les ORF non retenus (voir analyse des ORFs). De plus les E value sont élevées, c'est pourquoi ils n'ont pas été retenus.


Les tableaux ci dessous synthétisent les résultats obtenus pour l'ORF 3.

__________________________________________________

      |  nombre de  | e-value | e-value | e-value |

      |  résultats  |   min   |   max   |  seuil  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  NR  |    5278     |  5e-60  |   9.8   |  1e-10  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  SP  |     41      |  1e-42  |   8.2   |   5e-8  |

______|_____________|_________|_________|_________|



CATALOGUE DES FONCTIONS, dans NR.

  ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • Alpha-L-fucosidase                                                  |    5e-60    |      6      |

  | • glycoside hydrolase family                                          |    7e-52    |      8.1    |

  | • Carbohydrate binding domain                                         |    3e-22    |    3e-13    |

  | • CoA transferase                                                     |    7e-08    |    7e-08    |

  | • Beta galactosidase                                                  |    1e-07    |    1e-07    |

  | • Facteur de coagulation                                              |    2e-04    |     1.9     |

  |_______________________________________________________________________|_____________|_____________|


CATALOGUE DES FONCTIONS, dans SwissProt

___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • Alpha-L-fucosidase                                                  |    1e-42    |    2e-04    |

  | • Peptide immun d'induction                                           |    0.51     |     0.51    |

  | • Lipoyl Synthase                                                     |      1      |     8.2     |

  | • Proteasome                                                          |     1.8     |     8.2     |

  | • RNA polymérase                                                      |     2.4     |     2.4     |

  | • Geranylgeranyl transferase                                          |     2.4     |     2.4     |

  |_______________________________________________________________________|_____________|_____________|



Dans NR, nous avons récolté plus de 5000 homologues potentiels à notre ORF. Les E value sont très étendues, allant de 5e-60 à 9.8. Les résultats obtenus renforcent l'idée que notre ORF code bien pour une protéine, bien qu'on ne possède qu'une partie de la séquence codante du gène. De plus les fonctions des homologues trouvés sont homogènes, avec une majorité de alpha L fucosidase ou de protéine ayant un domaine "alpha L fucosidase".

Nous avons choisi une E value standard, c'est à dire 1e-10. En effet, nous n'avons pas observé de rupture dans la liste des E value présentées par BLAST. La plupart des fonctions trouvées étaient similaires, et lorsqu'il s'agissait des protéines complètement différentes, leurs E valeur étaient très élevées (de l'ordre de 10-5). On nous a donc conseillé de placer le seuil de E value à 1e-10 afin d'être sur de n'avoir que des homologues (bien qu'il y ait de potentiels homologues au dessus de cette valeur).


Dans SwissProt, , nous avons obtenu 41 homologues potentiels à notre ORF, avec des E valeur tout aussi étendues que dans NR (de 1e-42 à 8.2). Les meilleures E value sont obtenues pour des homologues dont la fonction est aussi alpha L fucosidase, ce qui nous conforte dans notre hypothèse. Nous avons choisi comme E value seuil 5e-8. On observe une rupture des E value entre 6e-34 et 5e-8, mais comme la fonction protéique des homologues reste la même, nous avons décidé d'abaisser le seuil à 5e-8.


On peut voir que les fonctions trouvées par BLAST jusqu'à notre E value seuil sont des Alpha L Fucosidase. Or dans INTERPRO, nous avons retenu un domaine protéique ayant une fonction biologique similaire (Glycoside hydrolase). Avec les resultats d'INTERPRO, BLAST (NR et SwissProt), on peut faire l'hypothèse que notre ORF code pour une protéine de la famille des Glycosides hydrolases et qu'il pourrait s'agir d'une alpha-L-Fucosidase. Ces protéines sont impliquées dans l'hydrolyse des liaisons glycosidiques.


RÉSULTATS BRUTS:

a) ORF 3 contre nr
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|WP_018199881.1|  hypothetical protein [Candidatus Hydrogen...    203   5e-60
ref|WP_026307819.1|  alpha-L-fucosidase [candidate division NK...    203   5e-60
ref|WP_013665054.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]    193   7e-56
ref|WP_027126168.1|  alpha-L-fucosidase [Gelidibacter mesophilus]    191   1e-54
gb|ETN95141.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]          188   6e-54
ref|WP_015267678.1|  alpha-L-fucosidase [Echinicola vietnamensis]    187   1e-53
ref|WP_015808420.1|  alpha-L-fucosidase [Pedobacter heparinus]       186   2e-53
ref|WP_026210216.1|  alpha-L-fucosidase [Flexithrix dorotheae]       186   3e-53
ref|WP_013305118.1|  alpha-L-fucosidase [Maribacter sp. HTCC2170]    187   3e-53
gb|AHW59243.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]     185   8e-53
ref|WP_022809464.1|  alpha-L-fucosidase [candidate division OP...    185   9e-53
ref|WP_021929392.1|  alpha-L-fucosidase [Tannerella sp. CAG:118]     183   3e-52
ref|WP_005776506.1|  glycoside hydrolase family 29 [Bacteroide...    183   7e-52
ref|WP_005819524.1|  alpha-L-fucosidase [Bacteroides fragilis]       183   8e-52
ref|WP_005809014.1|  alpha-L-fucosidase [Bacteroides fragilis]       182   2e-51
ref|WP_018626805.1|  hypothetical protein [Niabella aurantiaca]      181   2e-51
ref|WP_027125459.1|  alpha-L-fucosidase [Gelidibacter mesophilus]    181   4e-51
gb|AEW47938.1|  GHF29 Protein [uncultured bacterium A1_9]            180   4e-51
ref|WP_010992673.1|  alpha-L-fucosidase [Bacteroides fragilis]       177   2e-50
ref|WP_018474602.1|  hypothetical protein [Echinicola pacifica]      178   6e-50
ref|WP_011202535.1|  alpha-L-fucosidase [Bacteroides fragilis]       177   7e-50
ref|WP_026445326.1|  alpha-L-fucosidase [Acidobacteriaceae bac...    177   1e-49
ref|WP_026905094.1|  hypothetical protein [Pedobacter glucosid...    177   2e-49
ref|WP_005681133.1|  alpha-L-fucosidase [Bacteroides caccae]         176   2e-49
gb|KER55696.1|  alpha-L-fucosidase [Bacteroides fragilis]            176   2e-49
gb|KER57639.1|  alpha-L-fucosidase [Bacteroides fragilis]            176   3e-49
gb|KEA53002.1|  alpha-L-fucosidase [Mangrovibacter sp. MFB070]       175   5e-49
gb|EXY66027.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   7e-49
gb|EXY27923.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   8e-49
ref|WP_005816994.1|  alpha-L-fucosidase [Bacteroides fragilis]       174   9e-49
gb|EXZ05958.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   9e-49
gb|EXY18701.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   9e-49
ref|WP_005800595.1|  alpha-L-fucosidase [Bacteroides fragilis]       174   9e-49
gb|EYA48883.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   9e-49
gb|EXZ14505.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   9e-49
gb|EXZ16959.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   9e-49
gb|EXZ73766.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   1e-48
gb|EXZ95028.1|  tissue alpha-L-fucosidase [Bacteroides fragili...    174   1e-48
ref|WP_005786624.1|  alpha-L-fucosidase [Bacteroides fragilis]       174   1e-48
ref|WP_009292011.1|  alpha-L-fucosidase [Bacteroides sp. 2_1_5...    174   1e-48
ref|WP_021987381.1|  uncharacterized protein [Odoribacter sp. ...    173   3e-48
gb|ETN95144.1|  hypothetical protein P278_18990 [Zhouia amylol...    174   5e-48
ref|WP_009126763.1|  alpha-L-fucosidase [Bacteroides fluxus]         172   6e-48
ref|WP_005675841.1|  alpha-L-fucosidase [Bacteroides caccae]         172   6e-48
ref|WP_026625730.1|  alpha-L-fucosidase [Dysgonomonas capnocyt...    172   8e-48
ref|WP_011965606.1|  alpha-L-fucosidase [Bacteroides vulgatus]       172   1e-47
ref|WP_026993792.1|  alpha-L-fucosidase [Flectobacillus major]       170   3e-47
ref|WP_024876829.1|  hypothetical protein [Saccharomonospora s...    170   4e-47
ref|XP_003387211.1|  PREDICTED: alpha-L-fucosidase-like [Amphi...    162   6e-47
ref|WP_015526585.1|  Alpha-L-fucosidase [Ruminococcus sp. SR1/5]     169   6e-47
ref|WP_015028089.1|  alpha-L-fucosidase [Emticicia oligotrophica]    169   6e-47
ref|WP_031161943.1|  hypothetical protein [Streptosporangium r...    169   7e-47
ref|WP_016275691.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...    169   7e-47
ref|WP_004290624.1|  alpha-L-fucosidase [Bacteroides eggerthii]      169   9e-47
ref|WP_004292967.1|  alpha-L-fucosidase [Bacteroides eggerthii]      169   9e-47
ref|WP_020722127.1|  hypothetical protein [Acidobacteriaceae b...    169   9e-47
ref|XP_004364107.1|  alpha-L-fucosidase [Capsaspora owczarzaki...    169   9e-47
ref|WP_021651687.1|  Alpha-L-fucosidase [Blautia sp. KLE 1732]       168   1e-46
gb|EPH53607.1|  hypothetical protein CAOG_08685 [Capsaspora ow...    169   1e-46
ref|WP_012789156.1|  alpha-L-fucosidase [Chitinophaga pinensis]      169   1e-46
ref|WP_018629080.1|  hypothetical protein [Niabella aurantiaca]      169   2e-46
ref|WP_018611292.1|  hypothetical protein [Segetibacter koreen...    169   2e-46
ref|WP_019538256.1|  hypothetical protein [Proteiniphilum acet...    167   3e-46
ref|WP_005936535.1|  hypothetical protein [Bacteroides massili...    168   3e-46
ref|WP_022507566.1|  glycoside hydrolase family 29 [Bacteroide...    168   3e-46
ref|WP_028667441.1|  alpha-L-fucosidase [Runella zeae]               166   6e-46
ref|WP_013991728.1|  alpha-L-fucosidase [Zobellia galactanivor...    167   6e-46
ref|WP_012891085.1|  alpha-L-fucosidase [Streptosporangium ros...    169   7e-46
gb|AIK90517.1|  alpha-L-fucosidase [Haemophilus parasuis]            166   8e-46
ref|WP_021110166.1|  alpha-L-fucosidase family protein [Haemop...    166   8e-46
ref|WP_016528620.1|  alpha-L-fucosidase [Haemophilus parasuis]       166   9e-46
ref|WP_010786406.1|  alpha-L-fucosidase [Haemophilus parasuis]       166   9e-46
ref|WP_021115371.1|  alpha-L-fucosidase, putative [Haemophilus...    166   9e-46
ref|WP_005710939.1|  alpha-L-fucosidase [Haemophilus parasuis]       166   9e-46
ref|WP_021112951.1|  alpha-L-fucosidase family protein [Haemop...    166   9e-46
gb|EFA85298.1|  hypothetical protein PPL_02299 [Polysphondyliu...    166   1e-45
ref|WP_021939498.1|  alpha-L-fucosidase [Bacteroides eggerthii...    166   1e-45
ref|WP_009004853.1|  alpha-L-fucosidase [Clostridium sp. D5]         166   1e-45
ref|WP_026464224.1|  alpha-L-fucosidase [Adhaeribacter aquaticus]    166   2e-45
ref|WP_012375788.1|  alpha-L-fucosidase [Opitutus terrae]            166   2e-45
ref|WP_008193678.1|  alpha-L-fucosidase [Thermotoga sp. EMP]         164   3e-45
dbj|BAM18173.1|  alpha-L-fucosidase [Papilio xuthus]                 165   4e-45
gb|KDB47671.1|  alpha-L-fucosidase [Haemophilus parasuis HPS10]      164   5e-45
ref|WP_009284440.1|  alpha-L-fucosidase [Fibrisoma limi]             164   8e-45
ref|WP_011688740.1|  alpha-L-fucosidase [Candidatus Solibacter...    164   1e-44
ref|WP_010865090.1|  alpha-L-fucosidase [Thermotoga maritima]        163   1e-44
ref|WP_012310645.1|  alpha-L-fucosidase [Thermotoga sp. RQ2]         162   2e-44
pdb|2ZWY|A  Chain A, Alpha-L-Fucosidase [Thermotoga maritima]        163   2e-44
gb|EHJ63664.1|  hypothetical protein KGM_17236 [Danaus plexippus]    159   2e-44
pdb|2WSP|A  Chain A, Thermotoga Maritima Alpha-L-Fucosynthase,...    162   2e-44
pdb|1HL8|A  Chain A, Crystal Structure Of Thermotoga Maritima ...    162   2e-44
ref|WP_004083032.1|  alpha-L-fucosidase [Thermotoga maritima]        162   2e-44
ref|WP_022188801.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...    162   3e-44
ref|WP_007276704.1|  mucin-desulfating sulfatase (N-acetylgluc...    166   5e-44
ref|WP_027297001.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...    161   6e-44
ref|WP_006250179.1|  alpha-L-fucosidase [Mannheimia haemolytica]     161   6e-44
ref|WP_011943223.1|  alpha-L-fucosidase [Thermotoga petrophila]      161   6e-44
ref|WP_006251492.1|  alpha-L-fucosidase [Mannheimia haemolytica]     161   7e-44
ref|WP_014175294.1|  alpha-L-fucosidase [Streptomyces bingchen...    161   1e-43
ref|WP_019164959.1|  hypothetical protein [Staphylococcus delp...    160   2e-43
ref|WP_008680180.1|  Plasma alpha-L-fucosidase [Rhodopirellula...    160   2e-43
ref|XP_971568.1|  PREDICTED: alpha-L-fucosidase-like [Triboliu...    159   3e-43
ref|WP_028522153.1|  alpha-L-fucosidase [Runella limosa]             159   3e-43
ref|WP_009103790.1|  fucosidase, alpha-L- 2, plasma [Rhodopire...    160   3e-43
ref|WP_020867451.1|  hypothetical protein [Streptomyces rapamy...    159   3e-43
ref|WP_019167208.1|  hypothetical protein [Staphylococcus inte...    159   4e-43
gb|EFA80507.1|  hypothetical protein PPL_07343 [Polysphondyliu...    159   5e-43
ref|WP_016297117.1|  hypothetical protein [Lachnospiraceae bac...    158   6e-43
ref|WP_027769746.1|  alpha-L-fucosidase [Streptomyces sp. CNQ329]    161   7e-43
ref|WP_013408421.1|  alpha-L-fucosidase [Leadbetterella byssop...    158   8e-43
ref|WP_016431122.1|  hypothetical protein [Streptomyces sp. HG...    161   8e-43
ref|XP_004923234.1|  PREDICTED: putative alpha-L-fucosidase-li...    159   8e-43
gb|AHF15303.1|  alpha-L-fucosidase [Niabella soli DSM 19437]         158   1e-42
gb|ELT92399.1|  hypothetical protein CAPTEDRAFT_177977 [Capite...    158   1e-42
ref|WP_006374423.1|  Tat pathway signal sequence domain protei...    158   1e-42
gb|KFM70007.1|  Alpha-L-fucosidase [Stegodyphus mimosarum]           157   1e-42
ref|WP_015331348.1|  alpha-L-fucosidase [Fibrella aestuarina]        158   1e-42
ref|XP_003289137.1|  hypothetical protein DICPUDRAFT_88361 [Di...    157   2e-42
ref|WP_027757310.1|  alpha-L-fucosidase [Streptomyces sp. CNH099]    160   2e-42
ref|XP_796773.3|  PREDICTED: alpha-L-fucosidase-like [Strongyl...    157   2e-42
ref|WP_012121056.1|  alpha-L-fucosidase [Roseiflexus castenhol...    157   2e-42
ref|XP_002109172.1|  hypothetical protein TRIADDRAFT_37144 [Tr...    157   3e-42
ref|WP_028798794.1|  alpha-L-fucosidase [Streptomyces sp. 142M...    159   4e-42
ref|XP_004350181.1|  alpha-fucosidase [Dictyostelium fascicula...    156   4e-42
ref|WP_027746531.1|  alpha-L-fucosidase [Streptomyces sp. CNT371]    159   5e-42
gb|EKC35757.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        156   5e-42
ref|WP_030930480.1|  alpha-L-fucosidase [Streptomyces violaceo...    156   6e-42
ref|WP_030930590.1|  alpha-L-fucosidase [Streptomyces violaceo...    159   6e-42
gb|AGQ53950.1|  alpha-L-fucoside fucohydrolase [Spodoptera lit...    156   6e-42
gb|AEE63020.1|  unknown [Dendroctonus ponderosae]                    156   6e-42
gb|EFA00167.1|  hypothetical protein TcasGA2_TC002989 [Triboli...    159   6e-42
ref|XP_005108503.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    156   6e-42
ref|WP_030665153.1|  alpha-L-fucosidase [Streptomyces cellulosae]    159   6e-42
ref|XP_003385396.1|  PREDICTED: alpha-L-fucosidase-like [Amphi...    155   7e-42
ref|WP_030663854.1|  alpha-L-fucosidase [Streptomyces cellulosae]    155   9e-42
ref|WP_013927996.1|  alpha-L-fucosidase [Runella slithyformis]       155   1e-41
ref|WP_011957529.1|  alpha-L-fucosidase [Roseiflexus sp. RS-1]       155   1e-41
gb|EFX75639.1|  hypothetical protein DAPPUDRAFT_55824 [Daphnia...    155   1e-41
ref|WP_030349381.1|  alpha-L-fucosidase [Streptomyces scopulir...    158   1e-41
gb|ACO09689.1|  Plasma alpha-L-fucosidase precursor [Osmerus m...    154   2e-41
ref|WP_004069602.1|  hypothetical protein [Clostridium sp. ASF...    154   2e-41
ref|XP_003747622.1|  PREDICTED: putative alpha-L-fucosidase-li...    155   2e-41
ref|XP_308535.4|  AGAP007285-PA [Anopheles gambiae str. PEST]        155   2e-41
ref|WP_026276966.1|  alpha-L-fucosidase [Streptomyces sp. CNS335]    157   2e-41
gb|AAV84202.1|  alpha-L-fucosidase [Culicoides sonorensis]           150   2e-41
ref|WP_031055515.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    157   2e-41
ref|NP_997905.1|  fucosidase, alpha-L-1, tissue precursor [Dan...    154   2e-41
ref|WP_027767020.1|  alpha-L-fucosidase [Streptomyces sp. CNQ865]    157   2e-41
ref|WP_018836161.1|  hypothetical protein [Streptomyces sp. CN...    157   2e-41
ref|WP_018852451.1|  hypothetical protein [Streptomyces sp. CN...    157   2e-41
gb|ETW23386.1|  alpha-L-fucosidase [Mycobacterium gastri 'Wayne']    155   2e-41
ref|WP_020721893.1|  hypothetical protein [Acidobacteriaceae b...    155   2e-41
ref|WP_019118431.1|  hypothetical protein [Anaerococcus obesie...    154   3e-41
ref|WP_019075972.1|  hypothetical protein [Streptomyces sp. R1...    156   3e-41
ref|WP_030978557.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    154   3e-41
gb|AAH66691.1|  Fucosidase, alpha-L- 1, tissue [Danio rerio]         154   4e-41
ref|WP_023545054.1|  hypothetical protein [Streptomyces roseoc...    156   4e-41
ref|WP_013671075.1|  alpha-L-fucosidase [Prevotella denticola]       154   4e-41
ref|WP_008823935.1|  alpha-L-fucosidase [Prevotella histicola]       154   4e-41
emb|CDQ93272.1|  unnamed protein product [Oncorhynchus mykiss]       149   5e-41
ref|XP_008329621.1|  PREDICTED: tissue alpha-L-fucosidase [Cyn...    153   5e-41
ref|WP_007572573.1|  alpha-L-fucosidase [Prevotella multisacch...    153   5e-41
ref|WP_005869667.1|  alpha-L-fucosidase [Actinomyces georgiae]       153   6e-41
ref|WP_019026070.1|  hypothetical protein [Colwellia piezophila]     153   8e-41
ref|WP_020710987.1|  hypothetical protein [Acidobacteriaceae b...    153   9e-41
gb|ENN77167.1|  hypothetical protein YQE_06306 [Dendroctonus p...    155   1e-40
ref|WP_020120520.1|  hypothetical protein [Streptomyces canus]       155   1e-40
ref|NP_001003559.1|  fucosidase, alpha-L-1, tissue precursor [...    152   1e-40
ref|XP_002030121.1|  GM24746 [Drosophila sechellia]                  152   1e-40
ref|NP_648472.1|  alpha-L-fucosidase [Drosophila melanogaster]       152   1e-40
ref|WP_026219842.1|  alpha-L-fucosidase [Streptomyces vitamino...    155   1e-40
ref|WP_025067808.1|  alpha-L-fucosidase [Prevotella denticola]       152   2e-40
ref|XP_001972396.1|  GG13916 [Drosophila erecta]                     152   2e-40
ref|WP_030923620.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    154   2e-40
ref|XP_005181980.1|  PREDICTED: putative alpha-L-fucosidase-li...    152   2e-40
ref|WP_015918877.1|  alpha-L-fucosidase [Thermotoga neapolitana]     151   2e-40
ref|WP_029136391.1|  alpha-L-fucosidase [Saxeibacter lacteus]        154   2e-40
ref|XP_002094427.1|  GE20211 [Drosophila yakuba]                     152   2e-40
ref|WP_030935265.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    154   2e-40
ref|XP_001948582.1|  PREDICTED: alpha-L-fucosidase [Acyrthosip...    151   3e-40
ref|XP_789308.3|  PREDICTED: alpha-L-fucosidase-like [Strongyl...    151   3e-40
ref|XP_002431934.1|  Plasma alpha-L-fucosidase precursor, puta...    151   3e-40
gb|ERL93145.1|  hypothetical protein D910_10444 [Dendroctonus ...    154   3e-40
emb|CCD59834.1|  alpha-l-fucosidase, putative [Schistosoma man...    152   3e-40
ref|WP_013303497.1|  alpha-L-fucosidase [Ignisphaera aggregans]      151   4e-40
ref|WP_023365542.1|  alpha-L-fucosidase [Mycobacterium kansasii]     151   4e-40
gb|KDR21959.1|  Plasma alpha-L-fucosidase [Zootermopsis nevade...    151   5e-40
ref|WP_030973685.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    153   5e-40
ref|WP_021973779.1|  alpha-L-fucosidase Fuc29A [Eubacterium sp...    151   5e-40
gb|ELT94975.1|  hypothetical protein CAPTEDRAFT_146103 [Capite...    150   6e-40
ref|WP_013580594.1|  alpha-L-fucosidase [Granulicella tundricola]    150   6e-40
ref|XP_002076532.1|  GD17581 [Drosophila simulans]                   151   6e-40
ref|WP_029472089.1|  hypothetical protein [Clostridiales bacte...    150   6e-40
ref|XP_005079673.1|  PREDICTED: tissue alpha-L-fucosidase [Mes...    145   7e-40
ref|XP_009058775.1|  hypothetical protein LOTGIDRAFT_217885 [L...    150   7e-40
ref|XP_005946646.1|  PREDICTED: tissue alpha-L-fucosidase-like...    150   7e-40
ref|WP_022939251.1|  hypothetical protein [Clostridiaceae bact...    150   8e-40
gb|EKC33485.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        151   8e-40
ref|WP_025360983.1|  alpha-L-fucosidase [Kutzneria albida]           152   9e-40
ref|WP_030471335.1|  alpha-L-fucosidase [Lechevalieria aerocol...    152   9e-40
gb|AAP05896.1|  similar to alpha-L-fucosidase [Schistosoma jap...    150   1e-39
ref|XP_643017.1|  hypothetical protein DDB_G0276661 [Dictyoste...    149   1e-39
ref|XP_008190884.1|  PREDICTED: alpha-L-fucosidase-like isofor...    149   1e-39
ref|XP_002008828.1|  GI11597 [Drosophila mojavensis]                 150   1e-39
ref|XP_971511.1|  PREDICTED: alpha-L-fucosidase-like isoform X...    149   1e-39
ref|XP_002734463.2|  PREDICTED: alpha-L-fucosidase-like [Sacco...    149   2e-39
ref|XP_002412934.1|  alpha-L-fucosidase, putative [Ixodes scap...    145   2e-39
ref|XP_001603580.1|  PREDICTED: alpha-L-fucosidase-like [Nason...    149   2e-39
gb|EUA10614.1|  putative alpha-L-fucosidase [Mycobacterium kan...    150   2e-39
gb|EGI64547.1|  Plasma alpha-L-fucosidase [Acromyrmex echinatior]    149   2e-39
ref|XP_971622.1|  PREDICTED: alpha-L-fucosidase [Tribolium cas...    149   3e-39
ref|XP_003969018.1|  PREDICTED: tissue alpha-L-fucosidase-like...    149   3e-39
ref|XP_644263.1|  hypothetical protein DDB_G0274391 [Dictyoste...    148   4e-39
ref|XP_395852.4|  PREDICTED: alpha-L-fucosidase [Apis mellifera]     148   4e-39
ref|XP_003704794.1|  PREDICTED: alpha-L-fucosidase-like [Megac...    148   4e-39
ref|XP_005477433.1|  PREDICTED: plasma alpha-L-fucosidase-like...    148   4e-39
ref|XP_001661015.1|  alpha-l-fucosidase [Aedes aegypti]              148   4e-39
ref|XP_006624538.1|  PREDICTED: alpha-L-fucosidase-like [Apis ...    148   4e-39
ref|NP_036694.2|  tissue alpha-L-fucosidase precursor [Rattus ...    148   4e-39
ref|XP_005736753.1|  PREDICTED: plasma alpha-L-fucosidase-like...    148   4e-39
ref|XP_004540123.1|  PREDICTED: plasma alpha-L-fucosidase-like...    148   4e-39
gb|EFX71905.1|  hypothetical protein DAPPUDRAFT_308689 [Daphni...    149   4e-39
sp|P17164.1|FUCO_RAT  RecName: Full=Tissue alpha-L-fucosidase;...    148   5e-39
ref|NP_001083206.1|  fucosidase, alpha-L- 2, plasma precursor ...    148   5e-39
ref|XP_002048580.1|  GJ11276 [Drosophila virilis]                    148   5e-39
ref|XP_008477226.1|  PREDICTED: alpha-L-fucosidase-like [Diaph...    148   6e-39
ref|NP_001015860.1|  tissue alpha-L-fucosidase precursor [Xeno...    148   6e-39
emb|CAJ81688.1|  fucosidase, alpha-L-1, tissue [Xenopus (Silur...    147   6e-39
ref|XP_002124240.1|  PREDICTED: alpha-L-fucosidase-like [Ciona...    148   6e-39
emb|CAG13212.1|  unnamed protein product [Tetraodon nigroviridis]    152   6e-39
ref|XP_003373634.1|  plasma alpha-L-fucosidase [Trichinella sp...    147   7e-39
ref|XP_001956543.1|  GF24545 [Drosophila ananassae]                  148   7e-39
ref|XP_001604815.1|  PREDICTED: alpha-L-fucosidase-like [Nason...    148   7e-39
ref|XP_001641290.1|  predicted protein [Nematostella vectensis]      147   8e-39
ref|NP_001004115.1|  plasma alpha-L-fucosidase precursor [Dani...    147   9e-39
ref|XP_002131484.1|  PREDICTED: alpha-L-fucosidase-like [Ciona...    147   9e-39
ref|XP_005102602.1|  PREDICTED: plasma alpha-L-fucosidase-like...    147   1e-38
ref|WP_008385421.1|  alpha-L-fucosidase [Halosarcina pallida]        147   1e-38
emb|CDQ59634.1|  unnamed protein product [Oncorhynchus mykiss]       147   1e-38
emb|CAF99453.1|  unnamed protein product [Tetraodon nigroviridis]    149   1e-38
ref|XP_008289438.1|  PREDICTED: plasma alpha-L-fucosidase [Ste...    147   1e-38
ref|XP_005946131.1|  PREDICTED: plasma alpha-L-fucosidase-like...    147   1e-38
ref|XP_007910364.1|  PREDICTED: tissue alpha-L-fucosidase [Cal...    147   1e-38
dbj|BAB85519.1|  a-L-fucosidase [Halocynthia roretzi]                147   1e-38
ref|WP_020658784.1|  alpha-L-fucosidase [Amycolatopsis benzoat...    149   1e-38
ref|NP_001279640.1|  fucosidase, alpha-L- 1, tissue precursor ...    147   1e-38
ref|XP_009017886.1|  hypothetical protein HELRODRAFT_79486 [He...    147   2e-38
ref|XP_003799886.1|  PREDICTED: tissue alpha-L-fucosidase [Oto...    147   2e-38
ref|XP_004074295.1|  PREDICTED: tissue alpha-L-fucosidase-like...    146   2e-38
ref|XP_008311033.1|  PREDICTED: plasma alpha-L-fucosidase [Cyn...    146   2e-38
gb|ELT96385.1|  hypothetical protein CAPTEDRAFT_184738 [Capite...    147   2e-38
ref|XP_002412933.1|  alpha-L-fucosidase, putative [Ixodes scap...    146   2e-38
ref|WP_020638584.1|  alpha-L-fucosidase [Amycolatopsis balhimy...    149   2e-38
ref|XP_008304020.1|  PREDICTED: tissue alpha-L-fucosidase [Ste...    146   2e-38
ref|XP_007559862.1|  PREDICTED: tissue alpha-L-fucosidase [Poe...    146   2e-38
ref|XP_003978601.1|  PREDICTED: plasma alpha-L-fucosidase-like...    143   3e-38
ref|XP_003356247.1|  PREDICTED: tissue alpha-L-fucosidase [Sus...    146   3e-38
ref|XP_001843371.1|  plasma alpha-L-fucosidase [Culex quinquef...    146   3e-38
gb|EKC34402.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        146   3e-38
gb|AEI59128.2|  fucosidase alpha-L-1 [Sus scrofa]                    146   3e-38
ref|XP_003739537.1|  PREDICTED: alpha-L-fucosidase-like [Metas...    145   3e-38
ref|WP_025697951.1|  hypothetical protein [Paenibacillus forsy...    146   3e-38
ref|WP_026446756.1|  alpha-L-fucosidase [Acidobacteriaceae bac...    146   3e-38
ref|XP_006924500.1|  PREDICTED: tissue alpha-L-fucosidase [Pte...    145   3e-38
ref|XP_001639645.1|  predicted protein [Nematostella vectensis]      145   3e-38
gb|ETN65790.1|  alpha-l-fucosidase [Anopheles darlingi]              146   3e-38
ref|XP_008146316.1|  PREDICTED: tissue alpha-L-fucosidase [Ept...    145   3e-38
ref|WP_025696066.1|  hypothetical protein [Paenibacillus durus]      146   3e-38
ref|WP_013227052.1|  alpha-L-fucosidase [Amycolatopsis mediter...    148   4e-38
gb|EKC34401.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        145   4e-38
gb|AAH74217.1|  Unknown (protein for MGC:83395) [Xenopus laevis]     145   4e-38
ref|XP_005318126.1|  PREDICTED: tissue alpha-L-fucosidase [Ict...    145   4e-38
ref|XP_003379139.1|  plasma alpha-L-fucosidase [Trichinella sp...    143   4e-38
ref|XP_006631396.1|  PREDICTED: tissue alpha-L-fucosidase-like...    145   4e-38
ref|NP_001011291.1|  plasma alpha-L-fucosidase precursor [Xeno...    145   4e-38
ref|XP_003695324.1|  PREDICTED: alpha-L-fucosidase-like [Apis ...    145   5e-38
gb|KFD56951.1|  hypothetical protein M513_02208 [Trichuris suis]     145   5e-38
ref|XP_004519134.1|  PREDICTED: putative alpha-L-fucosidase-li...    145   5e-38
ref|XP_004547845.1|  PREDICTED: tissue alpha-L-fucosidase-like...    145   6e-38
ref|XP_001984749.1|  GH16641 [Drosophila grimshawi]                  145   6e-38
ref|XP_006798734.1|  PREDICTED: plasma alpha-L-fucosidase-like...    145   6e-38
gb|KFI54157.1|  alpha-L-fucosidase [Bifidobacterium callitrich...    145   6e-38
ref|WP_020528867.1|  hypothetical protein [Flexithrix dorotheae]     145   7e-38
ref|XP_006094116.1|  PREDICTED: tissue alpha-L-fucosidase [Myo...    145   7e-38
ref|XP_002135114.1|  GA23876 [Drosophila pseudoobscura pseudoo...    145   7e-38
ref|XP_009049991.1|  hypothetical protein LOTGIDRAFT_113506 [L...    144   8e-38
gb|AAH42266.1|  Fuca protein [Xenopus laevis]                        145   8e-38
gb|EFX80400.1|  hypothetical protein DAPPUDRAFT_318578 [Daphni...    144   8e-38
gb|EFZ17969.1|  hypothetical protein SINV_07990 [Solenopsis in...    148   8e-38
ref|XP_005097744.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    144   8e-38
ref|XP_006795239.1|  PREDICTED: tissue alpha-L-fucosidase-like...    144   8e-38
ref|XP_003492575.1|  PREDICTED: alpha-L-fucosidase-like [Bombu...    145   9e-38
ref|XP_007252067.1|  PREDICTED: plasma alpha-L-fucosidase-like...    144   9e-38
ref|XP_001104941.2|  PREDICTED: tissue alpha-L-fucosidase [Mac...    144   9e-38
ref|XP_006078020.1|  PREDICTED: tissue alpha-L-fucosidase [Bub...    144   1e-37
ref|XP_007522658.1|  PREDICTED: tissue alpha-L-fucosidase [Eri...    144   1e-37
ref|XP_004212699.1|  PREDICTED: plasma alpha-L-fucosidase-like...    137   1e-37
gb|EHH49648.1|  hypothetical protein EGM_00346 [Macaca fascicu...    144   1e-37
ref|XP_002061760.1|  GK17022 [Drosophila willistoni]                 144   1e-37
ref|XP_003891371.1|  PREDICTED: tissue alpha-L-fucosidase [Pap...    144   1e-37
ref|XP_002008829.1|  GI11596 [Drosophila mojavensis]                 147   1e-37
dbj|BAE88708.1|  unnamed protein product [Macaca fascicularis]       144   1e-37
gb|EHH14448.1|  hypothetical protein EGK_00375 [Macaca mulatta]      144   1e-37
ref|XP_007561889.1|  PREDICTED: plasma alpha-L-fucosidase [Poe...    144   1e-37
ref|XP_005905220.1|  PREDICTED: tissue alpha-L-fucosidase [Bos...    144   2e-37
ref|XP_005544511.1|  PREDICTED: tissue alpha-L-fucosidase [Mac...    144   2e-37
ref|XP_003935048.1|  PREDICTED: tissue alpha-L-fucosidase [Sai...    143   2e-37
gb|AAI33213.1|  LOC432087 protein [Xenopus laevis]                   144   2e-37
gb|AAH70977.1|  LOC432087 protein [Xenopus laevis]                   144   2e-37
gb|AAH98979.1|  LOC432087 protein [Xenopus laevis]                   144   2e-37
ref|NP_001039500.1|  tissue alpha-L-fucosidase precursor [Bos ...    144   2e-37
ref|XP_007979379.1|  PREDICTED: tissue alpha-L-fucosidase [Chl...    144   2e-37
ref|XP_003448972.2|  PREDICTED: tissue alpha-L-fucosidase-like...    144   2e-37
gb|ELR49445.1|  Tissue alpha-L-fucosidase [Bos mutus]                144   2e-37
ref|XP_002750469.1|  PREDICTED: tissue alpha-L-fucosidase [Cal...    144   2e-37
gb|EFN72603.1|  Plasma alpha-L-fucosidase [Camponotus floridanus]    143   2e-37
ref|XP_001628122.1|  predicted protein [Nematostella vectensis]      144   2e-37
gb|EZA56254.1|  Alpha-L-fucosidase [Cerapachys biroi]                144   2e-37
ref|XP_005799280.1|  PREDICTED: plasma alpha-L-fucosidase-like...    144   2e-37
ref|XP_008571302.1|  PREDICTED: tissue alpha-L-fucosidase [Gal...    144   2e-37
gb|AAI08745.1|  LOC432087 protein [Xenopus laevis]                   144   2e-37
ref|XP_006883722.1|  PREDICTED: tissue alpha-L-fucosidase [Ele...    144   2e-37
ref|XP_008397246.1|  PREDICTED: plasma alpha-L-fucosidase [Poe...    143   2e-37
dbj|BAE41842.1|  unnamed protein product [Mus musculus]              143   2e-37
gb|EWM15950.1|  alpha-L-fucosidase [Kutzneria sp. 744]               145   3e-37
dbj|BAC41012.1|  unnamed protein product [Mus musculus]              143   3e-37
dbj|BAB21949.1|  unnamed protein product [Mus musculus]              143   3e-37
ref|XP_007933909.1|  PREDICTED: tissue alpha-L-fucosidase [Ory...    143   3e-37
gb|EDL29964.1|  fucosidase, alpha-L- 1, tissue [Mus musculus]        143   3e-37
ref|XP_006159439.1|  PREDICTED: tissue alpha-L-fucosidase [Tup...    143   3e-37
ref|XP_003780547.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...    143   3e-37
ref|NP_077205.3|  tissue alpha-L-fucosidase precursor [Mus mus...    143   3e-37
ref|XP_005875271.1|  PREDICTED: tissue alpha-L-fucosidase isof...    143   3e-37
gb|ERE82299.1|  tissue alpha-L-fucosidase [Cricetulus griseus]       142   3e-37
ref|NP_510020.2|  Protein W03G11.3 [Caenorhabditis elegans]          143   3e-37
ref|XP_005353090.1|  PREDICTED: tissue alpha-L-fucosidase [Mic...    143   4e-37
ref|XP_006822320.1|  PREDICTED: alpha-L-fucosidase-like [Sacco...    144   4e-37
ref|XP_009044265.1|  hypothetical protein LOTGIDRAFT_109263 [L...    143   4e-37
gb|ERE82298.1|  tissue alpha-L-fucosidase [Cricetulus griseus]       142   4e-37
ref|WP_014433074.1|  alpha-L-fucosidase [Caldilinea aerophila]       143   4e-37
ref|XP_004024944.1|  PREDICTED: tissue alpha-L-fucosidase [Gor...    143   4e-37
ref|XP_002716069.1|  PREDICTED: tissue alpha-L-fucosidase [Ory...    142   4e-37
gb|AAA52481.1|  alpha-L-fucosidase [Homo sapiens]                    142   4e-37
ref|XP_003810810.1|  PREDICTED: tissue alpha-L-fucosidase [Pan...    142   4e-37
dbj|BAG37210.1|  unnamed protein product [Homo sapiens]              142   5e-37
ref|NP_000138.2|  tissue alpha-L-fucosidase precursor [Homo sa...    142   5e-37
gb|AAA35519.1|  alpha-L-fucosidase precursor (EC 3.2.1.5) [Hom...    142   5e-37
ref|NP_001106897.1|  fucosidase, alpha-L- 1, tissue precursor ...    142   5e-37
ref|XP_003741678.1|  PREDICTED: uncharacterized protein LOC100...    145   5e-37
gb|AAI24840.1|  LOC432087 protein [Xenopus laevis]                   142   5e-37
ref|XP_003504971.1|  PREDICTED: tissue alpha-L-fucosidase [Cri...    142   5e-37
ref|XP_795481.3|  PREDICTED: alpha-L-fucosidase-like isoform 2...    142   5e-37
ref|XP_003415433.1|  PREDICTED: tissue alpha-L-fucosidase [Lox...    142   6e-37
ref|XP_003730635.1|  PREDICTED: alpha-L-fucosidase-like isofor...    142   6e-37
ref|XP_006749822.1|  PREDICTED: tissue alpha-L-fucosidase [Lep...    139   6e-37
ref|XP_005988801.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...    142   7e-37
ref|XP_008550870.1|  PREDICTED: alpha-L-fucosidase [Micropliti...    142   8e-37
ref|XP_009063457.1|  hypothetical protein LOTGIDRAFT_95029 [Lo...    137   9e-37
gb|EKC34412.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        142   9e-37
ref|XP_005150202.1|  PREDICTED: plasma alpha-L-fucosidase [Mel...    142   1e-36
ref|WP_004271650.1|  alpha-L-fucosidase [Azospirillum amazonense]    142   1e-36
emb|CDW53766.1|  alpha L fucosidase [Trichuris trichiura]            141   1e-36
gb|ELU08224.1|  hypothetical protein CAPTEDRAFT_173285 [Capite...    142   1e-36
ref|XP_002913322.1|  PREDICTED: tissue alpha-L-fucosidase-like...    141   1e-36
ref|WP_018597089.1|  hypothetical protein [Blautia producta]         141   1e-36
ref|XP_003271654.1|  PREDICTED: tissue alpha-L-fucosidase [Nom...    141   1e-36
gb|EFB27144.1|  hypothetical protein PANDA_001104 [Ailuropoda ...    141   1e-36
ref|XP_008846826.1|  PREDICTED: tissue alpha-L-fucosidase [Nan...    141   2e-36
emb|CDW55307.1|  plasma alpha l fucosidase [Trichuris trichiura]     141   2e-36
ref|WP_026180807.1|  hypothetical protein [Henriciella marina]       141   2e-36
ref|XP_002195964.1|  PREDICTED: plasma alpha-L-fucosidase [Tae...    141   2e-36
gb|KFP01048.1|  Plasma alpha-L-fucosidase [Calypte anna]             140   2e-36
ref|XP_006196830.1|  PREDICTED: tissue alpha-L-fucosidase [Vic...    141   2e-36
gb|EFN89423.1|  Plasma alpha-L-fucosidase [Harpegnathos saltator]    141   2e-36
gb|EKC34400.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        141   2e-36
ref|XP_007249384.1|  PREDICTED: tissue alpha-L-fucosidase-like...    141   2e-36
gb|EFA86770.1|  alpha-fucosidase [Polysphondylium pallidum PN500]    141   2e-36
ref|XP_008492320.1|  PREDICTED: plasma alpha-L-fucosidase [Cal...    140   2e-36
ref|XP_003989706.1|  PREDICTED: tissue alpha-L-fucosidase [Fel...    141   2e-36
ref|XP_006128849.1|  PREDICTED: plasma alpha-L-fucosidase [Pel...    140   2e-36
ref|WP_004274294.1|  alpha-L-fucosidase [Azospirillum amazonense]    141   2e-36
sp|Q60HF8.1|FUCO_MACFA  RecName: Full=Tissue alpha-L-fucosidas...    140   2e-36
gb|EYC18190.1|  hypothetical protein Y032_0028g1723 [Ancylosto...    141   2e-36
gb|EYC18191.1|  hypothetical protein Y032_0028g1723 [Ancylosto...    141   2e-36
ref|XP_004377318.1|  PREDICTED: tissue alpha-L-fucosidase [Tri...    140   2e-36
ref|XP_005813079.1|  PREDICTED: tissue alpha-L-fucosidase-like...    140   2e-36
ref|XP_009048066.1|  hypothetical protein LOTGIDRAFT_230702 [L...    140   2e-36
gb|KCZ54544.1|  hypothetical protein HY30_09665 [Hyphomonas sp...    140   2e-36
ref|WP_003099295.1|  alpha-L-fucosidase [Amycolatopsis vancore...    143   3e-36
ref|XP_004741245.1|  PREDICTED: tissue alpha-L-fucosidase [Mus...    140   3e-36
ref|XP_005518704.1|  PREDICTED: plasma alpha-L-fucosidase [Pse...    140   3e-36
ref|XP_005102742.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    140   3e-36
emb|CDJ01462.1|  fucosidase, alpha L 1, tissue [Echinococcus m...    140   3e-36
ref|XP_004327069.1|  PREDICTED: tissue alpha-L-fucosidase-like...    134   3e-36
gb|EUB62268.1|  Tissue alpha-L-fucosidase [Echinococcus granul...    140   3e-36
ref|WP_013629486.1|  alpha-fucosidase [Planctomyces brasiliensis]    140   4e-36
sp|C3YWU0.2|FUCO_BRAFL  RecName: Full=Alpha-L-fucosidase; AltN...    140   4e-36
ref|XP_008419740.1|  PREDICTED: tissue alpha-L-fucosidase [Poe...    140   4e-36
ref|XP_001501377.1|  PREDICTED: tissue alpha-L-fucosidase isof...    140   4e-36
ref|WP_018196090.1|  MULTISPECIES: hypothetical protein [Fervi...    140   4e-36
ref|XP_006975745.1|  PREDICTED: tissue alpha-L-fucosidase [Per...    140   4e-36
ref|XP_005607412.1|  PREDICTED: tissue alpha-L-fucosidase isof...    140   4e-36
ref|XP_005230301.1|  PREDICTED: plasma alpha-L-fucosidase [Fal...    140   4e-36
ref|XP_004657382.1|  PREDICTED: tissue alpha-L-fucosidase [Jac...    140   5e-36
ref|XP_004005173.1|  PREDICTED: tissue alpha-L-fucosidase [Ovi...    140   5e-36
ref|XP_419707.3|  PREDICTED: plasma alpha-L-fucosidase [Gallus...    139   5e-36
ref|XP_006862365.1|  PREDICTED: tissue alpha-L-fucosidase [Chr...    139   5e-36
ref|XP_003978804.1|  PREDICTED: tissue alpha-L-fucosidase-like...    139   6e-36
gb|KFW88398.1|  Plasma alpha-L-fucosidase [Manacus vitellinus]       139   6e-36
ref|WP_031239237.1|  alpha-L-fucosidase [Asticcacaulis sp. AC466]    140   6e-36
ref|XP_005100227.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    139   6e-36
gb|KFO71305.1|  Plasma alpha-L-fucosidase [Cuculus canorus]          139   6e-36
gb|ESQ82520.1|  hypothetical protein AEAC466_16780 [Asticcacau...    140   7e-36
ref|XP_009017883.1|  hypothetical protein HELRODRAFT_79628 [He...    139   7e-36
ref|XP_003471179.1|  PREDICTED: tissue alpha-L-fucosidase [Cav...    139   7e-36
ref|XP_008577086.1|  PREDICTED: plasma alpha-L-fucosidase [Gal...    139   7e-36
gb|ENN77429.1|  hypothetical protein YQE_06253 [Dendroctonus p...    139   7e-36
ref|XP_008930621.1|  PREDICTED: plasma alpha-L-fucosidase [Man...    139   8e-36
ref|NP_001003250.1|  tissue alpha-L-fucosidase precursor [Cani...    139   8e-36
ref|XP_004603751.1|  PREDICTED: tissue alpha-L-fucosidase [Sor...    139   8e-36
gb|AEE62189.1|  unknown [Dendroctonus ponderosae]                    139   8e-36
ref|XP_002127716.1|  PREDICTED: plasma alpha-L-fucosidase [Cio...    139   8e-36
ref|WP_029471680.1|  alpha-L-fucosidase [Clostridiales bacteri...    137   9e-36
ref|XP_002164384.2|  PREDICTED: alpha-L-fucosidase-like [Hydra...    139   9e-36
ref|XP_004082109.1|  PREDICTED: plasma alpha-L-fucosidase-like...    139   1e-35
ref|XP_008692830.1|  PREDICTED: tissue alpha-L-fucosidase isof...    139   1e-35
ref|XP_004394814.1|  PREDICTED: tissue alpha-L-fucosidase [Odo...    139   1e-35
ref|WP_022185344.1|  alpha-L-fucosidase [Bacteroides dorei CAG...    139   1e-35
ref|XP_005490311.1|  PREDICTED: plasma alpha-L-fucosidase [Zon...    139   1e-35
ref|WP_009001715.1|  alpha-L-fucosidase [Clostridium sp. D5]         139   1e-35
ref|XP_007056334.1|  PREDICTED: plasma alpha-L-fucosidase [Che...    139   1e-35
ref|WP_009253760.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...    139   1e-35
ref|WP_022498577.1|  alpha-L-fucosidase [Firmicutes bacterium ...    139   1e-35
ref|WP_022367578.1|  alpha-L-fucosidase Fuc29A [Firmicutes bac...    139   1e-35
ref|WP_022236470.1|  alpha-L-fucosidase [Clostridium leptum CA...    139   1e-35
ref|XP_002599322.1|  hypothetical protein BRAFLDRAFT_56888 [Br...    138   1e-35
ref|WP_012394548.1|  alpha-L-fucosidase [Mycobacterium marinum]      139   1e-35
ref|WP_020729094.1|  Alpha-L-fucosidase [Mycobacterium marinum]      139   1e-35
ref|WP_003533212.1|  alpha-L-fucosidase [ [Clostridium leptum]       139   1e-35
ref|WP_003533239.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...    139   1e-35
ref|XP_006643037.1|  PREDICTED: plasma alpha-L-fucosidase-like...    139   1e-35
ref|XP_007422971.1|  PREDICTED: plasma alpha-L-fucosidase [Pyt...    138   2e-35
gb|KFD49568.1|  hypothetical protein M513_09593 [Trichuris suis]     138   2e-35
gb|KFI49480.1|  alpha-L-fucosidase [Bifidobacterium biavatii D...    138   2e-35
ref|XP_005102733.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    138   2e-35
ref|WP_025656275.1|  alpha-L-fucosidase [Clostridiales bacteri...    138   2e-35
ref|WP_026559760.1|  alpha-L-fucosidase [Bacillus sp. J37]           138   2e-35
ref|WP_009077632.1|  hypothetical protein [Streptomyces sp. AA4]     138   2e-35
ref|XP_009017882.1|  hypothetical protein HELRODRAFT_79707 [He...    138   2e-35
ref|WP_009004516.1|  alpha-L-fucosidase [Clostridium sp. D5]         138   2e-35
ref|XP_004465460.1|  PREDICTED: tissue alpha-L-fucosidase [Das...    138   2e-35
ref|XP_004679435.1|  PREDICTED: tissue alpha-L-fucosidase [Con...    137   2e-35
ref|WP_005357748.1|  alpha-L-fucosidase [ [Eubacterium siraeum]      138   2e-35
ref|XP_005102731.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    138   2e-35
ref|WP_019662616.1|  alpha-L-fucosidase [ [Eubacterium siraeum]      138   2e-35
ref|XP_008031652.1|  glycoside hydrolase family 29 protein [Se...    139   3e-35
ref|XP_008692831.1|  PREDICTED: tissue alpha-L-fucosidase isof...    137   3e-35
ref|XP_008175371.1|  PREDICTED: plasma alpha-L-fucosidase isof...    137   3e-35
gb|ELK09660.1|  Plasma alpha-L-fucosidase [Pteropus alecto]          137   3e-35
ref|XP_008175374.1|  PREDICTED: plasma alpha-L-fucosidase isof...    137   3e-35
gb|ERG82843.1|  alpha-l-fucosidase [Ascaris suum]                    138   3e-35
sp|P48300.1|FUCO_CANFA  RecName: Full=Tissue alpha-L-fucosidas...    137   3e-35
emb|CAA63197.1|  alpha-L-fucosidase [Canis lupus familiaris]         137   3e-35
ref|XP_003404031.1|  PREDICTED: plasma alpha-L-fucosidase [Lox...    137   3e-35
ref|XP_007249383.1|  PREDICTED: tissue alpha-L-fucosidase-like...    137   3e-35
ref|WP_009079780.1|  predicted protein [Streptomyces sp. AA4]        138   4e-35
ref|XP_004895704.1|  PREDICTED: plasma alpha-L-fucosidase isof...    137   4e-35
ref|XP_006915419.1|  PREDICTED: plasma alpha-L-fucosidase [Pte...    137   4e-35
ref|WP_030891044.1|  hypothetical protein [Streptomyces varsov...    137   4e-35
ref|XP_007459231.1|  PREDICTED: tissue alpha-L-fucosidase [Lip...    137   4e-35
emb|CAP34201.2|  Protein CBG16208 [Caenorhabditis briggsae]          137   5e-35
emb|CDS28430.1|  fucosidase, alpha L 1, tissue [Hymenolepis mi...    137   5e-35
ref|WP_026442554.1|  alpha-L-fucosidase [Acidobacterium sp. PM...    137   5e-35
emb|CDO59692.1|  Alpha-L-fucosidase|GH29 [bacterium Ec32]            137   5e-35
ref|XP_006024310.1|  PREDICTED: plasma alpha-L-fucosidase-like...    134   5e-35
ref|XP_005043944.1|  PREDICTED: plasma alpha-L-fucosidase [Fic...    137   6e-35
ref|XP_005955877.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...    137   6e-35
ref|WP_013042272.1|  alpha-L-fucosidase [Coraliomargarita akaj...    138   6e-35
ref|XP_003227615.1|  PREDICTED: tissue alpha-L-fucosidase [Ano...    137   6e-35
emb|CBY19609.1|  unnamed protein product [Oikopleura dioica]         139   7e-35
ref|WP_008682219.1|  Glycoside hydrolase, family 29, subgroup ...    137   7e-35
gb|KCZ54542.1|  hypothetical protein HY30_09655 [Hyphomonas sp...    137   7e-35
ref|XP_003341064.1|  PREDICTED: tissue alpha-L-fucosidase-like...    136   8e-35
ref|XP_006755473.1|  PREDICTED: plasma alpha-L-fucosidase [Myo...    137   8e-35
ref|XP_006084558.1|  PREDICTED: LOW QUALITY PROTEIN: plasma al...    136   8e-35
ref|XP_005102743.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    136   9e-35
ref|XP_007491360.1|  PREDICTED: tissue alpha-L-fucosidase isof...    135   9e-35
ref|WP_026459668.1|  alpha-L-fucosidase [Actinomyces suimastit...    136   9e-35
ref|WP_006784504.1|  alpha-L-fucosidase [Turicibacter sanguinis]     136   1e-34
ref|WP_018659018.1|  hypothetical protein [Allofustis seminis]       136   1e-34
ref|XP_005394840.1|  PREDICTED: tissue alpha-L-fucosidase [Chi...    136   1e-34
gb|EFB26611.1|  hypothetical protein PANDA_000406 [Ailuropoda ...    136   1e-34
ref|WP_031391167.1|  alpha-L-fucosidase [Clostridium sp. KNHs209]    136   1e-34
ref|WP_009606148.1|  alpha-L-fucosidase [Turicibacter sp. HGF1]      136   1e-34
ref|WP_015390406.1|  alpha-L-fucosidase [Clostridium saccharop...    136   1e-34
ref|XP_007175179.1|  PREDICTED: tissue alpha-L-fucosidase [Bal...    136   1e-34
gb|ETT52619.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H7-689]    136   1e-34
ref|XP_002714822.1|  PREDICTED: plasma alpha-L-fucosidase [Ory...    135   1e-34
ref|WP_007216975.1|  MULTISPECIES: hypothetical protein [Bacte...    138   1e-34
ref|XP_005102732.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    135   2e-34
gb|KCZ82854.1|  alpha-L-fucosidase [Hyphomonas adhaerens MHS-3]      135   2e-34
ref|WP_026636352.1|  alpha-L-fucosidase [Dyella japonica]            136   2e-34
ref|WP_007210742.1|  hypothetical protein [Bacteroides cellulo...    137   2e-34
ref|WP_009358896.1|  alpha-L-fucosidase [Arthrobacter sp. SJCon]     135   2e-34
ref|XP_004425782.1|  PREDICTED: tissue alpha-L-fucosidase [Cer...    135   2e-34
ref|XP_002912693.1|  PREDICTED: plasma alpha-L-fucosidase-like...    136   2e-34
emb|CCA74278.1|  hypothetical protein PIIN_08231 [Piriformospo...    138   2e-34
ref|WP_005591308.1|  alpha-L-fucosidase [Streptococcus cristatus]    135   2e-34
ref|XP_009049999.1|  hypothetical protein LOTGIDRAFT_113714 [L...    135   2e-34
ref|WP_031220410.1|  hypothetical protein [Asticcacaulis benev...    135   2e-34
ref|XP_008138501.1|  PREDICTED: plasma alpha-L-fucosidase [Ept...    135   2e-34
ref|WP_015526584.1|  Alpha-L-fucosidase [Ruminococcus sp. SR1/5]     135   2e-34
ref|WP_026172862.1|  alpha-L-fucosidase [Asticcacaulis beneves...    135   2e-34
gb|ESQ92646.1|  hypothetical protein ABENE_07450 [Asticcacauli...    135   2e-34
ref|WP_021651688.1|  Alpha-L-fucosidase [Blautia sp. KLE 1732]       135   2e-34
ref|XP_004637789.1|  PREDICTED: tissue alpha-L-fucosidase [Oct...    135   2e-34
ref|XP_006891744.1|  PREDICTED: plasma alpha-L-fucosidase [Ele...    135   2e-34
ref|XP_004628643.1|  PREDICTED: plasma alpha-L-fucosidase [Oct...    135   2e-34
ref|XP_001364085.2|  PREDICTED: tissue alpha-L-fucosidase isof...    135   2e-34
ref|XP_005102744.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    135   2e-34
ref|WP_025491585.1|  alpha-L-fucosidase [Clostridiales bacteri...    135   3e-34
ref|WP_021635299.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...    135   3e-34
ref|WP_017688670.1|  alpha-L-fucosidase [Paenibacillus sp. PAM...    135   3e-34
ref|XP_005334907.1|  PREDICTED: plasma alpha-L-fucosidase [Ict...    135   3e-34
ref|WP_011740798.1|  alpha-L-fucosidase [Mycobacterium ulcerans]     135   3e-34
ref|XP_004369026.1|  PREDICTED: plasma alpha-L-fucosidase [Tri...    135   3e-34
ref|XP_006265800.1|  PREDICTED: plasma alpha-L-fucosidase [All...    135   3e-34
gb|EXY20221.1|  alpha-L-fucosidase family protein [Bacteroides...    135   3e-34
ref|WP_022014743.1|  alpha-L-fucosidase [Clostridium sp. CAG:122]    135   3e-34
ref|WP_024628358.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...    135   3e-34
ref|WP_008700390.1|  Glycoside hydrolase, family 29, subgroup ...    135   3e-34
gb|KCZ48019.1|  hypothetical protein HY2_16180 [Hyphomonas sp....    134   4e-34
ref|XP_004285707.1|  PREDICTED: tissue alpha-L-fucosidase [Orc...    134   4e-34
gb|ELQ42292.1|  alpha-L-fucosidase precursor [Magnaporthe oryz...    137   4e-34
ref|XP_004335685.1|  AlphaL-fucosidase [Acanthamoeba castellan...    134   4e-34
gb|ETE64217.1|  Plasma alpha-L-fucosidase [Ophiophagus hannah]       134   5e-34
ref|WP_008808168.1|  alpha-L-fucosidase [Streptococcus sp. 2_1...    134   5e-34
ref|WP_011999693.1|  alpha-L-fucosidase [Streptococcus gordonii]     134   5e-34
ref|WP_008656428.1|  Glycoside hydrolase, family 29, subgroup ...    134   5e-34
ref|XP_004893880.1|  PREDICTED: tissue alpha-L-fucosidase isof...    133   5e-34
ref|XP_003719101.1|  hypothetical protein MGG_00042 [Magnaport...    135   5e-34
ref|WP_022224807.1|  alpha-L-fucosidase [Clostridium sp. CAG:253]    134   5e-34
gb|EKC26041.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        134   5e-34
ref|XP_005389306.1|  PREDICTED: plasma alpha-L-fucosidase [Chi...    134   6e-34
ref|WP_019911076.1|  alpha-L-fucosidase [Paenibacillus sp. HW567]    134   6e-34
ref|WP_015357825.1|  alpha-L-fucosidase [ [[Clostridium] sterc...    134   6e-34
ref|WP_012916699.1|  alpha-L-fucosidase [Xanthomonas albilineans]    134   6e-34
ref|WP_022518040.1|  alpha-L-fucosidase [Roseburia sp. CAG:100]      134   6e-34
gb|ETW74955.1|  glycoside hydrolase family 29 protein [Heterob...    136   6e-34
ref|XP_004353771.1|  alpha-l-fucosidase family protein [Acanth...    134   6e-34
ref|XP_005058497.1|  PREDICTED: tissue alpha-L-fucosidase [Fic...    134   7e-34
gb|ELQ63927.1|  alpha-L-fucosidase precursor [Magnaporthe oryz...    136   7e-34
ref|WP_022463466.1|  alpha-L-fucosidase [Clostridium sp. CAG:277]    134   7e-34
ref|XP_003465681.1|  PREDICTED: plasma alpha-L-fucosidase [Cav...    134   7e-34
ref|WP_026516996.1|  alpha-L-fucosidase [Butyrivibrio sp. MC2021]    134   8e-34
ref|WP_008672583.1|  Glycoside hydrolase, family 29, subgroup ...    134   8e-34
gb|EFA86643.1|  Alpha-L-fucosidase precursor [Polysphondylium ...    134   8e-34
ref|XP_007345034.1|  glycoside hydrolase [Auricularia delicata...    136   8e-34
ref|WP_010895128.1|  alpha-L-fucosidase [Xylella fastidiosa]         134   8e-34
emb|CAF99451.1|  unnamed protein product [Tetraodon nigroviridis]    133   8e-34
ref|WP_022305208.1|  alpha-L-fucosidase [Roseburia sp. CAG:380]      134   8e-34
ref|XP_008529768.1|  PREDICTED: plasma alpha-L-fucosidase [Equ...    134   8e-34
ref|WP_030444392.1|  alpha-L-fucosidase [Actinocatenispora sera]     136   9e-34
ref|XP_001497270.1|  PREDICTED: plasma alpha-L-fucosidase [Equ...    134   9e-34
ref|WP_012338135.1|  alpha-L-fucosidase [Xylella fastidiosa]         134   9e-34
ref|WP_009099169.1|  Glycoside hydrolase, family 29, subgroup ...    134   9e-34
ref|WP_004085632.1|  alpha-L-fucosidase [Xylella fastidiosa]         134   1e-33
ref|WP_020852144.1|  Alpha-L-fucosidase [Xylella fastidiosa]         134   1e-33
gb|KFR03488.1|  Tissue alpha-L-fucosidase [Nipponia nippon]          133   1e-33
gb|KFA40873.1|  alpha-L-fucosidase [Xylella fastidiosa]              134   1e-33
ref|XP_009050000.1|  hypothetical protein LOTGIDRAFT_231110 [L...    133   1e-33
ref|WP_015253407.1|  alpha-L-fucosidase [Thermobacillus composti]    133   1e-33
ref|XP_004893879.1|  PREDICTED: tissue alpha-L-fucosidase isof...    133   1e-33
gb|EFA86148.1|  alpha-fucosidase [Polysphondylium pallidum PN500]    132   1e-33
ref|WP_020530262.1|  hypothetical protein [Flexithrix dorotheae]     133   2e-33
ref|XP_007430575.1|  PREDICTED: tissue alpha-L-fucosidase [Pyt...    133   2e-33
ref|WP_014712675.1|  alpha-L-fucosidase [Streptococcus parasan...    133   2e-33
gb|ETT37623.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-192]    133   2e-33
ref|XP_003396556.1|  PREDICTED: alpha-L-fucosidase-like [Bombu...    133   2e-33
gb|ETT63589.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R7-277]    133   2e-33
ref|XP_004587404.1|  PREDICTED: plasma alpha-L-fucosidase [Och...    135   2e-33
ref|NP_080075.2|  plasma alpha-L-fucosidase precursor [Mus mus...    132   2e-33
ref|XP_003106719.1|  hypothetical protein CRE_16614 [Caenorhab...    133   2e-33
ref|WP_013904449.1|  alpha-L-fucosidase [Streptococcus parasan...    133   2e-33
dbj|BAB22277.1|  unnamed protein product [Mus musculus]              132   2e-33
ref|WP_023908145.1|  alpha-L-fucosidase [Xylella fastidiosa]         133   2e-33
ref|XP_005302135.1|  PREDICTED: tissue alpha-L-fucosidase isof...    131   2e-33
gb|ELU12539.1|  hypothetical protein CAPTEDRAFT_51219 [Capitel...    125   2e-33
gb|AAH18181.1|  Fuca2 protein [Mus musculus]                         132   2e-33
ref|XP_006161987.1|  PREDICTED: plasma alpha-L-fucosidase [Tup...    133   2e-33
dbj|BAB25809.1|  unnamed protein product [Mus musculus]              132   2e-33
ref|XP_009049874.1|  hypothetical protein LOTGIDRAFT_113617 [L...    132   2e-33
ref|WP_003017002.1|  alpha-L-fucosidase [Streptococcus parasan...    132   2e-33
ref|WP_012548705.1|  alpha-L-fucosidase [Dictyoglomus thermoph...    132   2e-33
ref|XP_002120315.1|  PREDICTED: tissue alpha-L-fucosidase [Cio...    133   2e-33
ref|NP_001004218.1|  plasma alpha-L-fucosidase precursor [Ratt...    132   2e-33
gb|ESQ89685.1|  hypothetical protein ABAC460_12515 [Asticcacau...    132   2e-33
ref|WP_013042273.1|  alpha-L-fucosidase [Coraliomargarita akaj...    133   2e-33
ref|WP_004087476.1|  alpha-L-fucosidase [Xylella fastidiosa]         133   2e-33
ref|XP_008505574.1|  PREDICTED: tissue alpha-L-fucosidase isof...    132   3e-33
ref|WP_031236857.1|  alpha-L-fucosidase [Asticcacaulis sp. AC460]    132   3e-33
ref|WP_006857676.1|  alpha-L-fucosidase [Roseburia intestinalis]     132   3e-33
gb|AHX13284.1|  alpha-L-fucosidase [Dyella jiangningensis]           132   3e-33
ref|WP_023920176.1|  hypothetical protein [Streptococcus paras...    132   3e-33
ref|XP_005100219.1|  PREDICTED: alpha-L-fucosidase-like [Aplys...    132   3e-33
ref|WP_009254840.1|  alpha-L-fucosidase [Lachnospiraceae bacte...    132   3e-33
ref|XP_004609123.1|  PREDICTED: plasma alpha-L-fucosidase [Sor...    132   3e-33
ref|WP_022817276.1|  alpha-L-fucosidase [Candidatus Latescibac...    132   3e-33
ref|WP_009396640.1|  alpha-L-fucosidase [Actinomyces sp. oral ...    132   3e-33
ref|XP_002183372.1|  predicted protein [Phaeodactylum tricornu...    132   3e-33
ref|XP_008505575.1|  PREDICTED: tissue alpha-L-fucosidase isof...    132   4e-33
ref|XP_006834767.1|  PREDICTED: plasma alpha-L-fucosidase [Chr...    132   4e-33
ref|WP_027085508.1|  alpha-L-fucosidase [Cohnella panacarvi]         132   4e-33
ref|XP_008828039.1|  PREDICTED: plasma alpha-L-fucosidase [Nan...    132   4e-33
ref|WP_025482267.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...    132   4e-33
ref|WP_027292818.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...    132   4e-33
ref|WP_015520648.1|  Alpha-L-fucosidase [Roseburia intestinalis]     132   4e-33
ref|WP_015560629.1|  Alpha-L-fucosidase [Roseburia intestinalis]     132   4e-33
ref|WP_029664438.1|  alpha-L-fucosidase [Chitinophagaceae bact...    129   4e-33
ref|XP_005859201.1|  PREDICTED: plasma alpha-L-fucosidase [Myo...    131   4e-33
ref|WP_022446154.1|  putative uncharacterized protein [Faecali...    132   4e-33
ref|XP_003926908.1|  PREDICTED: plasma alpha-L-fucosidase [Sai...    131   5e-33
ref|WP_020787372.1|  Alpha-L-fucosidase [Mycobacterium sp. 012...    132   5e-33
gb|EKC34158.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        135   5e-33
gb|EWG14980.1|  Alpha-L-fucosidase [Xylella fastidiosa Mul-MD]       132   5e-33
gb|EWS78066.1|  alpha-L-fucosidase [Xylella fastidiosa PLS229]       132   5e-33
ref|XP_005302134.1|  PREDICTED: tissue alpha-L-fucosidase isof...    131   5e-33
ref|WP_031469701.1|  alpha-L-fucosidase [Sciscionella sp. SE31]      131   5e-33
ref|XP_004674188.1|  PREDICTED: plasma alpha-L-fucosidase [Con...    133   6e-33
ref|WP_019467184.1|  hypothetical protein [Dyella japonica]          132   6e-33
ref|WP_029488137.1|  alpha-L-fucosidase [Epulopiscium sp. 'N.t...    131   6e-33
ref|XP_005433154.1|  PREDICTED: tissue alpha-L-fucosidase [Fal...    131   7e-33
ref|WP_022024672.1|  alpha-L-fucosidase [Clostridium sp. CAG:75]     131   7e-33
ref|WP_007337557.1|  Glycoside hydrolase, family 29, subgroup ...    131   7e-33
ref|WP_022112829.1|  alpha-L-fucosidase [Roseburia intestinali...    131   7e-33
ref|WP_029488066.1|  alpha-L-fucosidase [Epulopiscium sp. 'N.t...    131   7e-33
ref|WP_007324550.1|  alpha-fucosidase [Rhodopirellula baltica]       131   7e-33
ref|WP_003010830.1|  alpha-L-fucosidase [Streptococcus parasan...    131   8e-33
ref|WP_004288409.1|  hypothetical protein [Bacteroides eggerthii]    131   8e-33
ref|WP_009443598.1|  alpha-L-fucosidase [Streptococcus sp. ora...    131   8e-33
ref|WP_022208634.1|  uncharacterized protein [Bacteroides cell...    131   8e-33
ref|WP_026143637.1|  alpha-L-fucosidase [Xanthomonas sp. SHU308]     131   9e-33
ref|XP_006976734.1|  PREDICTED: plasma alpha-L-fucosidase [Per...    130   9e-33
ref|WP_014433075.1|  alpha-L-fucosidase [Caldilinea aerophila]       130   9e-33
ref|WP_026485935.1|  alpha-L-fucosidase [Caldanaerobius polysa...    130   9e-33
ref|WP_016483270.1|  Alpha-L-fucosidase [Chthonomonas calidiro...    132   1e-32
gb|ETJ04809.1|  Alpha-L-fucosidase [Streptococcus parasanguini...    129   1e-32
ref|XP_003387212.1|  PREDICTED: tissue alpha-L-fucosidase-like...    129   1e-32
gb|EKC22136.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]        130   1e-32
ref|WP_028506922.1|  alpha-L-fucosidase [Ruminococcaceae bacte...    130   1e-32
ref|WP_022454662.1|  uncharacterized protein [Parabacteroides ...    130   1e-32
ref|WP_010134570.1|  alpha-L-fucosidase [Flavobacteriaceae bac...    130   1e-32
ref|WP_010343199.1|  alpha-L-fucosidase [Xanthomonas sacchari]       131   1e-32
ref|WP_005988605.1|  alpha-L-fucosidase [Xanthomonas vesicatoria]    130   1e-32
ref|XP_001640046.1|  predicted protein [Nematostella vectensis]      130   1e-32
ref|XP_005065918.1|  PREDICTED: plasma alpha-L-fucosidase [Mes...    130   1e-32
ref|WP_003009570.1|  alpha-L-fucosidase [Streptococcus parasan...    130   1e-32
ref|WP_007330588.1|  alpha-fucosidase [Rhodopirellula baltica]       130   1e-32
ref|WP_017112165.1|  alpha-L-fucosidase [Xanthomonas campestris]     130   1e-32
ref|WP_015355593.1|  alpha-L-fucosidase [Mycobacterium liflandii]    130   1e-32
ref|WP_019116597.1|  hypothetical protein [Anaerococcus sp. PH9]     130   1e-32
ref|WP_010381189.1|  alpha-L-fucosidase [Xanthomonas campestris]     130   1e-32
ref|XP_002132133.1|  PREDICTED: tissue alpha-L-fucosidase-like...    130   2e-32
ref|WP_026326982.1|  hypothetical protein [Proteiniphilum acet...    130   2e-32
gb|ETT45054.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-237]    130   2e-32
ref|XP_004397085.1|  PREDICTED: plasma alpha-L-fucosidase [Odo...    130   2e-32
ref|XP_007114374.1|  PREDICTED: plasma alpha-L-fucosidase isof...    129   2e-32
ref|XP_005875272.1|  PREDICTED: tissue alpha-L-fucosidase isof...    130   2e-32
ref|WP_011120626.1|  alpha-fucosidase [Rhodopirellula baltica]       131   2e-32
ref|XP_003293570.1|  hypothetical protein DICPUDRAFT_58554 [Di...    129   2e-32
ref|XP_003769565.1|  PREDICTED: plasma alpha-L-fucosidase [Sar...    130   2e-32
ref|WP_016297118.1|  hypothetical protein [Lachnospiraceae bac...    130   2e-32
ref|WP_011038013.1|  alpha-L-fucosidase [Xanthomonas campestris]     130   2e-32
ref|WP_015604242.1|  alpha-L-fucosidase [Streptococcus oligofe...    130   2e-32
ref|XP_003790378.1|  PREDICTED: plasma alpha-L-fucosidase [Oto...    129   2e-32
ref|WP_026235746.1|  alpha-L-fucosidase [Echinicola pacifica]        130   2e-32
ref|WP_014508550.1|  alpha-L-fucosidase [Xanthomonas campestris]     130   2e-32
ref|WP_029628887.1|  alpha-L-fucosidase [Xanthomonas campestris]     130   2e-32
ref|WP_021154244.1|  Alpha-L-fucosidase [Streptococcus sp. HSI...    130   2e-32
ref|XP_003255855.1|  PREDICTED: plasma alpha-L-fucosidase [Nom...    129   2e-32
ref|WP_009591567.1|  alpha-l-fucosidase [Xanthomonas translucens]    127   2e-32
ref|XP_007114373.1|  PREDICTED: plasma alpha-L-fucosidase isof...    129   2e-32
ref|XP_003499978.2|  PREDICTED: plasma alpha-L-fucosidase [Cri...    129   3e-32
ref|XP_003811598.1|  PREDICTED: plasma alpha-L-fucosidase [Pan...    129   3e-32
ref|WP_008615291.1|  alpha-L-fucosidase [Joostella marina]           129   3e-32
gb|AAH03060.1|  Fucosidase, alpha-L- 2, plasma [Homo sapiens]        129   3e-32
gb|EUA88936.1|  putative alpha-L-fucosidase [Mycobacterium ulc...    129   3e-32
ref|XP_004044823.1|  PREDICTED: plasma alpha-L-fucosidase [Gor...    129   3e-32
ref|XP_518777.2|  PREDICTED: plasma alpha-L-fucosidase [Pan tr...    129   3e-32
ref|WP_029426460.1|  hypothetical protein [Bacteroides cellulo...    129   3e-32
ref|WP_007219155.1|  hypothetical protein [Bacteroides cellulo...    129   3e-32
ref|NP_114409.2|  plasma alpha-L-fucosidase precursor [Homo sa...    129   3e-32
ref|WP_007211629.1|  hypothetical protein [Bacteroides cellulo...    129   3e-32
dbj|BAC11633.1|  unnamed protein product [Homo sapiens]              129   3e-32
ref|WP_017910451.1|  alpha-L-fucosidase [Xanthomonas sp. SHU199]     130   3e-32
ref|WP_026367040.1|  hypothetical protein [Bacteroides sp. 14(A)]    129   3e-32
ref|XP_007793801.1|  putative glycoside hydrolase family 29 pr...    130   3e-32
ref|WP_012086706.1|  alpha-L-fucosidase [Kineococcus radiotole...    129   3e-32
ref|WP_007127666.1|  alpha-L-fucosidase [Paenibacillus lactis]       129   3e-32
ref|WP_028405166.1|  alpha-L-fucosidase [Bacillus sp. J13]           129   4e-32
ref|XP_006745253.1|  PREDICTED: plasma alpha-L-fucosidase [Lep...    129   4e-32
ref|WP_022072707.1|  alpha-L-fucosidase Fuc29A [Anaerotruncus ...    129   4e-32
ref|XP_001631407.1|  predicted protein [Nematostella vectensis]      129   4e-32
ref|WP_005143992.1|  alpha-L-fucosidase [Mycobacterium rhodesiae]    129   4e-32
ref|XP_004263802.1|  PREDICTED: plasma alpha-L-fucosidase [Orc...    129   4e-32
ref|XP_004325102.1|  PREDICTED: plasma alpha-L-fucosidase-like...    129   4e-32
ref|WP_009732022.1|  hypothetical protein [Streptococcus sp. F...    129   4e-32
gb|KER84739.1|  alpha-L-fucosidase [Xanthomonas arboricola pv....    129   5e-32
ref|XP_005889150.1|  PREDICTED: plasma alpha-L-fucosidase [Bos...    129   5e-32
ref|NP_001192747.1|  plasma alpha-L-fucosidase precursor [Bos ...    129   5e-32
ref|WP_010368656.1|  alpha-L-fucosidase [Xanthomonas vasicola]       129   5e-32
ref|WP_022366074.1|  alpha-L-fucosidase Fuc29A [Firmicutes bac...    129   5e-32
ref|WP_026489660.1|  alpha-L-fucosidase [Butyrivibrio sp. XBB1...    129   5e-32
ref|WP_002814194.1|  alpha-L-fucosidase [Xanthomonas fragariae]      129   5e-32
gb|ELR61194.1|  Plasma alpha-L-fucosidase [Bos mutus]                128   5e-32
ref|XP_006075254.1|  PREDICTED: plasma alpha-L-fucosidase [Bub...    128   6e-32
ref|XP_008693286.1|  PREDICTED: plasma alpha-L-fucosidase [Urs...    128   6e-32
ref|WP_003781589.1|  alpha-L-fucosidase [Actinomyces naeslundii]     128   6e-32
ref|WP_018666411.1|  hypothetical protein [Bacteroides gallina...    129   6e-32
ref|XP_003898143.1|  PREDICTED: plasma alpha-L-fucosidase [Pap...    128   6e-32
ref|WP_011408209.1|  alpha-L-fucosidase [Xanthomonas oryzae]         129   6e-32
ref|NP_001127152.1|  plasma alpha-L-fucosidase precursor [Pong...    128   6e-32
gb|EHH18640.1|  hypothetical protein EGK_15287 [Macaca mulatta]      128   6e-32
ref|WP_010134038.1|  alpha-L-fucosidase [Flavobacteriaceae bac...    129   6e-32
ref|XP_007484717.1|  PREDICTED: plasma alpha-L-fucosidase [Mon...    128   6e-32
ref|XP_001091161.1|  PREDICTED: plasma alpha-L-fucosidase-like...    128   6e-32
ref|WP_013297196.1|  alpha-L-fucosidase [Thermoanaerobacterium...    128   7e-32
ref|XP_005529870.1|  PREDICTED: tissue alpha-L-fucosidase [Pse...    128   7e-32
ref|WP_012719098.1|  alpha-L-fucosidase [Sulfolobus islandicus]      128   7e-32
ref|WP_011258537.1|  alpha-L-fucosidase [Xanthomonas oryzae]         129   7e-32
ref|WP_015845856.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]    128   7e-32
ref|XP_417835.2|  PREDICTED: tissue alpha-L-fucosidase isoform...    128   7e-32
dbj|GAF63432.1|  alpha-L-fucosidase [Bacillus sp. TS-2]              128   7e-32
ref|WP_004219523.1|  alpha-L-fucosidase [Streptococcus parasan...    128   7e-32
gb|EHH53333.1|  hypothetical protein EGM_13952 [Macaca fascicu...    128   8e-32
ref|XP_004947953.1|  PREDICTED: tissue alpha-L-fucosidase isof...    128   8e-32
ref|WP_025531315.1|  MULTISPECIES: alpha-L-fucosidase [Bacteria]     128   8e-32
ref|WP_012445301.1|  alpha-L-fucosidase [Xanthomonas oryzae]         128   8e-32
gb|KDR85835.1|  hypothetical protein GALMADRAFT_218912 [Galeri...    129   8e-32
ref|WP_014504089.1|  alpha-L-fucosidase [Xanthomonas oryzae]         128   9e-32
ref|XP_002196557.1|  PREDICTED: tissue alpha-L-fucosidase [Tae...    128   9e-32
ref|WP_027703408.1|  alpha-L-fucosidase [Xanthomonas oryzae]         129   9e-32
ref|WP_024743846.1|  alpha-L-fucosidase [Xanthomonas oryzae]         129   9e-32
ref|WP_007984531.1|  alpha-L-fucosidase [Glaciecola chathamensis]    128   9e-32
ref|XP_005552062.1|  PREDICTED: plasma alpha-L-fucosidase isof...    128   9e-32
ref|WP_013754589.1|  alpha-L-fucosidase [Glaciecola sp. 4H-3-7...    128   9e-32
gb|AHX14561.1|  alpha-L-fucosidase [Dyella jiangningensis]           128   9e-32
ref|XP_007840796.1|  hypothetical protein PFICI_14024 [Pestalo...    130   9e-32
ref|WP_024710873.1|  alpha-L-fucosidase [Xanthomonas oryzae]         128   9e-32
ref|XP_004702193.1|  PREDICTED: plasma alpha-L-fucosidase [Ech...    127   9e-32
gb|AIF45976.1|  alpha-L-fucosidase [Dyella japonica A8]              128   1e-31
ref|WP_008305868.1|  alpha-L-fucosidase [Glaciecola agarilytica]     128   1e-31
ref|WP_029233178.1|  alpha-L-fucosidase [Butyrivibrio sp. VCB2...    128   1e-31
gb|EMC78535.1|  Tissue alpha-L-fucosidase [Columba livia]            127   1e-31
ref|XP_005361082.1|  PREDICTED: plasma alpha-L-fucosidase [Mic...    127   1e-31
ref|WP_026034128.1|  alpha-L-fucosidase [Dyella japonica]            128   1e-31
ref|WP_003472208.1|  alpha-L-fucosidase [Xanthomonas translucens]    128   1e-31
ref|XP_002747143.2|  PREDICTED: plasma alpha-L-fucosidase isof...    128   1e-31
ref|WP_017155578.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     128   1e-31
ref|XP_007305958.1|  glycoside hydrolase family 29 protein [St...    130   1e-31
ref|WP_017159305.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     128   1e-31
ref|XP_008993428.1|  PREDICTED: plasma alpha-L-fucosidase isof...    127   1e-31
ref|WP_013551233.1|  alpha-L-fucosidase [Cellulophaga algicola]      127   1e-31
ref|WP_017167782.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     128   1e-31
ref|XP_008993426.1|  PREDICTED: plasma alpha-L-fucosidase isof...    127   1e-31
ref|XP_008993427.1|  PREDICTED: plasma alpha-L-fucosidase isof...    127   1e-31
ref|WP_023904748.1|  alpha-L-fucosidase [Xanthomonas hortorum]       128   1e-31
ref|WP_002603686.1|  hypothetical protein [ [Clostridium hathe...    127   1e-31
ref|XP_004651208.1|  PREDICTED: plasma alpha-L-fucosidase [Jac...    127   1e-31
ref|WP_017161486.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     128   1e-31
ref|XP_007450374.1|  PREDICTED: plasma alpha-L-fucosidase [Lip...    127   1e-31
ref|WP_022351445.1|  alpha-L-fucosidase [Firmicutes bacterium ...    127   1e-31
gb|AAW82325.1|  alpha-fucosidase [synthetic construct]               127   1e-31
ref|XP_008004998.1|  PREDICTED: plasma alpha-L-fucosidase [Chl...    127   2e-31
ref|XP_008993425.1|  PREDICTED: plasma alpha-L-fucosidase isof...    127   2e-31
ref|XP_005513532.1|  PREDICTED: tissue alpha-L-fucosidase [Col...    127   2e-31
ref|XP_004011438.1|  PREDICTED: plasma alpha-L-fucosidase [Ovi...    127   2e-31
ref|XP_004441026.1|  PREDICTED: plasma alpha-L-fucosidase [Cer...    127   2e-31
ref|WP_011709588.1|  alpha-L-fucosidase [Gramella forsetii]          127   2e-31
ref|WP_026504272.1|  alpha-L-fucosidase [Butyrivibrio sp. NC3005]    127   2e-31
ref|WP_026658504.1|  alpha-L-fucosidase [Butyrivibrio sp. AC2005]    127   2e-31
ref|WP_019118416.1|  hypothetical protein [Anaerococcus obesie...    127   2e-31
gb|EKD01086.1|  alpha-L-fucosidase [Trichosporon asahii var. a...    129   2e-31
ref|WP_014513051.1|  alpha-L-fucosidase [Sulfolobus islandicus]      127   2e-31
ref|WP_014514204.1|  alpha-L-fucosidase [Sulfolobus islandicus]      127   2e-31
ref|XP_003969079.1|  PREDICTED: tissue alpha-L-fucosidase-like...    128   2e-31
ref|WP_003481382.1|  alpha-L-fucosidase [Xanthomonas translucens]    127   2e-31
emb|CAF99452.1|  unnamed protein product [Tetraodon nigroviridis]    127   2e-31
ref|WP_029561403.1|  alpha-L-fucosidase [Xanthomonas oryzae]         127   2e-31
ref|WP_031576677.1|  alpha-L-fucosidase [Streptococcus parasan...    127   2e-31
ref|XP_007538465.1|  PREDICTED: plasma alpha-L-fucosidase [Eri...    127   2e-31
ref|XP_007171384.1|  PREDICTED: LOW QUALITY PROTEIN: plasma al...    127   2e-31
ref|WP_013579012.1|  alpha-L-fucosidase [Granulicella tundricola]    127   2e-31
ref|WP_028271768.1|  alpha-L-fucosidase [Arthrobacter sp. UNC3...    127   2e-31
ref|XP_005974993.1|  PREDICTED: plasma alpha-L-fucosidase [Pan...    127   2e-31
ref|WP_012582721.1|  alpha-L-fucosidase [Dictyoglomus turgidum]      127   2e-31
ref|WP_029217576.1|  alpha-L-fucosidase [Xanthomonas oryzae]         127   2e-31
ref|WP_018771362.1|  hypothetical protein [Arthrobacter sp. 16...    127   2e-31
ref|XP_002183425.1|  predicted protein [Phaeodactylum tricornu...    127   2e-31
gb|EJT50107.1|  alpha-L-fucosidase [Trichosporon asahii var. a...    129   3e-31
ref|WP_008572058.1|  alpha-L-fucosidase [Xanthomonas perforans]      127   3e-31
ref|WP_031423701.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     127   3e-31
ref|WP_008615295.1|  alpha-L-fucosidase [Joostella marina]           127   3e-31
ref|WP_005915097.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     127   3e-31
ref|WP_007560978.1|  hypothetical protein [Bacteroides plebeius]     127   3e-31
ref|WP_029819963.1|  alpha-L-fucosidase [Xanthomonas alfalfae]       127   3e-31
ref|WP_022528441.1|  alpha-L-fucosidase [Lactobacillus shenzhe...    125   3e-31
ref|XP_007866397.1|  glycoside hydrolase [Gloeophyllum trabeum...    128   3e-31
ref|WP_014090758.1|  alpha-L-fucosidase [Xanthomonas alfalfae]       127   3e-31
ref|WP_026390300.1|  alpha-L-fucosidase [Acholeplasma axanthum]      126   3e-31
ref|WP_010551942.1|  alpha-L-fucosidase [Brachybacterium parac...    126   3e-31
ref|WP_027470540.1|  alpha-L-fucosidase [Cytophaga fermentans]       126   3e-31
ref|WP_007970192.1|  alpha-L-fucosidase [Xanthomonas fuscans]        127   4e-31
ref|WP_007968000.1|  alpha-L-fucosidase [Xanthomonas fuscans]        127   4e-31
ref|WP_026664383.1|  alpha-L-fucosidase [Butyrivibrio sp. FC2001]    126   4e-31
ref|WP_005931470.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     127   4e-31
ref|WP_026492552.1|  alpha-L-fucosidase [Butyrivibrio sp. XPD2...    126   4e-31
gb|KDQ56343.1|  glycoside hydrolase family 29 protein [Jaapia ...    126   4e-31
ref|WP_005919015.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     126   4e-31
ref|WP_011052017.1|  alpha-L-fucosidase [Xanthomonas citri]          127   4e-31
ref|WP_022558767.1|  alpha-L-fucosidase [Xanthomonas fuscans]        126   4e-31
ref|WP_015463473.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     126   5e-31
gb|EWH08274.1|  alpha-L-fucosidase [Catenovulum agarivorans DS-2]    126   5e-31
ref|WP_022478700.1|  gHF29 protein [Coraliomargarita sp. CAG:312]    127   5e-31
ref|WP_006451445.1|  alpha-L-fucosidase [Xanthomonas gardneri]       126   5e-31
ref|WP_015472472.1|  Alpha-L-fucosidase [Xanthomonas citri]          126   5e-31
ref|WP_025018832.1|  MULTISPECIES: hypothetical protein [Bacte...    127   5e-31
ref|WP_010769627.1|  hypothetical protein [Enterococcus phoeni...    126   5e-31
ref|WP_012876242.1|  alpha-L-fucosidase [Thermobaculum terrenum]     125   5e-31
ref|XP_007585207.1|  putative tissue alpha-l-fucosidase protei...    128   5e-31
ref|XP_001924298.1|  PREDICTED: plasma alpha-L-fucosidase isof...    125   5e-31
ref|XP_007341361.1|  glycoside hydrolase [Auricularia delicata...    127   5e-31
ref|WP_011348222.1|  alpha-L-fucosidase [Xanthomonas euvesicat...    126   5e-31
gb|KER88118.1|  alpha-L-fucosidase [Xanthomonas axonopodis pv....    126   6e-31
ref|WP_024940217.1|  alpha-L-fucosidase [Xanthomonas arboricola]     126   6e-31
ref|WP_012716615.1|  alpha-L-fucosidase [Sulfolobus islandicus]      125   6e-31
gb|KDQ18267.1|  glycoside hydrolase family 29 protein [Botryob...    125   6e-31
ref|WP_013305358.1|  alpha-L-fucosidase [Maribacter sp. HTCC2170]    125   6e-31
dbj|GAE55563.1|  hypothetical protein XPR_2198 [Xanthomonas ar...    126   6e-31
ref|WP_003482433.1|  alpha-L-fucosidase [Xanthomonas citri]          125   7e-31
gb|EWC49210.1|  alpha-L-fucosidase [Xanthomonas axonopodis pv....    125   7e-31
dbj|GAE53068.1|  alpha-L-fucosidase [Xanthomonas arboricola pv...    126   7e-31
ref|WP_012712247.1|  alpha-L-fucosidase [Sulfolobus islandicus]      125   7e-31
ref|WP_016851463.1|  alpha-L-fucosidase [Xanthomonas axonopodis]     126   8e-31
ref|WP_006289016.1|  alpha-L-fucosidase [Parascardovia dentico...    125   8e-31
ref|WP_009094168.1|  Glycoside hydrolase, family 29, subgroup ...    125   8e-31
ref|WP_019913064.1|  hypothetical protein [Paenibacillus sp. H...    125   8e-31
ref|WP_026064671.1|  alpha-L-fucosidase [Xanthomonas arboricola]     125   9e-31
ref|WP_029218695.1|  alpha-L-fucosidase [Xanthomonas cassavae]       125   9e-31
gb|KER87082.1|  alpha-L-fucosidase [Xanthomonas arboricola pv....    125   9e-31
ref|XP_007316622.1|  glycoside hydrolase family 29 protein [Se...    125   9e-31
ref|WP_016730264.1|  alpha-L-fucosidase [Sulfolobus islandicus]      125   1e-30
ref|WP_012714334.1|  MULTISPECIES: alpha-L-fucosidase [Sulfolo...    125   1e-30
ref|WP_012717121.1|  alpha-L-fucosidase [Sulfolobus islandicus]      125   1e-30
ref|WP_008704796.1|  Glycoside hydrolase, family 29, subgroup ...    125   1e-30
gb|ETN83500.1|  Alpha-L-fucosidase [Necator americanus]              124   1e-30
ref|WP_020528359.1|  hypothetical protein [Flexithrix dorotheae]     125   1e-30
ref|WP_029489168.1|  alpha-L-fucosidase [Flavobacteriaceae bac...    125   1e-30
ref|WP_025764442.1|  alpha-L-fucosidase [Dyadobacter sp. Y620-1]     124   2e-30
ref|XP_003853819.1|  hypothetical protein MYCGRDRAFT_38237 [Zy...    125   2e-30
gb|KFI44968.1|  alpha-L-fucosidase [Bifidobacterium bohemicum ...    124   2e-30
ref|WP_022858451.1|  alpha-L-fucosidase [Bifidobacterium pseud...    124   2e-30
ref|WP_013996001.1|  alpha-L-fucosidase [Zobellia galactanivor...    124   2e-30
ref|WP_029589363.1|  alpha-L-fucosidase [Caulobacter sp. JGI 0...    124   2e-30
ref|WP_017446621.1|  hypothetical protein [Gayadomonas joobini...    124   2e-30
ref|WP_011573720.1|  alpha-L-fucosidase [Pseudoalteromonas atl...    124   2e-30
ref|XP_006674583.1|  alpha-L-fucosidase, putative [Cordyceps m...    125   2e-30
ref|WP_018750328.1|  hypothetical protein [Paenibacillus sangu...    124   2e-30
ref|WP_018473522.1|  hypothetical protein [Echinicola pacifica]      124   2e-30
ref|WP_026662220.1|  alpha-L-fucosidase [Butyrivibrio proteocl...    124   2e-30
ref|WP_018173678.1|  hypothetical protein [Microbacterium sp. ...    124   3e-30
ref|WP_006293587.1|  alpha-L-fucosidase [Scardovia inopinata]        124   3e-30
ref|WP_013282357.1|  alpha-L-fucosidase [Butyrivibrio proteocl...    124   3e-30
gb|EFO23610.2|  alpha-L-fucosidase [Loa loa]                         124   3e-30
ref|WP_022898523.1|  alpha-L-fucosidase [Corynebacterium-like ...    123   3e-30
ref|WP_005871378.1|  alpha-L-fucosidase [Actinomyces georgiae]       123   3e-30
gb|EJT97023.1|  glycoside hydrolase [Dacryopinax sp. DJM-731 SS1]    123   3e-30
ref|WP_021614882.1|  Alpha-L-fucosidase [Actinomyces sp. oral ...    123   3e-30
gb|KEP50844.1|  alpha-L-fucosidase [Rhizoctonia solani 123E]         126   3e-30
ref|WP_013994962.1|  alpha-L-fucosidase [Zobellia galactanivor...    124   3e-30
ref|WP_026426916.1|  alpha-L-fucosidase [Actinomyces slackii]        123   3e-30
ref|XP_004789156.1|  PREDICTED: plasma alpha-L-fucosidase [Mus...    124   4e-30
gb|EFG33203.2|  hypothetical protein HMPREF9017_00615 [Parasca...    123   4e-30
ref|WP_011521707.1|  alpha-L-fucosidase [Candidatus Koribacter...    123   4e-30
gb|KFD29571.1|  alpha-L-fucosidase [Sphingobium yanoikuyae]          124   4e-30
ref|WP_009744008.1|  alpha-L-fucosidase [Actinomyces sp. oral ...    123   4e-30
ref|WP_026430217.1|  alpha-L-fucosidase [Actinomyces georgiae]       123   4e-30
gb|EJW79070.1|  alpha-L-fucosidase [Wuchereria bancrofti]            123   5e-30
ref|WP_022277258.1|  putative uncharacterized protein [Bactero...    123   6e-30
ref|WP_005456288.1|  alpha-L-fucosidase [Saccharomonospora cya...    125   6e-30
ref|WP_008140332.1|  hypothetical protein [Bacteroides coproph...    123   6e-30
gb|EMD85496.1|  glycoside hydrolase family 29 protein [Bipolar...    124   6e-30
ref|WP_004208996.1|  hypothetical protein [Sphingobium yanoiku...    123   6e-30
ref|WP_010134258.1|  alpha-L-fucosidase [Flavobacteriaceae bac...    123   6e-30
ref|XP_002183423.1|  predicted protein [Phaeodactylum tricornu...    123   6e-30
ref|WP_006106795.1|  alpha-L-fucosidase [Natrialba asiatica]         124   7e-30
dbj|GAF02719.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...    122   7e-30
ref|WP_010179041.1|  alpha-L-fucosidase [Aquimarina agarilytica]     123   7e-30
emb|CDP90679.1|  Protein Bm6173, isoform b [Brugia malayi]           122   8e-30
ref|WP_019026086.1|  hypothetical protein [Colwellia piezophila]     123   8e-30
ref|XP_007850142.1|  glycoside hydrolase family 29 protein [Mo...    125   9e-30
ref|WP_022262970.1|  alpha-L-fucosidase [Butyrivibrio sp. CAG:...    122   9e-30
emb|CDJ97569.1|  Glycoside hydrolase domain containing protein...    122   9e-30
ref|WP_018189325.1|  hypothetical protein [Leifsonia sp. 109]        122   1e-29
ref|WP_012576844.1|  alpha-L-fucosidase [Bifidobacterium longum]     122   1e-29
ref|WP_020075968.1|  hypothetical protein [Cryocola sp. 340MFS...    122   1e-29
ref|WP_004323363.1|  hypothetical protein [Bacteroides ovatus]       122   1e-29
gb|EKG10781.1|  Glycoside hydrolase family 29 [Macrophomina ph...    124   1e-29
gb|KFI64290.1|  alpha-L-fucosidase [Bifidobacterium kashiwanoh...    122   1e-29
ref|XP_007332480.1|  hypothetical protein AGABI1DRAFT_77963 [A...    123   1e-29
ref|WP_012576690.1|  alpha-L-fucosidase [Bifidobacterium longum]     122   1e-29
gb|EKG11455.1|  Glycoside hydrolase family 29 [Macrophomina ph...    124   1e-29
dbj|BAC04002.1|  unnamed protein product [Homo sapiens]              122   1e-29
gb|KCZ50803.1|  hypothetical protein HY29_18495 [Hyphomonas sp...    117   1e-29
dbj|GAK54524.1|  alpha-L-fucosidase [bacterium UASB14]               122   1e-29
gb|EUC64021.1|  alpha-L-fucosidase [Rhizoctonia solani AG-3 Rh...    124   2e-29
ref|WP_012185456.1|  alpha-L-fucosidase [Caldivirga maquilinge...    121   2e-29
ref|WP_028038679.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...    122   2e-29
ref|XP_007584703.1|  putative glycoside hydrolase family 29 pr...    124   2e-29
ref|WP_009059214.1|  alpha-L-fucosidase [Atopobium sp. ICM58]        121   2e-29
ref|XP_007704547.1|  glycoside hydrolase family 29 protein [Bi...    122   2e-29
ref|XP_007773688.1|  glycoside hydrolase family 29 protein [Co...    123   2e-29
gb|KEY28221.1|  alpha-L-fucosidase [Bifidobacterium longum sub...    120   2e-29
gb|KCZ50802.1|  hypothetical protein HY29_18500 [Hyphomonas sp...    116   2e-29
ref|WP_025156096.1|  alpha-L-fucosidase [Leifsonia aquatica]         121   2e-29
ref|WP_021611918.1|  Alpha-L-fucosidase [Actinomyces sp. oral ...    121   2e-29
ref|WP_003793381.1|  hypothetical protein [Actinomyces odontol...    121   3e-29
gb|EPB84067.1|  hypothetical protein HMPREF1544_09198 [Mucor c...    123   3e-29
ref|WP_008674591.1|  Glycoside hydrolase, family 29, subgroup ...    121   3e-29
ref|WP_016608389.1|  Alpha-L-fucosidase [Enterococcus casselif...    120   3e-29
ref|WP_013993565.1|  alpha-L-fucosidase [Zobellia galactanivor...    120   3e-29
ref|WP_005228463.1|  alpha-L-fucosidase [Enterococcus casselif...    120   4e-29
ref|XP_003032407.1|  glycoside hydrolase family 29 protein [Sc...    120   4e-29
gb|EJT97025.1|  glycoside hydrolase [Dacryopinax sp. DJM-731 SS1]    123   4e-29
ref|WP_022757364.1|  alpha-L-fucosidase [Butyrivibrio fibrisol...    120   4e-29
ref|XP_006179227.1|  PREDICTED: tissue alpha-L-fucosidase [Cam...    120   4e-29
ref|WP_027204324.1|  alpha-L-fucosidase [Butyrivibrio fibrisol...    120   4e-29
ref|WP_027217263.1|  alpha-L-fucosidase [Butyrivibrio fibrisol...    120   4e-29
ref|XP_005830650.1|  hypothetical protein GUITHDRAFT_140413 [G...    122   4e-29
ref|WP_022755338.1|  alpha-L-fucosidase [Butyrivibrio fibrisol...    120   4e-29
ref|WP_027206823.1|  alpha-L-fucosidase [Butyrivibrio fibrisol...    120   4e-29
ref|XP_004452087.1|  PREDICTED: LOW QUALITY PROTEIN: plasma al...    120   5e-29
ref|WP_018143281.1|  hypothetical protein [Metascardovia criceti]    120   5e-29
ref|XP_002116225.1|  hypothetical protein TRIADDRAFT_30613 [Tr...    120   6e-29
gb|KEP54373.1|  alpha-L-fucosidase [Rhizoctonia solani 123E]         122   6e-29
ref|XP_007773587.1|  glycoside hydrolase family 29 protein [Co...    121   6e-29
ref|WP_020075688.1|  hypothetical protein [Cryocola sp. 340MFS...    120   6e-29
ref|WP_022868988.1|  alpha-L-fucosidase [Actinomyces vaccimaxi...    119   7e-29
gb|EUN20714.1|  glycoside hydrolase family 29 protein [Bipolar...    121   7e-29
ref|XP_006464064.1|  hypothetical protein AGABI2DRAFT_209111 [...    120   9e-29
ref|WP_007278954.1|  alpha-L-fucosidase [Lentisphaera araneosa]      121   1e-28
ref|XP_002154947.2|  PREDICTED: tissue alpha-L-fucosidase-like...    119   1e-28
ref|WP_017446793.1|  hypothetical protein [Gayadomonas joobini...    119   1e-28
ref|WP_011645413.1|  putative alpha-L-fucosidase [Hyphomonas n...    119   1e-28
ref|WP_007634075.1|  alpha-L-fucosidase [Dietzia cinnamea]           119   1e-28
ref|WP_022142082.1|  alpha-L-fucosidase [Clostridium sp. CAG:230]    119   1e-28
ref|XP_007693698.1|  glycoside hydrolase family 29 protein [Bi...    120   1e-28
ref|WP_027471346.1|  alpha-L-fucosidase [Cytophaga fermentans]       119   1e-28
ref|XP_006268059.1|  PREDICTED: tissue alpha-L-fucosidase [All...    119   1e-28
ref|WP_031523303.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    119   2e-28
ref|XP_007819889.1|  alpha-L-fucosidase, putative [Metarhizium...    120   2e-28
ref|WP_008689110.1|  Glycoside hydrolase, family 29, subgroup ...    119   2e-28
gb|KFI84338.1|  alpha-L-fucosidase [Bifidobacterium psychraero...    119   2e-28
gb|EMF13154.1|  glycoside hydrolase family 29 protein [Sphaeru...    120   2e-28
ref|WP_008613875.1|  alpha-L-fucosidase [Joostella marina]           119   2e-28
ref|WP_017823478.1|  hypothetical protein [Brachybacterium muris]    119   2e-28
ref|XP_001898902.1|  Alpha-L-fucosidase family protein [Brugia...    119   2e-28
gb|EWC96976.1|  alpha-L-fucosidase [Actinomyces sp. ICM54]           118   2e-28
gb|KCZ98110.1|  putative alpha-L-fucosidase [Hyphomonas polymo...    118   2e-28
ref|WP_013994896.1|  alpha-L-fucosidase [Zobellia galactanivor...    119   2e-28
ref|WP_003794161.1|  putative alpha-L-fucosidase [Actinomyces ...    118   2e-28
gb|EWH08962.1|  alpha-L-fucosidase [Catenovulum agarivorans DS-2]    119   2e-28
emb|CDS06883.1|  hypothetical protein LRAMOSA09407 [Absidia id...    120   2e-28
ref|XP_003764930.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...    119   3e-28
ref|WP_015021221.1|  alpha-L-fucosidase [Bifidobacterium aster...    118   3e-28
ref|WP_016621638.1|  Alpha-L-fucosidase [Enterococcus faecalis]      118   3e-28
ref|WP_013551227.1|  alpha-L-fucosidase [Cellulophaga algicola]      118   3e-28
ref|WP_018189704.1|  hypothetical protein [Leifsonia sp. 109]        118   3e-28
ref|WP_010526647.1|  alpha-L-fucosidase [Anaerophaga sp. HS1]        118   3e-28
ref|WP_016612761.1|  Alpha-L-fucosidase [Enterococcus faecium]       118   3e-28
ref|WP_005234073.1|  MULTISPECIES: alpha-L-fucosidase [Enteroc...    118   3e-28
ref|WP_022907694.1|  alpha-L-fucosidase [Curtobacterium sp. B18]     118   4e-28
ref|WP_009099361.1|  alpha-L-fucosidase and sulfatase domain p...    120   4e-28
dbj|GAF38976.1|  alpha-L-fucosidase [Lactobacillus composti JC...    116   4e-28
ref|WP_003843165.1|  alpha-L-fucosidase [Bifidobacterium dentium]    118   4e-28
ref|WP_029677560.1|  alpha-L-fucosidase [Bifidobacterium sp. 7...    118   4e-28
ref|WP_025615688.1|  alpha-L-fucosidase [Cellulophaga baltica]       118   4e-28
ref|WP_020711516.1|  hypothetical protein [Acidobacteriaceae b...    118   4e-28
ref|WP_024481469.1|  alpha-L-fucosidase [Cellulophaga baltica]       118   4e-28
ref|WP_029489822.1|  alpha-L-fucosidase [Flavobacteriaceae bac...    118   4e-28
ref|WP_027472400.1|  alpha-L-fucosidase [Cytophaga fermentans]       118   4e-28
ref|WP_003838282.1|  alpha-L-fucosidase [Bifidobacterium dentium]    117   4e-28
ref|XP_007769245.1|  glycoside hydrolase family 29 protein [Co...    120   4e-28
emb|CDS05721.1|  hypothetical protein LRAMOSA08249 [Absidia id...    119   5e-28
ref|WP_029469953.1|  hypothetical protein [Clostridiales bacte...    117   5e-28
ref|WP_022530389.1|  alpha-L-fucosidase [Lactobacillus shenzhe...    117   5e-28
gb|ETO97333.1|  alpha-L-fucosidase [Bifidobacterium sp. MSTE12]      117   5e-28
ref|WP_018187866.1|  hypothetical protein [Microbacterium para...    117   5e-28
emb|CDF79790.1|  alpha-L-fucosidase (GH29) [Formosa agariphila...    117   6e-28
ref|XP_008596979.1|  Glycoside hydrolase, family 29 [Beauveria...    118   6e-28
ref|WP_009003692.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...    117   6e-28
ref|XP_007598031.1|  alpha-L-fucosidase [Colletotrichum fiorin...    119   7e-28
dbj|GAA86883.1|  alpha-L-fucosidase [Aspergillus kawachii IFO ...    119   7e-28
ref|WP_013620025.1|  alpha-L-fucosidase [Cellulophaga lytica]        117   7e-28
ref|XP_007303791.1|  glycoside hydrolase [Stereum hirsutum FP-...    119   7e-28
ref|WP_007386856.1|  hypothetical protein [Streptomyces sviceus]     116   7e-28
ref|WP_020528112.1|  hypothetical protein [Flexithrix dorotheae]     117   7e-28
ref|WP_026463614.1|  alpha-L-fucosidase [Adhaeribacter aquaticus]    117   7e-28
ref|XP_009093584.1|  PREDICTED: plasma alpha-L-fucosidase [Ser...    117   7e-28
ref|WP_022902391.1|  alpha-L-fucosidase [Curtobacterium sp. B8]      117   7e-28
gb|EWH13639.1|  alpha-L-fucosidase [Cellulophaga geojensis KL-A]     117   7e-28
gb|KFI91852.1|  alpha-L-fucosidase [Bifidobacterium saguini DS...    117   8e-28
ref|XP_007302144.1|  glycoside hydrolase [Stereum hirsutum FP-...    118   8e-28
gb|KFI64234.1|  alpha-L-fucosidase [Bifidobacterium cuniculi]        117   8e-28
ref|WP_018593747.1|  hypothetical protein [Blautia producta]         117   8e-28
gb|EPB90987.1|  hypothetical protein HMPREF1544_02241 [Mucor c...    119   1e-27
ref|WP_013551220.1|  alpha-L-fucosidase [Cellulophaga algicola]      117   1e-27
ref|WP_029923642.1|  hypothetical protein [Nocardia otitidisca...    116   1e-27
emb|CCF42172.1|  alpha-L-fucosidase [Colletotrichum higginsianum]    117   1e-27
ref|WP_020097641.1|  hypothetical protein [Microbacterium sp. ...    117   1e-27
gb|AIE85427.1|  alpha-L-fucosidase [Fimbriimonas ginsengisoli ...    116   1e-27
ref|WP_008895758.1|  alpha-L-fucosidase [Haloterrigena salina]       117   1e-27
ref|WP_008845532.1|  alpha-L-fucosidase [Glaciecola lipolytica]      117   1e-27
ref|WP_008689498.1|  Glycoside hydrolase, family 29, subgroup ...    116   1e-27
gb|KFG83413.1|  putative alpha-L-fucosidase [Metarhizium aniso...    117   1e-27
gb|KEQ97150.1|  glycoside hydrolase family 29 protein [Aureoba...    118   1e-27
ref|WP_027827655.1|  alpha-L-fucosidase [Lactobacillus harbine...    116   1e-27
ref|XP_007769249.1|  glycoside hydrolase family 29 protein [Co...    118   2e-27
ref|WP_026631428.1|  hypothetical protein [Dyadobacter alkalit...    116   2e-27
ref|WP_017445528.1|  hypothetical protein [Gayadomonas joobini...    116   2e-27
ref|WP_015510286.1|  alpha-L-fucosidase [Enterococcus casselif...    115   2e-27
gb|EZP27623.1|  Alpha-L-fucosidase [Microbacterium oleivorans]       116   2e-27
gb|ETY71851.1|  alpha-L-fucosidase [Bifidobacterium moukalaben...    115   2e-27
ref|WP_008686699.1|  Glycoside hydrolase, family 29, subgroup ...    116   2e-27
ref|WP_026447314.1|  alpha-L-fucosidase [Acidobacteriaceae bac...    116   3e-27
ref|XP_007850143.1|  glycoside hydrolase family 29 protein [Mo...    117   3e-27
ref|WP_006546885.1|  alpha-L-fucosidase precursor [Actinomyces...    115   3e-27
ref|WP_027292879.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...    115   3e-27
ref|WP_009102162.1|  Glycoside hydrolase, family 29, subgroup ...    115   3e-27
dbj|BAN21626.1|  alpha-l-fucosidase [Riptortus pedestris]            110   4e-27
gb|EMF12352.1|  glycoside hydrolase family 29 protein [Sphaeru...    117   4e-27
gb|ENH84225.1|  glycoside hydrolase family 29 protein [Colleto...    117   4e-27
ref|XP_007385878.1|  glycoside hydrolase [Punctularia strigoso...    115   4e-27
gb|EJT70212.1|  tissue alpha-L-fucosidase [Gaeumannomyces gram...    117   5e-27
gb|AHG01953.1|  hypothetical protein HALLA_01250 [Halostagnico...    115   6e-27
ref|WP_026642432.1|  alpha-L-fucosidase [Bifidobacterium tsuru...    114   6e-27
ref|WP_013994972.1|  alpha-L-fucosidase [Zobellia galactanivor...    114   6e-27
ref|WP_008193464.1|  alpha-L-fucosidase [Thermotoga sp. EMP]         114   6e-27
ref|XP_007925399.1|  glycoside hydrolase family 29 protein [Ps...    116   6e-27
ref|XP_007884770.1|  PREDICTED: plasma alpha-L-fucosidase-like...    108   7e-27
ref|XP_005102076.1|  PREDICTED: plasma alpha-L-fucosidase-like...    114   7e-27
ref|WP_014845300.1|  alpha-L-fucosidase [Propionibacterium pro...    114   7e-27
gb|KEQ88861.1|  glycoside hydrolase [Aureobasidium pullulans E...    116   7e-27
gb|EHA27381.1|  hypothetical protein ASPNIDRAFT_44822 [Aspergi...    115   8e-27
ref|WP_017446998.1|  hypothetical protein [Gayadomonas joobini...    115   8e-27
gb|EME45088.1|  glycoside hydrolase family 29 protein [Dothist...    116   9e-27
ref|WP_026370727.1|  hypothetical protein [bacterium JKG1]           114   9e-27
ref|WP_016296305.1|  hypothetical protein [Lachnospiraceae bac...    114   9e-27
gb|EXM18534.1|  hypothetical protein FOTG_13459 [Fusarium oxys...    116   9e-27
ref|WP_017204441.1|  hypothetical protein [Microbacterium bark...    114   9e-27
ref|XP_007793194.1|  putative tissue alpha-l-fucosidase protei...    116   1e-26
ref|XP_003302137.1|  hypothetical protein PTT_13847 [Pyrenopho...    110   1e-26
ref|XP_003302138.1|  hypothetical protein PTT_13848 [Pyrenopho...    110   1e-26
ref|XP_001396349.2|  alpha-L-fucosidase [Aspergillus niger CBS...    115   2e-26
gb|AHG74695.1|  Alpha-L-fucosidase [Mannheimia varigena USDA-A...    112   2e-26
gb|KEQ65757.1|  glycoside hydrolase [Aureobasidium melanogenum...    115   2e-26
ref|XP_002403894.1|  alpha-L-fucosidase, putative [Ixodes scap...    110   2e-26
ref|WP_009253406.1|  hypothetical protein [Lachnospiraceae bac...    113   2e-26
ref|XP_002486144.1|  alpha-L-fucosidase, putative [Talaromyces...    115   2e-26
ref|WP_026990086.1|  alpha-L-fucosidase [Flavobacterium subsax...    113   2e-26
ref|WP_029607370.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]    112   2e-26
gb|KEQ69053.1|  glycoside hydrolase [Aureobasidium pullulans v...    114   2e-26
ref|WP_005689930.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]    112   2e-26
ref|WP_005687706.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]    112   2e-26
dbj|GAE76820.1|  alpha-L-fucosidase [Propionibacterium acnes J...    112   2e-26
gb|KDQ21398.1|  glycoside hydrolase family 29 protein [Botryob...    113   2e-26
gb|KFC35786.1|  alpha-L-fucosidase [Lactobacillus rhamnosus K32]     112   2e-26
ref|WP_024481476.1|  alpha-L-fucosidase [Cellulophaga baltica]       113   3e-26
gb|EMF13801.1|  glycoside hydrolase family 29 protein [Sphaeru...    115   3e-26
gb|KFK45322.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]         112   3e-26
ref|WP_022891754.1|  alpha-L-fucosidase [Agromyces subbeticus]       112   3e-26
dbj|GAE67799.1|  alpha-L-fucosidase [Propionibacterium acnes J...    112   3e-26
ref|WP_014437012.1|  alpha-L-fucosidase [Phycisphaera mikurensis]    112   3e-26
ref|WP_006680551.1|  hypothetical protein [Actinomyces turicen...    112   3e-26
ref|WP_009640012.1|  Alpha-L-fucosidase [Propionibacterium sp....    112   3e-26
ref|XP_003389435.1|  PREDICTED: tissue alpha-L-fucosidase-like...    114   3e-26
gb|KFC16449.1|  alpha-L-fucosidase [Propionibacterium acnes HL...    112   3e-26
ref|WP_023031605.1|  hypothetical protein [Propionibacterium s...    112   3e-26
ref|WP_024541559.1|  alpha-L-fucosidase [Bifidobacterium choer...    112   4e-26
ref|WP_002530714.1|  alpha-L-fucosidase [Propionibacterium acnes]    112   4e-26
ref|WP_006378387.1|  Tat pathway signal sequence domain protei...    114   4e-26
emb|CDF79859.1|  alpha-L-fucosidase (GH29) [Formosa agariphila...    112   4e-26
gb|AHG76814.1|  Alpha-L-fucosidase [Mannheimia varigena USDA-A...    111   4e-26
emb|CDH60687.1|  glycoside hydrolase family 29 protein [Lichth...    114   4e-26
ref|XP_009096911.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...    112   5e-26
ref|WP_025725652.1|  alpha-L-fucosidase [Bacteroides sp. 14(A)]      112   5e-26
ref|WP_009093384.1|  Glycoside hydrolase, family 29, subgroup ...    112   5e-26
ref|XP_007851235.1|  glycoside hydrolase family 29 protein [Mo...    114   6e-26
ref|XP_003389436.1|  PREDICTED: tissue alpha-L-fucosidase-like...    113   6e-26
ref|WP_007216969.1|  hypothetical protein [Bacteroides cellulo...    112   6e-26
emb|CCT65213.1|  related to putative alpha-L-fucosidase precur...    113   7e-26
ref|WP_008599759.1|  Alpha-L-fucosidase [alpha proteobacterium...    112   7e-26
gb|ETW78636.1|  glycoside hydrolase family 29 protein [Heterob...    114   7e-26
ref|WP_031340579.1|  alpha-L-fucosidase [Xanthomonas sp. M97]        107   7e-26
ref|XP_003843339.1|  hypothetical protein LEMA_P074490.1 [Lept...    113   8e-26
ref|WP_021951228.1|  alpha-L-fucosidase [Clostridium sp. CAG:678]    111   8e-26
emb|CAK41610.1|  unnamed protein product [Aspergillus niger]         112   8e-26
ref|WP_013041829.1|  alpha-L-fucosidase [Coraliomargarita akaj...    111   9e-26
ref|WP_031427913.1|  alpha-L-fucosidase [Leeuwenhoekiella sp. ...    111   9e-26
ref|XP_009044266.1|  hypothetical protein LOTGIDRAFT_58502 [Lo...    105   9e-26
ref|XP_007915099.1|  putative tissue alpha-l-fucosidase protei...    113   9e-26
ref|WP_029036263.1|  alpha-L-fucosidase [Salinimicrobium xinji...    111   1e-25
ref|WP_005712370.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]    110   1e-25
ref|WP_007210754.1|  hypothetical protein [Bacteroides cellulo...    111   1e-25
ref|WP_007216966.1|  hypothetical protein [Bacteroides cellulo...    111   1e-25
ref|WP_029426044.1|  alpha-L-fucosidase [Bacteroides cellulosi...    110   1e-25
ref|WP_029446910.1|  alpha-L-fucosidase [Cellulophaga baltica]       110   2e-25
ref|WP_007210751.1|  MULTISPECIES: hypothetical protein [Bacte...    110   2e-25
ref|WP_029449830.1|  alpha-L-fucosidase [Cellulophaga baltica]       110   2e-25
ref|WP_031036891.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    112   2e-25
ref|WP_029589398.1|  glycoside hydrolase family 29 [Caulobacte...    110   2e-25
ref|WP_025615695.1|  alpha-L-fucosidase [Cellulophaga baltica]       110   2e-25
ref|WP_009714010.1|  alpha-L-fucosidase [Streptomyces himastat...    112   2e-25
ref|WP_009253386.1|  hypothetical protein [Lachnospiraceae bac...    110   2e-25
ref|WP_012374865.1|  alpha-L-fucosidase [Opitutus terrae]            110   2e-25
ref|XP_007839167.1|  hypothetical protein PFICI_12395 [Pestalo...    112   2e-25
gb|EWG54305.1|  hypothetical protein FVEG_12553 [Fusarium vert...    111   2e-25
ref|WP_012376027.1|  alpha-L-fucosidase [Opitutus terrae]            112   3e-25
gb|KEQ65794.1|  putative alpha-L-fucosidase [Aureobasidium mel...    112   3e-25
gb|KFI56796.1|  alpha-L-fucosidase [Bifidobacterium choerinum]       110   3e-25
ref|WP_017830807.1|  hypothetical protein [Microbacterium sp. ...    109   3e-25
ref|WP_020215104.1|  hypothetical protein [Flavobacterium rivuli]    110   3e-25
gb|EFW99648.1|  alpha-l-fucosidase [Grosmannia clavigera kw1407]     112   3e-25
gb|EXU67667.1|  alpha-L-fucosidase [Streptomyces sp. PRh5]           111   4e-25
dbj|BAG59123.1|  unnamed protein product [Homo sapiens]              105   4e-25
gb|EPE09066.1|  alpha-l-fucosidase [Ophiostoma piceae UAMH 11346]    111   4e-25
gb|ELK36469.1|  Plasma alpha-L-fucosidase [Myotis davidii]           109   4e-25
gb|EXK85116.1|  hypothetical protein FOQG_10775 [Fusarium oxys...    110   4e-25
ref|WP_013620032.1|  alpha-L-fucosidase [Cellulophaga lytica]        109   5e-25
gb|EXA51318.1|  hypothetical protein FOVG_03778 [Fusarium oxys...    110   5e-25
gb|EWH13632.1|  alpha-L-fucosidase [Cellulophaga geojensis KL-A]     109   5e-25
gb|EQB54139.1|  alpha-L-fucosidase [Colletotrichum gloeosporio...    111   5e-25
gb|AIA87331.1|  alpha_L_fucos [uncultured Xylella fastidiosa]        104   5e-25
ref|WP_021200385.1|  hypothetical protein [Microbacterium mari...    108   5e-25
gb|EWZ00017.1|  hypothetical protein FOYG_03929 [Fusarium oxys...    110   6e-25
ref|WP_025835408.1|  hypothetical protein [Bacteroides rodentium]    105   6e-25
gb|EWZ46040.1|  hypothetical protein FOZG_06226 [Fusarium oxys...    110   6e-25
gb|EWZ79747.1|  hypothetical protein FOWG_16245 [Fusarium oxys...    110   6e-25
ref|WP_007508399.1|  alpha-L-fucosidase [Rhodanobacter sp. 2AP...    110   6e-25
ref|XP_007275685.1|  glycoside hydrolase family 29 protein [Co...    111   6e-25
gb|EXL63395.1|  hypothetical protein FOCG_01731 [Fusarium oxys...    110   6e-25
gb|KDN65601.1|  putative alpha-L-fucosidase [Colletotrichum su...    110   7e-25
ref|WP_006138629.1|  putative alpha-L-fucosidase [Streptomyces...    108   7e-25
ref|WP_013551231.1|  alpha-L-fucosidase [Cellulophaga algicola]      109   7e-25
ref|WP_026176376.1|  glycoside hydrolase family 29 [Caulobacte...    106   7e-25
ref|WP_007379443.1|  alpha-L-fucosidase [Streptomyces sviceus]       110   8e-25
ref|WP_013991583.1|  alpha-L-fucosidase [Zobellia galactanivor...    109   8e-25
ref|WP_027483936.1|  alpha-L-fucosidase [Rhodanobacter sp. OR87]     109   8e-25
gb|EMP39109.1|  Plasma alpha-L-fucosidase [Chelonia mydas]           108   8e-25
ref|WP_020137249.1|  alpha-L-fucosidase [Streptomyces sp. 351M...    110   8e-25
ref|WP_029265503.1|  alpha-L-fucosidase [Microbacterium sp. Cr...    108   8e-25
ref|WP_028502753.1|  alpha-L-fucosidase [Microbacterium sp. UR...    108   9e-25
gb|KEQ85281.1|  putative alpha-L-fucosidase [Aureobasidium pul...    110   1e-24
ref|WP_007669373.1|  glycoside hydrolase family 29 [Caulobacte...    108   1e-24
ref|WP_031581180.1|  alpha-L-fucosidase [Lachnospiraceae bacte...    108   1e-24
ref|WP_022008697.1|  alpha-L-fucosidase [Firmicutes bacterium ...    107   1e-24
ref|WP_029259047.1|  alpha-L-fucosidase [Microbacterium sp. Cr...    107   1e-24
ref|WP_030316604.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    109   1e-24
ref|WP_030051914.1|  alpha-L-fucosidase [Streptomyces peruvien...    110   1e-24
gb|EXK26915.1|  hypothetical protein FOMG_16525 [Fusarium oxys...    109   1e-24
ref|WP_008098284.1|  Alpha-L-fucosidase superfamily [Verrucomi...    108   1e-24
dbj|GAF05719.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...    108   1e-24
gb|EWM10056.1|  alpha-L-fucosidase [Kutzneria sp. 744]               108   1e-24
ref|WP_030584983.1|  alpha-L-fucosidase [Streptomyces globispo...    107   2e-24
gb|KFF98665.1|  alpha-L-fucosidase [Streptomyces scabiei]            109   2e-24
ref|WP_020121527.1|  alpha-L-fucosidase [Streptomyces canus]         109   2e-24
ref|WP_008305877.1|  alpha-L-fucosidase [Glaciecola agarilytica]     108   2e-24
ref|WP_008679443.1|  Glycoside hydrolase, family 29, subgroup ...    108   2e-24
gb|KEP51552.1|  alpha-L-fucosidase [Rhizoctonia solani 123E]         109   2e-24
ref|WP_020865518.1|  alpha-L-fucosidase [Streptomyces rapamyci...    109   2e-24
gb|ELU14962.1|  hypothetical protein CAPTEDRAFT_44188 [Capitel...    101   2e-24
ref|WP_013754595.1|  alpha-L-fucosidase [Glaciecola sp. 4H-3-7...    108   2e-24
ref|WP_009093492.1|  Glycoside hydrolase, family 29, subgroup ...    107   2e-24
ref|WP_007984540.1|  alpha-L-fucosidase [Glaciecola chathamensis]    108   2e-24
ref|WP_030709942.1|  alpha-L-fucosidase [Streptomyces griseus]       106   2e-24
ref|WP_018956844.1|  alpha-L-fucosidase [Streptomyces sp. CNB091]    106   2e-24
gb|EFQ35921.1|  alpha-L-fucosidase [Colletotrichum graminicola...    109   2e-24
gb|ELU12589.1|  hypothetical protein CAPTEDRAFT_41728 [Capitel...    101   3e-24
ref|WP_031037457.1|  hypothetical protein [Streptomyces sp. NR...    109   3e-24
ref|WP_029449817.1|  alpha-L-fucosidase [Cellulophaga baltica]       107   3e-24
gb|KDN54087.1|  alpha-L-fucosidase [Flavobacterium sp. EM1321]       107   3e-24
ref|WP_030083777.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...    106   3e-24
ref|WP_010059335.1|  alpha-L-fucosidase [Streptomyces globispo...    106   3e-24
gb|AFR68934.1|  alpha-fucosidase GH29 [Fusarium oxysporum]           108   3e-24
ref|WP_020271740.1|  putative Tissue alpha-L-fucosidase [Strep...    108   3e-24
gb|EGU83738.1|  hypothetical protein FOXB_05755 [Fusarium oxys...    108   3e-24
ref|WP_031079050.1|  hypothetical protein [Streptomyces sp. NR...    106   4e-24
ref|WP_029446899.1|  alpha-L-fucosidase [Cellulophaga baltica]       107   4e-24
ref|WP_009186306.1|  alpha-L-fucosidase [Cecembia lonarensis]        107   4e-24
ref|WP_007457311.1|  alpha-L-fucosidase [Streptomyces sp. W007]      105   4e-24
ref|WP_028597615.1|  alpha-L-fucosidase [Paenibacillus pasaden...    107   4e-24
ref|WP_010038475.1|  alpha-L-fucosidase [Streptomyces chartreu...    108   4e-24
ref|WP_015612220.1|  Alpha-L-fucosidase [Streptomyces fulvissi...    105   4e-24
gb|ETZ24784.1|  hypothetical protein N824_00740 [Pedobacter sp...    107   5e-24
ref|WP_030804257.1|  alpha-L-fucosidase [Streptomyces mediolani]     105   5e-24
gb|KFK87362.1|  alpha-L-fucosidase [Streptomyces sp. JS01]           105   5e-24
ref|WP_030562316.1|  alpha-L-fucosidase [Streptomyces cyaneofu...    105   5e-24
gb|EXL90568.1|  hypothetical protein FOIG_16193 [Fusarium oxys...    107   5e-24
ref|WP_031588253.1|  hypothetical protein [Lachnospiraceae bac...    106   5e-24
ref|WP_014182491.1|  alpha-L-fucosidase [Streptomyces bingchen...    108   6e-24
ref|WP_007806650.1|  alpha-L-fucosidase [Flavobacterium sp. CF...    107   6e-24
ref|WP_030592494.1|  alpha-L-fucosidase [Streptomyces anulatus]      105   6e-24
ref|WP_003997172.1|  putative Alpha-L-fucosidase [Streptomyces...    108   6e-24
ref|WP_007641228.1|  alpha-L-fucosidase [Cellvibrio sp. BR]          106   7e-24
ref|WP_007386065.1|  alpha-L-fucosidase [Streptomyces sviceus]       107   7e-24
ref|WP_025615683.1|  alpha-L-fucosidase [Cellulophaga baltica]       106   7e-24
ref|WP_006128459.1|  alpha-L-fucosidase [Streptomyces filament...    105   7e-24
ref|WP_024481464.1|  alpha-L-fucosidase [Cellulophaga baltica]       106   8e-24
ref|WP_025145792.1|  alpha-L-fucosidase [Sphingobacterium sp. ...    107   8e-24
ref|WP_030164507.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    107   8e-24
gb|KEQ96643.1|  glycoside hydrolase family 29 protein [Aureoba...    107   8e-24
ref|WP_031061260.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    107   9e-24
ref|WP_004293997.1|  alpha-L-fucosidase [Bacteroides eggerthii]      106   9e-24
ref|WP_029429381.1|  alpha-L-fucosidase [Bacteroides eggerthii]      106   9e-24
ref|WP_004288490.1|  alpha-L-fucosidase [Bacteroides eggerthii]      106   1e-23
ref|WP_028418133.1|  alpha-L-fucosidase [Streptomyces sp. SolW...    104   1e-23
ref|WP_012378525.1|  alpha-L-fucosidase [Streptomyces griseus]       104   1e-23
ref|WP_003965471.1|  alpha-L-fucosidase [Streptomyces griseus]       104   1e-23
ref|WP_013042257.1|  alpha-L-fucosidase [Coraliomargarita akaj...    105   1e-23
ref|WP_017141244.1|  alpha-L-fucosidase [Bacteroides eggerthii...    106   1e-23
ref|XP_003718772.1|  tissue alpha-L-fucosidase [Magnaporthe or...    107   1e-23
ref|WP_031127127.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    104   1e-23
ref|WP_028908114.1|  alpha-L-fucosidase [Prevotella ruminicola]      105   1e-23
ref|WP_003091424.1|  alpha-L-fucosidase [Amycolatopsis vancore...    106   1e-23
gb|KDN20152.1|  alpha-L-fucosidase [Amycolatopsis rifamycinica]      106   2e-23
ref|WP_020122225.1|  alpha-L-fucosidase [Streptomyces canus]         106   2e-23
ref|WP_012200210.1|  alpha-L-fucosidase [Clostridium phytoferm...    104   2e-23
ref|WP_018491632.1|  alpha-L-fucosidase [Streptomyces sp. Ccal...    103   2e-23
ref|WP_012998575.1|  alpha-L-fucosidase [Streptomyces scabiei]       106   2e-23
ref|WP_011573712.1|  alpha-L-fucosidase [Pseudoalteromonas atl...    105   2e-23
ref|WP_025844964.1|  hypothetical protein [Paenibacillus ehime...    103   2e-23
ref|WP_026880582.1|  alpha-L-fucosidase [Hymenobacter norwiche...    105   2e-23
ref|WP_030948958.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    105   2e-23
ref|WP_030844634.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    106   3e-23
ref|WP_014218625.1|  alpha-L-fucosidase [Niastella koreensis]        105   3e-23
ref|WP_029395744.1|  alpha-L-fucosidase [Streptomyces sp. Wiga...    103   3e-23
ref|WP_025103277.1|  alpha-L-fucosidase [Microbacterium paraox...    103   3e-23
ref|XP_005684920.1|  PREDICTED: LOW QUALITY PROTEIN: plasma al...    103   3e-23
ref|WP_014669694.1|  alpha-L-fucosidase [Streptomyces hygrosco...    105   3e-23
ref|WP_020529767.1|  hypothetical protein [Flexithrix dorotheae]     103   3e-23
gb|ELT88295.1|  hypothetical protein CAPTEDRAFT_91196 [Capitel...    103   3e-23
ref|WP_025146405.1|  alpha-L-fucosidase [Sphingobacterium sp. ...    104   3e-23
ref|WP_030231786.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    105   4e-23
ref|WP_030836290.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    105   4e-23
ref|XP_003035417.1|  glycoside hydrolase family 29 protein [Sc...    105   4e-23
ref|WP_004017481.1|  alpha-L-fucosidase [Mobiluncus mulieris]        103   5e-23
ref|WP_004272095.1|  alpha-L-fucosidase [Azospirillum amazonense]    103   5e-23
ref|WP_030739239.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    105   5e-23
ref|WP_008754592.1|  alpha-L-fucosidase [Lachnoanaerobaculum s...    103   5e-23
ref|WP_003988231.1|  alpha-L-fucosidase [Streptomyces viridoch...    105   6e-23
ref|WP_009662714.1|  alpha-L-fucosidase [Lachnospiraceae bacte...    102   7e-23
ref|WP_003588140.1|  alpha-L-fucosidase [Lactobacillus casei]        101   7e-23
gb|ETO94646.1|  alpha-L-fucosidase [Lachnospiraceae bacterium ...    102   7e-23
ref|WP_030948680.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...    105   7e-23
ref|WP_023450240.1|  alpha-L-fucosidase [Asticcacaulis sp. AC402]    103   7e-23
ref|WP_020647079.1|  alpha-L-fucosidase [Amycolatopsis balhimy...    104   7e-23
gb|ACI01844.1|  putative alpha-L-fucosidase-like protein [Cera...    103   8e-23
ref|WP_013064658.1|  alpha-L-fucosidase [Prevotella ruminicola]      103   8e-23
ref|XP_003389434.1|  PREDICTED: tissue alpha-L-fucosidase-like...    104   8e-23
ref|WP_022461228.1|  putative uncharacterized protein [Blautia...    102   8e-23
ref|WP_004014754.1|  alpha-L-fucosidase [Mobiluncus mulieris]        102   8e-23
ref|WP_027470703.1|  hypothetical protein [Cytophaga fermentans]   98.6    8e-23
ref|WP_029936082.1|  glycoside hydrolase family 29 [Sphingomon...    102   8e-23
ref|WP_030052129.1|  hypothetical protein [Streptomyces peruvi...    101   9e-23
gb|EZP49993.1|  Alpha-L-fucosidase family protein [Sphingomona...    103   9e-23
dbj|BAP31270.1|  putative alpha-L-fucosidase [Chryseobacterium...    104   9e-23
ref|WP_019026089.1|  hypothetical protein [Colwellia piezophila]     103   1e-22
gb|AIA94416.1|  alpha_L_fucos [uncultured Paenibacillus sp.]       97.1    1e-22
ref|WP_026768462.1|  alpha-L-fucosidase [Sediminibacterium sp....    103   1e-22
ref|WP_029183986.1|  alpha-L-fucosidase [Streptomyces acidisca...    104   1e-22
ref|WP_031453616.1|  alpha-L-fucosidase [Flavobacterium chunga...    103   1e-22
ref|WP_013480666.1|  alpha-L-fucosidase [Asticcacaulis excentr...    103   1e-22
ref|WP_013225152.1|  alpha-L-fucosidase [Amycolatopsis mediter...    103   1e-22
ref|XP_001621684.1|  hypothetical protein NEMVEDRAFT_v1g53708 ...  98.6    1e-22
ref|WP_007591736.1|  alpha-L-fucosidase [Lachnospiraceae bacte...    102   1e-22
ref|WP_007279302.1|  probable glycosyl hydrolase [Lentisphaera...    103   1e-22
dbj|GAD95185.1|  alpha-L-fucosidase, putative [Byssochlamys sp...    104   2e-22
ref|WP_010357414.1|  alpha-L-fucosidase [Streptomyces acidisca...    103   2e-22
ref|XP_009048306.1|  hypothetical protein LOTGIDRAFT_238384 [L...    102   2e-22
ref|WP_020571035.1|  hypothetical protein [Lewinella persica]        102   2e-22
gb|EPD07332.1|  alpha-L-fucosidase [Lactobacillus paracasei su...    100   2e-22
gb|AIE86017.1|  alpha-L-fucosidase [Fimbriimonas ginsengisoli ...    103   2e-22
emb|CCM63681.1|  Glycoside hydrolase family 29 (Alpha-L-fucosi...    102   2e-22
ref|WP_008751270.1|  alpha-L-fucosidase [Lachnoanaerobaculum s...    101   2e-22
ref|WP_030939143.1|  alpha-L-fucosidase [Streptomyces violaceo...    103   3e-22
gb|KDS52929.1|  alpha-L-fucosidase family protein [Bacteroides...    102   3e-22
ref|WP_008662740.1|  alpha-L-fucosidase [Bacteroides sp. 4_1_36]     102   3e-22
ref|WP_009037731.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...    102   3e-22
ref|WP_020376803.1|  hypothetical protein [Candidatus Microthr...    102   3e-22
ref|WP_006272523.1|  alpha-L-fucosidase [Asticcacaulis biprost...    102   3e-22
ref|WP_026772534.1|  alpha-L-fucosidase [Sediminibacterium sp....    102   3e-22
ref|WP_005834631.1|  alpha-L-fucosidase [Bacteroides uniformis]      102   3e-22
ref|WP_009251078.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...    101   3e-22
ref|WP_005830301.1|  alpha-L-fucosidase [Bacteroides uniformis]      102   3e-22
gb|EPC70292.1|  alpha-L-fucosidase [Lactobacillus paracasei su...    100   3e-22
ref|WP_003579803.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...    100   3e-22
emb|CDT27943.1|  putative alpha-L-fucosidase [Sphingobacterium...    102   3e-22
ref|WP_003584884.1|  alpha-L-fucosidase [Lactobacillus casei]        100   3e-22
ref|WP_006378381.1|  ricin-type beta-trefoil lectin domain pro...    103   3e-22
ref|WP_022830838.1|  alpha-L-fucosidase [Cytophagales str. B6]       102   3e-22
ref|WP_027125939.1|  alpha-L-fucosidase [Gelidibacter mesophilus]    101   3e-22
ref|WP_009218529.1|  alpha-L-fucosidase [Lachnospiraceae oral ...    100   4e-22
ref|WP_012803738.1|  alpha-L-fucosidase [Brachybacterium faecium]    101   4e-22
ref|WP_022149377.1|  alpha-L-fucosidase [Prevotella sp. CAG:1320]    102   4e-22
ref|WP_014845441.1|  alpha-L-fucosidase [Propionibacterium pro...    100   4e-22
emb|CCY31869.1|  putative uncharacterized protein [Ruminococcu...    100   5e-22
ref|WP_019160482.1|  alpha-L-fucosidase [Ruminococcus sp. JC304]     100   5e-22
ref|WP_015793536.1|  alpha-fucosidase [Catenulispora acidiphila]     102   5e-22
ref|WP_029229099.1|  alpha-L-fucosidase [Caldicellulosiruptor ...    101   5e-22
gb|ELU14961.1|  hypothetical protein CAPTEDRAFT_96254 [Capitel...  95.9    6e-22
ref|WP_028911305.1|  alpha-L-fucosidase [Prevotella sp. MA2016]      101   6e-22
ref|WP_012201031.1|  alpha-L-fucosidase [Clostridium phytoferm...    100   7e-22
ref|WP_019899417.1|  alpha-L-fucosidase [Lactobacillus paracasei]  99.8    7e-22
ref|WP_026713942.1|  alpha-L-fucosidase [Flavobacterium daejeo...    101   7e-22
ref|WP_016388560.1|  Alpha-L-fucosidase [Lactobacillus paracasei]  99.8    7e-22
gb|EZP51258.1|  Alpha-L-fucosidase family protein [Sphingomona...    100   7e-22
ref|WP_031480903.1|  alpha-L-fucosidase [Streptomyces bicolor]       102   7e-22
ref|XP_009059102.1|  hypothetical protein LOTGIDRAFT_147833 [L...  95.5    8e-22
ref|WP_018514572.1|  alpha-L-fucosidase [Streptomyces sp. Scae...  99.4    8e-22
ref|WP_007173182.1|  alpha-L-fucosidase [Prevotella bergensis]       101   8e-22
ref|WP_008611906.1|  alpha-L-fucosidase [Joostella marina]           100   8e-22
ref|WP_013073725.1|  alpha-L-fucosidase [Zunongwangia profunda]      101   8e-22
ref|WP_019026119.1|  hypothetical protein [Colwellia piezophila]     101   9e-22
gb|ESQ83832.1|  hypothetical protein AEAC466_10910 [Asticcacau...    100   9e-22
ref|WP_007593953.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  99.8    9e-22
ref|WP_031238742.1|  alpha-L-fucosidase [Asticcacaulis sp. AC466]    100   9e-22
ref|WP_019370522.1|  hypothetical protein [Sphingomonas sp. AT...    100   9e-22
ref|WP_009662177.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  99.8    9e-22
ref|XP_524607.4|  PREDICTED: tissue alpha-L-fucosidase [Pan tr...    100   9e-22
ref|WP_016255472.1|  Alpha-L-fucosidase [Indibacter alkaliphilus]  99.8    1e-21
ref|WP_008505019.1|  alpha-L-fucosidase [Mucilaginibacter palu...    100   1e-21
ref|WP_017259406.1|  hypothetical protein [Pedobacter arcticus]    99.8    1e-21
ref|WP_030441220.1|  alpha-L-fucosidase [Actinoplanes sp. RP-A...    101   1e-21
gb|KCZ82563.1|  alpha-L-fucosidase [Hyphomonas adhaerens MHS-3]    95.5    1e-21
ref|WP_028068804.1|  alpha-L-fucosidase [Sphingobacterium thal...    100   1e-21
ref|WP_018200897.1|  MULTISPECIES: hypothetical protein [Hydro...  99.8    1e-21
ref|WP_019860636.1|  alpha-L-fucosidase [Lactobacillus paracasei]  98.6    1e-21
ref|WP_025559950.1|  MULTISPECIES: alpha-L-fucosidase [Sphingo...    100   1e-21
ref|WP_018475026.1|  hypothetical protein [Echinicola pacifica]    99.8    1e-21
ref|WP_012789588.1|  alpha-L-fucosidase [Chitinophaga pinensis]    99.4    1e-21
ref|WP_003591110.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  98.6    1e-21
ref|WP_003599118.1|  alpha-L-fucosidase [Lactobacillus casei]      98.6    2e-21
ref|WP_021636170.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  99.0    2e-21
ref|WP_013668016.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]    100   2e-21
ref|WP_025488641.1|  alpha-L-fucosidase [Clostridiales bacteri...  99.0    2e-21
ref|WP_016272469.1|  hypothetical protein [Bacteroides uniformis]    100   2e-21
ref|WP_021637418.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  99.0    2e-21
ref|WP_013480665.1|  glycoside hydrolase family 29 [Asticcacau...  99.0    2e-21
ref|WP_028068690.1|  alpha-L-fucosidase [Sphingobacterium thal...    100   2e-21
ref|WP_023458188.1|  glycoside hydrolase family 29 [Asticcacau...  99.0    2e-21
gb|ETT65468.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R7-277]  99.8    2e-21
gb|KEQ29567.1|  alpha-L-fucosidase [Sphingobacterium antarctic...    100   2e-21
ref|WP_013617911.1|  alpha-L-fucosidase [Bacteroides salanitro...    100   2e-21
ref|WP_021964446.1|  putative uncharacterized protein [Prevote...    100   2e-21
ref|WP_009186305.1|  alpha-L-fucosidase [Cecembia lonarensis]        100   2e-21
ref|WP_030442968.1|  alpha-L-fucosidase [Actinoplanes sp. RP-A...    100   2e-21
ref|WP_020138374.1|  hypothetical protein [Streptomyces sp. 35...    100   2e-21
ref|WP_025879658.1|  alpha-L-fucosidase [Prevotella oris]            100   2e-21
ref|WP_000683281.1|  alpha-L-fucosidase [Streptococcus pneumon...  99.0    2e-21
ref|WP_010162856.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  99.8    2e-21
gb|ETZ22513.1|  hypothetical protein N824_23225 [Pedobacter sp...  99.0    2e-21
ref|WP_016381818.1|  hypothetical protein [Lactobacillus parac...  95.1    2e-21
gb|KFG06429.1|  alpha-L-fucosidase [Streptomyces scabiei]            100   2e-21
gb|AIA87589.1|  alpha_L_fucos [uncultured Opitutus sp.]            93.2    2e-21
ref|WP_020517422.1|  hypothetical protein [Actinoplanes globis...    100   3e-21
ref|WP_008706305.1|  alpha-L-fucosidase [Ruminococcus sp. 5_1_...  98.6    3e-21
ref|XP_001618439.1|  hypothetical protein NEMVEDRAFT_v1g154558...  93.6    3e-21
ref|WP_012998871.1|  alpha-L-fucosidase [Streptomyces scabiei]       100   3e-21
ref|WP_022380024.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  98.6    3e-21
ref|WP_026649169.1|  alpha-L-fucosidase [Blautia wexlerae]         98.6    3e-21
ref|WP_001843310.1|  alpha-L-fucosidase [Streptococcus pneumon...  97.8    3e-21
ref|WP_006380279.1|  Tat pathway signal sequence domain protei...    100   3e-21
ref|WP_025488214.1|  hypothetical protein [Clostridiales bacte...  98.2    3e-21
ref|WP_025614163.1|  alpha-L-fucosidase [Cellulophaga baltica]     98.6    3e-21
ref|WP_009297568.1|  Tat pathway signal sequence domain protei...    100   3e-21
gb|ELU12410.1|  hypothetical protein CAPTEDRAFT_49184 [Capitel...  93.2    3e-21
ref|WP_007211632.1|  alpha-L-fucosidase [Bacteroides cellulosi...  99.4    3e-21
ref|WP_020267812.1|  hypothetical protein [candidate division ...  98.2    3e-21
ref|WP_011916877.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  99.0    3e-21
ref|WP_029445472.1|  alpha-L-fucosidase [Cellulophaga baltica]     98.6    3e-21
ref|WP_003601925.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  97.8    3e-21
ref|WP_007845929.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  99.4    3e-21
ref|WP_007219158.1|  alpha-L-fucosidase [Bacteroides cellulosi...  99.4    4e-21
ref|WP_005843582.1|  alpha-L-fucosidase [Bacteroides vulgatus]     99.4    4e-21
ref|WP_019062034.1|  hypothetical protein [Streptomyces prunic...    100   4e-21
ref|WP_029426462.1|  alpha-L-fucosidase [Bacteroides cellulosi...  99.4    4e-21
ref|WP_007831454.1|  alpha-L-fucosidase [Bacteroides dorei]        99.4    4e-21
ref|WP_023449210.1|  alpha-L-fucosidase [Asticcacaulis sp. AC402]  99.4    4e-21
ref|WP_005853678.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  99.4    4e-21
ref|WP_028608917.1|  alpha-L-fucosidase [Paenibacillus harenae]    99.0    4e-21
ref|WP_022508422.1|  uncharacterized protein [Bacteroides vulg...  99.4    4e-21
ref|WP_016270892.1|  alpha-L-fucosidase [Bacteroides vulgatus]     99.4    4e-21
ref|WP_000683280.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
ref|WP_009720257.1|  alpha-L-fucosidase [Streptomyces himastat...  97.8    4e-21
ref|WP_000683276.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
gb|AII64783.1|  alpha-L-fucosidase [Bacteroides dorei]             99.4    4e-21
ref|WP_000683277.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
ref|WP_016398339.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
ref|WP_000683274.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
ref|WP_000683279.1|  alpha-L-fucosidase [Streptococcus pneumon...  98.2    4e-21
ref|WP_013291116.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  98.6    5e-21
ref|WP_007839411.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  99.0    5e-21
ref|WP_010215856.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  99.0    5e-21
ref|WP_000683275.1|  alpha-L-fucosidase [Streptococcus pneumon...  97.8    5e-21
ref|WP_000683278.1|  alpha-L-fucosidase [Streptococcus pneumon...  97.8    5e-21
gb|ETK36929.1|  alpha-L-fucosidase [Microbispora sp. ATCC PTA-...  99.8    5e-21
ref|WP_027342037.1|  alpha-L-fucosidase [Hamadaea tsunoensis]      99.4    5e-21
ref|WP_002980031.1|  alpha-L-fucosidase [Chryseobacterium gleum]   99.4    5e-21
ref|WP_022328796.1|  alpha-L-fucosidase [Prevotella sp. CAG:732]   99.0    5e-21
ref|WP_013224956.1|  alpha-L-fucosidase [Amycolatopsis mediter...  99.8    6e-21
ref|WP_020647116.1|  alpha-L-fucosidase [Amycolatopsis balhimy...  99.8    6e-21
ref|WP_008198373.1|  alpha-L-fucosidase [Algoriphagus sp. PR1]     97.8    6e-21
ref|WP_024995829.1|  alpha-L-fucosidase [Bacteroides graminiso...  99.0    6e-21
ref|WP_029276081.1|  alpha-L-fucosidase [Pedobacter borealis]      99.0    6e-21
ref|WP_026334506.1|  alpha-L-fucosidase [Oxalobacteraceae bact...  99.0    6e-21
ref|WP_015264400.1|  alpha-L-fucosidase [Echinicola vietnamensis]  97.8    6e-21
ref|WP_000683273.1|  alpha-L-fucosidase [Streptococcus pneumon...  97.8    6e-21
emb|CDN80212.1|  Alpha-L-fucosidase [Elizabethkingia anophelis]    99.0    6e-21
gb|EKC23767.1|  Plasma alpha-L-fucosidase [Crassostrea gigas]      97.1    6e-21
dbj|GAE84403.1|  alpha-L-fucosidase [Bacteroides reticulotermi...  96.7    7e-21
ref|WP_013917903.1|  alpha-L-fucosidase [Paenibacillus mucilag...  98.2    7e-21
ref|WP_005484135.1|  alpha-L-fucosidase [Streptomyces bottrope...  99.4    7e-21
ref|WP_022040235.1|  putative uncharacterized protein [Bactero...  98.6    7e-21
ref|WP_000683272.1|  alpha-L-fucosidase [Streptococcus pneumon...  97.4    7e-21
ref|WP_025489480.1|  alpha-L-fucosidase [Clostridiales bacteri...  97.8    7e-21
ref|WP_030059361.1|  alpha-L-fucosidase [Streptomyces pyridomy...  99.4    7e-21
ref|WP_030324822.1|  Tat pathway signal protein [Streptomyces ...  99.4    7e-21
ref|WP_026448536.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  98.6    8e-21
ref|WP_028796862.1|  alpha-L-fucosidase [Streptomyces bottrope...  99.4    8e-21
emb|CCY31842.1|  putative uncharacterized protein [Ruminococcu...  97.4    8e-21
ref|WP_013169322.1|  alpha-L-fucosidase [Arcanobacterium haemo...  97.1    8e-21
gb|ETO94711.1|  alpha-L-fucosidase [Lachnospiraceae bacterium ...  97.4    8e-21
ref|WP_021637016.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  97.8    8e-21
ref|WP_014219967.1|  alpha-L-fucosidase [Niastella koreensis]      97.4    8e-21
ref|WP_005717244.1|  Alpha-L-fucosidase [Lactobacillus rhamnosus]  96.7    8e-21
ref|WP_022162234.1|  putative uncharacterized protein [Bactero...  98.2    8e-21
ref|WP_007575478.1|  alpha-L-fucosidase [Prevotella multisacch...  97.4    9e-21
gb|EHA98328.1|  Plasma alpha-L-fucosidase [Heterocephalus glaber]  95.9    9e-21
ref|WP_030935248.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  97.1    9e-21
ref|WP_014370425.1|  alpha-L-fucosidase [Paenibacillus mucilag...  97.8    9e-21
ref|WP_020526237.1|  hypothetical protein [Flexithrix dorotheae]   97.4    9e-21
emb|CDT05094.1|  Glycoside hydrolase family 29 (Alpha-L-fucosi...  98.2    1e-20
ref|WP_018471867.1|  alpha-L-fucosidase [Echinicola pacifica]      97.1    1e-20
ref|WP_021348779.1|  alpha-L-fucosidase [Elizabethkingia menin...  98.6    1e-20
ref|WP_021934234.1|  putative uncharacterized protein [Firmicu...  97.1    1e-20
ref|WP_009088705.1|  alpha-L-fucosidase [Elizabethkingia anoph...  98.6    1e-20
ref|WP_030776092.1|  alpha-L-fucosidase [Streptomyces lavendul...  98.6    1e-20
ref|WP_023354585.1|  Alpha-L-fucosidase [Catonella morbi]          97.1    1e-20
ref|WP_024568011.1|  alpha-L-fucosidase [Elizabethkingia anoph...  98.2    1e-20
ref|WP_021653144.1|  Alpha-L-fucosidase [Blautia sp. KLE 1732]     96.7    1e-20
ref|WP_013445788.1|  alpha-L-fucosidase [Paludibacter propioni...  97.4    1e-20
ref|WP_021977204.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:17]  96.7    1e-20
ref|XP_002479555.1|  hypothetical protein TSTA_024450 [Talarom...  95.9    1e-20
ref|WP_012791863.1|  alpha-L-fucosidase [Chitinophaga pinensis]    97.8    1e-20
ref|WP_029204325.1|  alpha-L-fucosidase [Pedobacter agri]          98.2    1e-20
ref|XP_003204203.1|  PREDICTED: plasma alpha-L-fucosidase-like...  96.3    1e-20
ref|WP_022208609.1|  alpha-L-fucosidase [Bacteroides cellulosi...  97.8    1e-20
ref|WP_007886191.1|  alpha-L-fucosidase [Roseburia inulinivorans]  96.7    1e-20
ref|WP_010187426.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  97.4    1e-20
ref|WP_015793464.1|  alpha-L-fucosidase [Catenulispora acidiph...  97.1    1e-20
ref|WP_020134892.1|  alpha-L-fucosidase [Streptomyces sp. 351M...  98.6    1e-20
ref|XP_003716717.1|  plasma alpha-L-fucosidase [Magnaporthe or...  97.8    2e-20
ref|WP_022067017.1|  putative uncharacterized protein [Blautia...  96.7    2e-20
ref|WP_015793521.1|  alpha-L-fucosidase [Catenulispora acidiph...  98.2    2e-20
ref|WP_029282920.1|  alpha-L-fucosidase [Pedobacter sp. R20-19]    97.4    2e-20
ref|WP_027296714.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...  96.3    2e-20
ref|WP_016481727.1|  Alpha-L-fucosidase [Chthonomonas calidiro...  97.8    2e-20
ref|WP_027375289.1|  alpha-L-fucosidase [Chryseobacterium sp. ...  97.8    2e-20
ref|WP_013429629.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  96.7    2e-20
ref|WP_000683282.1|  alpha-L-fucosidase [Streptococcus mitis]      96.3    2e-20
ref|WP_024021467.1|  alpha-L-fucosidase [Sphingobium sp. C100]     97.1    2e-20
ref|WP_024564259.1|  alpha-L-fucosidase [Elizabethkingia anoph...  97.4    2e-20
ref|WP_030468545.1|  hypothetical protein [Lechevalieria aeroc...  97.4    2e-20
ref|WP_025018670.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  97.1    2e-20
ref|XP_001619417.1|  hypothetical protein NEMVEDRAFT_v1g42027 ...  94.7    2e-20
ref|WP_015908426.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  96.3    3e-20
gb|AIM36937.1|  alpha-L-fucosidase [Sphingobacterium sp. ML3W]     97.1    3e-20
ref|WP_026903680.1|  alpha-L-fucosidase [Pedobacter glucosidil...  96.7    3e-20
ref|WP_030322891.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  97.4    3e-20
ref|WP_009435962.1|  alpha-L-fucosidase [Prevotella sp. oral t...  95.9    3e-20
ref|WP_014679944.1|  alpha-L-fucosidase [Solitalea canadensis]     95.9    3e-20
ref|WP_002995182.1|  alpha-L-fucosidase [Sphingobacterium spir...  97.1    3e-20
ref|WP_020751962.1|  Alpha-L-fucosidase [Lactobacillus rhamnosus]  94.7    3e-20
dbj|BAH12098.1|  unnamed protein product [Homo sapiens]            91.7    3e-20
dbj|GAE65759.1|  putative glycosidase [Chryseobacterium indolo...  97.1    3e-20
gb|AHW58533.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   96.7    4e-20
ref|WP_004375215.1|  alpha-L-fucosidase [Prevotella oris]          96.7    4e-20
gb|KFC38403.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  97.1    4e-20
ref|WP_022383314.1|  glycoside hydrolase family 29 (Alpha-L-fu...  96.7    4e-20
ref|WP_004378232.1|  alpha-L-fucosidase [Prevotella oris]          96.7    4e-20
ref|WP_010519975.1|  alpha-L-fucosidase [Mesoflavibacter zeaxa...  95.9    4e-20
ref|WP_027067680.1|  alpha-L-fucosidase [Maribacter sp. Hel_I_7]   95.5    4e-20
ref|WP_020873226.1|  alpha-L-fucosidase [Streptomyces rapamyci...  95.1    4e-20
ref|WP_021284426.1|  hypothetical protein [Clostridium sp. BL8]    95.1    4e-20
ref|WP_010359147.1|  alpha-fucosidase [Streptomyces acidiscabies]  96.7    5e-20
ref|WP_008622456.1|  MULTISPECIES: alpha-L-fucosidase [Parapre...  96.3    5e-20
ref|WP_013994779.1|  alpha-L-fucosidase [Zobellia galactanivor...  96.7    5e-20
ref|WP_013402623.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  95.5    5e-20
gb|KEQ29357.1|  hypothetical protein N180_07365 [Sphingobacter...  95.1    5e-20
ref|WP_026955232.1|  alpha-L-fucosidase [Algoriphagus vanfonge...  95.1    5e-20
dbj|GAF05717.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  93.2    5e-20
ref|WP_008385426.1|  alpha-L-fucosidase [Halosarcina pallida]      95.1    6e-20
gb|EKC26040.1|  Tissue alpha-L-fucosidase [Crassostrea gigas]      90.5    6e-20
ref|WP_025485232.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  95.5    6e-20
ref|WP_009251031.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  95.5    6e-20
ref|WP_022393035.1|  alpha-L-fucosidase [Bacteroides intestina...  95.9    6e-20
gb|EXU69753.1|  alpha-L-fucosidase [Streptomyces sp. PRh5]         94.7    7e-20
ref|WP_025829880.1|  alpha-L-fucosidase [Prevotella maculosa]      95.9    7e-20
ref|WP_007380041.1|  alpha-L-fucosidase [Streptomyces sviceus]     96.3    7e-20
gb|AAB17401.1|  alpha-L-fucosidase [Canis lupus familiaris]        90.5    7e-20
ref|WP_004383982.1|  alpha-L-fucosidase [Prevotella veroralis]     94.7    7e-20
ref|WP_007387147.1|  alpha-L-fucosidase [Streptomyces sviceus]     96.7    7e-20
ref|WP_013781888.1|  alpha-L-fucosidase [Mahella australiensis]    95.1    7e-20
ref|WP_022054047.1|  alpha-L-fucosidase [Bacteroides plebeius ...  94.0    8e-20
ref|WP_008767035.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  95.5    8e-20
ref|WP_018910535.1|  alpha-L-fucosidase [Prevotella veroralis]     94.4    8e-20
ref|WP_013781871.1|  alpha-L-fucosidase [Mahella australiensis]    94.4    8e-20
ref|WP_016269770.1|  alpha-L-fucosidase [Bacteroides thetaiota...  95.5    8e-20
gb|ETZ21061.1|  hypothetical protein N824_02800 [Pedobacter sp...  95.9    9e-20
ref|WP_008565977.1|  alpha-L-fucosidase [Prevotella maculosa]      95.5    9e-20
ref|XP_006777719.1|  PREDICTED: tissue alpha-L-fucosidase [Myo...  95.1    9e-20
ref|WP_018779959.1|  alpha-L-fucosidase [Arthrobacter sp. 161M...  94.4    9e-20
ref|WP_013994654.1|  alpha-L-fucosidase [Zobellia galactanivor...  93.2    9e-20
ref|WP_009130204.1|  hypothetical protein [Bacteroides oleicip...  95.1    1e-19
gb|KFF16686.1|  alpha-L-fucosidase [Chryseobacterium sp. CTM]      95.5    1e-19
gb|EOB23718.1|  alpha-L-fucosidase [Streptococcus pneumoniae 1...  94.0    1e-19
ref|WP_016276324.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  94.4    1e-19
ref|WP_013666632.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  95.5    1e-19
ref|WP_023455515.1|  alpha-L-fucosidase [Asticcacaulis sp. AC460]  95.1    1e-19
ref|WP_007660866.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  95.1    1e-19
ref|WP_021966984.1|  alpha-L-fucosidase [Bacteroides intestina...  95.1    1e-19
emb|CDF78740.1|  alpha-L-fucosidase (GH29) [Formosa agariphila...  94.4    1e-19
ref|WP_020334571.1|  hypothetical protein [Vibrio natriegens]      94.0    1e-19
ref|WP_016438302.1|  hypothetical protein [Coprococcus sp. HPP...  94.0    1e-19
ref|WP_009262475.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  94.0    1e-19
ref|WP_008974815.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  94.0    1e-19
gb|EWM10408.1|  alpha-L-fucosidase [Kutzneria sp. 744]             95.1    1e-19
ref|WP_027637742.1|  alpha-L-fucosidase [Clostridium cadaveris]    94.0    1e-19
ref|WP_026812334.1|  alpha-L-fucosidase [Arenibacter certesii]     94.0    1e-19
ref|WP_009324731.1|  alpha-L-fucosidase [Subdoligranulum sp. 4...  94.0    1e-19
ref|WP_029280575.1|  alpha-L-fucosidase [Pedobacter borealis]      94.0    2e-19
gb|KDS29100.1|  alpha-L-fucosidase family protein [Bacteroides...  94.0    2e-19
gb|AIA94452.1|  alpha_L_fucos [uncultured Bifidobacterium sp.]     89.4    2e-19
ref|WP_025572067.1|  alpha-L-fucosidase [Flavobacterium sp. JG...  94.4    2e-19
gb|AII64408.1|  alpha-L-fucosidase [Bacteroides dorei]             93.6    2e-19
ref|WP_007853853.1|  alpha-L-fucosidase [Bacteroides dorei]        93.6    2e-19
ref|WP_023391212.1|  Alpha-L-fucosidase [Abiotrophia defectiva]    93.6    2e-19
ref|WP_012285596.1|  alpha-L-fucosidase [Caulobacter sp. K31]      94.4    2e-19
ref|WP_005847124.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  93.6    2e-19
ref|WP_022336155.1|  alpha-L-fucosidase [Firmicutes bacterium ...  93.6    2e-19
ref|WP_018279991.1|  alpha-L-fucosidase [Capnocytophaga cynode...  93.6    2e-19
ref|WP_025663100.1|  alpha-L-fucosidase [Aquimarina megaterium]    93.6    2e-19
ref|WP_007840100.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  93.6    2e-19
dbj|GAF04657.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  94.7    2e-19
ref|WP_016440935.1|  hypothetical protein [Coprococcus sp. HPP...  93.6    2e-19
gb|KFQ43417.1|  Plasma alpha-L-fucosidase [Nestor notabilis]       92.8    2e-19
ref|WP_008671988.1|  alpha-L-fucosidase [Bacteroides sp. 9_1_4...  93.6    2e-19
ref|WP_008625735.1|  alpha-L-fucosidase [Paraprevotella xylani...  94.4    2e-19
ref|WP_031441977.1|  alpha-L-fucosidase [Arenibacter sp. TG409]    93.6    2e-19
emb|CDR14352.1|  Alpha-L-fucosidase [Streptomyces iranensis]       93.2    2e-19
ref|WP_013412619.1|  alpha-L-fucosidase [Caldicellulosiruptor ...  94.0    2e-19
ref|XP_005027497.1|  PREDICTED: plasma alpha-L-fucosidase isof...  92.8    2e-19
gb|EOA95771.1|  Plasma alpha-L-fucosidase [Anas platyrhynchos]     92.8    2e-19
ref|WP_027452718.1|  alpha-L-fucosidase [Prevotella albensis]      94.4    2e-19
gb|AHF24008.1|  alpha-L-fucosidase [uncultured bacterium Conti...  93.6    2e-19
ref|WP_024990691.1|  alpha-L-fucosidase [Prevotella albensis]      94.4    2e-19
ref|WP_002692475.1|  hypothetical protein [Treponema denticola]    93.6    3e-19
ref|WP_031238267.1|  alpha-L-fucosidase [Asticcacaulis sp. AC466]  94.0    3e-19
ref|WP_010698562.1|  hypothetical protein [Treponema denticola]    93.6    3e-19
gb|KFV57654.1|  Plasma alpha-L-fucosidase [Tyto alba]              92.4    3e-19
gb|ESQ85050.1|  hypothetical protein AEAC466_04910 [Asticcacau...  94.0    3e-19
gb|KFA74736.1|  hypothetical protein S40288_08834 [Stachybotry...  94.0    3e-19
ref|WP_018631040.1|  alpha-L-fucosidase [Niabella aurantiaca]      93.2    3e-19
gb|KFV04343.1|  Plasma alpha-L-fucosidase [Pterocles gutturalis]   92.4    3e-19
ref|WP_031298662.1|  alpha-L-fucosidase [Sphingobium lactosutens]  93.6    3e-19
ref|WP_022529888.1|  alpha-L-fucosidase [Lactobacillus shenzhe...  92.8    3e-19
gb|KFF19594.1|  alpha-L-fucosidase [Chryseobacterium sp. JM1]      94.0    3e-19
ref|WP_008237726.1|  alpha-L-fucosidase [Imtechella halotolerans]  92.8    4e-19
ref|XP_004206782.1|  PREDICTED: plasma alpha-L-fucosidase-like...  88.6    4e-19
gb|KFV80579.1|  Plasma alpha-L-fucosidase [Struthio camelus au...  92.0    4e-19
ref|WP_007758476.1|  alpha-L-fucosidase [Bacteroides finegoldii]   92.8    4e-19
ref|WP_022472066.1|  alpha-L-fucosidase [Bacteroides thetaiota...  93.6    4e-19
ref|WP_008644769.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  92.4    4e-19
ref|WP_004301091.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  92.4    4e-19
gb|KEY66411.1|  hypothetical protein S7711_05844 [Stachybotrys...  94.0    4e-19
gb|KFA57274.1|  alpha-L-fucosidase [Clostridiales genomosp. BV...  92.4    4e-19
ref|WP_004311780.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  92.4    4e-19
gb|KFP20502.1|  Plasma alpha-L-fucosidase [Egretta garzetta]       92.0    4e-19
ref|WP_012993237.1|  alpha-L-fucosidase [Clostridiales genomos...  92.4    4e-19
ref|WP_025587360.1|  MULTISPECIES: alpha-L-fucosidase [Sphingo...  93.2    4e-19
ref|WP_002672618.1|  hypothetical protein [Treponema denticola]    92.8    5e-19
gb|KFP59619.1|  Plasma alpha-L-fucosidase [Cariama cristata]       92.0    5e-19
ref|WP_002676837.1|  hypothetical protein [Treponema denticola]    92.8    5e-19
gb|KFW63696.1|  Plasma alpha-L-fucosidase [Pygoscelis adeliae]     92.0    5e-19
ref|XP_007121188.1|  PREDICTED: tissue alpha-L-fucosidase [Phy...  92.4    5e-19
gb|KFQ15806.1|  Plasma alpha-L-fucosidase [Leptosomus discolor]    92.0    5e-19
ref|WP_029724390.1|  alpha-L-fucosidase [Sphingomonas sp. JGI ...  93.2    5e-19
gb|KFP35311.1|  Plasma alpha-L-fucosidase [Chlamydotis undulat...  91.7    5e-19
ref|XP_005507737.1|  PREDICTED: plasma alpha-L-fucosidase [Col...  92.0    5e-19
ref|WP_002665987.1|  alpha-L-fucosidase [Treponema denticola]      92.8    5e-19
gb|KFP46223.1|  Plasma alpha-L-fucosidase [Cathartes aura]         91.7    5e-19
gb|KFM08991.1|  Plasma alpha-L-fucosidase [Aptenodytes forsteri]   91.7    5e-19
ref|WP_014758165.1|  alpha-L-fucosidase [Thermoanaerobacterium...  92.0    5e-19
ref|WP_013546147.1|  alpha-L-fucosidase [Bacteroides helcogenes]   92.4    5e-19
gb|AHG93187.1|  glycoside hydrolase family 29 (alpha-L-fucosid...  92.4    5e-19
gb|KFQ93618.1|  Plasma alpha-L-fucosidase [Nipponia nippon]        91.7    5e-19
ref|XP_008634230.1|  PREDICTED: plasma alpha-L-fucosidase [Cor...  91.7    5e-19
ref|WP_028297744.1|  alpha-L-fucosidase [Olivibacter sitiensis]    92.4    5e-19
gb|KFO90664.1|  Plasma alpha-L-fucosidase [Buceros rhinoceros ...  91.7    5e-19
gb|KFV55273.1|  Plasma alpha-L-fucosidase [Gavia stellata]         91.7    5e-19
ref|WP_002995647.1|  alpha-L-fucosidase [Sphingobacterium spir...  92.4    5e-19
gb|EGT58016.1|  hypothetical protein CAEBREN_05420 [Caenorhabd...  92.0    6e-19
gb|KFO60908.1|  Plasma alpha-L-fucosidase [Corvus brachyrhynchos]  91.7    6e-19
ref|WP_027379536.1|  alpha-L-fucosidase [Chryseobacterium daeg...  93.6    6e-19
gb|EQB12823.1|  hypothetical protein RLDS_18790 [Sphingobium l...  92.4    6e-19
ref|WP_021970561.1|  putative uncharacterized protein [Bactero...  92.4    6e-19
ref|WP_029487874.1|  hypothetical protein [Epulopiscium sp. 'N...  92.8    6e-19
ref|WP_010802712.1|  MULTISPECIES: hypothetical protein [Parab...  92.8    6e-19
ref|WP_008774836.1|  alpha-L-fucosidase [Bacteroides sp. 2_2_4]    92.0    6e-19
ref|WP_026556835.1|  alpha-L-fucosidase [Arthrobacter sp. 35W]     92.0    6e-19
ref|WP_017198762.1|  alpha-L-fucosidase [Arthrobacter sp. M201...  92.0    6e-19
ref|WP_025792365.1|  alpha-L-fucosidase [Prevotella histicola]     92.0    6e-19
ref|WP_022231299.1|  alpha-L-fucosidase [Bacteroides sp. CAG:443]  92.0    7e-19
ref|WP_016195418.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  92.0    7e-19
ref|WP_030471115.1|  alpha-L-fucosidase [Lechevalieria aerocol...  93.6    7e-19
ref|WP_020714278.1|  hypothetical protein [Acidobacteriaceae b...  92.8    7e-19
gb|KFO12180.1|  Plasma alpha-L-fucosidase [Balearica pavonina ...  91.3    7e-19
ref|WP_026809568.1|  alpha-L-fucosidase [Arenibacter latericius]   92.0    7e-19
ref|WP_027202889.1|  alpha-L-fucosidase [Butyricimonas virosa]     92.0    7e-19
ref|WP_016199001.1|  alpha-L-fucosidase [Elizabethkingia menin...  93.2    7e-19
ref|WP_020702823.1|  hypothetical protein [Oxalobacteraceae ba...  92.0    7e-19
ref|WP_007561247.1|  alpha-L-fucosidase [Bacteroides plebeius]     92.0    7e-19
ref|WP_025488219.1|  hypothetical protein [Clostridiales bacte...  92.0    7e-19
gb|KFW06412.1|  Plasma alpha-L-fucosidase [Fulmarus glacialis]     91.3    8e-19
ref|WP_021636180.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  92.0    8e-19
ref|WP_028809988.1|  alpha-L-fucosidase [Streptomyces sp. 351M...  93.6    8e-19
ref|WP_018061303.1|  alpha-L-fucosidase [Caulobacter sp. JGI 0...  92.8    8e-19
ref|WP_005847191.1|  alpha-L-fucosidase [Prevotella dentalis]      94.0    8e-19
ref|WP_022126053.1|  alpha-L-fucosidase [Bacteroides coprocola...  92.0    8e-19
ref|XP_008486246.1|  PREDICTED: putative alpha-L-fucosidase [D...  87.4    8e-19
ref|WP_015310464.1|  alpha-L-fucosidase [Prevotella dentalis]      94.0    8e-19
ref|WP_011776405.1|  MULTISPECIES: alpha-L-fucosidase [Arthrob...  91.7    8e-19
ref|WP_027471299.1|  alpha-L-fucosidase [Cytophaga fermentans]     92.0    8e-19
ref|WP_003066419.1|  alpha-L-fucosidase [Streptococcus equinus]    91.7    9e-19
ref|WP_009346408.1|  alpha-L-fucosidase [Alloprevotella rava]      91.7    9e-19
ref|WP_018710488.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  92.0    9e-19
ref|WP_027951897.1|  alpha-L-fucosidase [Hallella seregens]        93.6    9e-19
ref|WP_020717845.1|  hypothetical protein [Acidobacteriaceae b...  92.4    9e-19
ref|WP_026497275.1|  alpha-L-fucosidase [Butyrivibrio sp. WCD3...  92.0    9e-19
ref|WP_025747415.1|  alpha-L-fucosidase [Caldicoprobacter oshi...  91.3    9e-19
ref|WP_024818477.1|  alpha-L-fucosidase [Arthrobacter sp. 31Y]     91.7    9e-19
ref|WP_008846267.1|  hypothetical protein [Glaciecola lipolytica]  90.9    1e-18
ref|WP_009192983.1|  alpha-L-fucosidase [Streptomyces sp. e14]     91.3    1e-18
ref|WP_025863872.1|  alpha-L-fucosidase [Prolixibacter bellari...  91.7    1e-18
gb|KEZ85284.1|  alpha-L-fucosidase [Clostridium sulfidigenes]      91.7    1e-18
ref|WP_030315010.1|  alpha-L-fucosidase [Streptomyces flavochr...  91.7    1e-18
ref|WP_026670605.1|  alpha-L-fucosidase [Butyrivibrio sp. AE3006]  92.0    1e-18
ref|WP_026542675.1|  alpha-L-fucosidase [Arthrobacter nicotino...  91.3    1e-18
gb|KFQ67736.1|  Plasma alpha-L-fucosidase [Phaethon lepturus]      90.9    1e-18
ref|WP_026523880.1|  alpha-L-fucosidase [Butyrivibrio sp. MB2005]  92.0    1e-18
ref|WP_026548436.1|  alpha-L-fucosidase [Arthrobacter nicotino...  91.3    1e-18
ref|WP_022355109.1|  alpha-L-fucosidase [Bacteroides sp. CAG:875]  92.4    1e-18
ref|XP_005420197.1|  PREDICTED: plasma alpha-L-fucosidase [Geo...  90.9    1e-18
ref|WP_008025871.1|  alpha-L-fucosidase [Bacteroides xylanisol...  91.3    1e-18
gb|KFZ57977.1|  Plasma alpha-L-fucosidase [Caprimulgus carolin...  90.5    1e-18
ref|WP_007832238.1|  alpha-L-fucosidase [Bacteroides dorei]        91.3    1e-18
ref|XP_005438252.1|  PREDICTED: plasma alpha-L-fucosidase [Fal...  90.9    1e-18
ref|WP_015710587.1|  alpha-L-fucosidase [Treponema azotonutric...  91.7    1e-18
gb|AHW61248.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   91.3    1e-18
ref|WP_026293127.1|  hypothetical protein [Rudaea cellulosilyt...  91.7    1e-18
ref|WP_008678000.1|  glycoside hydrolase family 29 (alpha-L-fu...  91.7    1e-18
ref|WP_003005686.1|  alpha-L-fucosidase [Sphingobacterium spir...  92.4    1e-18
ref|WP_004307183.1|  alpha-L-fucosidase [Bacteroides ovatus]       91.3    1e-18
ref|WP_009261933.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  91.3    1e-18
gb|ETN94192.1|  hypothetical protein P278_29960 [Zhouia amylol...  91.7    1e-18
ref|WP_016440556.1|  hypothetical protein [Coprococcus sp. HPP...  91.3    1e-18
ref|WP_026207391.1|  alpha-L-fucosidase [Butyricimonas synergi...  90.9    1e-18
ref|WP_016438857.1|  hypothetical protein [Coprococcus sp. HPP...  91.3    2e-18
ref|WP_023370309.1|  putative alpha-L-fucosidase [Streptococcu...  91.3    2e-18
gb|KFU90296.1|  Plasma alpha-L-fucosidase [Chaetura pelagica]      90.5    2e-18
gb|KFV68034.1|  Plasma alpha-L-fucosidase [Picoides pubescens]     90.5    2e-18
gb|KFP91053.1|  Plasma alpha-L-fucosidase [Apaloderma vittatum]    90.1    2e-18
gb|AHF16990.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       92.0    2e-18
gb|KFW74010.1|  Plasma alpha-L-fucosidase [Phalacrocorax carbo]    90.1    2e-18
ref|WP_029757435.1|  alpha-L-fucosidase [Oxalobacteraceae bact...  91.7    2e-18
ref|WP_031440644.1|  alpha-L-fucosidase [Sphingomonas sp. FUKU...  91.7    2e-18
ref|WP_028072476.1|  alpha-L-fucosidase [Sphingobacterium thal...  92.0    2e-18
gb|KDS49733.1|  alpha-L-fucosidase family protein [Bacteroides...  90.5    2e-18
ref|WP_028040974.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...  91.7    2e-18
ref|WP_008663980.1|  alpha-L-fucosidase [Bacteroides sp. 4_1_36]   90.5    2e-18
gb|KFR11871.1|  Plasma alpha-L-fucosidase [Opisthocomus hoazin]    90.1    2e-18
gb|KFQ48821.1|  Plasma alpha-L-fucosidase [Pelecanus crispus]      90.1    2e-18
ref|WP_004314017.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  90.5    2e-18
ref|WP_008975631.1|  hypothetical protein [Lachnospiraceae bac...  92.4    2e-18
ref|WP_011684411.1|  alpha-L-fucosidase [Candidatus Solibacter...  90.9    2e-18
gb|KFZ67785.1|  Plasma alpha-L-fucosidase [Podiceps cristatus]     90.1    2e-18
ref|WP_026485937.1|  alpha-L-fucosidase [Caldanaerobius polysa...  90.5    2e-18
ref|WP_005927651.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  91.7    2e-18
ref|WP_011009740.1|  alpha-L-fucosidase [Clostridium perfringens]  90.5    2e-18
gb|AIE85759.1|  glycoside hydrolase family 29 (alpha-L-fucosid...  92.0    2e-18
ref|WP_022053511.1|  putative uncharacterized protein [Bactero...  90.5    2e-18
ref|WP_007568106.1|  alpha-L-fucosidase [Bacteroides coprocola]    90.5    2e-18
ref|WP_018363152.1|  alpha-L-fucosidase [Prevotella nanceiensis]   90.5    2e-18
ref|WP_022302193.1|  MULTISPECIES: putative uncharacterized pr...  91.3    3e-18
gb|KFQ02012.1|  Plasma alpha-L-fucosidase [Haliaeetus albicilla]   89.7    3e-18
gb|KFQ76607.1|  Plasma alpha-L-fucosidase [Phoenicopterus rube...  89.7    3e-18
ref|WP_031267277.1|  alpha-L-fucosidase [Cytophagales str. B6]     89.0    3e-18
ref|WP_008678002.1|  Glycoside hydrolase, family 29 [Rhodopire...  92.0    3e-18
ref|WP_028039133.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...  91.3    3e-18
ref|WP_016404321.1|  putative uncharacterized protein [Clostri...  90.9    3e-18
gb|AIA86349.1|  alpha_L_fucos [uncultured Bifidobacterium sp.]     86.3    3e-18
ref|WP_022499793.1|  alpha-L-fucosidase [Firmicutes bacterium ...  90.1    3e-18
ref|WP_010688608.1|  hypothetical protein [Treponema denticola]    90.9    3e-18
ref|WP_022353143.1|  putative uncharacterized protein [Bactero...  91.3    3e-18
ref|WP_025141832.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  90.5    3e-18
ref|WP_028070005.1|  alpha-L-fucosidase [Sphingobacterium thal...  90.1    3e-18
gb|ETN95133.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]        90.1    3e-18
ref|WP_025863552.1|  alpha-L-fucosidase [Prolixibacter bellari...  90.1    3e-18
ref|WP_031392899.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  90.5    3e-18
ref|WP_010693528.1|  hypothetical protein [Treponema denticola]    90.5    3e-18
ref|WP_003002916.1|  alpha-L-fucosidase [Sphingobacterium spir...  90.5    3e-18
ref|WP_008707299.1|  glycoside hydrolase family 29 (alpha-L-fu...  87.4    3e-18
ref|WP_022810759.1|  MULTISPECIES: alpha-L-fucosidase [unclass...  90.5    3e-18
gb|EZH73469.1|  alpha-L-fucosidase [Aquimarina sp. 22II-S11-z7]    90.1    3e-18
ref|WP_008824006.1|  alpha-L-fucosidase [Prevotella histicola]     90.1    3e-18
ref|WP_015896032.1|  alpha-L-fucosidase [Acidobacterium capsul...  90.5    4e-18
ref|WP_020526695.1|  hypothetical protein [Flexithrix dorotheae]   90.1    4e-18
ref|WP_020873227.1|  alpha-L-fucosidase [Streptomyces rapamyci...  89.7    4e-18
ref|WP_024963075.1|  hypothetical protein [Trueperella pyogenes]   89.7    4e-18
ref|WP_026051102.1|  alpha-L-fucosidase [Clostridium tunisiense]   89.7    4e-18
ref|WP_020617804.1|  hypothetical protein [Paenibacillus daeje...  89.4    4e-18
ref|WP_014221516.1|  glycoside hydrolase family protein [Niast...  90.5    4e-18
ref|WP_022352626.1|  alpha-L-fucosidase [Bacteroides sp. CAG:875]  90.1    4e-18
gb|EWH10224.1|  alpha-L-fucosidase [Catenovulum agarivorans DS-2]  90.5    4e-18
gb|AHU89767.1|  alpha-L-fucosidase [Trueperella pyogenes]          89.7    4e-18
ref|WP_013997733.1|  alpha-L-fucosidase [Capnocytophaga canimo...  90.1    4e-18
ref|WP_024993343.1|  alpha-L-fucosidase [Bacteroides paurosacc...  90.5    4e-18
ref|XP_009082126.1|  PREDICTED: plasma alpha-L-fucosidase [Aca...  89.4    4e-18
gb|AHE57095.1|  hypothetical protein NX02_27555 [Sphingomonas ...  90.1    4e-18
ref|XP_001216732.1|  conserved hypothetical protein [Aspergill...  90.9    4e-18
ref|WP_017873281.1|  hypothetical protein [Candidatus Caldatri...  89.7    4e-18
ref|WP_018757413.1|  alpha-L-fucosidase [Paenibacillus terrigena]  89.7    5e-18
gb|KFP73260.1|  Plasma alpha-L-fucosidase [Acanthisitta chloris]   89.4    5e-18
gb|EMC85913.1|  Plasma alpha-L-fucosidase [Columba livia]          89.0    5e-18
ref|WP_031002408.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  89.7    5e-18
ref|WP_016953883.1|  hypothetical protein [Catenovulum agarivo...  90.5    5e-18
ref|WP_025078009.1|  alpha-L-fucosidase [Prevotella fusca]         89.7    5e-18
ref|WP_026770201.1|  alpha-L-fucosidase [Sediminibacterium sp....  89.7    5e-18
ref|XP_009049993.1|  hypothetical protein LOTGIDRAFT_158597 [L...  88.2    5e-18
ref|WP_013078968.1|  alpha-L-fucosidase [Caulobacter segnis]       90.5    5e-18
gb|AHW58723.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   90.5    5e-18
gb|KFQ35132.1|  Plasma alpha-L-fucosidase [Mesitornis unicolor]    89.0    5e-18
gb|AIC77302.1|  alpha-L-fucosidase [uncultured bacterium]          89.4    6e-18
ref|WP_022462075.1|  putative uncharacterized protein [Blautia...  89.7    6e-18
ref|WP_031301492.1|  hypothetical protein [Sphingobacterium pa...  90.5    6e-18
gb|KFV04824.1|  Plasma alpha-L-fucosidase [Tauraco erythrolophus]  89.0    6e-18
ref|WP_015808507.1|  alpha-L-fucosidase [Pedobacter heparinus]     90.5    6e-18
gb|EWM10049.1|  alpha-L-fucosidase [Kutzneria sp. 744]             90.5    6e-18
gb|ERJ60179.1|  hypothetical protein M472_15570 [Sphingobacter...  90.5    6e-18
ref|WP_005679652.1|  alpha-L-fucosidase [Bacteroides caccae]       89.4    6e-18
ref|WP_018195413.1|  MULTISPECIES: hypothetical protein [Fervi...  86.3    7e-18
ref|WP_004338518.1|  alpha-L-fucosidase [Prevotella bivia]         89.7    7e-18
ref|WP_007663631.1|  alpha-L-fucosidase [Caulobacter sp. AP07]     90.1    7e-18
ref|WP_004844769.1|  alpha-L-fucosidase [ [[Ruminococcus] gnavus]  89.4    7e-18
ref|WP_024771494.1|  alpha-L-fucosidase [Aquimarina macrocephali]  89.4    7e-18
ref|WP_009244304.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  89.4    7e-18
ref|WP_005681677.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  89.0    7e-18
ref|WP_002687135.1|  hypothetical protein [Treponema denticola]    89.7    8e-18
ref|WP_030937427.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  90.5    8e-18
ref|WP_007749769.1|  alpha-L-fucosidase [Bacteroides finegoldii]   90.1    8e-18
ref|WP_008677999.1|  Glycoside hydrolase, family 29, subgroup ...  89.4    8e-18
ref|WP_024993683.1|  alpha-L-fucosidase [Bacteroides paurosacc...  89.0    8e-18
ref|WP_026773080.1|  alpha-L-fucosidase [Sediminibacterium sp....  89.4    8e-18
dbj|GAE15109.1|  alpha-L-fucosidase [Bacteroides pyogenes JCM ...  86.7    8e-18
ref|WP_012187579.1|  alpha-L-fucosidase [Herpetosiphon auranti...  89.0    9e-18
ref|XP_005676914.1|  PREDICTED: tissue alpha-L-fucosidase [Cap...  88.2    9e-18
ref|WP_016195427.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  89.7    9e-18
ref|WP_018919197.1|  alpha-L-fucosidase [Prevotella oris]          89.0    9e-18
ref|WP_008628120.1|  alpha-L-fucosidase [Paraprevotella xylani...  90.5    9e-18
dbj|GAF05716.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  89.7    9e-18
ref|WP_008143434.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  89.0    9e-18
ref|WP_022274800.1|  alpha-L-fucosidase family protein [Bacter...  89.7    9e-18
ref|WP_022052406.1|  putative uncharacterized protein [Bactero...  89.7    9e-18
ref|WP_015333353.1|  alpha-L-fucosidase [Fibrella aestuarina]      89.7    1e-17
ref|WP_028070234.1|  alpha-L-fucosidase [Sphingobacterium thal...  89.7    1e-17
ref|WP_025587362.1|  MULTISPECIES: alpha-L-fucosidase [Sphingo...  89.7    1e-17
ref|WP_022041576.1|  uncharacterized protein [Bacteroides cacc...  89.0    1e-17
ref|WP_011682690.1|  glycoside hydrolase family alpha-L-fucosi...  89.4    1e-17
ref|WP_028545690.1|  alpha-L-fucosidase [Paenibacillus taiwane...  88.6    1e-17
ref|WP_021311245.1|  alpha-L-fucosidase [Bacteroidetes bacteri...  89.0    1e-17
ref|WP_028298084.1|  alpha-L-fucosidase [Olivibacter sitiensis]    89.7    1e-17
ref|WP_026389029.1|  glycoside hydrolase [Acidobacteria bacter...  89.4    1e-17
gb|KDN34151.1|  hypothetical protein RSAG8_12764 [Rhizoctonia ...  88.6    1e-17
ref|WP_016271025.1|  alpha-L-fucosidase [Bacteroides vulgatus]     87.4    1e-17
emb|CDA84816.1|  putative uncharacterized protein [Bacteroides...  88.6    1e-17
ref|WP_005682590.1|  alpha-L-fucosidase [Bacteroides caccae]       89.0    1e-17
ref|WP_005678271.1|  alpha-L-fucosidase [Bacteroides caccae]       89.0    1e-17
dbj|GAE23698.1|  alpha-L-fucosidase [Bacteroides pyogenes JCM ...  88.6    1e-17
ref|WP_016277802.1|  alpha-L-fucosidase [Bacteroides massilien...  88.6    1e-17
ref|WP_004271475.1|  alpha-L-fucosidase [Azospirillum amazonense]  89.0    1e-17
ref|WP_022110587.1|  glycoside hydrolase family 29 (Alpha-L-fu...  89.0    1e-17
ref|WP_013304975.1|  alpha-L-fucosidase [Maribacter sp. HTCC2170]  88.6    1e-17
ref|WP_025880367.1|  alpha-L-fucosidase [Prevotella baroniae]      88.6    1e-17
ref|WP_017446853.1|  hypothetical protein [Gayadomonas joobini...  89.0    1e-17
ref|WP_016196143.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  87.8    1e-17
ref|WP_004376566.1|  alpha-L-fucosidase [Prevotella oris]          88.2    2e-17
ref|WP_013559669.1|  alpha-L-fucosidase [Anaerolinea thermophila]  88.2    2e-17
ref|WP_009123133.1|  alpha-amylase [Bacteroides clarus]            89.0    2e-17
ref|WP_018167217.1|  alpha-L-fucosidase [Streptococcus minor]      88.2    2e-17
ref|XP_008304633.1|  PREDICTED: plasma alpha-L-fucosidase-like...  87.4    2e-17
ref|WP_007560664.1|  alpha-L-fucosidase [Bacteroides plebeius]     89.0    2e-17
ref|WP_009247874.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  88.2    2e-17
ref|WP_022218297.1|  putative uncharacterized protein [Bactero...  88.6    2e-17
ref|WP_004374180.1|  alpha-L-fucosidase [Prevotella oris]          88.2    2e-17
gb|AHF15515.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       89.0    2e-17
ref|WP_004377348.1|  alpha-L-fucosidase [Prevotella oris]          88.2    2e-17
ref|WP_004604888.1|  alpha-L-fucosidase [ [Clostridium scindens]   88.2    2e-17
ref|WP_008707306.1|  alpha-L-fucosidase [Rhodopirellula maiorica]  88.6    2e-17
gb|ETZ21371.1|  alpha-L-fucosidase [Pedobacter sp. V48]            88.2    2e-17
ref|WP_013663912.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  88.2    2e-17
dbj|GAE83252.1|  alpha-L-fucosidase [Bacteroides reticulotermi...  86.3    2e-17
ref|WP_031525468.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  89.0    2e-17
ref|WP_006211907.1|  alpha-L-fucosidase [Paenibacillus vortex]     87.8    2e-17
gb|AHG93296.1|  glycoside hydrolase family 29 (alpha-L-fucosid...  88.6    2e-17
gb|ETT32494.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808]  87.8    2e-17
ref|WP_029470575.1|  alpha-L-fucosidase [Clostridiales bacteri...  87.8    2e-17
ref|WP_004288536.1|  alpha-amylase [Bacteroides eggerthii]         88.6    2e-17
gb|AAA52482.1|  alpha-L fucosidase [Homo sapiens]                  86.7    2e-17
ref|WP_004372610.1|  alpha-L-fucosidase [Prevotella oris]          87.8    2e-17
ref|WP_029276054.1|  alpha-L-fucosidase [Pedobacter borealis]      87.8    2e-17
ref|WP_019536719.1|  alpha-L-fucosidase [Paenibacillus ginseng...  87.8    2e-17
ref|WP_004293969.1|  alpha-amylase [Bacteroides eggerthii]         88.6    2e-17
gb|KFI84614.1|  alpha-L-fucosidase [Bifidobacterium pullorum]      87.8    2e-17
ref|WP_007803132.1|  alpha-L-fucosidase [Flavobacterium sp. CF...  88.6    2e-17
ref|WP_010925633.1|  MS119, putative fucosidase [Microscilla s...  88.6    2e-17
gb|KFI61248.1|  alpha-L-fucosidase [Bifidobacterium gallinarum]    87.8    2e-17
ref|WP_013265003.1|  alpha-L-fucosidase [Prevotella melaninoge...  87.8    2e-17
ref|WP_027952067.1|  alpha-L-fucosidase [Hallella seregens]        88.6    3e-17
ref|WP_007920137.1|  alpha-L-fucosidase [Ktedonobacter racemifer]  87.8    3e-17
gb|KFW78192.1|  Tissue alpha-L-fucosidase [Manacus vitellinus]     87.4    3e-17
ref|WP_018614510.1|  hypothetical protein [Segetibacter koreen...  88.2    3e-17
ref|WP_021644844.1|  Alpha-L-fucosidase [Bacteroides pyogenes]     87.4    3e-17
ref|WP_005846361.1|  alpha-L-fucosidase [Prevotella dentalis]      88.6    3e-17
gb|KFC58432.1|  alpha-L-fucosidase [Flavobacterium sp. EM1308]     87.4    3e-17
ref|WP_009011381.1|  alpha-L-fucosidase [Prevotella sp. C561]      87.4    3e-17
ref|WP_022508349.1|  glycoside hydrolase family 29 [Bacteroide...  87.8    3e-17
ref|WP_007449287.1|  alpha-L-fucosidase [Streptomyces sp. W007]    87.4    3e-17
ref|WP_008124795.1|  alpha-L-fucosidase [Prevotella timonensis]    87.4    3e-17
ref|WP_013918434.1|  alpha-L-fucosidase [Paenibacillus mucilag...  87.4    3e-17
gb|EKJ77323.1|  hypothetical protein FPSE_02401 [Fusarium pseu...  88.6    3e-17
ref|WP_005849267.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  87.4    3e-17
ref|WP_028038276.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...  88.6    3e-17
ref|WP_008782525.1|  alpha-L-fucosidase [Bacteroides sp. 3_1_40A]  87.4    3e-17
ref|WP_005842890.1|  alpha-L-fucosidase [Bacteroides vulgatus]     87.4    3e-17
ref|WP_006952978.1|  alpha-L-fucosidase [Prevotella micans]        87.4    3e-17
ref|WP_015898316.1|  alpha-L-fucosidase [Acidobacterium capsul...  88.6    3e-17
ref|WP_017506782.1|  hypothetical protein [alpha proteobacteri...  88.2    3e-17
ref|WP_021686298.1|  Alpha-L-fucosidase [Treponema lecithinoly...  87.0    3e-17
ref|WP_023057814.1|  alpha-L-fucosidase [Prevotella sp. BV3P1]     87.4    3e-17
ref|WP_013305683.1|  alpha-L-fucosidase [Maribacter sp. HTCC2170]  87.4    3e-17
ref|XP_006932130.1|  PREDICTED: plasma alpha-L-fucosidase isof...  86.7    3e-17
ref|WP_002681576.1|  alpha-L-fucosidase [Treponema denticola]      87.8    3e-17
ref|WP_029425671.1|  alpha-L-fucosidase [Bacteroides faecis]       87.4    3e-17
ref|WP_018666439.1|  alpha-amylase [Bacteroides gallinarum]        88.2    3e-17
ref|XP_007096422.1|  PREDICTED: plasma alpha-L-fucosidase isof...  86.7    3e-17
ref|WP_016405049.1|  putative uncharacterized protein [Clostri...  87.4    3e-17
ref|XP_006932132.1|  PREDICTED: plasma alpha-L-fucosidase isof...  86.3    4e-17
ref|WP_029174503.1|  alpha-L-fucosidase [Streptococcus suis]       87.4    4e-17
ref|WP_022302488.1|  alpha-L-fucosidase [Bacteroides faecis CA...  87.4    4e-17
ref|WP_026993950.1|  alpha-L-fucosidase [Flectobacillus major]     88.2    4e-17
ref|WP_023463102.1|  hypothetical protein [Asticcacaulis sp. Y...  88.2    4e-17
ref|WP_024394491.1|  alpha-L-fucosidase [Streptococcus suis]       87.4    4e-17
ref|WP_018919508.1|  alpha-L-fucosidase [Prevotella oris]          87.4    4e-17
ref|WP_025075978.1|  alpha-L-fucosidase [Bacteroides faecichin...  87.0    4e-17
ref|XP_006012134.1|  PREDICTED: plasma alpha-L-fucosidase [Lat...  86.3    4e-17
gb|ETT02642.1|  alpha-L-fucosidase [Prevotella sp. ICM33]          87.0    4e-17
gb|AIE85994.1|  putative glycosyl hydrolase [Fimbriimonas gins...  88.2    4e-17
ref|WP_016525540.1|  hypothetical protein [Treponema maltophilum]  87.4    4e-17
ref|WP_008991065.1|  alpha-L-fucosidase [Galbibacter sp. ck-I2...  87.4    4e-17
ref|WP_015847693.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]  87.0    4e-17
ref|WP_008866910.1|  alpha-L-fucosidase [Flavobacteria bacteri...  87.0    4e-17
ref|WP_022185369.1|  uncharacterized protein [Bacteroides dore...  87.0    4e-17
ref|WP_018061663.1|  hypothetical protein [Caulobacter sp. JGI...  87.8    4e-17
ref|WP_007836642.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  87.0    4e-17
ref|WP_015808505.1|  alpha-L-fucosidase [Pedobacter heparinus]     87.4    4e-17
ref|WP_029178538.1|  alpha-L-fucosidase [Streptococcus suis]       87.0    5e-17
ref|WP_009100250.1|  Alpha-L-fucosidase [Rhodopirellula sp. SWK7]  84.0    5e-17
ref|WP_007671514.1|  alpha-L-fucosidase [Caulobacter sp. AP07]     87.8    5e-17
ref|WP_030311778.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  87.0    5e-17
ref|WP_007560760.1|  alpha-L-fucosidase [Bacteroides plebeius]     87.0    5e-17
ref|WP_005522870.1|  alpha-L-fucosidase [Vibrio mimicus]           86.7    5e-17
ref|WP_007899177.1|  alpha-L-fucosidase [Prevotella stercorea]     87.0    5e-17
ref|XP_005615744.1|  PREDICTED: plasma alpha-L-fucosidase [Can...  87.4    5e-17
ref|WP_015736794.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  87.0    5e-17
ref|WP_022158081.1|  alpha-L-fucosidase [Prevotella sp. CAG:520]   87.0    5e-17
ref|WP_021583556.1|  alpha-L-fucosidase [Prevotella pleuritidis]   86.7    6e-17
gb|KDS23870.1|  alpha-L-fucosidase family protein [Bacteroides...  86.7    6e-17
ref|WP_009591280.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   86.7    6e-17
ref|WP_014031412.1|  alpha-L-fucosidase [Muricauda ruestringen...  86.7    6e-17
gb|ETT68063.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  86.7    6e-17
gb|KDS54340.1|  alpha-L-fucosidase family protein [Bacteroides...  86.7    6e-17
gb|ENH73596.1|  Plasma alpha-L-fucosidase [Fusarium oxysporum ...  87.4    6e-17
gb|KDN54084.1|  hypothetical protein FEM21_27370 [Flavobacteri...  87.4    6e-17
ref|WP_021589001.1|  alpha-L-fucosidase [Prevotella baroniae]      86.7    6e-17
ref|WP_004300973.1|  alpha-L-fucosidase [Bacteroides ovatus]       87.0    6e-17
ref|WP_005826218.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  86.7    7e-17
ref|WP_029197759.1|  alpha-L-fucosidase [Paenibacillus alginol...  86.7    7e-17
ref|WP_022601559.1|  Alpha-L-fucosidase protein [Vibrio nigrip...  86.7    7e-17
ref|WP_005676651.1|  alpha-L-fucosidase [Bacteroides caccae]       86.7    7e-17
ref|WP_020526235.1|  hypothetical protein [Flexithrix dorotheae]   87.4    7e-17
gb|KDS59320.1|  alpha-L-fucosidase family protein [Bacteroides...  86.3    7e-17
ref|WP_019831419.1|  hypothetical protein [Sphingomonas sp. PR...  87.0    7e-17
gb|EUC62946.1|  alpha-L-fucosidase [Rhizoctonia solani AG-3 Rh...  87.8    7e-17
ref|WP_029176270.1|  alpha-L-fucosidase [Streptococcus suis]       86.7    7e-17
ref|WP_022042521.1|  uncharacterized protein [Bacteroides cacc...  86.7    7e-17
gb|KFZ19495.1|  hypothetical protein V501_00636 [Pseudogymnoas...  87.8    7e-17
ref|WP_007368168.1|  alpha-L-fucosidase [Prevotella multiformis]   86.3    7e-17
ref|WP_024405679.1|  alpha-L-fucosidase [Streptococcus suis]       86.3    7e-17
gb|KFZ80990.1|  alpha-L-fucosidase [Amycolatopsis sp. MJM2582]     86.3    7e-17
ref|WP_029281879.1|  alpha-L-fucosidase [Pedobacter sp. R20-19]    86.3    8e-17
ref|WP_024988133.1|  alpha-L-fucosidase [Bacteroides acidifaci...  86.3    8e-17
ref|WP_029943356.1|  alpha-L-fucosidase [Streptococcus suis]       86.3    8e-17
ref|WP_024417174.1|  alpha-L-fucosidase [Streptococcus suis]       86.3    8e-17
ref|WP_025571090.1|  alpha-L-fucosidase [Flavobacterium sp. JG...  87.0    8e-17
ref|WP_002697083.1|  alpha-L-fucosidase [Treponema phagedenis]     86.3    8e-17
gb|EPQ03282.1|  Plasma alpha-L-fucosidase [Myotis brandtii]        86.3    8e-17
ref|WP_022401587.1|  uncharacterized protein [Bacteroides unif...  86.3    8e-17
ref|WP_022426307.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:90]  84.0    8e-17
ref|WP_016333835.1|  alpha-L-fucosidase [Amycolatopsis orienta...  86.3    8e-17
ref|WP_021990108.1|  alpha-L-fucosidase [Prevotella sp. CAG:1092]  86.3    8e-17
gb|AIG77206.1|  Hypothetical protein AJAP_21740 [Amycolatopsis...  86.3    8e-17
gb|EWZ30974.1|  alpha-L-fucosidase [Fusarium oxysporum Fo47]       87.0    8e-17
gb|EPY85092.1|  tissue alpha-L-fucosidase precursor [Camelus f...  85.5    8e-17
gb|EPC70039.1|  alpha-L-fucosidase [Lactobacillus paracasei su...  84.7    8e-17
gb|EXK36330.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  87.0    8e-17
gb|KFU78087.1|  alpha-L-fucosidase [Amycolatopsis lurida NRRL ...  86.3    8e-17
gb|EXM22822.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  87.0    8e-17
gb|EWY82402.1|  alpha-L-fucosidase [Fusarium oxysporum FOSC 3-a]   87.0    8e-17
ref|WP_004195670.1|  alpha-L-fucosidase [Streptococcus suis]       86.3    8e-17
gb|EJT77348.1|  plasma alpha-L-fucosidase [Gaeumannomyces gram...  87.0    9e-17
ref|WP_024752049.1|  alpha-L-fucosidase [Treponema phagedenis]     85.9    9e-17
ref|WP_025837895.1|  alpha-L-fucosidase [Prevotella scopos]        86.3    9e-17
gb|KDU79479.1|  Alpha-L-fucosidase [Porphyromonas sp. KLE 1280]    86.3    9e-17
gb|KFP27767.1|  Plasma alpha-L-fucosidase [Colius striatus]        85.5    9e-17
gb|EXA36634.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  87.0    9e-17
dbj|GAE18777.1|  alpha-L-fucosidase [Bacteroides pyogenes JCM ...  86.3    9e-17
ref|WP_009433189.1|  alpha-L-fucosidase [Porphyromonas sp. ora...  86.3    9e-17
ref|WP_022310634.1|  alpha-L-fucosidase [Prevotella sp. CAG:474]   86.3    9e-17
ref|WP_007814803.1|  alpha-L-fucosidase [Rhizobium sp. CF142]      86.3    9e-17
gb|EWG53851.1|  alpha-L-fucosidase [Fusarium verticillioides 7...  87.0    9e-17
gb|EXL95926.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  87.0    9e-17
ref|WP_026309769.1|  alpha-L-fucosidase [Niabella aurantiaca]      87.0    9e-17
ref|WP_027325071.1|  alpha-L-fucosidase [Bacteroides pyogenes]     85.9    9e-17
ref|WP_021672668.1|  Alpha-L-fucosidase [Prevotella sp. F0091]     85.9    9e-17
ref|WP_007278955.1|  alpha-L-fucosidase [Lentisphaera araneosa]    87.0    9e-17
ref|WP_019883646.1|  alpha-L-fucosidase [Lactobacillus paracasei]  83.2    9e-17
gb|EMT67482.1|  Plasma alpha-L-fucosidase [Fusarium oxysporum ...  87.0    1e-16
ref|WP_015331114.1|  alpha-L-fucosidase [Fibrella aestuarina]      87.0    1e-16
ref|WP_007278439.1|  alpha-L-fucosidase precursor [Lentisphaer...  87.0    1e-16
ref|WP_024381865.1|  alpha-L-fucosidase [Streptococcus suis]       86.3    1e-16
gb|KDN69927.1|  putative alpha-L-fucosidase [Colletotrichum su...  87.0    1e-16
ref|WP_010918680.1|  alpha-L-fucosidase [Caulobacter vibrioides]   86.7    1e-16
ref|WP_022335331.1|  putative uncharacterized protein [Firmicu...  86.3    1e-16
gb|EPC52594.1|  alpha-L-fucosidase [Lactobacillus paracasei su...  84.3    1e-16
pdb|4NI3|A  Chain A, Crystal Structure Of Gh29 Family Alpha-l-...  86.7    1e-16
ref|WP_026871073.1|  alpha-L-fucosidase [Inquilinus limosus]       85.9    1e-16
ref|WP_025068181.1|  alpha-L-fucosidase [Prevotella denticola]     85.9    1e-16
emb|CCT67811.1|  related to putative alpha-L-fucosidase precur...  86.7    1e-16
ref|WP_019026436.1|  hypothetical protein [Colwellia piezophila]   86.7    1e-16
ref|WP_016269038.1|  MULTISPECIES: hypothetical protein [Bacte...  86.3    1e-16
ref|XP_391430.1|  hypothetical protein FG11254.1 [Fusarium gra...  86.7    1e-16
ref|WP_010136622.1|  fucosidase [Flavobacteriaceae bacterium S85]  86.7    1e-16
ref|WP_008767257.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  86.3    1e-16
gb|EXL73351.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  86.7    1e-16
ref|WP_018475039.1|  hypothetical protein [Echinicola pacifica]    85.5    1e-16
ref|WP_003575535.1|  alpha-L-fucosidase [Lactobacillus casei]      85.1    1e-16
gb|EYB22939.1|  hypothetical protein FG05_11254 [Fusarium gram...  86.7    1e-16
ref|WP_022455570.1|  glycoside hydrolase family 29 (Alpha-L-fu...  85.9    1e-16
gb|EGU77371.1|  hypothetical protein FOXB_12119 [Fusarium oxys...  86.7    1e-16
ref|XP_001640045.1|  predicted protein [Nematostella vectensis]    85.9    1e-16
pdb|2WVT|A  Chain A, Crystal Structure Of An Alpha-L-Fucosidas...  85.9    1e-16
ref|WP_029178055.1|  alpha-L-fucosidase [Streptococcus suis]       85.9    1e-16
pdb|4PCT|A  Chain A, Crystal Structure Of A Bacterial Fucosida...  85.9    1e-16
pdb|2WVV|B  Chain B, Crystal Structure Of An Alpha-L-Fucosidas...  85.9    1e-16
pdb|2XIB|A  Chain A, Crystal Structure Of An Alpha-L-Fucosidas...  85.9    1e-16
ref|WP_021666431.1|  Alpha-L-fucosidase [Porphyromonas sp. ora...  85.9    1e-16
gb|KFQ21434.1|  Plasma alpha-L-fucosidase [Merops nubicus]         85.1    1e-16
pdb|4PEE|A  Chain A, Crystal Structure Of A Bacterial Fucosida...  85.9    1e-16
ref|WP_013634637.1|  glycoside hydrolase family protein [Pedob...  86.3    1e-16
ref|WP_018615486.1|  alpha-L-fucosidase [Segetibacter koreensis]   85.9    1e-16
ref|WP_008761818.1|  alpha-L-fucosidase [Bacteroides sp. 1_1_14]   85.9    1e-16
pdb|4JL2|A  Chain A, Crystal Structure Of A Bacterial Fucosida...  85.9    1e-16
pdb|2WVS|A  Chain A, Crystal Structure Of An Alpha-L-Fucosidas...  85.9    1e-16
ref|WP_012785114.1|  alpha-L-fucosidase [Catenulispora acidiph...  85.5    1e-16
gb|EXZ06791.1|  alpha-L-fucosidase family protein [Bacteroides...  85.9    1e-16
pdb|2WVV|A  Chain A, Crystal Structure Of An Alpha-L-Fucosidas...  85.9    1e-16
ref|WP_030231230.1|  hypothetical protein [Streptomyces sp. NR...  86.7    1e-16
ref|WP_004369737.1|  alpha-L-fucosidase [Prevotella oralis]        85.5    1e-16
gb|EXZ95827.1|  alpha-L-fucosidase family protein [Bacteroides...  85.9    1e-16
ref|WP_016279564.1|  hypothetical protein [Lachnospiraceae bac...  85.9    1e-16
ref|WP_005785086.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  85.9    1e-16
ref|WP_028910530.1|  alpha-L-fucosidase [Prevotella sp. AGR2160]   86.3    1e-16
ref|WP_006381502.1|  alpha-L-fucosidase [Streptomyces turgidis...  85.5    1e-16
ref|WP_003660543.1|  alpha-L-fucosidase [Lactobacillus paracasei]  85.1    1e-16
ref|XP_008946454.1|  PREDICTED: plasma alpha-L-fucosidase [Mer...  85.1    1e-16
gb|EXY14545.1|  alpha-L-fucosidase family protein [Bacteroides...  85.5    1e-16
ref|WP_011202181.1|  alpha-L-fucosidase [Bacteroides fragilis]     85.5    1e-16
ref|WP_022208176.1|  uncharacterized protein [Bacteroides cell...  85.5    2e-16
ref|WP_003566826.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  84.7    2e-16
gb|EXY52415.1|  alpha-L-fucosidase family protein [Bacteroides...  85.5    2e-16
ref|WP_024377506.1|  alpha-L-fucosidase [Streptococcus suis]       85.5    2e-16
ref|WP_008763216.1|  alpha-L-fucosidase [Bacteroides sp. 1_1_14]   85.5    2e-16
ref|WP_022011956.1|  glycoside hydrolase family 29 [Bacteroide...  85.5    2e-16
ref|WP_029180290.1|  alpha-L-fucosidase [Streptococcus suis]       85.5    2e-16
ref|WP_008767711.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  85.5    2e-16
ref|WP_018631050.1|  alpha-L-fucosidase [Niabella aurantiaca]      86.3    2e-16
gb|EXZ40845.1|  alpha-L-fucosidase family protein [Bacteroides...  85.5    2e-16
gb|KER49892.1|  alpha-L-fucosidase [Bacteroides fragilis]          85.5    2e-16
ref|WP_005818464.1|  alpha-L-fucosidase [Bacteroides fragilis]     85.5    2e-16
gb|KFX75406.1|  alpha-L-fucosidase [Bacteroides fragilis]          85.5    2e-16
gb|EYA00444.1|  alpha-L-fucosidase family protein [Bacteroides...  85.5    2e-16
ref|WP_005775612.1|  alpha-L-fucosidase [Bacteroides fragilis]     85.5    2e-16
ref|WP_004351690.1|  alpha-L-fucosidase [Prevotella denticola]     85.5    2e-16
ref|WP_011674607.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  84.7    2e-16
ref|WP_005810226.1|  alpha-L-fucosidase [Bacteroides fragilis]     85.5    2e-16
gb|KER59130.1|  alpha-L-fucosidase [Bacteroides fragilis]          85.5    2e-16
ref|WP_005606553.1|  alpha-L-fucosidase [Granulicatella adiacens]  85.5    2e-16
ref|WP_003594975.1|  alpha-L-fucosidase [Lactobacillus casei]      84.7    2e-16
ref|WP_028559571.1|  alpha-L-fucosidase [Paenibacillus pinihumi]   85.5    2e-16
gb|EFQ36257.1|  alpha-L-fucosidase [Colletotrichum graminicola...  86.3    2e-16
gb|EXY85913.1|  alpha-L-fucosidase family protein [Bacteroides...  85.5    2e-16
emb|CDQ38401.1|  Alpha-L-fucosidase [Virgibacillus sp. Vm-5]       85.1    2e-16
ref|WP_022340607.1|  glycoside hydrolase family 29 (Alpha-L-fu...  85.1    2e-16
ref|WP_008614653.1|  alpha-L-fucosidase [Joostella marina]         85.1    2e-16
gb|AIC77299.1|  alpha-L-fucosidase [uncultured bacterium]          85.1    2e-16
ref|WP_029913546.1|  alpha-L-fucosidase [Caulobacter sp. UNC35...  85.9    2e-16
ref|WP_016266906.1|  alpha-L-fucosidase [Bacteroides thetaiota...  85.1    2e-16
ref|WP_024994871.1|  alpha-L-fucosidase [Bacteroides paurosacc...  85.1    2e-16
ref|WP_009100270.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  85.5    2e-16
ref|WP_022470316.1|  alpha-L-fucosidase [Bacteroides thetaiota...  85.1    2e-16
gb|EXY42246.1|  alpha-L-fucosidase family protein [Bacteroides...  85.1    2e-16
ref|WP_031143449.1|  alpha-L-fucosidase [Streptomyces xanthoph...  85.1    2e-16
ref|WP_005937384.1|  MULTISPECIES: hypothetical protein [Bacte...  85.1    2e-16
ref|XP_008120508.1|  PREDICTED: plasma alpha-L-fucosidase [Ano...  85.1    2e-16
ref|WP_029465764.1|  alpha-L-fucosidase [Chitinophaga sp. JGI ...  85.9    2e-16
ref|WP_031154734.1|  alpha-L-fucosidase [Streptomyces xanthoph...  84.7    2e-16
ref|WP_024406082.1|  alpha-L-fucosidase [Streptococcus suis]       85.1    2e-16
ref|WP_029724999.1|  hypothetical protein [Sphingomonas sp. JG...  81.6    2e-16
ref|WP_004360733.1|  alpha-L-fucosidase [Prevotella melaninoge...  85.1    2e-16
ref|WP_029175467.1|  alpha-L-fucosidase [Streptococcus suis]       85.1    2e-16
ref|WP_018754471.1|  alpha-L-fucosidase [Paenibacillus terrigena]  84.7    2e-16
ref|WP_013671662.1|  alpha-L-fucosidase [Prevotella denticola]     84.7    2e-16
ref|WP_012794370.1|  alpha-L-fucosidase [Chitinophaga pinensis]    85.1    2e-16
ref|WP_005399130.1|  alpha-L-fucosidase [Helcococcus kunzii]       84.7    2e-16
ref|WP_022456335.1|  putative alpha-L-fucosidase [Parabacteroi...  85.1    2e-16
ref|WP_022038729.1|  alpha-L-fucosidase [Bacteroides sp. CAG:702]  85.1    3e-16
ref|WP_022020395.1|  alpha-L-fucosidase [Bacteroides sp. CAG:661]  85.5    3e-16
ref|WP_022052857.1|  putative uncharacterized protein [Bactero...  85.1    3e-16
gb|KFV90592.1|  Tissue alpha-L-fucosidase [Eurypyga helias]        84.3    3e-16
ref|WP_016384726.1|  Alpha-L-fucosidase [Lactobacillus paracasei]  84.3    3e-16
ref|XP_004947954.1|  PREDICTED: tissue alpha-L-fucosidase isof...  84.7    3e-16
gb|EQB38087.1|  hypothetical protein M948_05810 [Virgibacillus...  84.7    3e-16
ref|WP_026530126.1|  alpha-L-fucosidase [Arthrobacter sanguinis]   84.7    3e-16
ref|WP_014638948.1|  alpha-L-fucosidase [Streptococcus suis]       84.7    3e-16
ref|WP_028548305.1|  alpha-L-fucosidase [Paenibacillus sp. UNC...  84.7    3e-16
ref|WP_016523086.1|  hypothetical protein [Treponema medium]       85.1    3e-16
ref|WP_029173300.1|  alpha-L-fucosidase [Streptococcus suis]       84.7    3e-16
ref|WP_019896246.1|  alpha-L-fucosidase [Lactobacillus paracasei]  84.0    3e-16
ref|WP_031335158.1|  alpha-L-fucosidase [Virgibacillus sp. CM-4]   84.7    3e-16
ref|WP_016373099.1|  alpha-L-fucosidase [Lactobacillus paracasei]  84.0    3e-16
gb|ETZ22086.1|  hypothetical protein N824_24490 [Pedobacter sp...  84.7    3e-16
ref|WP_013548670.1|  alpha-L-fucosidase [Bacteroides helcogenes]   84.7    3e-16
ref|WP_021993097.1|  uncharacterized protein [Prevotella sp. C...  84.7    3e-16
ref|XP_004752803.1|  PREDICTED: plasma alpha-L-fucosidase [Mus...  84.3    3e-16
ref|WP_022126004.1|  alpha-L-fucosidase [Bacteroides coprocola...  84.7    3e-16
gb|EWZ80561.1|  alpha-L-fucosidase [Fusarium oxysporum f. sp. ...  85.5    3e-16
ref|WP_024992398.1|  alpha-L-fucosidase [Prevotella pleuritidis]   84.3    3e-16
ref|WP_018626146.1|  hypothetical protein [Niabella aurantiaca]    85.1    3e-16
ref|WP_028899025.1|  alpha-L-fucosidase [Prevotella sp. HJM029]    84.3    3e-16
ref|WP_007133962.1|  alpha-L-fucosidase [Prevotella salivae]       84.3    4e-16
ref|WP_022507867.1|  glycoside hydrolase family 29 [Bacteroide...  83.6    4e-16
gb|EXZ15283.1|  alpha-L-fucosidase family protein [Bacteroides...  84.7    4e-16
ref|WP_025072832.1|  alpha-L-fucosidase [Prevotella timonensis]    84.3    4e-16
ref|WP_010738450.1|  alpha-L-fucosidase [Enterococcus hirae]       84.3    4e-16
ref|WP_025726124.1|  alpha-L-fucosidase [Bacteroides sp. 14(A)]    84.3    4e-16
ref|WP_022311275.1|  alpha-L-fucosidase [Prevotella sp. CAG:474]   84.3    4e-16
ref|WP_018631036.1|  hypothetical protein [Niabella aurantiaca]    85.1    4e-16
ref|WP_016370664.1|  hypothetical protein [Lactobacillus parac...  83.2    4e-16
ref|WP_021850668.1|  putative uncharacterized protein [Firmicu...  84.7    4e-16
ref|WP_029873466.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.3    4e-16
ref|WP_009100285.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  84.3    4e-16
ref|WP_017992492.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.3    4e-16
ref|WP_023961891.1|  alpha-L-fucosidase [Paenibacillus sp. JCM...  84.3    5e-16
ref|WP_018195728.1|  MULTISPECIES: hypothetical protein [uncla...  84.3    5e-16
gb|KDR92353.1|  alpha-L-fucosidase [Enterococcus hirae]            84.3    5e-16
ref|WP_013664034.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  84.3    5e-16
gb|AIE85654.1|  glycosyl hydrolase [Fimbriimonas ginsengisoli ...  84.0    5e-16
ref|WP_003538647.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.3    5e-16
ref|WP_011654304.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.3    5e-16
ref|WP_022020516.1|  alpha-L-fucosidase [Bacteroides sp. CAG:661]  84.0    5e-16
ref|WP_007127581.1|  alpha-L-fucosidase [Paenibacillus lactis]     84.3    5e-16
ref|WP_004378987.1|  alpha-L-fucosidase [Prevotella oulorum]       84.0    5e-16
ref|WP_028406051.1|  alpha-L-fucosidase [Bacillus sp. J13]         84.3    5e-16
ref|WP_018483054.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    5e-16
ref|WP_030980021.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  84.0    5e-16
ref|WP_012491709.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  83.2    5e-16
ref|WP_030924729.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  84.0    5e-16
ref|WP_019056917.1|  alpha-L-fucosidase [Streptomyces prunicolor]  84.0    5e-16
gb|ETK02944.1|  alpha-L-fucosidase [Tannerella sp. oral taxon ...  84.0    5e-16
ref|WP_013481052.1|  alpha-L-fucosidase [Asticcacaulis excentr...  84.7    5e-16
ref|WP_021847108.1|  alpha-L-fucosidase [Bacteroides sp. CAG:598]  84.0    5e-16
ref|WP_016364351.1|  hypothetical protein [Lactobacillus parac...  83.2    5e-16
gb|ERM56457.1|  hypothetical protein P781_07775 [Vibrio mimicu...  82.4    5e-16
ref|WP_013760014.1|  alpha-L-fucosidase [Porphyromonas asaccha...  84.0    6e-16
ref|WP_031343698.1|  alpha-L-fucosidase [Vibrio mimicus]           82.0    6e-16
gb|EQB78779.1|  fucosidase, alpha-L- 2, plasma [Camelus ferus]     82.8    6e-16
gb|ESQ83491.1|  hypothetical protein AEAC466_12510 [Asticcacau...  84.7    6e-16
ref|WP_018449187.1|  MULTISPECIES: alpha-L-fucosidase [Rhizobium]  84.0    6e-16
ref|WP_024322559.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    6e-16
ref|XP_007947007.1|  PREDICTED: plasma alpha-L-fucosidase [Ory...  83.6    6e-16
ref|WP_008615319.1|  alpha-L-fucosidase [Joostella marina]         84.3    6e-16
ref|WP_027690341.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    6e-16
ref|WP_022393537.1|  alpha-L-fucosidase [Bacteroides intestina...  84.0    6e-16
ref|WP_018246738.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    6e-16
ref|WP_031238885.1|  alpha-L-fucosidase [Asticcacaulis sp. AC466]  84.3    6e-16
gb|AIC77298.1|  alpha-L-fucosidase [uncultured bacterium]          83.6    6e-16
ref|WP_027683135.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    6e-16
ref|WP_005937116.1|  hypothetical protein [Bacteroides massili...  84.0    6e-16
ref|WP_022042794.1|  uncharacterized protein [Bacteroides cacc...  84.0    7e-16
ref|WP_021847974.1|  alpha-L-fucosidase [Bacteroides sp. CAG:598]  84.3    7e-16
ref|WP_005678930.1|  alpha-L-fucosidase [Bacteroides caccae]       84.0    7e-16
gb|EXZ99372.1|  alpha-L-fucosidase family protein [Bacteroides...  83.6    7e-16
ref|WP_008143623.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  84.0    7e-16
ref|WP_020047963.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    7e-16
ref|WP_018494004.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  84.0    7e-16
ref|WP_016196481.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  84.0    7e-16
gb|EXZ48210.1|  alpha-L-fucosidase family protein [Bacteroides...  83.6    7e-16
ref|WP_022354346.1|  putative uncharacterized protein [Bactero...  83.6    7e-16
ref|WP_016227351.1|  hypothetical protein [Lachnospiraceae bac...  83.6    7e-16
ref|WP_011958635.1|  alpha-L-fucosidase [Roseiflexus sp. RS-1]     83.6    7e-16
ref|WP_029186480.1|  alpha-L-fucosidase [Streptococcus suis]       83.6    7e-16
ref|WP_005682237.1|  alpha-L-fucosidase [Bacteroides caccae]       84.0    7e-16
ref|WP_007566945.1|  alpha-L-fucosidase [Bacteroides coprocola]    83.6    7e-16
ref|WP_013666128.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  84.3    7e-16
ref|WP_004331923.1|  alpha-L-fucosidase [Porphyromonas asaccha...  83.6    7e-16
ref|WP_007664499.1|  alpha-L-fucosidase [Bacteroides intestina...  83.6    7e-16
ref|WP_010720073.1|  hypothetical protein [Enterococcus faeciu...  83.6    7e-16
ref|WP_026178763.1|  alpha-L-fucosidase [Streptomyces sp. R1-N...  83.6    7e-16
ref|WP_027827468.1|  alpha-L-fucosidase [Lactobacillus harbine...  83.6    8e-16
ref|WP_013997318.1|  alpha-L-fucosidase [Capnocytophaga canimo...  83.6    8e-16
ref|XP_004895705.1|  PREDICTED: plasma alpha-L-fucosidase isof...  82.8    8e-16
ref|WP_029712682.1|  alpha-L-fucosidase [candidate division BR...  83.6    8e-16
gb|KER51503.1|  alpha-L-fucosidase [Bacteroides fragilis]          83.6    8e-16
gb|EWC92024.1|  alpha-L-fucosidase [Porphyromonas catoniae ATC...  83.6    8e-16
ref|WP_022012040.1|  alpha-L-fucosidase [Bacteroides fragilis ...  83.6    8e-16
ref|WP_005780841.1|  alpha-L-fucosidase [Bacteroides fragilis]     83.6    8e-16
ref|WP_021653148.1|  MULTISPECIES: Alpha-L-fucosidase [Clostri...  83.2    8e-16
ref|WP_021825559.1|  alpha-L-fucosidase [Prevotella salivae]       83.6    8e-16
ref|WP_027125938.1|  alpha-L-fucosidase [Gelidibacter mesophilus]  83.6    8e-16
ref|WP_005807843.1|  alpha-L-fucosidase [Bacteroides fragilis]     83.6    8e-16
ref|WP_014225862.1|  alpha-L-fucosidase [Tannerella forsythia]     83.6    8e-16
ref|WP_028967133.1|  alpha-L-fucosidase [Sphingomonas phyllosp...  84.3    8e-16
gb|KER77352.1|  alpha-L-fucosidase [Bacteroides fragilis]          83.6    8e-16
ref|WP_009720419.1|  alpha-L-fucosidase [Streptomyces himastat...  83.2    8e-16
ref|WP_005166127.1|  Alpha-L-fucosidase [Amycolatopsis azurea]     83.6    8e-16
ref|WP_022180263.1|  putative uncharacterized protein [Firmicu...  83.6    8e-16
ref|WP_029429102.1|  alpha-L-fucosidase [Bacteroides cellulosi...  83.6    8e-16
ref|WP_022128984.1|  glycoside hydrolase family 29 (Alpha-L-fu...  83.6    9e-16
ref|WP_003008132.1|  alpha-L-fucosidase [Sphingobacterium spir...  84.3    9e-16
ref|WP_007217268.1|  alpha-L-fucosidase [Bacteroides cellulosi...  83.6    9e-16
ref|WP_015808515.1|  alpha-L-fucosidase [Pedobacter heparinus]     84.3    9e-16
ref|WP_014057531.1|  alpha-L-fucosidase [Streptomyces violaceu...  83.2    9e-16
ref|WP_007029198.1|  Alpha-L-fucosidase [Amycolatopsis decapla...  83.2    9e-16
ref|XP_008070275.1|  PREDICTED: plasma alpha-L-fucosidase [Tar...  82.8    9e-16
ref|WP_017446900.1|  hypothetical protein [Gayadomonas joobini...  84.0    9e-16
gb|EXZ09000.1|  alpha-L-fucosidase family protein [Bacteroides...  83.2    1e-15
ref|WP_005802715.1|  alpha-L-fucosidase [Bacteroides fragilis]     83.2    1e-15
ref|WP_008769537.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  83.2    1e-15
ref|WP_005799023.1|  alpha-L-fucosidase [Bacteroides fragilis]     83.2    1e-15
gb|AHG93142.1|  glycoside hydrolase family 29 (alpha-L-fucosid...  83.2    1e-15
ref|WP_014856765.1|  alpha-L-fucosidase [Melioribacter roseus]     82.8    1e-15
ref|WP_010802704.1|  MULTISPECIES: hypothetical protein [Parab...  82.8    1e-15
ref|WP_005468288.1|  Alpha-L-fucosidase [Porphyromonas catoniae]   83.2    1e-15
ref|WP_022347164.1|  putative uncharacterized protein [Bactero...  83.2    1e-15
ref|WP_016662578.1|  alpha-L-fucosidase [Bacteroides stercoris]    83.2    1e-15
ref|WP_005789789.1|  alpha-L-fucosidase [Bacteroides fragilis]     83.2    1e-15
ref|WP_007658193.1|  hypothetical protein [Parabacteroides gol...  82.8    1e-15
ref|WP_022130879.1|  putative uncharacterized protein [Bactero...  83.2    1e-15
ref|XP_004044824.1|  PREDICTED: plasma alpha-L-fucosidase-like...  81.6    1e-15
ref|WP_014787687.1|  alpha-L-fucosidase [Terriglobus roseus]       83.6    1e-15
ref|WP_031500851.1|  hypothetical protein [Bryobacter aggregatus]  83.2    1e-15
ref|WP_009132768.1|  hypothetical protein [Bacteroides oleicip...  83.2    1e-15
ref|WP_018337542.1|  hypothetical protein [Butyricimonas syner...  83.2    1e-15
ref|WP_005233765.1|  alpha-L-fucosidase [Enterococcus casselif...  83.2    1e-15
ref|WP_022043892.1|  alpha-L-fucosidase [Alistipes finegoldii ...  83.2    1e-15
ref|WP_028404061.1|  alpha-L-fucosidase [Bacillus sp. J13]         83.2    1e-15
ref|WP_005814804.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  83.2    1e-15
ref|WP_013042280.1|  alpha-L-fucosidase [Coraliomargarita akaj...  83.6    1e-15
ref|WP_026775023.1|  alpha-L-fucosidase [Sediminibacterium sp....  84.0    1e-15
ref|WP_023983719.1|  hypothetical protein [Prevotella oralis]      81.3    1e-15
gb|EQB81848.1|  hypothetical protein L950_23390 [Sphingobacter...  82.0    1e-15
gb|AHF88358.1|  alpha-L-fucosidase [Rhizobium leguminosarum bv...  83.2    1e-15
gb|ETN95146.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]        83.2    1e-15
gb|AIC77301.1|  alpha-L-fucosidase [uncultured bacterium]          82.8    1e-15
ref|WP_006273661.1|  alpha-L-fucosidase [Asticcacaulis biprost...  83.6    1e-15
gb|EMT72666.1|  Plasma alpha-L-fucosidase [Fusarium oxysporum ...  83.6    1e-15
ref|WP_008244640.1|  alpha-L-fucosidase [Pedobacter sp. BAL39]     82.8    1e-15
ref|WP_027295949.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...  82.8    1e-15
gb|ETT68105.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  83.6    1e-15
gb|ETK06364.1|  alpha-L-fucosidase [Tannerella sp. oral taxon ...  82.8    1e-15
ref|WP_000999696.1|  alpha-L-fucosidase [Vibrio mimicus]           82.8    1e-15
ref|WP_027296532.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...  82.8    2e-15
ref|WP_003605411.1|  alpha-L-fucosidase [Lactobacillus casei]      82.0    2e-15
ref|WP_027667237.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  82.8    2e-15
emb|CDA83522.1|  uncharacterized protein BN772_01996 [Bacteroi...  82.8    2e-15
ref|WP_018358454.1|  hypothetical protein [Porphyromonas levii]    83.6    2e-15
ref|WP_007128910.1|  alpha-L-fucosidase [Paenibacillus lactis]     82.4    2e-15
ref|WP_020636470.1|  alpha-L-fucosidase [Amycolatopsis alba]       82.4    2e-15
dbj|GAF08492.1|  alpha-L-fucosidase [Paenibacillus pini JCM 16...  82.4    2e-15
ref|WP_003572422.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  82.8    2e-15
gb|AIA92724.1|  alpha_L_fucos [uncultured Solibacter sp.]          77.8    2e-15
ref|WP_007659923.1|  alpha-L-fucosidase [Bacteroides intestina...  82.8    2e-15
ref|WP_013042720.1|  alpha-L-fucosidase [Coraliomargarita akaj...  82.8    2e-15
ref|WP_003591199.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  82.4    2e-15
ref|WP_031263308.1|  alpha-L-fucosidase [Curtobacterium sp. B18]   82.4    2e-15
ref|WP_005511687.1|  alpha-L-fucosidase [Vibrio mimicus]           82.8    2e-15
ref|WP_027064615.1|  alpha-L-fucosidase [Maribacter sp. Hel_I_7]   82.4    2e-15
ref|XP_006188574.1|  PREDICTED: plasma alpha-L-fucosidase [Cam...  81.6    2e-15
ref|WP_016411140.1|  alpha-L-fucosidase [Prevotella sp. CAG:1031]  82.4    2e-15
ref|WP_000999694.1|  alpha-L-fucosidase [Vibrio mimicus]           82.4    2e-15
ref|WP_027510410.1|  alpha-L-fucosidase [Rhizobium sullae]         82.4    2e-15
ref|WP_022817277.1|  alpha-L-fucosidase [Candidatus Latescibac...  82.4    2e-15
ref|WP_010519973.1|  alpha-L-fucosidase [Mesoflavibacter zeaxa...  83.2    2e-15
ref|WP_009250614.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  82.4    2e-15
ref|WP_017260369.1|  hypothetical protein [Pedobacter arcticus]    82.4    2e-15
ref|WP_008357671.1|  alpha-L-fucosidase [Nocardioidaceae bacte...  82.4    2e-15
ref|WP_005514216.1|  alpha-L-fucosidase [Vibrio mimicus]           82.4    2e-15
ref|WP_025484864.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  82.4    2e-15
ref|WP_008379461.1|  alpha-L-fucosidase [Enterococcus sp. C1]      82.4    2e-15
ref|WP_027294942.1|  glycoside hydrolase family 29 [Robinsonie...  82.4    2e-15
ref|WP_012556169.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  82.4    2e-15
ref|WP_009098489.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  83.2    2e-15
ref|WP_004635095.1|  hypothetical protein [Dolosigranulum pigrum]  82.8    2e-15
ref|WP_006675924.1|  alpha-L-fucosidase [Paenibacillus dendrit...  82.8    2e-15
ref|WP_016563716.1|  uncharacterized protein [Bacteroides sp. ...  82.4    2e-15
ref|WP_016612908.1|  Alpha-L-fucosidase [Enterococcus faecium]     82.0    2e-15
ref|WP_026176550.1|  MULTISPECIES: alpha-L-fucosidase [Cauloba...  82.8    2e-15
ref|WP_016621902.1|  Alpha-L-fucosidase [Enterococcus faecalis]    82.0    2e-15
ref|WP_025869096.1|  alpha-L-fucosidase [Enterococcus sp. TR]      82.4    2e-15
ref|WP_005549414.1|  alpha-L-fucosidase [Paenibacillus alvei]      81.6    2e-15
ref|WP_015329128.1|  alpha-L-fucosidase [Fibrella aestuarina]      82.0    2e-15
gb|ELV13870.1|  Plasma alpha-L-fucosidase [Tupaia chinensis]       82.8    2e-15
ref|WP_025881685.1|  alpha-L-fucosidase [Prevotella baroniae]      82.0    2e-15
ref|WP_015031283.1|  alpha-L-fucosidase [Streptomyces venezuelae]  82.0    2e-15
ref|WP_005546624.1|  alpha-L-fucosidase [Paenibacillus alvei]      82.4    3e-15
ref|WP_026386441.1|  alpha-L-fucosidase [Acidobacteria bacteri...  82.8    3e-15
ref|WP_026769425.1|  alpha-L-fucosidase [Sediminibacterium sp....  82.8    3e-15
ref|WP_025143809.1|  hypothetical protein [Sphingobacterium sp...  82.0    3e-15
emb|CDM60817.1|  alpha-L-fucosidase [Rhizobium sp. LPU83]          82.0    3e-15
ref|WP_012804915.1|  alpha-L-fucosidase [Brachybacterium faecium]  82.0    3e-15
ref|WP_009123473.1|  alpha-L-fucosidase [Bacteroides fluxus]       81.6    3e-15
gb|EUB15780.1|  alpha-L-fucosidase [Shuttleworthia sp. MSX8B]      81.6    3e-15
gb|EPC70725.1|  hypothetical protein Lpp126_16659 [Lactobacill...  80.9    3e-15
ref|WP_021589393.1|  alpha-L-fucosidase [Prevotella baroniae]      82.0    3e-15
gb|ETK07273.1|  alpha-L-fucosidase [Tannerella sp. oral taxon ...  82.0    3e-15
ref|WP_016665271.1|  hypothetical protein [Prevotella oralis]      81.6    3e-15
ref|WP_028904973.1|  alpha-L-fucosidase [Prevotella intermedia]    82.0    3e-15
ref|WP_029710224.1|  alpha-L-fucosidase [Rhizobium sp. OR191]      82.0    3e-15
ref|WP_022327751.1|  alpha-L-fucosidase [Prevotella sp. CAG:732]   82.0    3e-15
ref|WP_010925634.1|  MS120, putative fucosidase [Microscilla s...  82.4    3e-15
ref|WP_010665295.1|  alpha-L-fucosidase [Marinilabilia salmoni...  82.4    3e-15
ref|WP_013606094.1|  glycoside hydrolase family protein [Sphae...  82.0    3e-15
ref|WP_005642501.1|  hypothetical protein [Parabacteroides mer...  81.6    3e-15
ref|WP_018071804.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  82.0    3e-15
gb|EXG77838.1|  alpha-L-fucosidase [Xylanibacter oryzae DSM 17...  82.4    3e-15
ref|WP_013073729.1|  alpha-L-fucosidase [Zunongwangia profunda]    81.6    3e-15
ref|WP_022043383.1|  uncharacterized protein [Bacteroides cacc...  81.6    3e-15
ref|WP_015441134.1|  putative glycosidase [Ilumatobacter cocci...  82.8    3e-15
ref|WP_008675685.1|  glycoside hydrolase family 29 (alpha-L-fu...  81.3    3e-15
ref|WP_028600271.1|  alpha-L-fucosidase [Paenibacillus pasaden...  81.6    3e-15
ref|WP_028598881.1|  alpha-L-fucosidase [Paenibacillus pasaden...  81.6    3e-15
ref|WP_021253635.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  81.6    3e-15
ref|WP_017958349.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  81.6    4e-15
ref|WP_002997089.1|  alpha-L-fucosidase [Sphingobacterium spir...  82.4    4e-15
ref|WP_021687688.1|  Alpha-L-fucosidase [Treponema lecithinoly...  82.0    4e-15
ref|WP_026292570.1|  alpha-L-fucosidase [Prevotella loescheii]     81.6    4e-15
ref|WP_031079148.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  81.6    4e-15
ref|WP_009236058.1|  alpha-L-fucosidase [Prevotella sp. oral t...  81.6    4e-15
ref|WP_005681991.1|  hypothetical protein [Bacteroides caccae]     81.6    4e-15
ref|WP_022103480.1|  alpha-L-fucosidase [Bacteroides stercoris...  81.6    4e-15
ref|WP_005654392.1|  alpha-L-fucosidase [Bacteroides stercoris]    81.6    4e-15
ref|XP_008918878.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...  82.8    4e-15
ref|WP_022042568.1|  uncharacterized protein [Bacteroides cacc...  81.6    4e-15
ref|WP_029279242.1|  hypothetical protein [Pedobacter borealis]    80.5    4e-15
gb|KDR51988.1|  Alpha-L-fucosidase [Prevotella loescheii DSM 1...  81.6    4e-15
ref|WP_021261816.1|  alpha-L-fucosidase [Paenibacillus alvei]      81.6    4e-15
ref|WP_015735299.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  81.6    4e-15
ref|WP_008686956.1|  glycosyl hydrolase [Rhodopirellula sallen...  81.6    4e-15
ref|WP_009676129.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  81.3    4e-15
ref|WP_013781874.1|  alpha-L-fucosidase [Mahella australiensis]    80.5    4e-15
ref|WP_021260295.1|  alpha-L-fucosidase [Paenibacillus alvei]      81.3    4e-15
ref|WP_007087261.1|  alpha-L-fucosidase [Bacillus bataviensis]     81.3    4e-15
ref|WP_029733075.1|  MULTISPECIES: alpha-L-fucosidase [Proteob...  81.6    4e-15
gb|ETT38332.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808]  81.3    4e-15
ref|WP_026230471.1|  alpha-L-fucosidase [Rhizobium gallicum]       81.6    4e-15
ref|WP_007495649.1|  alpha-L-fucosidase [Streptomyces zincires...  81.3    4e-15
ref|WP_009100206.1|  Glycoside hydrolase, family 29, subgroup ...  81.6    4e-15
ref|WP_014670937.1|  alpha-L-fucosidase [Streptomyces hygrosco...  81.3    4e-15
ref|WP_009250843.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  81.3    4e-15
ref|WP_018473508.1|  hypothetical protein [Echinicola pacifica]    82.0    4e-15
ref|WP_022510813.1|  alpha-L-fucosidase [Prevotella sp. CAG:617]   81.3    4e-15
ref|WP_021839334.1|  putative uncharacterized protein [Alistip...  81.3    5e-15
gb|KFI94520.1|  alpha-L-fucosidase [Bifidobacterium scardovii]     81.3    5e-15
ref|WP_003575880.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  81.3    5e-15
ref|WP_026209133.1|  alpha-L-fucosidase [Catelliglobosispora k...  81.3    5e-15
ref|WP_028549735.1|  glycoside hydrolase [Paenibacillus sp. UN...  81.3    5e-15
ref|XP_009017881.1|  hypothetical protein HELRODRAFT_172980 [H...  80.9    5e-15
ref|WP_025725740.1|  alpha-L-fucosidase [Bacteroides sp. 14(A)]    81.6    5e-15
ref|WP_007210589.1|  alpha-L-fucosidase [Bacteroides cellulosi...  81.6    5e-15
ref|WP_021997751.1|  tissue alpha-L-fucosidase (Alpha-L-fucosi...  81.3    5e-15
ref|WP_009066364.1|  alpha-L-fucosidase [Clostridium sp. MSTE9]    81.3    5e-15
ref|WP_007635382.1|  alpha-L-fucosidase [Rhizobium sp. CCGE 510]   81.3    5e-15
ref|WP_011675004.1|  alpha-L-fucosidase [Lactobacillus casei]      80.1    5e-15
ref|WP_018245922.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  81.3    5e-15
gb|EKP96308.1|  alpha-L-fucosidase [Lactobacillus casei 12A]       80.1    5e-15
ref|WP_022162161.1|  alpha-L-fucosidase [Bacteroides sp. CAG:633]  81.3    5e-15
ref|WP_007217088.1|  alpha-L-fucosidase [Bacteroides cellulosi...  81.3    6e-15
ref|WP_021980664.1|  alpha-L-fucosidase [Paraprevotella clara ...  82.4    6e-15
gb|AIA89280.1|  alpha_L_fucos [uncultured Catenulispora sp.]       77.4    6e-15
ref|XP_005773793.1|  hypothetical protein EMIHUDRAFT_469809 [E...  82.4    6e-15
ref|WP_009596583.1|  alpha-L-fucosidase [Alistipes sp. HGB5]       80.9    6e-15
ref|WP_022209513.1|  uncharacterized protein [Bacteroides cell...  81.3    6e-15
ref|WP_008619939.1|  alpha-L-fucosidase [Paraprevotella clara]     82.4    6e-15
ref|XP_005234197.1|  PREDICTED: tissue alpha-L-fucosidase [Fal...  80.5    6e-15
ref|WP_016382616.1|  hypothetical protein [Lactobacillus parac...  79.7    6e-15
ref|WP_008690152.1|  glycosyl hydrolase [Rhodopirellula maiorica]  81.6    6e-15
ref|WP_008686713.1|  Alpha-L-fucosidase [Rhodopirellula sallen...  82.0    6e-15
ref|WP_007128311.1|  MULTISPECIES: alpha-L-fucosidase [Bacilla...  81.6    6e-15
ref|WP_026769423.1|  alpha-L-fucosidase [Sediminibacterium sp....  81.3    6e-15
gb|EHZ34946.1|  alpha-L-fucosidase family protein [Streptococc...  80.9    6e-15
gb|AHF15524.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       81.6    6e-15
ref|WP_030743522.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  80.9    7e-15
ref|WP_026775024.1|  alpha-L-fucosidase [Sediminibacterium sp....  81.3    7e-15
ref|WP_017956732.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.9    7e-15
ref|WP_027343748.1|  alpha-L-fucosidase [Hamadaea tsunoensis]      80.5    7e-15
ref|WP_011649432.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.9    7e-15
ref|WP_026011414.1|  alpha-L-fucosidase [Paenibacillus sp. OSY...  80.9    7e-15
ref|WP_022392509.1|  alpha-L-fucosidase [Bacteroides intestina...  80.9    7e-15
ref|WP_015736751.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  81.3    7e-15
ref|WP_010137136.1|  alpha-L-fucosidase [Flavobacteriaceae bac...  81.3    7e-15
ref|XP_006197821.1|  PREDICTED: plasma alpha-L-fucosidase [Vic...  80.1    7e-15
ref|WP_022426306.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:90]  80.5    7e-15
ref|WP_014776274.1|  alpha-L-fucosidase [Alistipes finegoldii]     80.9    7e-15
ref|WP_012927341.1|  alpha-L-fucosidase [Spirosoma linguale]       81.3    7e-15
ref|WP_004324077.1|  hypothetical protein [Bacteroides ovatus]     82.0    8e-15
ref|WP_024319653.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.9    8e-15
ref|WP_018464581.1|  hypothetical protein [Prevotella paludivi...  81.3    8e-15
ref|WP_006949601.1|  Alpha-L-fucosidase [Sphingobium japonicum]    81.3    8e-15
ref|WP_018280353.1|  alpha-L-fucosidase [Capnocytophaga cynode...  80.9    8e-15
ref|WP_026727636.1|  alpha-L-fucosidase [Flavobacterium denitr...  80.9    8e-15
ref|WP_021931874.1|  alpha-L-fucosidase [Tannerella sp. CAG:118]   82.0    8e-15
ref|WP_027688290.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.9    8e-15
emb|CDS91961.1|  Alpha-L-fucosidase [Sphingobacterium sp. PM2-...  81.3    8e-15
ref|WP_022081854.1|  alpha-L-fucosidase [Bacteroides sp. CAG:144]  81.3    8e-15
ref|WP_022231660.1|  alpha-L-fucosidase [Bacteroides sp. CAG:443]  80.9    8e-15
ref|WP_018072985.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.9    8e-15
ref|WP_018482411.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.5    8e-15
gb|AIC31272.1|  alpha-L-fucosidase protein [Rhizobium etli bv....  80.9    8e-15
gb|KFO60182.1|  Tissue alpha-L-fucosidase [Corvus brachyrhynchos]  80.1    8e-15
ref|WP_012285359.1|  alpha-L-fucosidase [Caulobacter sp. K31]      81.3    8e-15
ref|WP_006744104.1|  alpha-L-fucosidase [Bacteroides coprosuis]    80.5    8e-15
ref|WP_019536333.1|  hypothetical protein [Paenibacillus ginse...  81.3    8e-15
ref|WP_008020422.1|  alpha-L-fucosidase [Bacteroides xylanisol...  80.9    8e-15
ref|WP_025484140.1|  alpha-L-fucosidase [Clostridiales bacteri...  80.5    8e-15
ref|WP_018626144.1|  hypothetical protein [Niabella aurantiaca]    80.9    8e-15
ref|WP_007564217.1|  alpha-L-fucosidase [Bacteroides plebeius]     80.5    9e-15
ref|WP_004293970.1|  alpha-L-fucosidase [Bacteroides eggerthii]    77.8    9e-15
ref|WP_009252575.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  80.5    9e-15
ref|WP_029871304.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.5    9e-15
gb|AIA96052.1|  alpha_L_fucos [uncultured Opitutus sp.]            75.5    9e-15
ref|WP_005682023.1|  hypothetical protein [Bacteroides caccae]     80.5    9e-15
ref|WP_016195430.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  80.5    9e-15
ref|WP_017258106.1|  alpha-L-fucosidase [Pedobacter arcticus]      80.9    9e-15
ref|XP_008633392.1|  PREDICTED: tissue alpha-L-fucosidase [Cor...  80.1    1e-14
ref|WP_022008730.1|  alpha-L-fucosidase [Firmicutes bacterium ...  80.5    1e-14
ref|WP_017967475.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.5    1e-14
ref|WP_003571802.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  79.3    1e-14
ref|WP_004362242.1|  hypothetical protein [Prevotella nigrescens]  80.5    1e-14
ref|WP_027293711.1|  hypothetical protein [Robinsoniella sp. K...  80.1    1e-14
gb|EXZ52954.1|  alpha-L-fucosidase family protein [Bacteroides...  80.1    1e-14
ref|WP_016735849.1|  alpha-L-fucosidase [Rhizobium phaseoli]       80.5    1e-14
ref|WP_024632455.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  80.1    1e-14
ref|WP_008472328.1|  alpha-L-fucosidase [Lactobacillus gigerio...  80.1    1e-14
gb|EXY26528.1|  alpha-L-fucosidase family protein [Bacteroides...  80.1    1e-14
ref|WP_027585301.1|  alpha-L-fucosidase [Prolixibacter bellari...  80.9    1e-14
ref|WP_004366064.1|  alpha-L-fucosidase [Prevotella nigrescens]    80.5    1e-14
ref|WP_003577546.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.5    1e-14
ref|WP_020047229.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.5    1e-14
ref|WP_022670876.1|  alpha-L-fucosidase [Lactobacillus casei]      79.3    1e-14
ref|WP_023925353.1|  hypothetical protein [Prevotella nigrescens]  80.5    1e-14
ref|WP_016370115.1|  hypothetical protein [Lactobacillus parac...  79.3    1e-14
ref|WP_026011202.1|  alpha-L-fucosidase [Paenibacillus sp. OSY...  80.5    1e-14
gb|EYA65290.1|  alpha-L-fucosidase family protein [Bacteroides...  80.1    1e-14
ref|WP_025490633.1|  alpha-L-fucosidase [Clostridiales bacteri...  80.1    1e-14
ref|WP_025815456.1|  alpha-L-fucosidase [Prevotella shahii]        80.1    1e-14
ref|WP_018560443.1|  alpha-L-fucosidase [Streptomyces sp. BoleA5]  80.1    1e-14
ref|WP_027202235.1|  hypothetical protein [Butyricimonas virosa]   81.3    1e-14
gb|KER49495.1|  alpha-L-fucosidase [Bacteroides fragilis]          80.5    1e-14
gb|KER70266.1|  alpha-L-fucosidase [Bacteroides fragilis]          80.5    1e-14
ref|WP_019890476.1|  hypothetical protein [Lactobacillus parac...  79.3    1e-14
ref|WP_016388257.1|  Alpha-L-fucosidase [Lactobacillus paracasei]  79.3    1e-14
ref|WP_016384185.1|  Alpha-L-fucosidase [Lactobacillus paracasei]  79.3    1e-14
ref|WP_003576771.1|  alpha-L-fucosidase [Lactobacillus casei]      79.3    1e-14
ref|WP_012492118.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  79.3    1e-14
ref|WP_003581420.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  79.3    1e-14
ref|WP_021639329.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  80.1    1e-14
ref|WP_003585883.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  79.0    1e-14
gb|EPC57015.1|  hypothetical protein Lpp123_04229 [Lactobacill...  79.0    1e-14
ref|WP_027664712.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.1    1e-14
ref|WP_027686554.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.1    1e-14
ref|WP_010737387.1|  alpha-L-fucosidase [Enterococcus hirae]       80.1    1e-14
ref|WP_009230227.1|  alpha-L-fucosidase [Prevotella sp. oral t...  80.1    1e-14
ref|WP_003549883.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  80.1    1e-14
ref|WP_023453877.1|  alpha-L-fucosidase [Asticcacaulis sp. AC460]  80.5    1e-14
ref|WP_006207072.1|  alpha-L-fucosidase [Paenibacillus vortex]     80.1    1e-14
ref|WP_025669475.1|  alpha-L-fucosidase [Rhizobium sp. JGI 001...  80.1    1e-14
ref|WP_021679067.1|  Alpha-L-fucosidase [Porphyromonas gingiva...  80.9    1e-14
ref|WP_027296528.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...  80.1    1e-14
emb|CDQ38393.1|  Alpha-L-fucosidase [Virgibacillus sp. Vm-5]       80.1    1e-14
ref|WP_009128861.1|  hypothetical protein [Bacteroides oleicip...  81.6    1e-14
ref|WP_008661295.1|  alpha-L-fucosidase [Bacteroides sp. 3_2_5]    80.1    1e-14
dbj|GAK42378.1|  alpha-L-fucosidase [Paenibacillus sp. TCA20]      79.7    1e-14
ref|WP_021289723.1|  hypothetical protein [Virgibacillus sp. C...  80.1    1e-14
ref|WP_009034527.1|  alpha-L-fucosidase [Indibacter alkaliphilus]  80.5    1e-14
gb|AIC30866.1|  alpha-L-fucosidase protein [Rhizobium etli bv....  79.7    1e-14
ref|WP_021677281.1|  Alpha-L-fucosidase [Porphyromonas gingiva...  80.9    1e-14
ref|WP_022463177.1|  putative uncharacterized protein [Blautia...  79.7    1e-14
ref|WP_022685739.1|  alpha-L-fucosidase [Sphingomonas phyllosp...  80.5    1e-14
ref|WP_022315922.1|  glycoside hydrolase family 29 (Alpha-L-fu...  80.1    1e-14
ref|WP_013633100.1|  glycoside hydrolase family protein [Pedob...  80.1    1e-14
ref|WP_019424421.1|  alpha-L-fucosidase [Paenibacillus sp. OSY...  79.7    2e-14
gb|EYA94859.1|  alpha-L-fucosidase family protein [Bacteroides...  79.7    2e-14
ref|WP_006045000.1|  alpha-L-fucosidase [Prevotella pallens]       80.1    2e-14
ref|WP_003572787.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  79.7    2e-14
ref|WP_022308547.1|  alpha-L-fucosidase [Alistipes sp. CAG:268]    79.7    2e-14
ref|WP_028742967.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  79.7    2e-14
ref|WP_031112198.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  79.7    2e-14
gb|EYA08300.1|  alpha-L-fucosidase family protein [Bacteroides...  79.7    2e-14
ref|WP_021854847.1|  alpha-L-fucosidase [Prevotella sp. CAG:255]   79.7    2e-14
ref|WP_006286062.1|  alpha-L-fucosidase [Paenibacillus popilliae]  76.6    2e-14
gb|AHF87191.1|  alpha-L-fucosidase [Rhizobium leguminosarum bv...  79.7    2e-14
ref|WP_012490003.1|  alpha-L-fucosidase [Rhizobium etli]           79.7    2e-14
ref|WP_013569167.1|  alpha-L-fucosidase [Terriglobus saanensis]    80.5    2e-14
ref|WP_020272701.1|  putative Tissue alpha-L-fucosidase [Strep...  79.7    2e-14
ref|WP_010719448.1|  hypothetical protein [Enterococcus faeciu...  79.7    2e-14
gb|EXY17019.1|  alpha-L-fucosidase family protein [Bacteroides...  79.7    2e-14
gb|KDN73131.1|  alpha-L-fucosidase [Streptomyces olindensis]       79.3    2e-14
ref|WP_013620023.1|  alpha-L-fucosidase [Cellulophaga lytica]      80.1    2e-14
ref|WP_028298798.1|  alpha-L-fucosidase [Olivibacter sitiensis]    79.7    2e-14
gb|KDR91949.1|  alpha-L-fucosidase [Enterococcus hirae]            79.7    2e-14
ref|WP_028533140.1|  alpha-L-fucosidase [Paenibacillus sp. UNC...  79.7    2e-14
ref|WP_021253027.1|  alpha-L-fucosidase [Paenibacillus alvei]      79.7    2e-14
ref|WP_028545421.1|  alpha-L-fucosidase [Paenibacillus taiwane...  79.3    2e-14
ref|XP_005827033.1|  hypothetical protein GUITHDRAFT_113792 [G...  79.7    2e-14
gb|ETT38638.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-192]  79.3    2e-14
ref|WP_016359859.1|  MULTISPECIES: alpha-L-fucosidase [unclass...  79.7    2e-14
ref|XP_002406095.1|  alpha-L-fucosidase, putative [Ixodes scap...  75.5    2e-14
ref|WP_025001060.1|  alpha-L-fucosidase [Prevotella aurantiaca]    79.7    2e-14
ref|WP_009752171.1|  Alpha-L-fucosidase [Prevotella sp. oral t...  79.3    2e-14
ref|XP_005654434.1|  PREDICTED: plasma alpha-L-fucosidase isof...  79.3    2e-14
gb|KFO32261.1|  Plasma alpha-L-fucosidase [Fukomys damarensis]     79.0    2e-14
ref|WP_012419072.1|  alpha-L-fucosidase [Akkermansia muciniphila]  80.1    2e-14
gb|KFL28034.1|  alpha-L-fucosidase [Devosia sp. 17-2-E-8]          79.3    2e-14
ref|WP_009224615.1|  alpha-L-fucosidase [Paenibacillus sp. ora...  79.3    2e-14
ref|WP_007663823.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  79.7    2e-14
ref|WP_024998004.1|  alpha-L-fucosidase [Prevotella falsenii]      79.3    2e-14
ref|WP_029429385.1|  alpha-L-fucosidase [Bacteroides eggerthii]    79.7    2e-14
ref|WP_021665253.1|  Alpha-L-fucosidase [Porphyromonas gingiva...  80.1    2e-14
ref|WP_019028950.1|  hypothetical protein [Colwellia piezophila]   79.7    2e-14
ref|WP_009255136.1|  MULTISPECIES: hypothetical protein [Clost...  79.3    2e-14
ref|WP_016313327.1|  alpha-L-fucosidase [Paenibacillus barengo...  79.3    2e-14
ref|WP_016196471.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  80.1    2e-14
gb|KFD34373.1|  alpha-L-fucosidase [Lactobacillus casei]           78.2    2e-14
ref|WP_025528989.1|  alpha-L-fucosidase [Chitinophagaceae bact...  79.3    3e-14
ref|WP_004288534.1|  hypothetical protein [Bacteroides eggerthii]  79.3    3e-14
gb|ETZ23249.1|  hypothetical protein N824_17460 [Pedobacter sp...  79.7    3e-14
ref|WP_025489900.1|  alpha-L-fucosidase [Clostridiales bacteri...  79.3    3e-14
ref|WP_021639195.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  79.3    3e-14
ref|WP_014709919.1|  alpha-L-fucosidase [Prevotella intermedia]    79.3    3e-14
ref|WP_009100283.1|  Alpha-L-fucosidase [Rhodopirellula sp. SWK7]  79.7    3e-14
ref|WP_025493965.1|  glycoside hydrolase family 29 [Lachnospir...  79.3    3e-14
ref|WP_007634861.1|  alpha-L-fucosidase [Rhizobium sp. CCGE 510]   79.3    3e-14
ref|WP_028538705.1|  alpha-L-fucosidase [Paenibacillus sp. J14]    79.0    3e-14
emb|CDA84489.1|  uncharacterized protein BN772_02911 [Bacteroi...  79.3    3e-14
ref|WP_004068388.1|  hypothetical protein [Clostridium sp. ASF...  79.0    3e-14
ref|WP_016297123.1|  hypothetical protein [Lachnospiraceae bac...  79.0    3e-14
ref|WP_018493273.1|  alpha-L-fucosidase [Rhizobium leguminosarum]  79.0    3e-14
ref|WP_022198045.1|  alpha-L-fucosidase [Akkermansia muciniphi...  79.7    3e-14
ref|WP_013685566.1|  alpha-L-fucosidase [Fluviicola taffensis]     79.3    3e-14
ref|WP_007278433.1|  alpha-L-fucosidase precursor [Lentisphaer...  79.7    3e-14
ref|WP_020556078.1|  alpha-L-fucosidase [Streptomyces scabrisp...  79.3    3e-14
gb|KEC69307.1|  alpha-L-fucosidase [Rhizobium leguminosarum bv...  79.0    3e-14
ref|WP_026961465.1|  alpha-L-fucosidase [Alicyclobacillus herb...  79.0    3e-14
ref|WP_016777398.1|  hypothetical protein [Anaerophaga thermoh...  75.5    3e-14
ref|WP_015711897.1|  alpha-L-fucosidase [Treponema azotonutric...  79.0    3e-14
ref|WP_029276772.1|  glycoside hydrolase [Pedobacter borealis]     79.3    3e-14
ref|WP_022830556.1|  hypothetical protein [Cytophagales str. B6]   79.7    3e-14
ref|WP_008532232.1|  alpha-L-fucosidase [Rhizobium sp. Pop5]       79.0    3e-14
ref|WP_016736895.1|  alpha-L-fucosidase [Rhizobium phaseoli]       79.0    3e-14
gb|EGE57889.1|  putative fucosidase [Rhizobium etli CNPAF512]      79.0    3e-14
ref|WP_022107173.1|  putative uncharacterized protein [Clostri...  79.0    3e-14
ref|WP_007277077.1|  alpha-L-fucosidase [Lentisphaera araneosa]    79.7    3e-14
ref|WP_020213246.1|  hypothetical protein [Flavobacterium rivuli]  79.7    3e-14
ref|WP_015333177.1|  alpha-L-fucosidase [Fibrella aestuarina]      79.3    3e-14
ref|WP_008530185.1|  alpha-L-fucosidase [Rhizobium sp. Pop5]       79.0    3e-14
gb|KER48747.1|  alpha-L-fucosidase [Bacteroides fragilis]          79.0    3e-14
gb|KFX73149.1|  alpha-L-fucosidase [Bacteroides fragilis]          79.0    3e-14
ref|WP_007362617.1|  glycoside hydrolase [Opitutaceae bacteriu...  79.3    4e-14
gb|KER78047.1|  alpha-L-fucosidase [Bacteroides fragilis]          79.0    4e-14
ref|WP_008769106.1|  alpha-L-fucosidase [Bacteroides sp. 2_1_16]   79.0    4e-14
ref|WP_013815198.1|  alpha-L-fucosidase [Porphyromonas gingiva...  79.7    4e-14
emb|CDF79849.1|  alpha-L-fucosidase (GH29) [Formosa agariphila...  79.3    4e-14
ref|WP_020264148.1|  MULTISPECIES: hypothetical protein [uncla...  79.0    4e-14
ref|WP_005676747.1|  hypothetical protein [Bacteroides caccae]     79.0    4e-14
ref|WP_022048981.1|  putative uncharacterized protein [Odoriba...  78.6    4e-14
ref|WP_009136602.1|  alpha-L-fucosidase [Odoribacter laneus]       78.6    4e-14
ref|WP_028041586.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...  79.3    4e-14
ref|WP_006680066.1|  alpha-L-fucosidase [Paenibacillus dendrit...  78.6    4e-14
gb|ETN95114.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]        79.0    4e-14
gb|KFO84909.1|  Tissue alpha-L-fucosidase [Buceros rhinoceros ...  78.2    4e-14
ref|WP_021661919.1|  Alpha-L-fucosidase [Porphyromonas gingiva...  79.7    4e-14
ref|WP_029902125.1|  alpha-L-fucosidase [Prevotella sp. 10(H)]     78.6    4e-14
ref|WP_005941944.1|  hypothetical protein [Bacteroides massili...  79.0    4e-14
ref|WP_014218678.1|  glycoside hydrolase family protein [Niast...  78.6    4e-14
dbj|GAF10952.1|  alpha-L-fucosidase [Bacillus sp. JCM 19045]       78.6    4e-14
gb|EXY48398.1|  alpha-L-fucosidase family protein [Bacteroides...  79.0    4e-14
ref|WP_022506591.1|  putative uncharacterized protein [Bactero...  79.0    4e-14
emb|CDA84855.1|  uncharacterized protein BN772_03247 [Bacteroi...  79.3    4e-14
ref|WP_016431529.1|  hypothetical protein [Streptomyces sp. HG...  78.6    4e-14
gb|KFD33359.1|  alpha-L-fucosidase [Lactobacillus casei]           77.8    4e-14
gb|AHF12430.1|  alpha-L-fucosidase [Barnesiella viscericola DS...  78.6    4e-14
gb|KEQ26240.1|  alpha-L-fucosidase [Paenibacillus sp. MSt1]        79.3    4e-14
ref|WP_028913336.1|  alpha-L-fucosidase [Prevotella sp. MA2016]    78.6    4e-14
ref|WP_003128606.1|  MULTISPECIES: alpha-L-fucosidase [Enteroc...  78.6    4e-14
ref|WP_008385436.1|  alpha-L-fucosidase [Halosarcina pallida]      77.8    4e-14
ref|WP_030312324.1|  hypothetical protein [Streptomyces sp. NR...  78.6    4e-14
ref|WP_031069785.1|  hypothetical protein [Streptomyces sp. NR...  79.3    4e-14
ref|WP_004052943.1|  hypothetical protein [Eubacterium plexica...  78.2    4e-14
dbj|GAF17655.1|  alpha-L-fucosidase [Bacillus sp. JCM 19046]       78.6    4e-14
ref|WP_015737869.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  78.6    5e-14
gb|KFL31334.1|  alpha-L-fucosidase [Devosia riboflavina]           78.6    5e-14
ref|WP_009593008.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   78.6    5e-14
ref|WP_026905567.1|  hypothetical protein [Pedobacter glucosid...  76.6    5e-14
ref|WP_026473562.1|  alpha-L-fucosidase [Alkaliflexus imshenet...  79.0    5e-14
gb|KFZ47335.1|  Tissue alpha-L-fucosidase [Caprimulgus carolin...  77.8    5e-14
gb|AIM35804.1|  alpha-L-fucosidase [Sphingobacterium sp. ML3W]     79.0    5e-14
gb|AHF15520.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       78.6    5e-14
ref|WP_021903727.1|  glycoside hydrolase family 29 candidate a...  79.0    5e-14
ref|WP_013634627.1|  glycoside hydrolase [Pedobacter saltans]      78.6    5e-14
ref|WP_005686503.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  78.2    5e-14
ref|WP_013633091.1|  alpha-L-fucosidase [Pedobacter saltans]       79.0    5e-14
ref|WP_010187056.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  79.0    5e-14
ref|WP_005717725.1|  Alpha-L-fucosidase [Lactobacillus rhamnosus]  78.2    6e-14
ref|WP_004120321.1|  putative alpha-L-fucosidase protein [Rhiz...  78.2    6e-14
ref|WP_028612190.1|  alpha-L-fucosidase [Paenibacillus harenae]    78.6    6e-14
ref|WP_026418718.1|  alpha-L-fucosidase [Actinoalloteichus cya...  78.2    6e-14
ref|WP_009100268.1|  Glycoside hydrolase, family 29 [Rhodopire...  78.6    6e-14
emb|CDA87046.1|  uncharacterized protein BN772_00532 [Bacteroi...  78.2    6e-14
ref|WP_015510406.1|  alpha-L-fucosidase [Enterococcus casselif...  78.2    6e-14
ref|WP_026903243.1|  hypothetical protein [Pedobacter glucosid...  76.3    6e-14
ref|WP_022010934.1|  alpha-L-fucosidase [Bacteroides fragilis ...  78.2    6e-14
ref|WP_005782800.1|  alpha-L-fucosidase [Bacteroides fragilis]     78.2    6e-14
ref|WP_005822520.1|  alpha-L-fucosidase [Bacteroides fragilis]     78.2    6e-14
gb|EXZ21503.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
gb|EXY67480.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
gb|EXY20508.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
ref|WP_010215835.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  78.6    7e-14
gb|EPC84476.1|  hypothetical protein Lpp126_03991 [Lactobacill...  77.8    7e-14
ref|WP_020262838.1|  MULTISPECIES: hypothetical protein [uncla...  78.2    7e-14
ref|WP_020260890.1|  MULTISPECIES: hypothetical protein [Amini...  78.2    7e-14
ref|WP_016384650.1|  Alpha-L-fucosidase [Lactobacillus paracasei]  77.8    7e-14
ref|WP_027470791.1|  alpha-L-fucosidase [Cytophaga fermentans]     77.8    7e-14
ref|WP_003596450.1|  alpha-L-fucosidase [Lactobacillus casei]      77.8    7e-14
ref|WP_009136744.1|  alpha-L-fucosidase [Odoribacter laneus]       78.2    7e-14
dbj|GAF02174.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  78.2    7e-14
ref|WP_010162840.1|  alpha-L-fucosidase [Sphingomonas sp. PAMC...  78.6    7e-14
ref|WP_007386030.1|  alpha-L-fucosidase [Streptomyces sviceus]     77.8    7e-14
ref|WP_016699857.1|  hypothetical protein [Actinoalloteichus s...  77.8    7e-14
gb|EXY15238.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
ref|WP_006674899.1|  alpha-L-fucosidase [Paenibacillus dendrit...  78.2    7e-14
ref|WP_031521314.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  77.8    7e-14
ref|WP_004583547.1|  alpha-L-fucosidase [Porphyromonas gingiva...  79.0    7e-14
gb|EXZ85546.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
gb|EXZ16026.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
gb|EXY29502.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
gb|EYA63632.1|  alpha-L-fucosidase family protein [Bacteroides...  78.2    7e-14
ref|WP_022348446.1|  alpha-L-fucosidase [Bacteroides fragilis ...  78.2    7e-14
ref|WP_005797085.1|  alpha-L-fucosidase [Bacteroides fragilis]     78.2    7e-14
ref|WP_030950309.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  77.8    7e-14
ref|WP_005783586.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  78.2    7e-14
ref|WP_005813974.1|  alpha-L-fucosidase [Bacteroides fragilis]     78.2    7e-14
ref|WP_008657849.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  78.2    7e-14
ref|WP_029154805.1|  alpha-L-fucosidase [candidate division OP...  78.2    7e-14
ref|WP_013551230.1|  alpha-L-fucosidase [Cellulophaga algicola]    78.2    7e-14
ref|WP_006676648.1|  alpha-L-fucosidase [Paenibacillus dendrit...  77.8    7e-14
ref|WP_023847704.1|  alpha-L-fucosidase [Porphyromonas gingiva...  78.6    8e-14
ref|WP_009333257.1|  alpha-L-fucosidase [Streptomyces ipomoeae]    77.8    8e-14
ref|WP_012458550.1|  alpha-L-fucosidase [Porphyromonas gingiva...  78.6    8e-14
ref|WP_026680036.1|  alpha-L-fucosidase [Bacillus megaterium]      77.8    8e-14
ref|WP_007670556.1|  alpha-L-fucosidase [Caulobacter sp. AP07]     78.2    8e-14
gb|AIC77304.1|  alpha-L-fucosidase [uncultured bacterium]          77.8    9e-14
gb|AHW59205.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   78.2    9e-14
ref|WP_025490634.1|  alpha-L-fucosidase [Clostridiales bacteri...  77.8    9e-14
ref|WP_020073626.1|  alpha-L-fucosidase [ [Clostridium sporosp...  77.4    9e-14
ref|WP_030662740.1|  alpha-L-fucosidase [Streptomyces cellulosae]  77.4    9e-14
ref|WP_005675289.1|  alpha-L-fucosidase [Bacteroides caccae]       77.8    9e-14
ref|WP_021892177.1|  glycoside hydrolase family 29 [Bacteroide...  77.8    9e-14
ref|WP_020016595.1|  hypothetical protein [Promicromonospora s...  77.8    1e-13
ref|WP_021639330.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  77.8    1e-13
ref|WP_022048852.1|  putative uncharacterized protein [Odoriba...  77.8    1e-13
ref|WP_005681776.1|  alpha-L-fucosidase [Bacteroides caccae]       77.8    1e-13
ref|WP_022277190.1|  uncharacterized protein [Bacteroides copr...  77.8    1e-13
ref|WP_008141580.1|  alpha-L-fucosidase [Bacteroides coprophilus]  77.8    1e-13
ref|WP_022043290.1|  uncharacterized protein [Bacteroides cacc...  77.8    1e-13
ref|WP_005944039.1|  hypothetical protein [Bacteroides massili...  77.8    1e-13
gb|KDR21958.1|  Plasma alpha-L-fucosidase [Zootermopsis nevade...  72.8    1e-13
ref|WP_004288404.1|  hypothetical protein [Bacteroides eggerthii]  77.8    1e-13
ref|WP_022480990.1|  glycoside hydrolase family 29 (Alpha-L-fu...  77.4    1e-13
ref|WP_010544423.1|  alpha-L-fucosidase [Sphingomonas elodea]      77.8    1e-13
ref|WP_022021285.1|  putative uncharacterized protein [Bactero...  77.8    1e-13
ref|WP_005812445.1|  alpha-L-fucosidase [Bacteroides fragilis]     77.8    1e-13
ref|WP_007485630.1|  hypothetical protein [Bacteroides nordii]     77.8    1e-13
ref|WP_031220556.1|  alpha-L-fucosidase [Asticcacaulis beneves...  77.8    1e-13
ref|WP_027200433.1|  alpha-L-fucosidase [Butyricimonas virosa]     77.4    1e-13
ref|WP_026309776.1|  alpha-L-fucosidase [Niabella aurantiaca]      77.4    1e-13
gb|EXZ03339.1|  alpha-L-fucosidase family protein [Bacteroides...  77.4    1e-13
ref|XP_005427218.1|  PREDICTED: tissue alpha-L-fucosidase [Geo...  77.0    1e-13
ref|WP_029724080.1|  alpha-L-fucosidase [Sphingomonas sp. JGI ...  77.8    1e-13
ref|WP_024481465.1|  alpha-L-fucosidase [Cellulophaga baltica]     77.8    1e-13
ref|WP_016199747.1|  alpha-L-fucosidase [Elizabethkingia menin...  77.4    1e-13
ref|WP_031109013.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  77.0    1e-13
ref|WP_011685198.1|  glycoside hydrolase [Candidatus Solibacte...  77.4    1e-13
ref|WP_021848447.1|  uncharacterized protein [Bacteroides sp. ...  77.4    1e-13
gb|ESQ91848.1|  hypothetical protein ABENE_09450 [Asticcacauli...  77.4    1e-13
ref|WP_025615684.1|  alpha-L-fucosidase [Cellulophaga baltica]     77.4    1e-13
ref|WP_021695872.1|  alpha-L-fucosidase [Brevundimonas abyssalis]  77.4    1e-13
ref|WP_025103270.1|  alpha-L-fucosidase [Microbacterium paraox...  77.0    1e-13
ref|WP_026172823.1|  alpha-L-fucosidase [Asticcacaulis beneves...  77.8    1e-13
ref|WP_021931875.1|  alpha-L-fucosidase [Tannerella sp. CAG:118]   78.2    1e-13
gb|EYA41394.1|  alpha-L-fucosidase family protein [Bacteroides...  77.4    1e-13
ref|WP_031372083.1|  hypothetical protein [Lysobacter antibiot...  77.0    1e-13
ref|WP_023536762.1|  alpha-L-fucosidase [Streptomyces niveus]      77.0    2e-13
gb|KFQ24156.1|  Tissue alpha-L-fucosidase [Mesitornis unicolor]    76.6    2e-13
ref|WP_008668225.1|  alpha-L-fucosidase [Bacteroides sp. 4_3_4...  77.0    2e-13
ref|WP_013666131.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  77.0    2e-13
ref|WP_013667916.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  77.4    2e-13
ref|WP_015265991.1|  alpha-L-fucosidase [Echinicola vietnamensis]  77.0    2e-13
ref|WP_022116738.1|  putative uncharacterized protein [Clostri...  77.0    2e-13
ref|WP_010043008.1|  alpha-L-fucosidase [Streptomyces chartreu...  76.6    2e-13
ref|WP_031480806.1|  alpha-L-fucosidase [Streptomyces bicolor]     76.6    2e-13
ref|WP_030245801.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  76.6    2e-13
ref|WP_029934922.1|  alpha-L-fucosidase [Sphingomonas sp. UNC3...  77.4    2e-13
ref|WP_030929968.1|  alpha-L-fucosidase [Streptomyces violaceo...  76.6    2e-13
gb|ETY73169.1|  alpha-L-fucosidase [Lactobacillus fabifermenta...  76.6    2e-13
ref|WP_016170132.1|  alpha-L-fucosidase [Elizabethkingia menin...  76.6    2e-13
ref|WP_022133209.1|  putative uncharacterized protein [Clostri...  76.6    2e-13
ref|WP_026149201.1|  alpha-L-fucosidase [Elizabethkingia menin...  76.6    2e-13
gb|EYA51565.1|  alpha-L-fucosidase family protein [Bacteroides...  76.6    2e-13
gb|AIE84375.1|  carbohydrate binding domain protein [Fimbriimo...  76.6    2e-13
ref|WP_022405632.1|  putative alpha-L-fucosidase [Prevotella s...  76.6    2e-13
ref|WP_013633106.1|  alpha-L-fucosidase [Pedobacter saltans]       77.0    2e-13
ref|WP_008026369.1|  alpha-L-fucosidase [Bacteroides xylanisol...  76.6    2e-13
ref|WP_013611287.1|  MULTISPECIES: alpha-L-fucosidase [Odoriba...  76.6    2e-13
ref|WP_026770483.1|  alpha-L-fucosidase [Sediminibacterium sp....  76.6    2e-13
ref|WP_014216978.1|  glycoside hydrolase [Niastella koreensis]     76.6    2e-13
ref|WP_022323827.1|  putative uncharacterized protein [Alistip...  76.6    2e-13
ref|WP_024625672.1|  alpha-L-fucosidase [Lactobacillus fabifer...  76.3    2e-13
gb|AHF18028.1|  hypothetical protein NIASO_18995 [Niabella sol...  76.6    2e-13
ref|WP_014670256.1|  alpha-L-fucosidase [Streptomyces hygrosco...  76.3    2e-13
ref|WP_021664814.1|  Alpha-L-fucosidase [Porphyromonas gingiva...  77.4    2e-13
ref|WP_003589110.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  76.3    2e-13
gb|KDR93469.1|  alpha-L-fucosidase [Enterococcus hirae]            76.6    2e-13
ref|WP_022397081.1|  alpha-L-fucosidase [Akkermansia sp. CAG:344]  77.0    2e-13
ref|WP_029448175.1|  hypothetical protein [Cellulophaga baltica]   76.6    2e-13
ref|WP_031206207.1|  alpha-L-fucosidase [Microbacterium sp. UC...  76.3    2e-13
ref|WP_007481015.1|  hypothetical protein [Bacteroides salyers...  77.0    2e-13
ref|WP_029446900.1|  alpha-L-fucosidase [Cellulophaga baltica]     76.6    2e-13
ref|WP_022161425.1|  alpha-L-fucosidase [Odoribacter splanchni...  76.6    2e-13
gb|EOF60583.1|  hypothetical protein SE1_00552 [Enterococcus f...  76.6    2e-13
ref|WP_007135446.1|  alpha-L-fucosidase [Prevotella salivae]       76.6    2e-13
ref|WP_007659919.1|  alpha-L-fucosidase [Bacteroides intestina...  76.6    3e-13
ref|WP_026940026.1|  alpha-L-fucosidase [Humibacter albus]         76.3    3e-13
ref|WP_025480167.1|  alpha-L-fucosidase [Enterococcus faecium ...  76.6    3e-13
ref|WP_021824888.1|  alpha-L-fucosidase [Prevotella salivae]       76.6    3e-13
ref|WP_007485634.1|  hypothetical protein [Bacteroides nordii]     77.0    3e-13
ref|WP_008625737.1|  carbohydrate binding domain protein [Para...  77.0    3e-13
ref|WP_016381404.1|  hypothetical protein [Lactobacillus parac...  76.3    3e-13
ref|WP_007678611.1|  alpha-L-fucosidase [Novosphingobium sp. A...  76.6    3e-13
ref|WP_014432563.1|  alpha-L-fucosidase [Caldilinea aerophila]     76.3    3e-13
ref|WP_029445512.1|  alpha-L-fucosidase [Cellulophaga baltica]     76.3    3e-13
ref|WP_021940557.1|  putative uncharacterized protein [Bactero...  76.6    3e-13
gb|ERM56628.1|  hypothetical protein P780_07745 [Vibrio mimicu...  74.3    3e-13
ref|WP_026682202.1|  alpha-L-fucosidase [Bacillus megaterium]      76.3    3e-13
ref|WP_016368786.1|  hypothetical protein [Lactobacillus parac...  75.9    3e-13
ref|WP_023457010.1|  hypothetical protein [Asticcacaulis sp. A...  76.6    3e-13
ref|WP_018535727.1|  hypothetical protein [Streptomyces sp. Hm...  76.3    3e-13
gb|KFC60056.1|  hypothetical protein FEM08_11670 [Flavobacteri...  76.3    3e-13
ref|WP_020717550.1|  hypothetical protein [Acidobacteriaceae b...  76.6    3e-13
ref|WP_025867761.1|  hypothetical protein [Bacteroides nordii]     76.6    3e-13
ref|WP_020722478.1|  hypothetical protein [Acidobacteriaceae b...  76.3    3e-13
ref|WP_020576845.1|  hypothetical protein [Actinopolymorpha alba]  75.9    3e-13
ref|WP_021914127.1|  putative uncharacterized protein [Firmicu...  75.9    3e-13
ref|WP_008860812.1|  alpha-L-fucosidase [Barnesiella intestini...  75.9    3e-13
ref|WP_028404060.1|  alpha-L-fucosidase [Bacillus sp. J13]         76.3    3e-13
ref|WP_019991255.1|  hypothetical protein [Rudanella lutea]        75.9    4e-13
ref|WP_012492060.1|  MULTISPECIES: alpha-L-fucosidase [Lactoba...  75.9    4e-13
ref|WP_005687932.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  75.1    4e-13
ref|WP_021930081.1|  alpha-L-fucosidase [Tannerella sp. CAG:118]   75.9    4e-13
dbj|GAF05720.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  76.3    4e-13
ref|WP_022821377.1|  hypothetical protein [Armatimonadetes bac...  75.9    4e-13
ref|WP_026773703.1|  alpha-L-fucosidase [Sediminibacterium sp....  75.9    4e-13
ref|WP_005873989.1|  alpha-L-fucosidase [Porphyromonas gingiva...  76.6    4e-13
ref|WP_013584520.1|  alpha-L-fucosidase [Microbacterium testac...  75.9    4e-13
ref|WP_009134704.1|  hypothetical protein [Alistipes indistinc...  75.9    4e-13
ref|WP_003865661.1|  alpha-L-fucosidase [ [[Eubacterium] biforme]  75.5    4e-13
ref|WP_005712170.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  74.7    4e-13
gb|KFC58796.1|  alpha-L-fucosidase [Flavobacterium sp. EM1308]     76.3    4e-13
ref|WP_012875840.1|  alpha-L-fucosidase [Thermobaculum terrenum]   75.9    4e-13
ref|WP_009278424.1|  alpha-L-fucosidase [Olsenella sp. oral ta...  75.9    4e-13
ref|WP_018474064.1|  hypothetical protein [Echinicola pacifica]    75.1    4e-13
ref|WP_022398917.1|  alpha-L-fucosidase [Roseburia sp. CAG:471]    75.9    4e-13
ref|WP_026136130.1|  alpha-L-fucosidase [Paenibacillus sp. A9]     75.9    4e-13
ref|WP_005802027.1|  alpha-L-fucosidase [Bacteroides fragilis]     75.9    4e-13
ref|WP_026770185.1|  alpha-L-fucosidase [Sediminibacterium sp....  75.9    4e-13
ref|WP_020600253.1|  hypothetical protein [Spirosoma panaciter...  75.9    4e-13
ref|WP_014221518.1|  alpha-L-fucosidase [Niastella koreensis]      76.3    5e-13
ref|WP_013064128.1|  alpha-L-fucosidase [Prevotella ruminicola]    75.9    5e-13
ref|WP_010983191.1|  alpha-L-fucosidase [Streptomyces avermiti...  75.5    5e-13
ref|WP_020135532.1|  alpha-L-fucosidase [Streptomyces sp. 351M...  75.5    5e-13
ref|WP_006798046.1|  alpha-L-fucosidase [Dysgonomonas gadei]       75.5    5e-13
ref|WP_028907142.1|  alpha-L-fucosidase [Prevotella ruminicola]    75.5    5e-13
ref|WP_026235961.1|  alpha-L-fucosidase [Echinicola pacifica]      75.9    5e-13
ref|WP_026770447.1|  hypothetical protein [Sediminibacterium s...  75.5    5e-13
ref|WP_022429357.1|  alpha-L-fucosidase [Prevotella stercorea ...  75.5    5e-13
ref|WP_007404913.1|  alpha-L-fucosidase [Sphingomonas sp. S17]     75.9    5e-13
ref|WP_014570175.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  74.7    5e-13
gb|KFC40008.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  75.5    5e-13
ref|WP_024567449.1|  alpha-L-fucosidase [Elizabethkingia anoph...  75.5    5e-13
ref|WP_018028726.1|  hypothetical protein [Porphyromonas somerae]  76.3    5e-13
ref|WP_018757659.1|  hypothetical protein [Paenibacillus terri...  75.5    5e-13
ref|WP_014775549.1|  alpha-L-fucosidase [Alistipes finegoldii]     75.5    5e-13
ref|WP_013409577.1|  alpha-L-fucosidase [Leadbetterella byssop...  75.5    5e-13
gb|EWH08979.1|  alpha-l-fucosidase [Catenovulum agarivorans DS-2]  75.9    5e-13
ref|WP_009090079.1|  alpha-L-fucosidase [Elizabethkingia anoph...  75.5    5e-13
ref|WP_005474693.1|  glycosyl hydrolase [Streptomyces bottrope...  75.5    5e-13
emb|CDS94960.1|  Glycoside hydrolase family 29 (Alpha-L-fucosi...  75.9    5e-13
ref|WP_007214979.1|  hypothetical protein [Bacteroides cellulo...  75.1    5e-13
ref|WP_026318461.1|  alpha-L-fucosidase [Alistipes onderdonkii]    75.5    5e-13
ref|WP_027292413.1|  hypothetical protein [Robinsoniella sp. K...  75.5    5e-13
ref|WP_029259043.1|  alpha-L-fucosidase [Microbacterium sp. Cr...  75.5    5e-13
ref|WP_025851619.1|  alpha-L-fucosidase [Paenibacillus ehimensis]  75.9    5e-13
ref|WP_026773104.1|  alpha-L-fucosidase [Sediminibacterium sp....  75.5    5e-13
ref|WP_005657265.1|  alpha-L-fucosidase [Bacteroides stercoris]    75.5    5e-13
ref|WP_026162563.1|  alpha-L-fucosidase [Kribbella catacumbae]     75.5    5e-13
ref|WP_020122265.1|  alpha-L-fucosidase [Streptomyces canus]       75.1    5e-13
ref|WP_029265507.1|  MULTISPECIES: alpha-L-fucosidase [Microba...  75.5    5e-13
gb|KFF25649.1|  alpha-L-fucosidase [Chryseobacterium sp. CTM]      75.5    5e-13
ref|WP_024563850.1|  alpha-L-fucosidase [Elizabethkingia anoph...  75.5    5e-13
ref|WP_021635253.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  75.5    5e-13
ref|WP_020526221.1|  hypothetical protein [Flexithrix dorotheae]   75.5    6e-13
ref|WP_007900942.1|  alpha-L-fucosidase [Prevotella stercorea]     75.5    6e-13
ref|WP_029449818.1|  alpha-L-fucosidase [Cellulophaga baltica]     75.9    6e-13
ref|WP_029280302.1|  hypothetical protein [Pedobacter borealis]    75.5    6e-13
ref|WP_021347561.1|  alpha-L-fucosidase [Elizabethkingia menin...  75.5    6e-13
ref|WP_025142314.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  75.5    6e-13
ref|WP_010956433.1|  alpha-L-fucosidase [Porphyromonas gingiva...  75.9    7e-13
ref|WP_029985996.1|  hypothetical protein [Sphingobacterium sp...  75.1    7e-13
ref|WP_015843107.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]  75.1    7e-13
ref|WP_014679940.1|  alpha-L-fucosidase [Solitalea canadensis]     75.1    7e-13
ref|WP_030042071.1|  alpha-L-fucosidase [Streptomyces resistom...  75.1    7e-13
ref|WP_011026984.1|  alpha-L-fucosidase [Streptomyces coelicolor]  75.1    7e-13
ref|WP_029445513.1|  hypothetical protein [Cellulophaga baltica]   75.1    7e-13
ref|WP_026049988.1|  alpha-L-fucosidase [Microbacterium barkeri]   75.1    7e-13
ref|WP_022172446.1|  alpha-L-fucosidase [Blautia sp. CAG:52]       75.1    7e-13
dbj|GAF02716.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  75.5    7e-13
ref|WP_030862276.1|  alpha-L-fucosidase [Streptomyces violaceo...  75.1    8e-13
gb|KFF99472.1|  alpha-L-fucosidase [Streptomyces scabiei]          75.1    8e-13
ref|WP_028502760.1|  alpha-L-fucosidase [Microbacterium sp. UR...  75.1    8e-13
ref|WP_030647234.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  74.7    8e-13
ref|WP_013042537.1|  alpha-L-fucosidase [Coraliomargarita akaj...  75.1    8e-13
ref|WP_013994945.1|  alpha-L-fucosidase [Zobellia galactanivor...  75.1    8e-13
ref|WP_003994273.1|  alpha-L-fucosidase [Streptomyces viridoch...  74.7    8e-13
ref|WP_031025854.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  74.7    8e-13
ref|WP_030987918.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  74.7    8e-13
ref|WP_012794618.1|  alpha-L-fucosidase [Chitinophaga pinensis]    75.1    8e-13
ref|WP_025747140.1|  alpha-L-fucosidase [Caldicoprobacter oshi...  75.1    8e-13
ref|WP_012419205.1|  alpha-L-fucosidase [Akkermansia muciniphila]  75.5    8e-13
ref|WP_022158339.1|  alpha-L-fucosidase [Prevotella sp. CAG:520]   74.7    9e-13
ref|WP_007128911.1|  alpha-L-fucosidase [Paenibacillus lactis]     74.7    9e-13
ref|WP_031394057.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  75.1    9e-13
ref|WP_014834594.1|  alpha-L-fucosidase [Enterococcus hirae]       74.7    1e-12
ref|WP_028523828.1|  alpha-L-fucosidase [Runella limosa]           75.1    1e-12
gb|ETT46191.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-237]  74.7    1e-12
gb|KFI40112.1|  Alpha-L-fucosidase [Bifidobacterium actinocolo...  73.9    1e-12
gb|ETT29634.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-192]  74.7    1e-12
ref|WP_010737752.1|  hypothetical protein [Enterococcus hirae]     74.7    1e-12
ref|WP_018627967.1|  hypothetical protein [Niabella aurantiaca]    74.7    1e-12
ref|WP_006841716.1|  alpha-L-fucosidase [Dysgonomonas mossii]      74.7    1e-12
ref|WP_030936450.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  74.3    1e-12
ref|WP_017691191.1|  hypothetical protein [Paenibacillus sp. P...  74.7    1e-12
dbj|GAK42377.1|  alpha-L-fucosidase [Paenibacillus sp. TCA20]      74.7    1e-12
ref|WP_027470823.1|  alpha-L-fucosidase precursor [Cytophaga f...  73.9    1e-12
ref|WP_006207073.1|  alpha-L-fucosidase [Paenibacillus vortex]     74.7    1e-12
ref|WP_003978587.1|  alpha-L-fucosidase [Streptomyces lividans]    74.3    1e-12
gb|KFE30609.1|  alpha-L-fucosidase family protein [Vibrio chol...  74.3    1e-12
ref|WP_008240610.1|  alpha-L-fucosidase precursor, putative [P...  75.1    1e-12
gb|ETT38333.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808]  74.7    1e-12
emb|CDT10292.1|  Alpha-L-fucosidase [Sphingobacterium sp. PM2-...  74.7    1e-12
dbj|GAF05843.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  75.1    1e-12
gb|KFP24271.1|  Tissue alpha-L-fucosidase [Colius striatus]        73.9    1e-12
ref|WP_019026059.1|  hypothetical protein [Colwellia piezophila]   75.1    1e-12
ref|WP_031441393.1|  alpha-L-fucosidase [Sphingomonas sp. FUKU...  74.7    1e-12
ref|WP_013928334.1|  alpha-L-fucosidase [Runella slithyformis]     75.1    1e-12
gb|ETZ21747.1|  hypothetical protein N824_26285 [Pedobacter sp...  74.7    1e-12
ref|WP_004322894.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  75.1    1e-12
gb|KEQ25050.1|  alpha-L-fucosidase [Paenibacillus sp. MSt1]        74.7    1e-12
ref|WP_022830967.1|  alpha-L-fucosidase [Cytophagales str. B6]     74.7    1e-12
ref|WP_030616230.1|  alpha-L-fucosidase [Streptomyces fulvovio...  74.3    1e-12
ref|WP_028552868.1|  alpha-L-fucosidase [Paenibacillus sp. UNC...  75.1    1e-12
ref|WP_026178730.1|  alpha-L-fucosidase [Streptomyces sp. R1-N...  74.3    1e-12
gb|AHF14366.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       74.7    1e-12
ref|WP_029184355.1|  alpha-L-fucosidase [Streptomyces acidisca...  74.3    1e-12
ref|WP_022275065.1|  alpha-L-fucosidase [Bacteroides finegoldi...  74.3    1e-12
ref|WP_008775326.1|  alpha-L-fucosidase [Bacteroides sp. 2_2_4]    74.7    1e-12
ref|WP_005700178.1|  alpha-L-fucosidase (GH29) [Lactobacillus ...  73.6    1e-12
ref|WP_025815441.1|  alpha-L-fucosidase [Prevotella shahii]        74.3    1e-12
ref|WP_026555895.1|  alpha-L-fucosidase [Arthrobacter sp. 35W]     74.3    1e-12
ref|WP_026377623.1|  alpha-L-fucosidase [Aestuariimicrobium kw...  74.3    1e-12
ref|WP_005717603.1|  Alpha-L-fucosidase [Lactobacillus rhamnosus]  73.6    1e-12
gb|KFC58167.1|  alpha-L-fucosidase [Flavobacterium sp. EM1308]     74.3    1e-12
ref|WP_024627374.1|  alpha-L-fucosidase [Bifidobacterium sp. A11]  73.2    1e-12
ref|WP_029204346.1|  hypothetical protein [Pedobacter agri]        72.4    1e-12
ref|WP_010491434.1|  alpha-L-fucosidase [Paenibacillus elgii]      74.7    2e-12
ref|WP_019670323.1|  hypothetical protein [Eudoraea adriatica]     73.9    2e-12
ref|WP_029793948.1|  alpha-L-fucosidase [alpha proteobacterium...  74.3    2e-12
ref|WP_026751956.1|  hypothetical protein [Sediminibacterium s...  73.9    2e-12
ref|WP_018964738.1|  alpha-L-fucosidase [Porphyromonas gulae]      74.7    2e-12
ref|WP_006291817.1|  alpha-L-fucosidase [Parascardovia dentico...  73.9    2e-12
ref|WP_022416579.1|  tissue alpha-L-fucosidase (Alpha-L-fucosi...  70.9    2e-12
ref|WP_007590351.1|  alpha-L-fucosidase [Actinomyces sp. ICM39]    74.7    2e-12
ref|WP_012122087.1|  alpha-L-fucosidase [Roseiflexus castenhol...  73.9    2e-12
ref|WP_016371458.1|  hypothetical protein [Lactobacillus parac...  73.6    2e-12
ref|WP_010528836.1|  alpha-L-fucosidase [Anaerophaga sp. HS1]      73.9    2e-12
ref|WP_009593004.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   73.9    2e-12
ref|WP_018776800.1|  hypothetical protein [Arthrobacter sp. 16...  73.9    2e-12
ref|WP_014219707.1|  Alpha-N-acetylglucosaminidase, Alpha-L-fu...  74.7    2e-12
ref|WP_019370041.1|  alpha-L-fucosidase [Sphingomonas sp. ATCC...  73.9    2e-12
ref|WP_026327093.1|  alpha-L-fucosidase [Proteiniphilum acetat...  73.9    2e-12
gb|EQB12877.1|  alpha-L-fucosidase [Sphingobium lactosutens DS20]  73.9    2e-12
ref|WP_031298684.1|  alpha-L-fucosidase [Sphingobium lactosutens]  73.9    2e-12
ref|WP_026939984.1|  alpha-L-fucosidase [Humibacter albus]         73.6    2e-12
gb|ETT69191.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  73.6    2e-12
ref|WP_015737870.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  73.6    2e-12
ref|WP_023961124.1|  alpha-L-fucosidase [Paenibacillus sp. JCM...  73.6    2e-12
ref|WP_022397505.1|  alpha-L-fucosidase [Akkermansia sp. CAG:344]  74.3    2e-12
ref|WP_021908701.1|  uncharacterized protein [Prevotella sp. C...  73.9    2e-12
emb|CDK28773.1|  unnamed protein product [Kuraishia capsulata ...  73.6    2e-12
ref|WP_017888014.1|  alpha-L-fucosidase [Curtobacterium flaccu...  73.6    3e-12
gb|KFP10847.1|  Tissue alpha-L-fucosidase [Egretta garzetta]       72.8    3e-12
ref|WP_009099377.1|  Alpha-L-fucosidase [Rhodopirellula sp. SWK7]  73.6    3e-12
ref|WP_020919627.1|  alpha-L-fucosidase protein [Rhizobium etli]   73.2    3e-12
ref|WP_011685928.1|  alpha-L-fucosidase [Candidatus Solibacter...  73.2    3e-12
ref|WP_021735266.1|  alpha-L-fucosidase [Coriobacteriaceae bac...  73.2    3e-12
ref|WP_013169743.1|  glycosyl hydrolase [Arcanobacterium haemo...  73.2    3e-12
ref|WP_015843106.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]  73.2    3e-12
gb|EHN79165.1|  glycosyl hydrolase [Streptomyces coelicoflavus...  72.8    4e-12
ref|WP_009256188.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  73.2    4e-12
gb|KFF23150.1|  alpha-L-fucosidase [Chryseobacterium sp. CTM]      73.2    4e-12
ref|WP_030615308.1|  alpha-L-fucosidase [Streptomyces fulvovio...  72.8    4e-12
ref|WP_028598877.1|  alpha-L-fucosidase [Paenibacillus pasaden...  73.2    4e-12
gb|AIC93184.1|  alpha-L-fucosidase [Bacillus lehensis G1]          72.8    4e-12
emb|CDN78067.1|  Alpha-L-fucosidase [Elizabethkingia anophelis]    72.8    4e-12
ref|WP_024629463.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  72.8    4e-12
ref|WP_011428611.1|  alpha-L-fucosidase [Rhizobium etli]           72.8    4e-12
ref|WP_008505949.1|  glycoside hydrolase family 29 (alpha-L-fu...  73.6    4e-12
ref|WP_012920214.1|  alpha-L-fucosidase [Kribbella flavida]        72.8    4e-12
ref|WP_027628765.1|  alpha-L-fucosidase [ [Clostridium cellobi...  72.8    4e-12
ref|WP_016277425.1|  MULTISPECIES: hypothetical protein [Bacte...  72.8    4e-12
ref|WP_013927994.1|  alpha-L-fucosidase [Runella slithyformis]     72.8    4e-12
gb|AHF15258.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       72.8    5e-12
dbj|GAF02788.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  72.4    5e-12
ref|WP_004630939.1|  Alpha-L-fucosidase [ [Clostridium termiti...  72.4    5e-12
ref|WP_013709064.1|  alpha-L-fucosidase [Coriobacterium glomer...  72.4    5e-12
gb|ETZ21375.1|  hypothetical protein N824_28310 [Pedobacter sp...  72.4    5e-12
ref|WP_012779749.1|  alpha-L-fucosidase [Dyadobacter fermentans]   72.4    5e-12
ref|WP_003007707.1|  possible alpha-L-fucosidase [Sphingobacte...  71.6    5e-12
ref|WP_009090656.1|  alpha-L-fucosidase [Elizabethkingia anoph...  72.8    5e-12
ref|WP_009094609.1|  alpha-L-fucosidase [Elizabethkingia anoph...  72.8    6e-12
ref|WP_005690738.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  71.6    6e-12
ref|WP_005228056.1|  hypothetical protein [Enterococcus cassel...  72.4    6e-12
gb|KFF03107.1|  alpha-L-fucosidase [Chryseobacterium luteum]       72.8    6e-12
ref|WP_031257533.1|  alpha-L-fucosidase [Elizabethkingia menin...  72.8    6e-12
ref|WP_017258098.1|  hypothetical protein [Pedobacter arcticus]    73.2    6e-12
ref|WP_028298799.1|  alpha-L-fucosidase [Olivibacter sitiensis]    72.8    6e-12
emb|CDN79432.1|  Alpha-L-fucosidase [Elizabethkingia anophelis]    72.8    6e-12
ref|WP_029276776.1|  alpha-L-fucosidase [Pedobacter borealis]      72.8    6e-12
ref|WP_006255802.1|  alpha-L-fucosidase [Alloprevotella tannerae]  72.0    6e-12
ref|WP_008686763.1|  glycosyl hydrolase [Rhodopirellula sallen...  72.8    6e-12
gb|KEZ18398.1|  Alpha-L-fucosidase precursor [Sphingobium yano...  72.8    6e-12
ref|XP_005984991.1|  PREDICTED: plasma alpha-L-fucosidase-like...  72.8    6e-12
gb|EQB91928.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  72.4    6e-12
ref|WP_004208386.1|  hypothetical protein [Sphingobium yanoiku...  72.8    6e-12
ref|WP_017500715.1|  alpha-L-fucosidase [alpha proteobacterium...  72.8    6e-12
gb|KFD27772.1|  alpha-L-fucosidase [Sphingobium yanoikuyae]        72.8    6e-12
ref|WP_031048300.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  72.0    6e-12
gb|AIM36940.1|  alpha-L-fucosidase [Sphingobacterium sp. ML3W]     72.4    6e-12
ref|WP_009133797.1|  alpha-L-fucosidase [Alistipes indistinctus]   72.0    7e-12
ref|WP_004332290.1|  glycoside hydrolase family 29, candidate ...  72.8    7e-12
ref|WP_015510402.1|  hypothetical protein [Enterococcus cassel...  72.4    7e-12
gb|KFC35207.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  72.4    7e-12
dbj|GAF08490.1|  alpha-L-fucosidase [Paenibacillus pini JCM 16...  71.6    7e-12
ref|WP_015364354.1|  glycoside hydrolase family 29 (alpha-L-fu...  69.3    8e-12
ref|WP_009133107.1|  hypothetical protein [Alistipes indistinc...  72.4    8e-12
ref|WP_022529080.1|  alpha-L-fucosidase [Lactobacillus shenzhe...  72.0    8e-12
ref|WP_009100273.1|  Glycoside hydrolase, family 29 [Rhodopire...  72.4    8e-12
ref|WP_019058988.1|  alpha-L-fucosidase [Streptomyces prunicolor]  72.0    8e-12
gb|ETZ24477.1|  hypothetical protein N824_13235 [Pedobacter sp...  72.8    8e-12
ref|WP_007712299.1|  alpha-L-fucosidase [Sphingobium sp. AP49]     72.4    8e-12
ref|WP_025833289.1|  alpha-L-fucosidase [Bacteroides rodentium]    72.0    8e-12
ref|WP_009213101.1|  hypothetical protein [Actinomyces sp. ora...  72.8    9e-12
ref|WP_020594740.1|  hypothetical protein [Spirosoma panaciter...  72.0    9e-12
ref|WP_009675618.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  72.4    9e-12
ref|WP_031393200.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  72.4    9e-12
ref|WP_022054389.1|  alpha-L-fucosidase [Bacteroides plebeius ...  72.0    9e-12
ref|WP_028550714.1|  alpha-L-fucosidase [Paenibacillus sp. UNC...  72.0    9e-12
ref|WP_025763091.1|  alpha-L-fucosidase [Dyadobacter sp. Y620-1]   71.6    9e-12
ref|WP_020620645.1|  hypothetical protein [Paenibacillus daeje...  72.0    9e-12
ref|WP_013479409.1|  alpha-L-fucosidase [Asticcacaulis excentr...  72.0    1e-11
ref|WP_009676073.1|  MULTISPECIES: alpha-L-fucosidase [Paeniba...  72.0    1e-11
ref|WP_014173533.1|  alpha-L-fucosidase [Streptomyces bingchen...  71.6    1e-11
ref|WP_018759895.1|  hypothetical protein [Paenibacillus terri...  71.6    1e-11
ref|WP_026851978.1|  alpha-L-fucosidase [Glaciibacter superstes]   71.6    1e-11
dbj|GAF24167.1|  alpha-L-fucosidase [Bacillus sp. JCM 19047]       71.6    1e-11
dbj|GAE64181.1|  putative alpha-L-fucosidase [Chryseobacterium...  71.6    1e-11
ref|WP_016621897.1|  Alpha-L-fucosidase [Enterococcus faecalis]    71.6    1e-11
ref|WP_009099866.1|  alpha-L-fucosidase precursor [Rhodopirell...  72.0    1e-11
ref|WP_018754470.1|  alpha-L-fucosidase [Paenibacillus terrigena]  71.6    1e-11
gb|KFF30350.1|  alpha-L-fucosidase [Chryseobacterium sp. CTM]      71.6    1e-11
dbj|GAE72097.1|  alpha-L-fucosidase [Propionibacterium acnes J...  69.3    1e-11
ref|WP_016460438.1|  hypothetical protein [Actinomyces sp. HPA...  72.4    1e-11
ref|WP_024567475.1|  alpha-L-fucosidase [Elizabethkingia anoph...  71.6    1e-11
ref|WP_013005723.1|  alpha-L-fucosidase [Streptomyces scabiei]     71.2    1e-11
ref|WP_026448537.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  71.6    1e-11
ref|WP_026055227.1|  alpha-L-fucosidase [Anaerophaga thermohal...  71.6    1e-11
ref|WP_024987601.1|  alpha-L-fucosidase [Bacteroides acidifaci...  71.6    1e-11
ref|WP_015955455.1|  alpha-L-fucosidase [Cyanothece sp. PCC 7424]  71.2    1e-11
ref|WP_020389557.1|  hypothetical protein [Kribbella catacumbae]   69.3    1e-11
ref|WP_021590317.1|  alpha-L-fucosidase [Prevotella baroniae]      71.2    1e-11
ref|WP_018617028.1|  hypothetical protein [Segetibacter koreen...  71.6    1e-11
ref|WP_019989662.1|  alpha-L-fucosidase [Rudanella lutea]          71.6    1e-11
ref|WP_030315023.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  71.2    1e-11
ref|WP_027374224.1|  alpha-L-fucosidase [Chryseobacterium sp. ...  71.2    2e-11
gb|KDN55682.1|  alpha-L-fucosidase [Flavobacterium sp. EM1321]     71.2    2e-11
ref|WP_009102226.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  71.2    2e-11
ref|WP_002977812.1|  alpha-L-fucosidase [Chryseobacterium gleum]   71.2    2e-11
gb|AIE84189.1|  alpha-L-fucosidase [Fimbriimonas ginsengisoli ...  71.2    2e-11
ref|WP_028543373.1|  alpha-L-fucosidase [Paenibacillus taiwane...  71.2    2e-11
ref|WP_013570303.1|  alpha-L-fucosidase [Terriglobus saanensis]    71.6    2e-11
ref|WP_028806766.1|  alpha-L-fucosidase [Streptomyces sp. 303M...  70.9    2e-11
gb|AIL46393.1|  Alpha-L-fucosidase 1 [Elizabethkingia anopheli...  71.2    2e-11
ref|WP_005233770.1|  alpha-L-fucosidase [Enterococcus casselif...  71.2    2e-11
ref|WP_015808651.1|  alpha-L-fucosidase [Pedobacter heparinus]     71.2    2e-11
ref|WP_010492940.1|  alpha-L-fucosidase [Paenibacillus elgii]      71.6    2e-11
ref|WP_016612903.1|  Alpha-L-fucosidase [Enterococcus faecium]     71.2    2e-11
ref|WP_015546330.1|  Alpha-L-fucosidase [Alistipes shahii]         71.2    2e-11
ref|WP_021839615.1|  putative uncharacterized protein [Alistip...  71.2    2e-11
ref|WP_008379471.1|  alpha-L-fucosidase [Enterococcus sp. C1]      71.2    2e-11
gb|KFF00494.1|  alpha-L-fucosidase [Chryseobacterium formosense]   71.2    2e-11
ref|WP_019942942.1|  hypothetical protein [Dyadobacter beijing...  71.6    2e-11
ref|WP_022529895.1|  alpha-L-fucosidase [Lactobacillus shenzhe...  71.2    2e-11
ref|WP_024565490.1|  alpha-L-fucosidase [Elizabethkingia anoph...  71.2    2e-11
ref|WP_026511625.1|  alpha-L-fucosidase [Butyrivibrio sp. LC3010]  70.9    2e-11
ref|WP_007843727.1|  alpha-L-fucosidase [Chryseobacterium sp. ...  71.2    2e-11
ref|WP_020620906.1|  hypothetical protein [Paenibacillus daeje...  70.9    2e-11
ref|WP_018666462.1|  alpha-L-fucosidase [Bacteroides gallinarum]   70.9    2e-11
ref|WP_028072495.1|  alpha-L-fucosidase [Sphingobacterium thal...  70.9    2e-11
ref|WP_005867291.1|  alpha-L-fucosidase [Actinomyces georgiae]     71.6    2e-11
gb|EWC99472.1|  alpha-L-fucosidase [Actinomyces sp. ICM54]         71.6    2e-11
ref|WP_021611236.1|  Alpha-L-fucosidase [Actinomyces sp. oral ...  71.6    2e-11
ref|WP_026764163.1|  alpha-L-fucosidase [Sediminibacterium sal...  70.9    2e-11
ref|WP_013069465.1|  hypothetical protein [Propionibacterium a...  68.9    2e-11
ref|WP_023607012.1|  hypothetical protein [Vagococcus lutrae]      70.9    2e-11
ref|WP_021234294.1|  alpha-L-fucosidase [Novosphingobium linda...  71.2    2e-11
ref|WP_009648084.1|  alpha-L-fucosidase [Actinomyces sp. ICM47]    71.6    2e-11
ref|WP_003001643.1|  alpha-L-fucosidase [Sphingobacterium spir...  70.9    2e-11
ref|WP_026429709.1|  alpha-L-fucosidase [Actinomyces georgiae]     71.6    2e-11
emb|CDA84487.1|  uncharacterized protein BN772_02909 [Bacteroi...  71.2    2e-11
ref|WP_019026063.1|  hypothetical protein [Colwellia piezophila]   70.5    2e-11
ref|WP_019944177.1|  alpha-L-fucosidase [Dyadobacter beijingen...  70.5    2e-11
ref|WP_008690137.1|  Glycoside hydrolase, family 29, subgroup ...  70.1    3e-11
ref|WP_024305736.1|  alpha-L-fucosidase [Lactobacillus rhamnosus]  69.7    3e-11
ref|WP_024853835.1|  alpha-L-fucosidase [ [[Ruminococcus] gnavus]  70.5    3e-11
ref|WP_016313286.1|  alpha-L-fucosidase [Paenibacillus barengo...  70.5    3e-11
ref|WP_025844865.1|  alpha-L-fucosidase [Paenibacillus ehimensis]  70.9    3e-11
ref|WP_028539623.1|  alpha-L-fucosidase [Paenibacillus sp. J14]    70.5    3e-11
ref|WP_024565855.1|  alpha-L-fucosidase [Elizabethkingia anoph...  70.5    3e-11
ref|WP_022218291.1|  alpha-L-fucosidase [Bacteroides clarus CA...  70.5    3e-11
ref|WP_016176672.1|  hypothetical protein [Enterococcus durans]    70.5    3e-11
ref|WP_022130752.1|  alpha-L-fucosidase [Bacteroides sp. CAG:530]  70.9    3e-11
ref|WP_023461830.1|  alpha-L-fucosidase [Asticcacaulis sp. YBE...  70.9    3e-11
ref|WP_029286770.1|  alpha-L-fucosidase [Pedobacter sp. R20-19]    70.5    3e-11
ref|WP_002534674.1|  alpha-L-fucosidase [Propionibacterium acnes]  70.1    3e-11
ref|WP_031310294.1|  alpha-L-fucosidase [Sphingobium sp. C100]     70.9    3e-11
ref|WP_020571382.1|  hypothetical protein [Lewinella persica]      70.9    3e-11
gb|ETI59004.1|  alpha-L-fucosidase [Sphingobium sp. C100]          70.9    3e-11
ref|WP_009673623.1|  alpha-L-fucosidase [Paenibacillus sp. HGF7]   70.5    3e-11
ref|WP_022281508.1|  putative uncharacterized protein [Clostri...  70.1    3e-11
ref|WP_016424144.1|  hypothetical protein [Paenibacillus sp. H...  70.1    3e-11
ref|WP_003793771.1|  putative alpha-L-fucosidase [Actinomyces ...  70.9    3e-11
ref|WP_024295750.1|  MULTISPECIES: alpha-L-fucosidase [Lachnoc...  70.1    3e-11
ref|WP_018611258.1|  hypothetical protein [Segetibacter koreen...  70.1    3e-11
ref|WP_024346799.1|  alpha-L-fucosidase [ [Clostridium methoxy...  70.1    3e-11
ref|WP_026727643.1|  alpha-L-fucosidase [Flavobacterium denitr...  70.1    3e-11
ref|WP_020711033.1|  hypothetical protein [Acidobacteriaceae b...  70.1    4e-11
ref|WP_023487695.1|  glycosyl hydrolase, putative alpha-L-fuco...  70.1    4e-11
ref|WP_013738990.1|  glycoside hydrolase 29 (alpha-L-fucosidas...  70.1    4e-11
ref|WP_015330594.1|  Alpha-L-fucosidase [Fibrella aestuarina]      70.1    4e-11
ref|WP_002530919.1|  MULTISPECIES: glycosyl hydrolase [Propion...  70.1    4e-11
ref|WP_002537215.1|  MULTISPECIES: glycosyl hydrolase [Propion...  70.1    4e-11
ref|WP_015884019.1|  alpha-L-fucosidase [Beutenbergia cavernae]    69.3    4e-11
ref|WP_022386032.1|  glycoside hydrolase family 29 (Alpha-L-fu...  70.1    4e-11
ref|WP_002518109.1|  glycosyl hydrolase [Propionibacterium acnes]  70.1    4e-11
ref|WP_003790808.1|  hypothetical protein [Actinomyces odontol...  70.9    4e-11
ref|WP_009055840.1|  alpha-L-fucosidase [Atopobium sp. ICM58]      70.5    4e-11
ref|WP_009098492.1|  alpha-L-fucosidase precursor [Rhodopirell...  69.3    4e-11
ref|WP_026392897.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  70.1    4e-11
ref|WP_014218490.1|  alpha-L-fucosidase [Niastella koreensis]      70.1    4e-11
ref|WP_009714278.1|  alpha-L-fucosidase [Streptomyces himastat...  70.5    4e-11
ref|WP_029297044.1|  alpha-L-fucosidase [Chryseobacterium hisp...  70.1    4e-11
ref|WP_014219706.1|  alpha-L-fucosidase [Niastella koreensis]      70.1    4e-11
ref|WP_025656064.1|  hypothetical protein [Clostridiales bacte...  69.7    4e-11
gb|EDK74352.1|  probable glycosyl hydrolase [Streptococcus pne...  69.7    4e-11
ref|WP_002515131.1|  MULTISPECIES: glycosyl hydrolase [Propion...  69.7    5e-11
ref|WP_009085418.1|  alpha-L-fucosidase [Elizabethkingia anoph...  68.6    5e-11
ref|XP_002643527.1|  Hypothetical protein CBG16208 [Caenorhabd...  70.1    5e-11
ref|WP_009091700.1|  MULTISPECIES: alpha-L-fucosidase [Elizabe...  70.1    5e-11
gb|EZP51110.1|  Alpha-L-fucosidase family protein [Sphingomona...  70.1    5e-11
ref|WP_030440484.1|  alpha-L-fucosidase [Actinoplanes sp. RP-A...  69.7    5e-11
ref|WP_008599267.1|  glycosyl hydrolase [Propionibacterium sp....  69.7    5e-11
ref|WP_020530419.1|  hypothetical protein [Flexithrix dorotheae]   70.1    5e-11
ref|WP_002540739.1|  glycosyl hydrolase [Propionibacterium acnes]  69.7    5e-11
ref|XP_003140460.1|  alpha-L-fucosidase [Loa loa]                  70.1    5e-11
gb|KEY37943.1|  glycosyl hydrolase, putative alpha-L-fucosidas...  69.3    5e-11
dbj|GAE82179.1|  alpha-L-fucosidase [Bacteroides reticulotermi...  69.7    5e-11
ref|WP_026994196.1|  alpha-L-fucosidase [Flectobacillus major]     69.7    5e-11
ref|WP_020897765.1|  Alpha-L-fucosidase [Winogradskyella psych...  68.9    5e-11
ref|WP_009224653.1|  alpha-L-fucosidase [Paenibacillus sp. ora...  69.7    5e-11
ref|WP_022081539.1|  tissue alpha-L-fucosidase (Alpha-L-fucosi...  69.7    5e-11
emb|CDP53362.1|  Alpha-L-fucosidase [Devosia sp. DBB001]           69.7    5e-11
ref|WP_028667443.1|  alpha-L-fucosidase [Runella zeae]             69.7    5e-11
ref|WP_022142807.1|  tissue alpha-L-fucosidase (Alpha-L-fucosi...  69.7    5e-11
ref|WP_009002417.1|  alpha-L-fucosidase [Clostridium sp. D5]       69.7    5e-11
ref|WP_022043022.1|  uncharacterized protein [Bacteroides cacc...  65.9    5e-11
ref|WP_030311795.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  70.1    5e-11
ref|WP_012412132.1|  glycoside hydrolase family alpha-L-fucosi...  69.3    5e-11
ref|WP_008245214.1|  alpha-L-fucosidase [Pedobacter sp. BAL39]     69.7    6e-11
ref|WP_027380666.1|  alpha-L-fucosidase [Chryseobacterium daeg...  69.7    6e-11
ref|WP_007653355.1|  MULTISPECIES: alpha-L-fucosidase [Parabac...  69.7    6e-11
ref|WP_009004706.1|  alpha-L-fucosidase [Clostridium sp. D5]       69.3    6e-11
ref|WP_025142371.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  69.7    6e-11
gb|AHE54727.1|  alpha-L-fucosidase [Sphingomonas sanxanigenens...  69.7    6e-11
gb|KFC60168.1|  hypothetical protein FEM08_10400 [Flavobacteri...  69.3    6e-11
ref|WP_022340377.1|  glycoside hydrolase family 29 (Alpha-L-fu...  69.3    6e-11
ref|WP_016198661.1|  alpha-L-fucosidase [Elizabethkingia menin...  69.7    6e-11
gb|EWS80582.1|  alpha-L-fucosidase [Brachybacterium phenolires...  69.3    6e-11
ref|WP_018709609.1|  alpha-L-fucosidase [Bacteroides barnesiae]    69.3    6e-11
ref|WP_009280605.1|  alpha-L-fucosidase [Fibrisoma limi]           69.3    7e-11
ref|WP_026473595.1|  alpha-L-fucosidase [Alkaliflexus imshenet...  69.3    7e-11
ref|WP_028522150.1|  alpha-L-fucosidase [Runella limosa]           69.3    7e-11
gb|KFF19127.1|  alpha-L-fucosidase [Chryseobacterium sp. JM1]      69.3    7e-11
ref|WP_029986105.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  69.3    7e-11
ref|WP_022455606.1|  putative uncharacterized protein [Parabac...  69.3    7e-11
ref|WP_014223401.1|  alpha-L-fucosidase [Niastella koreensis]      69.3    7e-11
gb|ETN96618.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]        69.3    7e-11
ref|WP_009130695.1|  hypothetical protein [Bacteroides oleicip...  69.3    7e-11
gb|AIA91048.1|  alpha_L_fucos [uncultured Leadbetterella sp.]      65.5    7e-11
gb|AIA90732.1|  alpha_L_fucos [uncultured Dictyoglomus sp.]        64.3    7e-11
ref|WP_022414439.1|  alpha-L-fucosidase (GH29) [Clostridium sp...  68.6    7e-11
ref|WP_012790907.1|  alpha-L-fucosidase [Chitinophaga pinensis]    69.3    7e-11
ref|WP_009124390.1|  alpha-L-fucosidase [Bacteroides fluxus]       69.3    8e-11
ref|WP_008686756.1|  glycoside hydrolase family 29 (alpha-L-fu...  68.9    8e-11
gb|KFX72665.1|  alpha-L-fucosidase [Bacteroides fragilis]          69.3    8e-11
ref|WP_003003741.1|  alpha-L-fucosidase [Sphingobacterium spir...  69.3    8e-11
emb|CDN77224.1|  Alpha-L-fucosidase (modular protein) [Elizabe...  68.9    8e-11
ref|WP_009743727.1|  alpha-L-fucosidase [Actinomyces sp. oral ...  69.7    8e-11
ref|WP_002543920.1|  glycosyl hydrolase [Propionibacterium acnes]  68.9    8e-11
ref|WP_002520328.1|  MULTISPECIES: glycosyl hydrolase [Propion...  68.9    8e-11
ref|WP_002544431.1|  glycosyl hydrolase [Propionibacterium acnes]  68.9    8e-11
ref|WP_002526186.1|  glycosyl hydrolase [Propionibacterium acnes]  68.9    8e-11
ref|WP_013582125.1|  alpha-L-fucosidase [Granulicella tundricola]  68.9    8e-11
ref|WP_021612849.1|  LPXTG-motif protein cell wall anchor doma...  69.7    8e-11
ref|WP_002997147.1|  alpha-L-fucosidase [Sphingobacterium spir...  68.9    9e-11
gb|KFC32993.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  68.9    9e-11
ref|WP_024565138.1|  alpha-L-fucosidase [Elizabethkingia anoph...  68.9    9e-11
ref|WP_021346456.1|  hypothetical protein [Elizabethkingia men...  68.9    9e-11
ref|WP_024567324.1|  alpha-L-fucosidase [Elizabethkingia anoph...  68.9    9e-11
ref|WP_026216010.1|  hypothetical protein [Porphyromonas macacae]  69.3    9e-11
ref|WP_024817699.1|  alpha-L-fucosidase [Arthrobacter sp. 31Y]     68.9    9e-11
ref|WP_006057804.1|  alpha-L-fucosidase [Holdemania filiformis]    68.6    1e-10
ref|WP_020722126.1|  hypothetical protein [Acidobacteriaceae b...  68.9    1e-10
ref|WP_027386069.1|  alpha-L-fucosidase [Chryseobacterium greg...  68.9    1e-10
gb|ETN94309.1|  alpha-L-fucosidase [Zhouia amylolytica AD3]        68.9    1e-10
ref|WP_015011418.1|  glycosyl hydrolase [Propionibacterium acnes]  68.9    1e-10
ref|WP_013570261.1|  alpha-L-fucosidase [Terriglobus saanensis]    68.6    1e-10
ref|WP_022512037.1|  alpha-L-fucosidase [Prevotella sp. CAG:617]   68.2    1e-10
ref|WP_018840993.1|  hypothetical protein [Streptomyces sp. CN...  69.3    1e-10
ref|WP_018845143.1|  hypothetical protein [Streptomyces sp. CN...  69.3    1e-10
ref|WP_021633854.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  68.9    1e-10
ref|WP_019149514.1|  hypothetical protein [Alistipes senegalen...  68.6    1e-10
ref|WP_029985477.1|  hypothetical protein [Sphingobacterium sp...  68.6    1e-10
ref|WP_016948770.1|  alpha-L-fucosidase [Anabaena sp. PCC 7108]    68.6    1e-10
ref|WP_018851447.1|  hypothetical protein [Streptomyces sp. CN...  68.9    1e-10
ref|WP_010581227.1|  alpha-L-fucosidase [Lactobacillus vini]       68.2    1e-10
ref|WP_027769466.1|  alpha-L-fucosidase [Streptomyces sp. CNQ865]  68.9    1e-10
ref|WP_013861656.1|  alpha-L-fucosidase [Microlunatus phosphov...  68.6    1e-10
ref|WP_008143190.1|  alpha-L-fucosidase [Bacteroides coprophilus]  68.6    1e-10
dbj|GAF01925.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  65.1    1e-10
ref|WP_022197002.1|  alpha-L-fucosidase [Akkermansia muciniphi...  68.9    1e-10
ref|WP_015812062.1|  alpha-L-fucosidase [Dyadobacter fermentans]   68.6    1e-10
ref|WP_028727331.1|  alpha-L-fucosidase [Parabacteroides gordo...  68.2    2e-10
ref|WP_014266538.1|  alpha-L-fucosidase [Granulicella mallensis]   68.2    2e-10
ref|WP_009100220.1|  Glycoside hydrolase, family 29 [Rhodopire...  68.6    2e-10
emb|CDS91423.1|  Alpha-L-fucosidase protein [Sphingobacterium ...  68.6    2e-10
ref|XP_007913865.1|  putative tissue alpha-l-fucosidase protei...  68.2    2e-10
ref|WP_020897760.1|  Alpha-L-fucosidase [Winogradskyella psych...  68.6    2e-10
ref|WP_005962411.1|  alpha-L-fucosidase [Actinomyces cardiffen...  68.9    2e-10
ref|WP_026327064.1|  hypothetical protein [Proteiniphilum acet...  68.6    2e-10
ref|WP_023961974.1|  alpha-L-fucosidase [Paenibacillus sp. JCM...  68.6    2e-10
ref|WP_003002069.1|  alpha-L-fucosidase [Sphingobacterium spir...  68.2    2e-10
ref|WP_003008183.1|  alpha-L-fucosidase [Sphingobacterium spir...  68.2    2e-10
gb|AIA86217.1|  alpha_L_fucos [uncultured Xanthomonas sp.]         64.3    2e-10
gb|KFP02836.1|  Tissue alpha-L-fucosidase [Calypte anna]           67.4    2e-10
ref|WP_014223389.1|  glycosyl hydrolase [Niastella koreensis]      68.2    2e-10
ref|WP_029276089.1|  alpha-L-fucosidase [Pedobacter borealis]      68.2    2e-10
ref|XP_008494638.1|  PREDICTED: tissue alpha-L-fucosidase [Cal...  67.4    2e-10
ref|WP_007361338.1|  alpha-L-fucosidase [Opitutaceae bacterium...  68.2    2e-10
gb|EZH73472.1|  alpha-L-fucosidase [Aquimarina sp. 22II-S11-z7]    68.2    2e-10
ref|WP_009268616.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  67.8    2e-10
ref|WP_022152581.1|  putative uncharacterized protein [Lachnos...  67.8    2e-10
ref|WP_031526727.1|  alpha-L-fucosidase [Dyadobacter crusticola]   67.8    2e-10
gb|KFC59411.1|  alpha-L-fucosidase [Flavobacterium sp. EM1308]     67.8    2e-10
gb|AIA92676.1|  alpha_L_fucos [uncultured Bacteroides sp.]         64.3    2e-10
gb|EWM10536.1|  alpha-L-fucosidase [Kutzneria sp. 744]             67.8    2e-10
ref|WP_022276981.1|  glycoside hydrolase family 29 (Alpha-L-fu...  67.8    2e-10
ref|WP_028447135.1|  alpha-L-fucosidase [Chitinimonas koreensis]   67.4    2e-10
ref|WP_007000874.1|  hypothetical protein [Actinobaculum massi...  67.8    3e-10
ref|WP_026170545.1|  hypothetical protein [Porphyromonas benno...  68.2    3e-10
ref|WP_022151668.1|  putative uncharacterized protein [Lachnos...  67.4    3e-10
ref|WP_014263343.1|  alpha-L-fucosidase [Granulicella mallensis]   67.4    3e-10
ref|WP_010719444.1|  hypothetical protein [Enterococcus faeciu...  67.4    3e-10
ref|WP_010737391.1|  hypothetical protein [Enterococcus hirae]     67.4    3e-10
ref|WP_009267066.1|  alpha-L-fucosidase [Lachnospiraceae bacte...  67.0    3e-10
ref|WP_013666631.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  67.8    3e-10
ref|WP_010665299.1|  alpha-L-fucosidase [Marinilabilia salmoni...  67.8    3e-10
ref|WP_021687049.1|  Alpha-L-fucosidase [Treponema lecithinoly...  67.4    3e-10
gb|KDR91953.1|  alpha-L-fucosidase [Enterococcus hirae]            67.4    3e-10
ref|WP_008841885.1|  alpha-L-fucosidase [Pediococcus lolii]        65.1    3e-10
gb|KFC59799.1|  hypothetical protein FEM08_14670 [Flavobacteri...  67.4    3e-10
ref|XP_007083875.1|  PREDICTED: tissue alpha-L-fucosidase [Pan...  67.4    3e-10
ref|WP_005679409.1|  MULTISPECIES: hypothetical protein [Bacte...  67.4    3e-10
gb|ETN95842.1|  hypothetical protein P278_15640 [Zhouia amylol...  67.4    3e-10
ref|WP_005680253.1|  hypothetical protein [Bacteroides caccae]     67.4    3e-10
ref|WP_010543129.1|  alpha-L-fucosidase [Sphingomonas elodea]      67.4    3e-10
ref|WP_008689089.1|  glycoside hydrolase family 29 (alpha-L- f...  67.4    3e-10
ref|WP_028070802.1|  alpha-L-fucosidase [Sphingobacterium thal...  67.4    4e-10
emb|CBY14144.1|  unnamed protein product [Oikopleura dioica]       67.8    4e-10
ref|WP_024993347.1|  alpha-L-fucosidase [Bacteroides paurosacc...  67.4    4e-10
ref|WP_018621341.1|  alpha-L-fucosidase [Spirosoma luteum]         67.0    4e-10
ref|WP_013666136.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  67.4    4e-10
ref|WP_026880096.1|  alpha-L-fucosidase [Hymenobacter norwiche...  67.0    4e-10
gb|KEA08255.1|  alpha-L-fucosidase [Agrobacterium rhizogenes]      67.0    4e-10
ref|WP_026177054.1|  alpha-L-fucosidase [Dysgonomonas mossii]      67.0    4e-10
ref|WP_002812019.1|  alpha-L-fucosidase [Xanthomonas fragariae]    67.0    4e-10
ref|WP_030875210.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  67.4    4e-10
emb|CBM40947.1|  alpha-L-fucosidase [Paenibacillus thiaminolyt...  67.0    4e-10
gb|AHF14719.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       67.0    4e-10
ref|WP_006356107.1|  hypothetical protein, partial [ [Clostrid...  67.8    4e-10
ref|WP_006842893.1|  alpha-L-fucosidase [Dysgonomonas mossii]      67.0    4e-10
ref|WP_018631104.1|  hypothetical protein [Niabella aurantiaca]    67.4    4e-10
ref|WP_007360974.1|  alpha-L-fucosidase [Opitutaceae bacterium...  67.0    4e-10
ref|WP_006354692.1|  hypothetical protein [ [Clostridium methy...  67.8    5e-10
ref|WP_026751127.1|  alpha-L-fucosidase [Sediminibacterium sp....  67.0    5e-10
ref|WP_018711383.1|  MULTISPECIES: hypothetical protein [Bacte...  67.4    5e-10
ref|WP_008201669.1|  alpha-L-fucosidase [Algoriphagus sp. PR1]     67.0    5e-10
ref|WP_031499944.1|  alpha-L-fucosidase [Bryobacter aggregatus]    67.0    5e-10
ref|WP_004322896.1|  MULTISPECIES: hypothetical protein [Bacte...  67.0    5e-10
gb|AHF91166.1|  alpha-L-fucosidase [Opitutaceae bacterium TAV5]    67.0    5e-10
ref|WP_012790255.1|  alpha-L-fucosidase [Chitinophaga pinensis]    66.6    5e-10
ref|WP_014785866.1|  alpha-L-fucosidase [Terriglobus roseus]       67.0    5e-10
gb|KFC58162.1|  hypothetical protein FEM08_30520 [Flavobacteri...  67.0    5e-10
ref|WP_026956117.1|  alpha-L-fucosidase [Algoriphagus vanfonge...  67.0    5e-10
ref|WP_009594386.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   67.0    5e-10
gb|EGI64546.1|  Plasma alpha-L-fucosidase [Acromyrmex echinatior]  66.2    5e-10
ref|WP_026448237.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  67.0    5e-10
ref|WP_022340378.1|  glycoside hydrolase family 29 (Alpha-L-fu...  66.6    5e-10
ref|WP_015030881.1|  alpha-L-fucosidase [Emticicia oligotrophica]  66.6    5e-10
ref|WP_029464377.1|  alpha-L-fucosidase [Chitinophaga sp. JGI ...  66.6    6e-10
ref|WP_022049009.1|  putative uncharacterized protein [Odoriba...  67.0    6e-10
ref|WP_018709610.1|  hypothetical protein [Bacteroides barnesiae]  66.6    6e-10
ref|WP_012925729.1|  alpha-L-fucosidase [Spirosoma linguale]       66.6    6e-10
ref|WP_021927752.1|  glycoside hydrolase family 29 [Alistipes ...  66.6    6e-10
ref|WP_024771491.1|  alpha-L-fucosidase [Aquimarina macrocephali]  66.6    6e-10
gb|ETT65907.1|  glycoside hydrolase family protein [Paenibacil...  67.0    6e-10
gb|KER51460.1|  glycoside hydrolase family 29 [Bacteroides fra...  67.0    6e-10
ref|WP_009136648.1|  hypothetical protein [Odoribacter laneus]     67.0    6e-10
ref|WP_007562027.1|  alpha-L-fucosidase [Bacteroides plebeius]     67.0    7e-10
gb|EXY45456.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    7e-10
ref|WP_022019619.1|  uncharacterized protein [Bacteroides sp. ...  66.6    7e-10
ref|WP_013568335.1|  alpha-L-fucosidase [Terriglobus saanensis]    66.6    7e-10
gb|EXZ09032.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    7e-10
ref|WP_005781367.1|  alpha-L-fucosidase [Bacteroides fragilis]     66.2    7e-10
ref|WP_010993306.1|  hypothetical protein [Bacteroides fragilis]   66.6    7e-10
ref|WP_010767328.1|  hypothetical protein [Enterococcus phoeni...  66.2    7e-10
gb|EYA60544.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    7e-10
ref|WP_005808417.1|  alpha-L-fucosidase [Bacteroides fragilis]     66.2    8e-10
gb|EXZ99339.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
gb|EXY12134.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
ref|WP_011203259.1|  MULTISPECIES: hypothetical protein [Bacte...  66.6    8e-10
ref|WP_014299245.1|  putative lipoprotein [Bacteroides fragilis]   66.6    8e-10
gb|EXY99635.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
ref|WP_005814851.1|  hypothetical protein [Bacteroides fragilis]   66.6    8e-10
gb|EXZ82179.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
gb|EXY83503.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
gb|EXY64636.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
ref|WP_005802747.1|  hypothetical protein [Bacteroides fragilis]   66.6    8e-10
ref|WP_025762308.1|  alpha-L-fucosidase [Dyadobacter sp. Y620-1]   66.2    8e-10
ref|WP_022830839.1|  alpha-L-fucosidase [Cytophagales str. B6]     66.6    8e-10
gb|EXY39859.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
ref|WP_005789701.1|  MULTISPECIES: hypothetical protein [Bacte...  66.6    8e-10
ref|WP_007338252.1|  alpha-L-fucosidase precursor [Rhodopirell...  66.6    8e-10
gb|EXZ04464.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
gb|EXZ88240.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    8e-10
gb|KER53754.1|  alpha-L-fucosidase [Bacteroides fragilis]          66.2    8e-10
ref|WP_015151601.1|  alpha-L-fucosidase [Oscillatoria acuminata]   65.9    8e-10
ref|WP_009593433.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   65.9    8e-10
ref|WP_007131235.1|  alpha-L-fucosidase [Paenibacillus lactis]     66.6    8e-10
gb|EXY17105.1|  F5/8 type C domain protein [Bacteroides fragil...  66.6    9e-10
ref|WP_013547078.1|  alpha-L-fucosidase [Bacteroides helcogenes]   66.2    9e-10
ref|WP_003128612.1|  alpha-L-fucosidase [Enterococcus sp. HSIEG1]  65.9    9e-10
ref|WP_022011801.1|  glycoside hydrolase family 29 [Bacteroide...  66.2    9e-10
ref|WP_030085637.1|  alpha-L-fucosidase [Streptomyces decoyicus]   65.1    1e-09
emb|CDR05742.1|  PA14 domain protein [Streptomyces iranensis]      66.2    1e-09
ref|WP_005472737.1|  MULTISPECIES: hypothetical protein [Enter...  65.9    1e-09
ref|WP_031443118.1|  alpha-L-fucosidase [Arenibacter sp. TG409]    65.9    1e-09
ref|WP_022354009.1|  putative uncharacterized protein [Bactero...  66.2    1e-09
ref|WP_013768352.1|  alpha-L-fucosidase [Haliscomenobacter hyd...  65.9    1e-09
ref|WP_028907144.1|  glycoside hydrolase family 29 [Prevotella...  66.2    1e-09
ref|WP_005780760.1|  glycoside hydrolase family 29 [Bacteroide...  66.2    1e-09
gb|AIC77303.1|  alpha-L-fucosidase [uncultured bacterium]          65.9    1e-09
ref|WP_028700412.1|  alpha-L-fucosidase [Propionibacterium aci...  65.9    1e-09
ref|WP_005821311.1|  hypothetical protein [Bacteroides fragilis]   66.2    1e-09
ref|WP_030890222.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  66.2    1e-09
ref|WP_022455426.1|  alpha-L-fucosidase [Parabacteroides sp. C...  65.9    1e-09
gb|EXU68712.1|  alpha-L-fucosidase [Streptomyces sp. PRh5]         66.2    1e-09
ref|WP_005807775.1|  hypothetical protein [Bacteroides fragilis]   66.2    1e-09
ref|WP_014264814.1|  alpha-L-fucosidase [Granulicella mallensis]   65.9    1e-09
ref|WP_028913338.1|  glycoside hydrolase family 29 [Prevotella...  66.2    1e-09
ref|WP_013064749.1|  DS domain-containing protein [Prevotella ...  66.2    1e-09
ref|WP_012819149.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  65.5    1e-09
ref|WP_002829383.1|  alpha-L-fucosidase [Pediococcus acidilact...  65.5    1e-09
gb|EXY32394.1|  alpha-L-fucosidase family protein [Bacteroides...  65.9    1e-09
gb|ETT65694.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  65.5    1e-09
ref|WP_024862801.1|  alpha-L-fucosidase [Pediococcus acidilact...  65.5    1e-09
ref|WP_008841495.1|  alpha-L-fucosidase [Pediococcus lolii]        65.5    1e-09
ref|WP_022012158.1|  putative uncharacterized protein [Bactero...  65.9    1e-09
ref|WP_022310743.1|  putative uncharacterized protein [Prevote...  65.9    1e-09
ref|WP_028405415.1|  alpha-L-fucosidase [Bacillus sp. J13]         65.9    1e-09
ref|WP_026460528.1|  alpha-L-fucosidase [Actinomyces suimastit...  65.5    1e-09
ref|WP_013042287.1|  glycoside hydrolase [Coraliomargarita aka...  65.5    1e-09
gb|ETZ24910.1|  hypothetical protein N824_01375 [Pedobacter sp...  65.9    1e-09
ref|WP_029693383.1|  alpha-L-fucosidase [Enterococcus faecalis]    65.1    1e-09
ref|WP_014021498.1|  alpha-L-fucosidase [Cyclobacterium marinum]   65.9    1e-09
ref|WP_022019578.1|  uncharacterized protein [Bacteroides sp. ...  65.5    1e-09
ref|WP_014055641.1|  alpha-L-fucosidase [Streptomyces violaceu...  65.9    1e-09
ref|WP_027586311.1|  alpha-L-fucosidase [Propionibacterium tho...  65.5    1e-09
ref|WP_004166383.1|  alpha-L-fucosidase [Pediococcus acidilact...  65.1    1e-09
ref|WP_022391025.1|  putative uncharacterized protein [Tannere...  65.9    1e-09
ref|WP_009317349.1|  hypothetical protein [Tannerella sp. 6_1_...  65.9    1e-09
ref|WP_002832627.1|  alpha-L-fucosidase [Pediococcus acidilact...  65.1    2e-09
ref|WP_014266635.1|  alpha-L-fucosidase [Granulicella mallensis]   65.5    2e-09
ref|WP_027586049.1|  glycoside hydrolase family 29 [Prolixibac...  65.5    2e-09
ref|WP_022009617.1|  alpha-L-fucosidase [Firmicutes bacterium ...  65.1    2e-09
ref|WP_029368671.1|  alpha-L-fucosidase [Sulfolobus islandicus]    65.1    2e-09
ref|WP_008669507.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  65.1    2e-09
ref|WP_026773712.1|  alpha-L-fucosidase [Sediminibacterium sp....  65.5    2e-09
ref|WP_025864992.1|  glycoside hydrolase family 29 [Prolixibac...  65.5    2e-09
gb|ELT89203.1|  hypothetical protein CAPTEDRAFT_102689 [Capite...  61.2    2e-09
gb|EFT95523.1|  Alpha-L-fucosidase [Enterococcus faecalis TX0012]  65.1    2e-09
ref|WP_007767694.1|  alpha-L-fucosidase [Bacteroides finegoldii]   65.5    2e-09
ref|WP_004297616.1|  alpha-L-fucosidase [Bacteroides ovatus]       65.5    2e-09
gb|ELT89630.1|  hypothetical protein CAPTEDRAFT_130974 [Capite...  61.2    2e-09
ref|WP_016276523.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  65.1    2e-09
gb|AIA90438.1|  CAZy families GH29 protein [uncultured bacterium]  60.8    2e-09
ref|XP_001176232.2|  PREDICTED: alpha-L-fucosidase-like [Stron...  65.1    2e-09
ref|WP_014651217.1|  alpha-L-fucosidase [Paenibacillus mucilag...  65.1    2e-09
ref|WP_014790154.1|  alpha-L-fucosidase [Ornithobacterium rhin...  65.5    2e-09
ref|WP_025868105.1|  hypothetical protein [Bacteroides nordii]     65.1    2e-09
ref|WP_022599813.1|  glycoside hydrolase family 29 [Coprobacte...  65.5    2e-09
ref|WP_008777130.1|  alpha-L-fucosidase [Bacteroides sp. 2_2_4]    65.5    2e-09
ref|WP_012928395.1|  hypothetical protein [Spirosoma linguale]     65.5    2e-09
ref|WP_006211609.1|  alpha-L-fucosidase [Paenibacillus vortex]     65.1    2e-09
gb|KEO74315.1|  alpha-L-fucosidase [Cytophagaceae bacterium AN...  65.1    2e-09
ref|WP_026336471.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  64.7    2e-09
ref|WP_010750994.1|  hypothetical protein [Enterococcus villorum]  65.1    2e-09
ref|WP_025881249.1|  glycoside hydrolase family 29 [Prevotella...  65.1    2e-09
ref|WP_004165353.1|  alpha-L-fucosidase [Pediococcus acidilact...  64.7    2e-09
ref|WP_005916284.1|  alpha-L-fucosidase [Pediococcus acidilact...  64.7    2e-09
ref|WP_012649736.1|  alpha-L-fucosidase [Agrobacterium tumefac...  64.7    2e-09
ref|WP_022506936.1|  putative uncharacterized protein [Bactero...  64.7    2e-09
gb|KDF46799.1|  hypothetical protein AE07_02654 [Enterobacter ...  65.9    2e-09
gb|ETT34925.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808]  64.7    2e-09
ref|WP_005842583.1|  alpha-L-fucosidase [Bacteroides vulgatus]     64.7    2e-09
ref|WP_022419404.1|  putative uncharacterized protein [Acidiph...  64.7    2e-09
ref|WP_025663097.1|  alpha-L-fucosidase [Aquimarina megaterium]    64.7    2e-09
ref|WP_007690682.1|  alpha-L-fucosidase [Rhizobium sp. AP16]       64.7    2e-09
ref|WP_020867727.1|  alpha-L-fucosidase [Streptomyces rapamyci...  65.1    2e-09
ref|WP_020892875.1|  Alpha-L-fucosidase [Cyclobacterium qasimii]   65.1    2e-09
ref|WP_029273727.1|  hypothetical protein [Microbacterium sp. ...  64.7    3e-09
gb|KEZ90324.1|  alpha-fucosidase [ [ [Clostridium celerecrescens]  64.7    3e-09
gb|EYA38264.1|  F5/8 type C domain protein [Bacteroides fragil...  65.1    3e-09
ref|WP_013665443.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  64.7    3e-09
ref|WP_005941527.1|  hypothetical protein [Bacteroides massili...  64.7    3e-09
ref|WP_021590105.1|  alpha-L-fucosidase [Prevotella baroniae]      64.7    3e-09
ref|WP_029264275.1|  hypothetical protein [Microbacterium sp. ...  64.3    3e-09
ref|WP_026814231.1|  hypothetical protein [Arenibacter certesii]   64.7    3e-09
ref|WP_006601957.1|  alpha-L-fucosidase [Streptomyces auratus]     64.7    3e-09
ref|WP_008690164.1|  glycosyl hydrolase [Rhodopirellula maiorica]  64.7    3e-09
ref|WP_009988419.1|  alpha-L-fucosidase [Sulfolobus solfataricus]  63.9    3e-09
ref|WP_009751055.1|  f5/8 type C domain protein [Capnocytophag...  64.7    3e-09
ref|WP_022120869.1|  putative lipoprotein [Prevotella copri CA...  63.9    3e-09
ref|WP_017811580.1|  alpha-L-fucosidase [Paenibacillus sp. A9]     64.3    4e-09
ref|WP_012916708.1|  alpha-L-fucosidase [Xanthomonas albilineans]  64.3    4e-09
ref|WP_002679088.1|  alpha-L-fucosidase [Capnocytophaga sputig...  64.7    4e-09
ref|WP_022330749.1|  alpha-L-fucosidase [Firmicutes bacterium ...  63.5    4e-09
ref|XP_005140151.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...  63.9    4e-09
emb|CDL97737.1|  Alpha-L-fucosidase [Bacteroides xylanisolvens...  62.4    4e-09
ref|WP_015808652.1|  alpha-L-fucosidase [Pedobacter heparinus]     64.3    4e-09
gb|ETZ20652.1|  hypothetical protein N824_04690 [Pedobacter sp...  64.3    4e-09
ref|WP_026814965.1|  alpha-L-fucosidase [Arenibacter certesii]     64.3    4e-09
ref|WP_020530615.1|  hypothetical protein [Flexithrix dorotheae]   64.3    4e-09
gb|EQM74279.1|  hypothetical protein L687_02170 [Microbacteriu...  63.9    4e-09
ref|WP_003585733.1|  alpha-L-fucosidase [Lactobacillus casei]      60.1    5e-09
ref|WP_024994850.1|  hypothetical protein [Bacteroides paurosa...  64.3    5e-09
ref|WP_008504552.1|  glycosyl hydrolase [Mucilaginibacter palu...  63.9    5e-09
ref|WP_026235822.1|  alpha-L-fucosidase [Echinicola pacifica]      63.9    5e-09
ref|WP_009859747.1|  hypothetical protein [Parabacteroides gol...  63.9    5e-09
ref|WP_010527171.1|  alpha-L-fucosidase [Anaerophaga sp. HS1]      63.9    5e-09
ref|WP_008991060.1|  alpha-L-fucosidase [Galbibacter sp. ck-I2...  63.9    5e-09
ref|WP_022164324.1|  f5/8 type C domain protein [Bacteroides s...  63.9    5e-09
ref|WP_010517409.1|  alpha-L-fucosidase [Mesoflavibacter zeaxa...  63.5    6e-09
ref|WP_030646509.1|  alpha-L-fucosidase [Streptomyces rimosus]     63.9    6e-09
ref|WP_014952394.1|  hypothetical protein [Lactobacillus casei]    59.7    6e-09
ref|WP_016359731.1|  MULTISPECIES: alpha-L-fucosidase [Clostri...  63.5    6e-09
ref|WP_025233568.1|  alpha-fucosidase [Clostridium sp. ASBs410]    63.5    6e-09
ref|WP_013994792.1|  alpha-L-fucosidase [Zobellia galactanivor...  63.9    7e-09
ref|WP_013709598.1|  alpha-L-fucosidase [Coriobacterium glomer...  63.5    7e-09
ref|WP_026429608.1|  glycosyl hydrolase [Actinomyces georgiae]     63.5    7e-09
ref|WP_005867369.1|  glycosyl hydrolase [Actinomyces georgiae]     63.5    7e-09
ref|WP_013305107.1|  alpha-L-fucosidase [Maribacter sp. HTCC2170]  63.9    7e-09
ref|WP_015208152.1|  alpha-L-fucosidase [Cylindrospermum stagn...  63.2    7e-09
ref|WP_012804912.1|  alpha-L-fucosidase [Brachybacterium faecium]  63.2    7e-09
gb|AHW60795.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   63.5    7e-09
ref|WP_022841806.1|  alpha-L-fucosidase [Acidobacteriaceae bac...  63.5    7e-09
ref|WP_020897758.1|  Alpha-L-fucosidase [Winogradskyella psych...  63.5    7e-09
ref|WP_022326814.1|  uncharacterized protein [Prevotella sp. C...  63.5    7e-09
ref|WP_030597301.1|  alpha-L-fucosidase [Streptomyces rimosus]     63.5    8e-09
ref|WP_006681545.1|  hypothetical protein [Actinomyces turicen...  63.9    8e-09
ref|WP_026481881.1|  alpha-L-fucosidase [Agromyces subbeticus]     63.2    8e-09
ref|WP_014223402.1|  alpha-L-fucosidase [Niastella koreensis]      63.2    8e-09
ref|WP_018358398.1|  hypothetical protein [Porphyromonas levii]    63.5    8e-09
ref|WP_008657519.1|  alpha-L-fucosidase [Bacteroides sp. 3_2_5]    63.2    8e-09
ref|WP_013547076.1|  alpha-L-fucosidase [Bacteroides helcogenes]   63.2    9e-09
ref|WP_028483851.1|  glycoside hydrolase family 29 [candidate ...  62.8    9e-09
ref|WP_029283597.1|  alpha-L-fucosidase [Pedobacter sp. R20-19]    63.2    9e-09
ref|WP_020530441.1|  hypothetical protein [Flexithrix dorotheae]   63.2    9e-09
ref|WP_005468442.1|  f5/8 type C domain protein [Porphyromonas...  63.5    9e-09
ref|WP_023961122.1|  alpha-L-fucosidase [Paenibacillus sp. JCM...  60.5    9e-09
ref|WP_014856258.1|  alpha-L-fucosidase 1 [Melioribacter roseus]   63.5    9e-09
ref|WP_022310625.1|  dS domain protein [Prevotella sp. CAG:474]    63.2    9e-09
ref|WP_025489486.1|  hypothetical protein [Clostridiales bacte...  63.2    9e-09
ref|WP_009999455.1|  alpha-L-fucosidase [Streptomyces clavulig...  63.2    9e-09
gb|AHF11992.1|  alpha-1,3/4-fucosidase [Barnesiella viscericol...  63.2    9e-09
ref|WP_003963447.1|  alpha-L-fucosidase [Streptomyces clavulig...  63.2    9e-09
ref|WP_016638540.1|  putative Alpha-L-fucosidase [Streptomyces...  63.2    9e-09
ref|WP_005644858.1|  glycoside hydrolase [Parabacteroides merdae]  63.2    1e-08
ref|WP_020260959.1|  MULTISPECIES: hypothetical protein [Amini...  63.2    1e-08
ref|WP_009100522.1|  alpha-L-fucosidase precursor [Rhodopirell...  63.2    1e-08
ref|WP_005633309.1|  glycoside hydrolase [Parabacteroides merdae]  63.2    1e-08
ref|WP_030360147.1|  alpha-L-fucosidase [Streptomyces ruber]       63.2    1e-08
ref|WP_018088460.1|  alpha-L-fucosidase [Streptomyces sp. Fxan...  63.2    1e-08
ref|WP_006744762.1|  alpha-1,3/4-fucosidase [Bacteroides copro...  63.2    1e-08
ref|WP_018473140.1|  hypothetical protein [Echinicola pacifica]    62.8    1e-08
ref|WP_023984971.1|  hypothetical protein [Prevotella oralis]      63.2    1e-08
ref|WP_004378964.1|  plasma alpha-L-fucosidase [Prevotella oris]   59.7    1e-08
ref|WP_003953031.1|  alpha-L-fucosidase [Streptomyces clavulig...  62.8    1e-08
ref|WP_029277331.1|  hypothetical protein [Pedobacter borealis]    62.8    1e-08
ref|WP_022454999.1|  uncharacterized protein [Parabacteroides ...  63.2    1e-08
ref|WP_007661874.1|  alpha-L-fucosidase [Caulobacter sp. AP07]     62.8    1e-08
gb|EXZ04086.1|  alpha-L-fucosidase family protein [Bacteroides...  62.8    1e-08
gb|ETT60872.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  62.8    1e-08
ref|WP_009589805.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   62.8    1e-08
ref|WP_022042430.1|  uncharacterized protein [Bacteroides cacc...  62.8    1e-08
ref|WP_005678331.1|  hypothetical protein [Bacteroides caccae]     62.8    1e-08
ref|WP_015736578.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  62.4    1e-08
ref|WP_007127914.1|  alpha-L-fucosidase [Paenibacillus lactis]     62.4    1e-08
ref|WP_005681652.1|  hypothetical protein [Bacteroides caccae]     62.8    1e-08
ref|WP_009988418.1|  Alpha-fucosidase N-terminal fragment (fuc...  58.5    1e-08
gb|EXY39447.1|  alpha-L-fucosidase family protein [Bacteroides...  62.4    1e-08
ref|WP_024332178.1|  glycosyl hydrolase [Actinomyces neuii]        62.4    1e-08
gb|EXZ08563.1|  alpha-L-fucosidase family protein [Bacteroides...  62.4    1e-08
gb|EXY45018.1|  alpha-L-fucosidase family protein [Bacteroides...  62.4    1e-08
ref|WP_014299352.1|  alpha-L-fucosidase [Bacteroides fragilis]     62.4    1e-08
gb|EYA69919.1|  alpha-L-fucosidase family protein [Bacteroides...  62.4    1e-08
ref|WP_005798159.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  62.4    1e-08
ref|WP_021915565.1|  alpha-L-fucosidase [Firmicutes bacterium ...  62.4    1e-08
gb|EXY99102.1|  alpha-L-fucosidase family protein [Bacteroides...  62.4    1e-08
ref|WP_009292597.1|  alpha-L-fucosidase [Bacteroides sp. 2_1_5...  62.4    1e-08
ref|WP_015783114.1|  alpha-L-fucosidase [Capnocytophaga ochracea]  62.8    1e-08
emb|CDA85665.1|  putative uncharacterized protein [Bacteroides...  62.8    1e-08
ref|WP_012794125.1|  hypothetical protein [Chitinophaga pinensis]  62.8    1e-08
ref|WP_017256952.1|  hypothetical protein [Pedobacter arcticus]    58.9    1e-08
ref|WP_009417841.1|  alpha-L-fucosidase [Capnocytophaga sp. or...  62.8    1e-08
ref|WP_009421333.1|  alpha-L-fucosidase [Capnocytophaga sp. or...  62.8    1e-08
ref|WP_026310017.1|  glycoside hydrolase family 29 [Niabella a...  62.4    1e-08
ref|WP_016479390.1|  alpha-L-fucosidase [Capnocytophaga sp. or...  62.8    2e-08
ref|WP_008210147.1|  alpha-L-fucosidase [Rhodanobacter sp. 115]    62.8    2e-08
ref|WP_030022473.1|  alpha-L-fucosidase [Streptomyces monomycini]  62.4    2e-08
gb|EXY29703.1|  alpha-L-fucosidase family protein [Bacteroides...  62.0    2e-08
ref|WP_009410363.1|  f5/8 type C domain protein [Capnocytophag...  62.8    2e-08
ref|WP_013409285.1|  alpha-L-fucosidase [Leadbetterella byssop...  62.4    2e-08
ref|WP_022811581.1|  MULTISPECIES: alpha-L-fucosidase [unclass...  62.4    2e-08
ref|WP_004351008.1|  F5/8 type C domain protein [Prevotella bu...  62.4    2e-08
ref|WP_007211898.1|  hypothetical protein [Bacteroides cellulo...  62.0    2e-08
ref|WP_022110515.1|  glycoside hydrolase family 29 [Prevotella...  62.0    2e-08
ref|XP_003305207.1|  hypothetical protein PTT_17987 [Pyrenopho...  61.6    2e-08
ref|WP_007219455.1|  MULTISPECIES: hypothetical protein [Bacte...  62.0    2e-08
ref|WP_026193881.1|  alpha-L-fucosidase [Capnocytophaga cynode...  62.4    2e-08
ref|WP_018475777.1|  hypothetical protein [Echinicola pacifica]    62.4    2e-08
ref|XP_003301918.1|  hypothetical protein PTT_13548 [Pyrenopho...  61.6    2e-08
ref|WP_026430519.1|  alpha-L-fucosidase [Actinomyces georgiae]     62.8    2e-08
ref|WP_005870659.1|  alpha-L-fucosidase [Actinomyces georgiae]     62.8    2e-08
ref|WP_029426592.1|  hypothetical protein [Bacteroides cellulo...  62.0    2e-08
ref|WP_022209688.1|  putative uncharacterized protein [Bactero...  62.0    2e-08
ref|WP_004314246.1|  MULTISPECIES: F5/8 type C domain protein ...  62.4    2e-08
ref|WP_015531557.1|  Alpha-L-fucosidase [Bacteroides xylanisol...  62.4    2e-08
ref|WP_014681014.1|  alpha-L-fucosidase [Solitalea canadensis]     62.0    2e-08
ref|WP_022348347.1|  uncharacterized protein [Bacteroides frag...  62.0    2e-08
ref|WP_026994349.1|  alpha-L-fucosidase [Flectobacillus major]     62.0    2e-08
ref|WP_031153047.1|  alpha-L-fucosidase [Streptomyces xanthoph...  62.0    2e-08
ref|WP_021637010.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  62.4    2e-08
gb|KDU78996.1|  f5/8 type C domain protein [Porphyromonas sp. ...  62.4    2e-08
ref|WP_009103432.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  62.0    2e-08
ref|WP_004327066.1|  hypothetical protein [Bacteroides ovatus]     62.4    2e-08
ref|WP_027126166.1|  alpha-L-fucosidase [Gelidibacter mesophilus]  62.4    2e-08
ref|WP_021862348.1|  putative uncharacterized protein [Parabac...  62.4    2e-08
ref|WP_009414901.1|  f5/8 type C domain protein [Capnocytophag...  62.0    2e-08
ref|WP_005802238.1|  alpha-L-fucosidase [Bacteroides fragilis]     62.0    2e-08
ref|WP_008146407.1|  glycoside hydrolase [Parabacteroides john...  62.4    2e-08
ref|WP_021986936.1|  putative uncharacterized protein [Odoriba...  62.4    2e-08
ref|WP_031140007.1|  alpha-L-fucosidase [Streptomyces xanthoph...  61.6    2e-08
gb|EXY16605.1|  alpha-L-fucosidase family protein [Bacteroides...  62.0    2e-08
ref|WP_008156346.1|  glycoside hydrolase [Parabacteroides john...  62.4    2e-08
ref|WP_004321622.1|  hypothetical protein [Bacteroides ovatus]     62.4    2e-08
ref|WP_004311760.1|  MULTISPECIES: F5/8 type C domain protein ...  62.4    2e-08
ref|WP_013073553.1|  alpha-L-fucosidase [Zunongwangia profunda]    62.0    2e-08
ref|WP_008505875.1|  alpha-L-fucosidase [Mucilaginibacter palu...  62.4    2e-08
gb|KDS12814.1|  F5/8 type C domain protein [Bacteroides ovatus...  62.0    2e-08
ref|WP_004307138.1|  hypothetical protein [Bacteroides ovatus]     62.0    2e-08
ref|WP_004301026.1|  MULTISPECIES: hypothetical protein [Bacte...  62.0    2e-08
ref|WP_022199810.1|  f5/8 type C domain protein [Bacteroides o...  62.0    2e-08
dbj|GAE75737.1|  alpha-L-fucosidase [Propionibacterium acnes J...  59.7    2e-08
ref|WP_009433630.1|  glycoside hydrolase [Porphyromonas sp. or...  62.4    2e-08
ref|WP_008999740.1|  hypothetical protein [Bacteroides sp. D2]     62.0    2e-08
ref|WP_009039296.1|  alpha-L-fucosidase 1 [Bacteroides sp. D22]    62.0    2e-08
ref|WP_011109395.1|  hypothetical protein [Bacteroides thetaio...  62.0    2e-08
ref|WP_022471054.1|  uncharacterized protein [Bacteroides thet...  62.0    2e-08
ref|WP_031427509.1|  alpha-L-fucosidase [Leeuwenhoekiella sp. ...  61.6    2e-08
ref|WP_010800917.1|  MULTISPECIES: hypothetical protein [Parab...  62.0    2e-08
gb|EXY82978.1|  alpha-L-fucosidase family protein [Bacteroides...  61.6    2e-08
ref|WP_008644792.1|  hypothetical protein [Bacteroides sp. 1_1...  62.0    2e-08
ref|WP_005851052.1|  alpha-L-fucosidase [Bacteroides vulgatus]     62.0    2e-08
ref|WP_016268135.1|  hypothetical protein [Bacteroides thetaio...  62.0    2e-08
gb|AHF15781.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       61.6    2e-08
ref|WP_008025919.1|  hypothetical protein [Bacteroides xylanis...  62.0    2e-08
ref|WP_021903406.1|  putative uncharacterized protein [Porphyr...  62.0    2e-08
ref|WP_018472395.1|  hypothetical protein [Echinicola pacifica]    62.0    2e-08
ref|WP_008670258.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  62.0    2e-08
ref|WP_005843037.1|  alpha-L-fucosidase [Bacteroides vulgatus]     62.0    2e-08
ref|WP_030681199.1|  alpha-L-fucosidase [Streptomyces rimosus]     62.0    3e-08
ref|WP_022508236.1|  glycoside hydrolase family 29 candidate a...  62.0    3e-08
ref|WP_027295528.1|  alpha-L-fucosidase [Robinsoniella sp. KNH...  61.6    3e-08
ref|WP_030667407.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  62.0    3e-08
ref|WP_022300780.1|  uncharacterized protein [Bacteroides faec...  62.0    3e-08
ref|WP_010537398.1|  hypothetical protein [Bacteroides faecis]     62.0    3e-08
ref|WP_008766773.1|  hypothetical protein [Bacteroides sp. 1_1_6]  62.0    3e-08
ref|WP_031288978.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  61.6    3e-08
ref|WP_004625912.1|  Alpha-L-fucosidase [ [Clostridium termiti...  61.2    3e-08
ref|WP_009743549.1|  glycosyl hydrolase, probable alpha-L-fuco...  61.6    3e-08
emb|CAX73206.1|  hypothetical protein [Schistosoma japonicum]      57.8    3e-08
ref|WP_008760416.1|  alpha-L-fucosidase 1 [Bacteroides sp. 1_1...  62.0    3e-08
ref|WP_031232379.1|  hypothetical protein [Streptomyces niveus]    61.2    3e-08
ref|WP_004296111.1|  alpha-L-fucosidase [Bacteroides ovatus]       62.0    3e-08
ref|WP_018029139.1|  hypothetical protein [Porphyromonas somerae]  61.6    3e-08
ref|WP_016312877.1|  hypothetical protein [Paenibacillus baren...  61.6    3e-08
ref|WP_030311112.1|  hypothetical protein [Streptomyces sp. NR...  61.2    3e-08
ref|WP_021612960.1|  Alpha-L-fucosidase [Actinomyces sp. oral ...  61.6    3e-08
gb|AHW59098.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   61.6    3e-08
ref|WP_026814599.1|  hypothetical protein [Arenibacter certesii]   61.6    3e-08
ref|WP_027201452.1|  alpha-1,3/4-fucosidase [Butyricimonas vir...  61.2    3e-08
ref|WP_017471490.1|  hypothetical protein [Amphibacillus jilin...  61.2    3e-08
gb|AIA94940.1|  alpha_L_fucos [uncultured Propionibacterium sp.]   57.8    3e-08
ref|WP_008245109.1|  glycosyl hydrolase [Pedobacter sp. BAL39]     61.6    3e-08
ref|WP_008613150.1|  alpha-L-fucosidase [Joostella marina]         61.6    3e-08
gb|AIM39073.1|  hypothetical protein KO02_22080 [Sphingobacter...  61.6    3e-08
ref|WP_009250084.1|  MULTISPECIES: alpha-fucosidase [Clostridi...  61.2    3e-08
ref|WP_009400223.1|  alpha-L-fucosidase [Actinomyces sp. oral ...  62.0    4e-08
ref|WP_007087290.1|  alpha-L-fucosidase [Bacillus bataviensis]     61.2    4e-08
ref|WP_021615088.1|  f5/8 type C domain protein [Actinomyces s...  61.6    4e-08
ref|WP_023058178.1|  alpha-L-fucosidase [Prevotella sp. BV3P1]     61.2    4e-08
gb|EQB80610.1|  hypothetical protein L950_29120 [Sphingobacter...  61.2    4e-08
ref|WP_004368017.1|  alpha-L-fucosidase [Prevotella oralis]        61.2    4e-08
ref|WP_030664279.1|  alpha-L-fucosidase [Streptomyces rimosus]     61.2    4e-08
ref|WP_005935495.1|  MULTISPECIES: hypothetical protein [Bacte...  61.2    4e-08
ref|WP_009418992.1|  f5/8 type C domain protein [Capnocytophag...  61.6    4e-08
ref|WP_025538380.1|  alpha-L-fucosidase [Cytophagaceae bacteri...  61.6    4e-08
ref|WP_019538400.1|  hypothetical protein [Proteiniphilum acet...  61.2    4e-08
ref|WP_022277527.1|  glycoside hydrolase family 29 (Alpha-L-fu...  61.2    4e-08
ref|WP_005790882.1|  alpha-L-fucosidase [Bacteroides fragilis]     60.8    4e-08
ref|WP_020599782.1|  alpha-L-fucosidase [Spirosoma panaciterrae]   61.2    4e-08
ref|WP_009778959.1|  alpha-L-fucosidase [Leeuwenhoekiella blan...  60.8    4e-08
gb|EWC91829.1|  alpha-L-fucosidase [Porphyromonas catoniae ATC...  61.2    5e-08
ref|WP_006680049.1|  alpha-L-fucosidase [Paenibacillus dendrit...  60.8    5e-08
gb|AHF15780.1|  glycoside hydrolase family 29 [Niabella soli D...  60.8    5e-08
ref|WP_019126475.1|  hypothetical protein [Actinomyces sp. ph3]    60.8    5e-08
ref|XP_007718524.1|  glycoside hydrolase family 29 protein [Bi...  60.5    5e-08
ref|WP_008143158.1|  hypothetical protein [Bacteroides coproph...  61.2    5e-08
ref|WP_019538401.1|  hypothetical protein [Proteiniphilum acet...  60.8    5e-08
ref|WP_031395048.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  60.1    5e-08
ref|WP_018474189.1|  hypothetical protein [Echinicola pacifica]    60.5    5e-08
ref|WP_004625482.1|  Alpha-L-fucosidase [ [Clostridium termiti...  60.8    5e-08
ref|WP_013572967.1|  alpha-L-fucosidase [Granulicella tundricola]  60.8    5e-08
ref|WP_026234413.1|  alpha-L-fucosidase [Prevotella paludivivens]  60.8    6e-08
ref|WP_022507751.1|  f5/8 type C domain protein [Bacteroides s...  60.8    6e-08
ref|WP_010800671.1|  MULTISPECIES: hypothetical protein [Parab...  60.5    6e-08
ref|WP_021929341.1|  uncharacterized protein [Tannerella sp. C...  60.8    6e-08
ref|WP_009100204.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  60.8    6e-08
ref|WP_029903929.1|  hypothetical protein [Prevotella sp. 10(H)]   60.8    6e-08
ref|WP_030889186.1|  hypothetical protein [Streptomyces sp. NR...  60.8    6e-08
ref|WP_022417466.1|  glycoside hydrolase family 29 (Alpha-L-fu...  60.1    6e-08
ref|WP_015331442.1|  coagulation factor 5/8 type domain protei...  60.8    6e-08
ref|WP_025747139.1|  alpha-L-fucosidase [Caldicoprobacter oshi...  60.5    6e-08
gb|KEJ83314.1|  alpha-L-fucosidase [Porphyromonas sp. 31_2]        60.1    6e-08
ref|WP_028538247.1|  alpha-L-fucosidase [Paenibacillus sp. J14]    60.5    6e-08
gb|EWS80586.1|  alpha-L-fucosidase [Brachybacterium phenolires...  60.5    6e-08
ref|WP_008670558.1|  crotonobetainyl-CoA:carnitine CoA-transfe...  60.5    6e-08
ref|WP_007810292.1|  alpha-L-fucosidase [Flavobacterium sp. CF...  60.8    6e-08
ref|WP_025865742.1|  glycosyl hydrolase [Prolixibacter bellari...  60.5    7e-08
ref|WP_030892520.1|  hypothetical protein [Streptomyces sp. NR...  60.5    7e-08
ref|WP_018360660.1|  hypothetical protein [Porphyromonas macacae]  60.8    7e-08
ref|WP_008238947.1|  crotonobetainyl-CoA:carnitine CoA-transfe...  60.5    7e-08
ref|WP_007132362.1|  alpha-L-fucosidase [Paenibacillus lactis]     60.1    7e-08
ref|WP_012804157.1|  alpha-L-fucosidase [Brachybacterium faecium]  60.5    7e-08
ref|WP_029466209.1|  alpha-L-fucosidase [Clostridiales bacteri...  60.1    7e-08
ref|WP_025531977.1|  alpha-L-fucosidase [Bacteroides sp. VE202...  60.1    7e-08
ref|WP_018629033.1|  hypothetical protein [Niabella aurantiaca]    60.5    7e-08
ref|WP_021897864.1|  alpha-L-fucosidase [Faecalibacterium sp. ...  60.5    7e-08
ref|WP_008467439.1|  alpha-L-fucosidase [Flavobacterium sp. F52]   60.5    8e-08
ref|WP_026310016.1|  alpha-L-fucosidase [Niabella aurantiaca]      60.5    8e-08
gb|EUJ42001.1|  alpha-L-fucosidase [Brochothrix campestris FSL...  60.1    8e-08
ref|XP_002993091.1|  hypothetical protein SELMODRAFT_136497 [S...  60.1    8e-08
ref|WP_022507036.1|  uncharacterized protein [Bacteroides sp. ...  60.5    8e-08
ref|WP_026448048.1|  hypothetical protein [Acidobacteriaceae b...  60.5    8e-08
ref|WP_019912449.1|  hypothetical protein [Paenibacillus sp. H...  60.1    8e-08
ref|WP_008688996.1|  glycosyl hydrolase [Rhodopirellula sallen...  60.1    8e-08
ref|WP_026366589.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 1...  60.5    8e-08
ref|WP_022393713.1|  uncharacterized protein [Bacteroides inte...  60.5    8e-08
ref|WP_020631803.1|  hypothetical protein [Amycolatopsis alba]     60.5    8e-08
ref|WP_016275570.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  60.5    9e-08
ref|WP_007660715.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  60.5    9e-08
ref|WP_022386802.1|  glycoside hydrolase family 29 (Alpha-L-fu...  60.1    9e-08
ref|WP_007839786.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  60.5    9e-08
ref|WP_008144142.1|  MULTISPECIES: hypothetical protein [Bacte...  60.5    9e-08
ref|WP_016195437.1|  Alpha-L-fucosidase [Arcticibacter svalbar...  60.1    9e-08
ref|WP_027325501.1|  alpha-1,3/4-fucosidase [Bacteroides pyoge...  60.1    9e-08
dbj|GAE22476.1|  beta-galactosidase [Bacteroides pyogenes JCM ...  60.1    9e-08
ref|WP_021644375.1|  f5/8 type C domain protein [Bacteroides p...  60.1    9e-08
ref|WP_007853538.1|  alpha-L-fucosidase [Bacteroides dorei]        60.5    9e-08
ref|WP_022185041.1|  glycoside hydrolase family 29 protein [Ba...  60.1    9e-08
ref|WP_016337526.1|  alpha-L-fucosidase [Amycolatopsis orienta...  60.1    9e-08
ref|WP_012201036.1|  alpha-fucosidase [Clostridium phytofermen...  60.1    9e-08
ref|WP_022276969.1|  f5/8 type C domain protein [Bacteroides c...  60.5    9e-08
ref|WP_016275013.1|  alpha-L-fucosidase [Bacteroides massilien...  60.1    9e-08
gb|ETT73343.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R7-277]  60.1    9e-08
ref|WP_022012002.1|  putative uncharacterized protein [Bactero...  60.1    9e-08
ref|WP_009126376.1|  f5/8 type C domain protein [Bacteroides f...  60.1    1e-07
ref|WP_009408819.1|  Alpha-L-fucosidase [Actinomyces sp. oral ...  60.1    1e-07
ref|WP_025017722.1|  glycoside hydrolase family 29 [Bacteroide...  60.1    1e-07
ref|WP_030990869.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  60.1    1e-07
ref|WP_029276792.1|  alpha-L-fucosidase [Pedobacter borealis]      60.1    1e-07
gb|KER47687.1|  alpha-1,3/4-fucosidase [Bacteroides fragilis]      60.1    1e-07
ref|WP_005821134.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  60.1    1e-07
ref|WP_008143786.1|  hypothetical protein [Bacteroides coproph...  60.1    1e-07
ref|WP_005780533.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  60.1    1e-07
ref|WP_005807581.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  60.1    1e-07
ref|WP_011966961.1|  glycoside hydrolase [Parabacteroides dist...  60.1    1e-07
ref|WP_020670269.1|  hypothetical protein [Amycolatopsis nigre...  60.1    1e-07
gb|KER51287.1|  alpha-1,3/4-fucosidase [Bacteroides fragilis]      60.1    1e-07
dbj|GAE18261.1|  beta-galactosidase [Bacteroides pyogenes JCM ...  60.1    1e-07
gb|KDS34261.1|  F5/8 type C domain protein [Parabacteroides di...  60.1    1e-07
gb|KDS47378.1|  F5/8 type C domain protein [Parabacteroides di...  60.1    1e-07
ref|WP_008774390.1|  glycoside hydrolase [Bacteroides sp. 2_1_...  60.1    1e-07
ref|WP_002604449.1|  hypothetical protein [ [Clostridium hathe...  59.7    1e-07
ref|WP_005864201.1|  MULTISPECIES: glycoside hydrolase [Bacter...  60.1    1e-07
ref|WP_005860858.1|  glycoside hydrolase [Parabacteroides dist...  60.1    1e-07
ref|WP_029273072.1|  alpha-L-fucosidase [Flavobacterium sp. KJJ]   60.1    1e-07
ref|WP_008781091.1|  glycoside hydrolase [Bacteroides sp. 3_1_19]  60.1    1e-07
ref|WP_014218629.1|  alpha-L-fucosidase [Niastella koreensis]      60.1    1e-07
ref|WP_021838180.1|  alpha-L-fucosidase-like [Alistipes sp. CA...  59.7    1e-07
ref|WP_002672585.1|  alpha-L-fucosidase [Capnocytophaga ochracea]  60.1    1e-07
ref|WP_006843246.1|  hypothetical protein [Dysgonomonas mossii]    60.1    1e-07
ref|WP_014224590.1|  glycoside hydrolase [Tannerella forsythia]    60.1    1e-07
gb|EST19304.1|  hypothetical protein M877_36595 [Streptomyces ...  60.1    1e-07
ref|WP_008666410.1|  MULTISPECIES: glycoside hydrolase family ...  60.1    1e-07
gb|KFC58433.1|  crotonobetainyl-CoA:carnitine CoA-transferase ...  59.7    1e-07
ref|WP_020605394.1|  alpha-L-fucosidase [Spirosoma spitsbergense]  60.1    1e-07
ref|WP_029426079.1|  alpha-1,3/4-fucosidase [Bacteroides cellu...  60.1    1e-07
ref|WP_024819405.1|  alpha-L-fucosidase [Arthrobacter sp. 31Y]     59.7    1e-07
ref|WP_007210829.1|  alpha-1,3/4-fucosidase [Bacteroides cellu...  60.1    1e-07
ref|WP_007216921.1|  alpha-1,3/4-fucosidase [Bacteroides cellu...  59.7    1e-07
ref|WP_015734912.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  59.3    1e-07
ref|WP_027318493.1|  hypothetical protein [Bacteroidetes bacte...  59.7    1e-07
ref|WP_022454641.1|  calx-beta domain-containing protein [Para...  59.7    1e-07
ref|WP_007486440.1|  alpha-1,3/4-fucosidase [Bacteroides nordii]   59.7    1e-07
ref|WP_012024111.1|  alpha-L-fucosidase [Flavobacterium johnso...  59.7    1e-07
ref|WP_010854541.1|  Alpha-L-fucosidase [Cyclobacteriaceae bac...  59.7    1e-07
gb|ETT62412.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  59.3    1e-07
ref|WP_002561148.1|  alpha-L-fucosidase [Bacteroides sp. HPS0048]  59.7    1e-07
ref|WP_022231349.1|  f5/8 type C domain protein [Bacteroides s...  60.1    1e-07
ref|WP_013273060.1|  alpha-fucosidase [ [Clostridium saccharol...  59.7    1e-07
ref|WP_018973008.1|  hypothetical protein [Rudaea cellulosilyt...  59.7    1e-07
ref|WP_028668082.1|  hypothetical protein [Runella zeae]           59.7    1e-07
ref|WP_009280350.1|  alpha-L-fucosidase [Fibrisoma limi]           59.7    1e-07
ref|WP_007831684.1|  alpha-L-fucosidase [Bacteroides dorei]        59.7    1e-07
gb|ETZ21299.1|  hypothetical protein N824_29015 [Pedobacter sp...  59.7    1e-07
ref|WP_030326141.1|  glycosyl hydrolase [Streptomyces sp. NRRL...  59.7    2e-07
gb|KFF96160.1|  glycosyl hydrolase [Streptomyces scabiei]          58.2    2e-07
ref|WP_027745272.1|  alpha-L-fucosidase [Streptomyces sp. CNT371]  59.7    2e-07
ref|WP_028085881.1|  alpha-fucosidase [Dorea longicatena]          59.3    2e-07
ref|WP_008860691.1|  alpha-1,3/4-fucosidase [Barnesiella intes...  59.7    2e-07
ref|WP_018614663.1|  hypothetical protein [Segetibacter koreen...  59.7    2e-07
ref|WP_012924924.1|  alpha-L-fucosidase [Spirosoma linguale]       59.3    2e-07
ref|WP_007033342.1|  PA14 domain-containing protein [Amycolato...  59.3    2e-07
ref|WP_027629817.1|  alpha-fucosidase [ [Clostridium cellobiop...  59.3    2e-07
ref|WP_030048161.1|  hypothetical protein [Streptomyces peruvi...  55.8    2e-07
ref|WP_019940674.1|  alpha-L-fucosidase [Dyadobacter beijingen...  59.3    2e-07
gb|ETZ21280.1|  hypothetical protein N824_28920 [Pedobacter sp...  58.9    2e-07
gb|KFZ76779.1|  alpha-L-fucosidase [Amycolatopsis sp. MJM2582]     59.3    2e-07
ref|WP_021637191.1|  hypothetical protein [Clostridium sp. KLE...  56.6    2e-07
ref|WP_022336739.1|  alpha-L-fucosidase [Firmicutes bacterium ...  58.9    2e-07
ref|WP_022037148.1|  putative uncharacterized protein [Ruminoc...  58.9    2e-07
ref|WP_022103764.1|  f5/8 type C domain protein [Bacteroides s...  59.7    2e-07
ref|WP_016661418.1|  alpha-L-fucosidase [Bacteroides stercoris]    59.7    2e-07
ref|WP_024854013.1|  alpha-fucosidase [ [[Ruminococcus] gnavus]    58.9    2e-07
gb|AIG73470.1|  PA14 domain-containing protein [Amycolatopsis ...  59.3    2e-07
ref|WP_005654688.1|  hypothetical protein [Bacteroides stercoris]  59.3    2e-07
ref|WP_007567455.1|  alpha-1,3/4-fucosidase [Bacteroides copro...  59.3    2e-07
emb|CDF79634.1|  alpha-L-fucosidase (GH29) [Formosa agariphila...  59.3    2e-07
ref|WP_026770417.1|  hypothetical protein [Sediminibacterium s...  58.9    2e-07
ref|WP_015266164.1|  alpha-L-fucosidase [Echinicola vietnamensis]  58.9    2e-07
ref|WP_022158435.1|  f5/8 type C domain protein [Prevotella sp...  59.3    2e-07
ref|WP_022160460.1|  putative alpha-L-fucosidase protein [Odor...  58.5    2e-07
ref|WP_008239777.1|  alpha-L-fucosidase [Imtechella halotolerans]  59.3    2e-07
ref|WP_022324742.1|  alpha-L-fucosidase-like [Alistipes sp. CA...  58.9    2e-07
ref|WP_022032399.1|  putative alpha-1 3/4-fucosidase [Clostrid...  58.9    2e-07
gb|KDS76007.1|  F5/8 type C domain protein [Parabacteroides di...  59.3    2e-07
ref|WP_026997597.1|  alpha-L-fucosidase [Flectobacillus major]     59.3    2e-07
ref|WP_006775425.1|  alpha-fucosidase [ [Clostridium hathewayi]    58.9    2e-07
ref|WP_014856259.1|  alpha-L-fucosidase [Melioribacter roseus]     58.9    2e-07
ref|WP_005945379.1|  hypothetical protein [Bacteroides massili...  58.9    2e-07
ref|XP_002994376.1|  hypothetical protein SELMODRAFT_236951 [S...  58.9    2e-07
ref|WP_022507106.1|  glycoside hydrolase family 29 protein [Ba...  58.9    2e-07
ref|WP_009184842.1|  alpha-L-fucosidase [Cecembia lonarensis]      58.9    2e-07
gb|KFF03544.1|  alpha-L-fucosidase [Flavobacterium reichenbachii]  58.9    2e-07
ref|WP_014020387.1|  glycoside hydrolase [Cyclobacterium marinum]  59.3    2e-07
gb|EYA38126.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.9    2e-07
gb|AII65668.1|  alpha-1,3/4-fucosidase [Bacteroides dorei]         58.9    2e-07
ref|WP_007856315.1|  alpha-1,3/4-fucosidase [Bacteroides dorei]    58.9    2e-07
dbj|GAE84717.1|  alpha-L-fucosidase [Bacteroides reticulotermi...  58.9    2e-07
ref|WP_007848620.1|  alpha-1,3/4-fucosidase [Bacteroides dorei]    58.9    2e-07
ref|WP_008866907.1|  coagulation factor 5/8 type domain protei...  58.9    2e-07
ref|WP_021927401.1|  putative uncharacterized protein [Alistip...  58.5    2e-07
ref|WP_029486307.1|  alpha-L-fucosidase [Enterococcus gallinarum]  58.5    2e-07
ref|WP_005470131.1|  MULTISPECIES: alpha-L-fucosidase [Enteroc...  58.5    2e-07
ref|WP_007840866.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  58.9    2e-07
ref|WP_027774870.1|  alpha-L-fucosidase [Streptomyces sp. CNQ329]  58.9    2e-07
ref|WP_026905066.1|  hypothetical protein [Pedobacter glucosid...  58.9    2e-07
ref|WP_007833019.1|  alpha-1,3/4-fucosidase [Bacteroides dorei]    58.9    2e-07
ref|WP_008667472.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  58.9    2e-07
ref|WP_021846705.1|  f5/8 type C domain protein [Bacteroides s...  58.9    3e-07
ref|WP_022508183.1|  glycoside hydrolase family 29 candidate a...  58.9    3e-07
ref|WP_022021591.1|  f5/8 type C domain protein [Bacteroides s...  58.9    3e-07
ref|WP_005840273.1|  alpha-1,3/4-fucosidase [Bacteroides vulga...  58.9    3e-07
ref|WP_005850843.1|  alpha-1,3/4-fucosidase [Bacteroides vulga...  58.9    3e-07
ref|WP_022163212.1|  f5/8 type C domain protein [Bacteroides s...  58.9    3e-07
ref|WP_026548336.1|  alpha-L-fucosidase [Arthrobacter nicotino...  58.5    3e-07
ref|WP_012341573.1|  alpha-L-fucosidase [Histophilus somni]        57.8    3e-07
ref|WP_011203202.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  58.9    3e-07
ref|WP_003008126.1|  alpha-L-fucosidase [Sphingobacterium spir...  58.5    3e-07
gb|EXY12330.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.9    3e-07
ref|WP_016271811.1|  alpha-L-fucosidase [Bacteroides vulgatus]     58.9    3e-07
gb|EXY17333.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.9    3e-07
ref|WP_027290089.1|  hypothetical protein [Rikenella microfusus]   58.5    3e-07
ref|WP_008769631.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 2...  58.9    3e-07
gb|EXZ88291.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.9    3e-07
ref|WP_005789248.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  58.9    3e-07
ref|WP_005814997.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  58.9    3e-07
ref|WP_009292825.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 2...  58.9    3e-07
ref|WP_005798837.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  58.9    3e-07
ref|WP_008661096.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 3...  58.9    3e-07
gb|EXZ82354.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.5    3e-07
gb|EXY83551.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.5    3e-07
gb|EXY78193.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.5    3e-07
gb|EXY26638.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.5    3e-07
ref|WP_022347746.1|  putative exported fucosidase [Bacteroides...  58.5    3e-07
ref|WP_002997082.1|  alpha-L-fucosidase [Sphingobacterium spir...  58.5    3e-07
ref|WP_022130999.1|  f5/8 type C domain protein [Bacteroides s...  58.5    3e-07
ref|WP_014031877.1|  alpha-L-fucosidase [Muricauda ruestringen...  58.9    3e-07
ref|WP_031439257.1|  alpha-L-fucosidase [Sphingomonas sp. FUKU...  58.5    3e-07
ref|WP_018972823.1|  hypothetical protein [Rudaea cellulosilyt...  58.5    3e-07
ref|WP_021639186.1|  Alpha-L-fucosidase [Clostridium sp. KLE 1...  58.5    3e-07
ref|WP_019989670.1|  hypothetical protein [Rudanella lutea]        58.5    3e-07
ref|WP_008678535.1|  glycoside hydrolase family 29 (alpha-L-fu...  58.5    3e-07
ref|WP_025892534.1|  alpha-1,3/4-fucosidase [Bacteroides barne...  58.5    3e-07
ref|WP_022194712.1|  uncharacterized protein [Clostridium sp. ...  58.5    3e-07
ref|WP_005802860.1|  alpha-1,3/4-fucosidase [Bacteroides fragi...  58.5    3e-07
ref|WP_018709381.1|  hypothetical protein [Bacteroides barnesiae]  58.5    3e-07
ref|WP_011109123.1|  alpha-1,3/4-fucosidase [Bacteroides theta...  58.5    3e-07
ref|WP_016275422.1|  MULTISPECIES: alpha-L-fucosidase [Bactero...  58.5    3e-07
ref|WP_012926016.1|  alpha-L-fucosidase [Spirosoma linguale]       58.5    3e-07
ref|WP_019418971.1|  alpha-L-fucosidase [Paenibacillus sp. OSY...  58.2    3e-07
ref|WP_009099374.1|  alpha-L-fucosidase precursor [Rhodopirell...  58.5    3e-07
ref|WP_007885606.1|  hypothetical protein [Roseburia inulinivo...  56.2    3e-07
ref|WP_029163896.1|  alpha-L-fucosidase [Anaerophaga thermohal...  58.5    3e-07
ref|WP_008654020.1|  glycoside hydrolase family 29 [Bacteroide...  58.5    3e-07
gb|AHW60409.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   58.5    3e-07
ref|WP_021892231.1|  f5/8 type C domain protein [Bacteroides s...  58.5    3e-07
ref|WP_009598658.1|  MULTISPECIES: glycoside hydrolase [Alisti...  58.5    4e-07
gb|KFO76842.1|  Tissue alpha-L-fucosidase [Cuculus canorus]        57.8    4e-07
ref|WP_013409192.1|  coagulation factor 5/8 type domain-contai...  58.2    4e-07
ref|XP_004160066.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-L-f...  58.2    4e-07
ref|WP_029732340.1|  alpha-fucosidase [Dorea sp. AGR2135]          58.2    4e-07
ref|WP_031118830.1|  glycosyl hydrolase [Streptomyces sp. NRRL...  58.5    4e-07
ref|WP_005341796.1|  alpha-fucosidase [Dorea formicigenerans]      58.2    4e-07
ref|WP_026714394.1|  alpha-L-fucosidase [Flavobacterium daejeo...  58.5    4e-07
ref|WP_025761186.1|  hypothetical protein [Dyadobacter sp. Y62...  57.8    4e-07
ref|WP_015656412.1|  glycosyl hydrolase [Streptomyces davawensis]  58.5    4e-07
ref|WP_015334019.1|  Alpha-L-fucosidase [Fibrella aestuarina]      58.2    4e-07
gb|EXZ99444.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  58.2    4e-07
ref|WP_028612191.1|  alpha-L-fucosidase [Paenibacillus harenae]    57.8    4e-07
ref|WP_028730142.1|  alpha-L-fucosidase [Parabacteroides gordo...  58.2    4e-07
ref|WP_025489907.1|  alpha-L-fucosidase [Clostridiales bacteri...  58.2    4e-07
ref|WP_010769959.1|  hypothetical protein [Enterococcus phoeni...  58.2    4e-07
ref|WP_027077373.1|  alpha-L-fucosidase [Maribacter antarcticus]   58.2    4e-07
ref|WP_021638714.1|  hypothetical protein [Clostridium sp. KLE...  58.2    4e-07
ref|WP_022160643.1|  calx-beta domain-containing protein [Odor...  58.2    4e-07
ref|WP_022307140.1|  putative glycosyl hydrolase [Roseburia sp...  57.8    4e-07
ref|WP_022188981.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  57.8    4e-07
ref|WP_011608590.1|  alpha-L-fucosidase [Histophilus somni]        56.2    4e-07
ref|WP_016469000.1|  hypothetical protein [Streptomyces sp. HP...  58.2    4e-07
ref|WP_014920671.1|  alpha-L-fucosidase [Arthrobacter sp. Rue61a]  57.8    4e-07
ref|WP_022047509.1|  putative uncharacterized protein [Odoriba...  58.2    4e-07
ref|WP_018627093.1|  hypothetical protein [Niabella aurantiaca]    58.2    5e-07
ref|WP_007834376.1|  hypothetical protein [Bacteroides dorei]      58.2    5e-07
ref|WP_007854857.1|  hypothetical protein [Bacteroides dorei]      58.2    5e-07
ref|WP_014786444.1|  alpha-L-fucosidase [Terriglobus roseus]       58.2    5e-07
gb|ETN95142.1|  hypothetical protein P278_18970 [Zhouia amylol...  58.2    5e-07
gb|ETZ24815.1|  crotonobetainyl-CoA:carnitine CoA-transferase ...  57.8    5e-07
ref|WP_012243585.1|  alpha-L-fucosidase [Renibacterium salmoni...  57.8    5e-07
ref|WP_020617104.1|  hypothetical protein [Paenibacillus daeje...  57.8    5e-07
ref|WP_008674532.1|  glycoside hydrolase family 29 protein [Ba...  58.2    5e-07
ref|WP_025488431.1|  alpha-fucosidase [Clostridiales bacterium...  57.8    5e-07
ref|WP_007847711.1|  hypothetical protein [Bacteroides dorei]      58.2    5e-07
ref|WP_014774549.1|  glycoside hydrolase [Alistipes finegoldii]    58.2    5e-07
ref|WP_026292444.1|  twin-arginine translocation pathway signa...  58.2    5e-07
ref|WP_009236592.1|  twin-arginine translocation pathway signa...  58.2    5e-07
ref|WP_008856614.1|  alpha-L-fucosidase [Lactobacillus kisonen...  57.8    5e-07
ref|WP_025789887.1|  twin-arginine translocation pathway signa...  58.2    5e-07
ref|WP_005228045.1|  alpha-L-fucosidase [Enterococcus casselif...  57.8    5e-07
ref|WP_026773751.1|  hypothetical protein [Sediminibacterium s...  57.8    5e-07
gb|AII61814.1|  glycoside hydrolase family 29 [Bacteroides dorei]  58.2    5e-07
ref|WP_016271065.1|  alpha-L-fucosidase [Bacteroides vulgatus]     58.2    5e-07
ref|WP_007841762.1|  glycoside hydrolase family 29 protein [Ba...  58.2    5e-07
ref|WP_005843854.1|  F5/8 type C domain protein [Bacteroides v...  58.2    5e-07
ref|WP_005849832.1|  hypothetical protein [Bacteroides vulgatus]   58.2    5e-07
ref|WP_011965104.1|  glycoside hydrolase [Bacteroides vulgatus]    58.2    5e-07
gb|EWC98349.1|  alpha-L-fucosidase [Actinomyces sp. ICM54]         58.2    5e-07
ref|WP_005941725.1|  hypothetical protein [Bacteroides massili...  57.0    5e-07
ref|WP_022021458.1|  f5/8 type C domain protein [Bacteroides s...  58.2    5e-07
ref|WP_007591453.1|  alpha-fucosidase [Lachnospiraceae bacteri...  57.8    5e-07
ref|WP_022508383.1|  glycoside hydrolase family 29 [Bacteroide...  58.2    5e-07
ref|WP_009137099.1|  glycoside hydrolase [Odoribacter laneus]      58.2    5e-07
ref|WP_025819767.1|  alpha-1,3/4-fucosidase [Bacteroides salye...  57.8    5e-07
gb|AII67165.1|  glycoside hydrolase family 29 [Bacteroides dorei]  57.8    5e-07
ref|WP_031176636.1|  alpha-L-fucosidase [Streptomyces albus]       57.8    5e-07
ref|WP_008144829.1|  alpha-L-fucosidase [Bacteroides coprophilus]  58.2    5e-07
ref|WP_022124814.1|  f5/8 type C domain protein [Bacteroides c...  58.2    5e-07
ref|WP_005656118.1|  hypothetical protein [Bacteroides stercoris]  58.2    5e-07
ref|WP_026179572.1|  alpha-L-fucosidase [Streptomyces sp. R1-N...  57.8    6e-07
ref|WP_005156073.1|  hypothetical protein [Amycolatopsis azurea]   57.8    6e-07
ref|WP_022308006.1|  putative exported fucosidase [Alistipes s...  57.8    6e-07
ref|WP_026902922.1|  alpha-L-fucosidase [Pedobacter glucosidil...  57.8    6e-07
gb|KDS52843.1|  F5/8 type C domain protein [Bacteroides vulgat...  57.8    6e-07
gb|KDS25351.1|  F5/8 type C domain protein [Bacteroides vulgat...  57.8    6e-07
ref|XP_004324377.1|  PREDICTED: LOW QUALITY PROTEIN: tissue al...  57.4    6e-07
ref|WP_012794042.1|  carbohydrate-binding protein [Chitinophag...  57.4    6e-07
ref|WP_029678277.1|  alpha-L-fucosidase [Bifidobacterium sp. 7...  57.4    6e-07
ref|WP_009250838.1|  MULTISPECIES: hypothetical protein [Clost...  57.4    6e-07
ref|WP_025494297.1|  hypothetical protein [Lachnospiraceae bac...  57.4    6e-07
ref|WP_021936674.1|  uncharacterized protein [Bacteroides sp. ...  57.8    6e-07
ref|WP_027290660.1|  glycoside hydrolase [Rikenella microfusus]    57.8    6e-07
ref|WP_003796286.1|  alpha-L-fucosidase family protein [Actino...  58.2    6e-07
ref|WP_011773358.1|  alpha-L-fucosidase [Arthrobacter aurescens]   57.4    6e-07
ref|WP_005930156.1|  hypothetical protein [Bacteroides salyers...  57.8    6e-07
ref|WP_020888352.1|  Alpha-L-fucosidase [Cyclobacterium qasimii]   57.8    6e-07
ref|WP_025571709.1|  alpha-L-fucosidase [Flavobacterium sp. JG...  57.8    6e-07
ref|WP_018622380.1|  alpha-L-fucosidase [Spirosoma luteum]         57.4    6e-07
ref|WP_004629167.1|  Alpha-L-fucosidase [ [Clostridium termiti...  57.4    6e-07
ref|WP_007481643.1|  alpha-1,3/4-fucosidase [Bacteroides salye...  57.8    6e-07
ref|WP_008681881.1|  Glycoside hydrolase, family 29 [Rhodopire...  57.8    6e-07
ref|WP_007588347.1|  alpha-L-fucosidase [Actinomyces sp. ICM39]    57.8    6e-07
ref|WP_028700846.1|  alpha-L-fucosidase [Propionibacterium aci...  57.4    7e-07
ref|WP_026995125.1|  alpha-L-fucosidase [Flectobacillus major]     57.4    7e-07
ref|WP_020717977.1|  hypothetical protein [Acidobacteriaceae b...  57.4    7e-07
emb|CDN44784.1|  Alpha-L-fucosidase 1 [Paenibacillus sp. P22]      57.4    7e-07
ref|WP_006841711.1|  carbohydrate-binding protein [Dysgonomona...  57.4    7e-07
ref|WP_009230882.1|  twin-arginine translocation pathway signa...  57.8    7e-07
ref|WP_022353814.1|  f5/8 type C domain protein [Bacteroides s...  57.4    7e-07
ref|WP_013994950.1|  alpha-L-fucosidase [Zobellia galactanivor...  57.4    7e-07
ref|WP_028903520.1|  hypothetical protein [Prevotella sp. P6B4]    57.4    7e-07
ref|WP_008648799.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 3...  57.4    7e-07
ref|WP_018361668.1|  alpha-1,3/4-fucosidase [Prevotella nancei...  57.4    7e-07
ref|WP_008627884.1|  Alpha-L-fucosidase [Mariniradius saccharo...  57.4    8e-07
ref|WP_025004836.1|  glycoside hydrolase [Porphyromonas macacae]   57.4    8e-07
ref|WP_031455805.1|  alpha-L-fucosidase [Flavobacterium chunga...  57.4    8e-07
ref|WP_004304358.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  57.4    8e-07
ref|WP_021949490.1|  putative uncharacterized protein [Clostri...  57.0    8e-07
gb|ETO98970.1|  alpha-L-fucosidase [Lachnospiraceae bacterium ...  57.0    8e-07
ref|WP_004300809.1|  alpha-1,3/4-fucosidase [Bacteroides ovatus]   57.4    8e-07
gb|KFU81602.1|  alpha-L-fucosidase [Amycolatopsis lurida NRRL ...  57.4    8e-07
ref|WP_012024099.1|  alpha-L-fucosidase [Flavobacterium johnso...  57.4    8e-07
ref|XP_008465351.1|  PREDICTED: alpha-L-fucosidase 1 [Cucumis ...  57.4    8e-07
ref|XP_004145759.1|  PREDICTED: alpha-L-fucosidase 1-like [Cuc...  57.4    8e-07
ref|WP_020600526.1|  alpha-L-fucosidase [Spirosoma panaciterrae]   57.0    8e-07
ref|WP_019540434.1|  hypothetical protein [Proteiniphilum acet...  57.0    8e-07
ref|WP_009129618.1|  hypothetical protein [Bacteroides oleicip...  57.4    8e-07
ref|WP_027739971.1|  alpha-L-fucosidase [Streptomyces sp. CNT360]  57.0    8e-07
ref|WP_030893364.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  57.0    8e-07
ref|WP_030890859.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  57.0    8e-07
ref|WP_022301961.1|  MULTISPECIES: alpha-L-fucosidase-like [Ba...  57.0    9e-07
ref|WP_024987745.1|  alpha-1,3/4-fucosidase [Bacteroides acidi...  57.4    9e-07
gb|AAC98456.1|  unknown protein [Arabidopsis thaliana]             55.1    9e-07
ref|WP_009606885.1|  hypothetical protein [Turicibacter sp. HGF1]  57.0    9e-07
ref|WP_015071771.1|  Alpha-1,3/4-fucosidase [Propionibacterium...  57.0    9e-07
ref|WP_030886067.1|  alpha-L-fucosidase [Streptomyces varsovie...  57.0    1e-06
ref|WP_008198262.1|  alpha-L-fucosidase [Algoriphagus sp. PR1]     57.0    1e-06
gb|ELU02421.1|  hypothetical protein CAPTEDRAFT_91072 [Capitel...  54.3    1e-06
ref|WP_025490611.1|  hypothetical protein [Clostridiales bacte...  54.7    1e-06
ref|WP_006801287.1|  hypothetical protein [Dysgonomonas gadei]     57.0    1e-06
emb|CDA86514.1|  putative uncharacterized protein [Bacteroides...  57.0    1e-06
ref|WP_020605016.1|  alpha-L-fucosidase [Spirosoma spitsbergense]  56.6    1e-06
ref|WP_025018315.1|  alpha-1,3/4-fucosidase [Bacteroides sarto...  57.0    1e-06
gb|KER48681.1|  calcium:sodium exchange protein [Bacteroides f...  56.2    1e-06
ref|WP_013764579.1|  alpha-L-fucosidase [Haliscomenobacter hyd...  56.6    1e-06
ref|WP_014680648.1|  alpha-L-fucosidase [Solitalea canadensis]     56.6    1e-06
ref|WP_027628168.1|  hypothetical protein [ [Clostridium cello...  56.2    1e-06
ref|WP_025830939.1|  alpha-1,3/4-fucosidase [Bacteroides sterc...  57.0    1e-06
ref|WP_031266997.1|  alpha-L-fucosidase [Cytophagales str. B6]     56.6    1e-06
ref|XP_007205149.1|  hypothetical protein PRUPE_ppa005337mg [P...  56.6    1e-06
ref|WP_002604401.1|  hypothetical protein [ [Clostridium hathe...  56.6    1e-06
ref|WP_022340121.1|  f5/8 type C domain protein [Bacteroides s...  56.6    1e-06
ref|WP_031453603.1|  alpha-L-fucosidase [Flavobacterium chunga...  56.6    1e-06
ref|WP_022161931.1|  f5/8 type C domain protein [Bacteroides s...  56.6    1e-06
ref|WP_018565451.1|  hypothetical protein [Streptomyces sp. Ps...  56.2    1e-06
ref|WP_008448754.1|  alpha-L-fucosidase [Prevotella amnii]         56.6    1e-06
gb|EYA71017.1|  F5/8 type C domain protein [Bacteroides fragil...  56.6    1e-06
ref|WP_019035524.1|  alpha-L-fucosidase [Prevotella amnii]         56.6    1e-06
gb|AIM37951.1|  alpha-1,3/4-fucosidase [Sphingobacterium sp. M...  56.6    1e-06
ref|WP_023354452.1|  hypothetical protein [Catonella morbi]        56.6    1e-06
ref|XP_008344884.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-L-f...  56.6    1e-06
ref|XP_002992485.1|  hypothetical protein SELMODRAFT_448790 [S...  56.2    1e-06
ref|WP_013042286.1|  glycoside hydrolase [Coraliomargarita aka...  56.2    1e-06
ref|WP_009218420.1|  alpha-fucosidase [Lachnospiraceae oral ta...  56.2    1e-06
gb|KER49424.1|  calcium:sodium exchange protein [Bacteroides f...  56.2    1e-06
ref|WP_005815764.1|  hypothetical protein [Bacteroides fragilis]   56.6    1e-06
ref|WP_022164203.1|  calx-beta domain-containing protein [Bact...  56.2    1e-06
gb|EXY17961.1|  F5/8 type C domain protein [Bacteroides fragil...  56.6    1e-06
ref|WP_021847802.1|  putative uncharacterized protein [Bactero...  55.8    1e-06
emb|CCY33010.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:60]      56.2    1e-06
ref|WP_006783702.1|  hypothetical protein [Turicibacter sangui...  56.2    1e-06
gb|EXZ03172.1|  F5/8 type C domain protein [Bacteroides fragil...  56.6    2e-06
ref|XP_002975390.1|  hypothetical protein SELMODRAFT_103375 [S...  54.3    2e-06
ref|WP_009776262.1|  alpha-L-fucosidase [Janibacter sp. HTCC2649]  56.2    2e-06
ref|WP_022454642.1|  coagulation factor 5/8 type domain protei...  56.2    2e-06
gb|EYA39075.1|  F5/8 type C domain protein [Bacteroides fragil...  56.6    2e-06
ref|WP_030934915.1|  glycosyl hydrolase [Streptomyces sp. NRRL...  56.6    2e-06
gb|KFF98530.1|  glycosyl hydrolase [Streptomyces scabiei]          56.6    2e-06
ref|WP_021989499.1|  putative uncharacterized protein [Odoriba...  56.2    2e-06
ref|WP_006353580.1|  hypothetical protein [ [Clostridium methy...  56.6    2e-06
ref|WP_022455529.1|  coagulation factor 5/8 type domain protei...  53.9    2e-06
ref|WP_009593542.1|  alpha-L-fucosidase [Paenibacillus sp. HGF5]   56.2    2e-06
gb|KEQ30340.1|  carbohydrate-binding protein [Sphingobacterium...  56.2    2e-06
ref|WP_029197825.1|  alpha-fucosidase [Paenibacillus alginolyt...  56.2    2e-06
ref|WP_009035013.1|  alpha-L-fucosidase [Indibacter alkaliphilus]  56.6    2e-06
gb|EEV33648.1|  alpha-L-fucosidase [Enterococcus gallinarum EG2]   56.2    2e-06
ref|WP_022506508.1|  glycoside hydrolase family 29 [Bacteroide...  56.2    2e-06
ref|WP_022456568.1|  alpha-L-fucosidase 1 [Parabacteroides sp....  56.2    2e-06
ref|WP_004324080.1|  hypothetical protein [Bacteroides ovatus]     56.2    2e-06
ref|WP_026541784.1|  alpha-L-fucosidase [Arthrobacter nicotino...  56.2    2e-06
ref|WP_020529626.1|  hypothetical protein [Flexithrix dorotheae]   56.2    2e-06
ref|WP_008761019.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  56.2    2e-06
ref|WP_007844479.1|  alpha-L-fucosidase [Bacteroides dorei]        56.2    2e-06
ref|WP_026648778.1|  alpha-fucosidase [Blautia wexlerae]           55.8    2e-06
gb|AIE85760.1|  coagulation factor 5/8 type domain protein [Fi...  55.8    2e-06
ref|WP_021876500.1|  Putative Calx-beta domain protein [Clostr...  56.2    2e-06
ref|WP_025018149.1|  MULTISPECIES: calcium:sodium exchange pro...  55.8    2e-06
ref|WP_022507501.1|  uncharacterized protein [Bacteroides sp. ...  55.8    2e-06
ref|WP_016461859.1|  hypothetical protein [Actinomyces sp. HPA...  56.2    2e-06
ref|WP_007379485.1|  glycosyl hydrolase [Streptomyces sviceus]     56.2    2e-06
ref|WP_021667265.1|  f5/8 type C domain protein [Porphyromonas...  56.2    2e-06
ref|WP_028965260.1|  alpha-L-fucosidase [Sphingomonas phyllosp...  56.2    2e-06
ref|XP_008226394.1|  PREDICTED: alpha-L-fucosidase 1 [Prunus m...  55.8    2e-06
ref|WP_018756045.1|  hypothetical protein [Paenibacillus terri...  55.8    2e-06
ref|WP_021880933.1|  Alpha-L-fucosidase 1 [Paenibacillus sp. P22]  55.8    2e-06
ref|WP_016278298.1|  MULTISPECIES: hypothetical protein [Bacte...  55.5    2e-06
ref|XP_002990206.1|  hypothetical protein SELMODRAFT_428667 [S...  55.8    2e-06
ref|WP_013996991.1|  alpha-1,3/4-fucosidase [Capnocytophaga ca...  56.2    2e-06
ref|WP_021991252.1|  alpha-L-fucosidase 1 [Prevotella sp. CAG:...  53.1    2e-06
ref|WP_021997587.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  55.8    2e-06
ref|WP_022173522.1|  alpha-L-fucosidase [Bifidobacterium bifid...  55.8    2e-06
ref|WP_022529554.1|  alpha-L-fucosidase [Lactobacillus shenzhe...  55.8    2e-06
ref|XP_002980082.1|  hypothetical protein SELMODRAFT_112167 [S...  55.8    2e-06
ref|WP_008673812.1|  coagulation factor 5/8 type domain protei...  55.8    2e-06
ref|WP_022340836.1|  alpha-L-fucosidase [Bacteroides sp. CAG:714]  56.2    2e-06
emb|CDA84853.1|  uncharacterized protein BN772_03245 [Bacteroi...  55.8    2e-06
ref|WP_015264995.1|  alpha-L-fucosidase [Echinicola vietnamensis]  55.8    2e-06
gb|KDS45524.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  55.8    2e-06
ref|WP_010767490.1|  hypothetical protein [Enterococcus phoeni...  55.8    2e-06
ref|XP_002987478.1|  hypothetical protein SELMODRAFT_158775 [S...  55.8    2e-06
ref|WP_005645082.1|  hypothetical protein [Parabacteroides mer...  55.8    2e-06
ref|WP_016778399.1|  hypothetical protein [Anaerophaga thermoh...  55.8    2e-06
ref|WP_019596101.1|  hypothetical protein [Rhodonellum psychro...  55.8    2e-06
ref|WP_028551519.1|  alpha-fucosidase [Paenibacillus sp. UNC45...  55.8    2e-06
ref|WP_007560630.1|  hypothetical protein [Bacteroides plebeius]   55.8    2e-06
gb|EXC31795.1|  Alpha-L-fucosidase 1 [Morus notabilis]             55.8    2e-06
gb|ETK05698.1|  alpha-L-fucosidase [Tannerella sp. oral taxon ...  55.5    2e-06
ref|XP_002975265.1|  hypothetical protein SELMODRAFT_103154 [S...  55.5    3e-06
ref|WP_028667571.1|  hypothetical protein [Runella zeae]           55.5    3e-06
ref|WP_028729115.1|  hypothetical protein [Parabacteroides gor...  55.1    3e-06
ref|WP_010665277.1|  alpha-L-fucosidase [Marinilabilia salmoni...  55.8    3e-06
ref|WP_022053036.1|  putative uncharacterized protein [Bactero...  55.8    3e-06
ref|WP_031445371.1|  hypothetical protein [Arenibacter sp. TG409]  55.8    3e-06
gb|AII69580.1|  alpha-L-fucosidase [Bacteroides dorei]             55.8    3e-06
ref|WP_008674797.1|  alpha-L-fucosidase [Bacteroides sp. 9_1_4...  55.8    3e-06
ref|WP_005935980.1|  hypothetical protein [Bacteroides massili...  55.8    3e-06
ref|WP_007833604.1|  hypothetical protein [Bacteroides dorei]      55.8    3e-06
ref|WP_004623577.1|  hypothetical protein [ [Clostridium termi...  55.1    3e-06
ref|WP_006211772.1|  alpha-fucosidase [Paenibacillus vortex]       55.5    3e-06
ref|WP_022185855.1|  alpha-L-fucosidase [Bacteroides dorei CAG...  55.8    3e-06
ref|XP_004291647.1|  PREDICTED: alpha-L-fucosidase 1-like [Fra...  55.5    3e-06
ref|WP_008622497.1|  carbohydrate-binding protein [Paraprevote...  55.5    3e-06
gb|ETT35249.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-808]  55.5    3e-06
ref|WP_008656033.1|  alpha-L-fucosidase [Bacteroides sp. 3_1_3...  55.8    3e-06
ref|WP_028729116.1|  alpha-L-fucosidase [Parabacteroides gordo...  55.5    3e-06
ref|WP_022430427.1|  f5/8 type C domain protein [Prevotella st...  55.5    3e-06
ref|WP_010663258.1|  alpha-L-fucosidase [Marinilabilia salmoni...  55.8    3e-06
ref|WP_022232702.1|  f5/8 type C domain protein [Bacteroides s...  55.8    3e-06
ref|WP_007855777.1|  hypothetical protein [Bacteroides dorei]      55.5    3e-06
ref|WP_007898133.1|  f5/8 type C domain protein [Prevotella st...  55.5    3e-06
ref|WP_028597616.1|  alpha-fucosidase [Paenibacillus pasadenen...  55.5    3e-06
ref|WP_028729593.1|  carbohydrate-binding protein [Parabactero...  55.5    3e-06
ref|WP_025142787.1|  carbohydrate-binding protein [Sphingobact...  55.5    3e-06
ref|XP_002975402.1|  hypothetical protein SELMODRAFT_103164 [S...  53.1    3e-06
ref|WP_021848127.1|  calx-beta domain-containing protein [Bact...  55.5    3e-06
ref|WP_025006767.1|  hypothetical protein [Marinilabilia salmo...  55.5    3e-06
ref|WP_008764196.1|  MULTISPECIES: carbohydrate-binding protei...  55.5    3e-06
ref|WP_021994311.1|  alpha-L-fucosidase-like [Prevotella sp. C...  55.5    3e-06
ref|WP_008505676.1|  carbohydrate-binding protein [Mucilaginib...  55.5    3e-06
ref|WP_028729780.1|  calcium:sodium exchange protein [Parabact...  55.1    3e-06
ref|WP_008144422.1|  hypothetical protein [Bacteroides coproph...  55.5    3e-06
ref|WP_022277724.1|  f5/8 type C domain protein [Bacteroides c...  55.5    3e-06
ref|WP_022130044.1|  calx-beta domain-containing protein [Bact...  55.1    4e-06
ref|WP_016199709.1|  alpha-1,3/4-fucosidase [Elizabethkingia m...  55.1    4e-06
emb|CDT04029.1|  Glycoside hydrolase family 29 (Alpha-L-fucosi...  55.1    4e-06
ref|WP_005681592.1|  alpha-1,3/4-fucosidase [Bacteroides caccae]   55.5    4e-06
ref|XP_006857990.1|  hypothetical protein AMTR_s00069p00183210...  52.4    4e-06
ref|WP_005633639.1|  hypothetical protein [Parabacteroides mer...  55.5    4e-06
ref|WP_018082561.1|  hypothetical protein [Asticcacaulis benev...  55.5    4e-06
gb|ETZ22974.1|  hypothetical protein N824_22040 [Pedobacter sp...  55.1    4e-06
ref|WP_005678484.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  55.1    4e-06
ref|WP_008143316.1|  MULTISPECIES: hypothetical protein [Bacte...  54.7    4e-06
ref|XP_004251106.1|  PREDICTED: alpha-L-fucosidase 1-like [Sol...  55.1    4e-06
ref|WP_019051017.1|  alpha-1,3/4-fucosidase [Elizabethkingia m...  55.1    4e-06
gb|AIA93346.1|  alpha_L_fucos [uncultured Porphyromonas sp.]       52.4    4e-06
ref|XP_002523703.1|  alpha-l-fucosidase, putative [Ricinus com...  55.1    4e-06
ref|WP_021312218.1|  alpha-L-fucosidase [Bacteroidetes bacteri...  55.1    4e-06
ref|WP_030926224.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  55.1    4e-06
ref|WP_013042256.1|  glycoside hydrolase [Coraliomargarita aka...  54.7    5e-06
ref|WP_008146587.1|  MULTISPECIES: hypothetical protein [Parab...  55.1    5e-06
ref|WP_006800772.1|  carbohydrate-binding protein [Dysgonomona...  54.7    5e-06
gb|AIA93641.1|  alpha_L_fucos [uncultured Bacteroides sp.]         51.2    5e-06
ref|XP_002410648.1|  alpha-L-fucosidase, putative [Ixodes scap...  53.9    5e-06
ref|XP_002313533.2|  hypothetical protein POPTR_0009s01240g [P...  54.7    5e-06
ref|WP_026769296.1|  alpha-L-fucosidase [Sediminibacterium sp....  54.7    5e-06
ref|WP_008156199.1|  hypothetical protein [Parabacteroides joh...  55.1    5e-06
ref|WP_029281144.1|  alpha-L-fucosidase [Pedobacter sp. R20-19]    54.7    5e-06
ref|WP_008669532.1|  MULTISPECIES: calx-beta domain-containing...  54.3    5e-06
ref|WP_022323212.1|  uncharacterized protein [Alistipes sp. CA...  54.7    5e-06
ref|WP_007844465.1|  calx-beta domain-containing protein [Bact...  54.3    5e-06
ref|WP_007758707.1|  beta-galactosidase [Bacteroides finegoldii]   55.1    5e-06
ref|WP_006356447.1|  hypothetical protein [ [Clostridium methy...  55.1    5e-06
ref|WP_009211742.1|  alpha-L-fucosidase [Actinomyces sp. oral ...  55.1    5e-06
ref|WP_028406965.1|  alpha-fucosidase [Bacillus sp. J13]           54.7    5e-06
ref|WP_030970677.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  54.7    5e-06
ref|WP_024751816.1|  alpha-L-fucosidase [Treponema phagedenis]     54.7    5e-06
ref|WP_002695092.1|  alpha-L-fucosidase [Treponema phagedenis]     54.7    5e-06
ref|WP_005422251.1|  alpha-fucosidase [ [[Ruminococcus] obeum]     54.7    5e-06
ref|NP_180377.2|  alpha-L-fucosidase 1 [Arabidopsis thaliana]      54.7    6e-06
ref|WP_008376143.1|  alpha-L-fucosidase [Enterococcus sp. C1]      54.7    6e-06
ref|WP_005232240.1|  alpha-L-fucosidase [Enterococcus casselif...  54.7    6e-06
ref|WP_009133613.1|  hypothetical protein [Alistipes indistinc...  54.7    6e-06
ref|WP_028556237.1|  alpha-L-fucosidase [Paenibacillus sp. URH...  54.3    6e-06
ref|WP_016619659.1|  hypothetical protein [Enterococcus faecalis]  54.7    6e-06
ref|WP_008508807.1|  carbohydrate-binding protein [Mucilaginib...  54.3    6e-06
ref|WP_013546109.1|  alpha-1,3/4-fucosidase [Bacteroides helco...  54.7    6e-06
ref|WP_022015980.1|  putative uncharacterized protein [Bactero...  54.7    6e-06
ref|WP_016611418.1|  hypothetical protein [Enterococcus faecium]   54.3    6e-06
ref|WP_027630133.1|  alpha-L-fucosidase [ [Clostridium cellobi...  54.3    6e-06
ref|WP_013265654.1|  alpha-L-fucosidase [Prevotella melaninoge...  54.3    6e-06
gb|KEQ24169.1|  alpha-L-fucosidase [Paenibacillus sp. MSt1]        54.3    6e-06
ref|WP_028964972.1|  alpha-L-fucosidase [Sphingomonas phyllosp...  54.7    6e-06
ref|WP_013140205.1|  alpha-L-fucosidase [Bifidobacterium longum]   54.3    6e-06
gb|AHI53815.1|  alpha-L-fucosidase [Spiroplasma sabaudiense Ar...  54.3    6e-06
ref|XP_002270630.2|  PREDICTED: alpha-L-fucosidase 1-like [Vit...  54.3    6e-06
gb|KFI63931.1|  putative alpha-1,3/4-fucosidase [Bifidobacteri...  54.3    6e-06
ref|WP_022241902.1|  putative uncharacterized protein [Clostri...  54.3    7e-06
gb|AAD10477.1|  alpha-1,3/4-fucosidase precursor [Streptomyces...  54.3    7e-06
ref|WP_019940673.1|  glycoside hydrolase family 29 [Dyadobacte...  54.3    7e-06
ref|WP_007361246.1|  alpha-L-fucosidase [Opitutaceae bacterium...  54.3    7e-06
gb|AHF90928.1|  alpha-1,3/4-fucosidase [Opitutaceae bacterium ...  54.3    7e-06
ref|WP_028727717.1|  hypothetical protein [Parabacteroides gor...  54.3    7e-06
ref|WP_021611111.1|  immunoglobulin I-set domain protein [Acti...  54.7    7e-06
emb|CBI24481.3|  unnamed protein product [Vitis vinifera]          54.7    7e-06
ref|WP_020967208.1|  hypothetical protein [Prevotella sp. oral...  54.3    7e-06
ref|WP_006356329.1|  hypothetical protein [ [Clostridium methy...  54.7    7e-06
ref|XP_006827402.1|  hypothetical protein AMTR_s00009p00020370...  54.3    7e-06
ref|WP_015812063.1|  coagulation factor 5/8 type domain-contai...  54.3    8e-06
ref|WP_021895855.1|  alpha-L-fucosidase-like [Prevotella sp. C...  54.3    8e-06
emb|CDN32280.1|  Alpha-L-fucosidase [Rikenellaceae bacterium M3]   54.3    8e-06
ref|WP_028665823.1|  glycoside hydrolase family 29 [Runella zeae]  54.3    8e-06
ref|WP_022507013.1|  f5/8 type C domain protein [Bacteroides s...  54.3    8e-06
ref|WP_005943867.1|  hypothetical protein [Bacteroides massili...  54.3    8e-06
ref|WP_026231464.1|  alpha-1,3/4-fucosidase [Bacteroides massi...  54.3    8e-06
gb|ERE47338.1|  hypothetical protein N036_76140 [Enterococcus ...  51.6    8e-06
gb|KFC34713.1|  alpha-1,3/4-fucosidase [Elizabethkingia mening...  54.3    8e-06
gb|ELU10360.1|  hypothetical protein CAPTEDRAFT_208204 [Capite...  52.8    8e-06
ref|WP_021970284.1|  f5/8 type C domain protein [Bacteroides s...  54.3    8e-06
ref|WP_026774327.1|  alpha-L-fucosidase [Sediminibacterium sp....  53.9    9e-06
ref|WP_022025608.1|  glycosyl hydrolase [Clostridium sp. CAG:75]   53.9    9e-06
ref|WP_019464549.1|  hypothetical protein [Dyella japonica]        53.9    9e-06
ref|WP_026207314.1|  carbohydrate-binding protein [Butyricimon...  53.9    9e-06
ref|WP_029273084.1|  alpha-L-fucosidase [Flavobacterium sp. KJJ]   53.9    9e-06
ref|WP_009860789.1|  glycoside hydrolase [Parabacteroides gold...  54.3    9e-06
ref|XP_007016857.1|  Alpha-L-fucosidase 1 [Theobroma cacao]        53.9    9e-06
gb|EZP57220.1|  F5/8 type C domain protein [Sphingomonas sp. R...  53.9    9e-06
ref|WP_014933395.1|  alpha-L-fucosidase [Brachyspira pilosicoli]   53.9    9e-06
ref|WP_014935729.1|  alpha-L-fucosidase [Brachyspira pilosicoli]   53.9    9e-06
ref|WP_018383003.1|  hypothetical protein [Streptomyces vitami...  53.9    9e-06
ref|WP_026081066.1|  alpha-fucosidase [Paenibacillus sp. PAMC ...  53.9    9e-06
ref|WP_024565840.1|  alpha-1,3/4-fucosidase [Elizabethkingia a...  53.9    9e-06
ref|WP_026260192.1|  alpha-L-fucosidase [Segetibacter koreensis]   53.9    9e-06
ref|WP_012733384.1|  alpha-L-fucosidase [Burkholderia glumae]      53.9    9e-06
ref|WP_017424744.1|  alpha-L-fucosidase [Burkholderia glumae]      53.9    1e-05
ref|WP_022511493.1|  uncharacterized protein [Prevotella sp. C...  53.5    1e-05
ref|WP_031267674.1|  carbohydrate-binding protein [Cytophagale...  53.9    1e-05
ref|WP_030937449.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  53.9    1e-05
ref|XP_005245878.1|  PREDICTED: tissue alpha-L-fucosidase isof...  53.5    1e-05
ref|WP_026966690.1|  alpha-L-fucosidase [Algoriphagus terrigena]   53.9    1e-05
ref|WP_022198425.1|  coagulation factor 5/8 type domain protei...  53.9    1e-05
ref|WP_007855781.1|  hypothetical protein [Bacteroides dorei]      53.5    1e-05
ref|WP_007833595.1|  hypothetical protein [Bacteroides dorei]      53.5    1e-05
ref|WP_021347969.1|  alpha-1,3/4-fucosidase [Elizabethkingia m...  53.9    1e-05
ref|WP_008625695.1|  carbohydrate-binding protein [Paraprevote...  53.5    1e-05
ref|XP_007150151.1|  hypothetical protein PHAVU_005G131200g [P...  53.9    1e-05
ref|WP_008674788.1|  calx-beta domain-containing protein [Bact...  53.5    1e-05
ref|WP_022821348.1|  hypothetical protein [Armatimonadetes bac...  53.5    1e-05
ref|WP_022275501.1|  beta-galactosidase [Bacteroides finegoldi...  54.3    1e-05
ref|WP_028730369.1|  glycoside hydrolase [Parabacteroides gord...  53.9    1e-05
ref|WP_009780810.1|  alpha-L-fucosidase [Leeuwenhoekiella blan...  53.5    1e-05
ref|WP_007756141.1|  beta-galactosidase [Bacteroides finegoldii]   53.9    1e-05
ref|XP_007016859.1|  Alpha-L-fucosidase 1 [Theobroma cacao]        53.9    1e-05
dbj|BAC43615.1|  unknown protein [Arabidopsis thaliana]            53.5    1e-05
ref|WP_014218521.1|  carbohydrate-binding protein [Niastella k...  53.5    1e-05
ref|WP_013243354.1|  alpha-L-fucosidase [Brachyspira pilosicoli]   53.5    1e-05
ref|WP_021979934.1|  f5/8 type C domain protein [Paraprevotell...  53.5    1e-05
ref|WP_012419446.1|  coagulation factor 5/8 type domain-contai...  53.5    1e-05
ref|WP_013816107.1|  alpha-1,3/4-fucosidase [Porphyromonas gin...  53.5    1e-05
ref|WP_005546194.1|  alpha-fucosidase [Paenibacillus alvei]        53.5    1e-05
gb|KFC34716.1|  alpha-1,3/4-fucosidase [Elizabethkingia mening...  53.5    1e-05
ref|WP_020120323.1|  glycosyl hydrolase [Streptomyces canus]       53.5    1e-05
ref|WP_008656035.1|  Ig domain-containing protein group 2 [Bac...  53.5    1e-05
ref|WP_026309860.1|  alpha-1,3/4-fucosidase [Niabella aurantiaca]  53.5    1e-05
ref|WP_007127626.1|  alpha-fucosidase [Paenibacillus lactis]       53.1    1e-05
ref|WP_028532504.1|  alpha-fucosidase [Paenibacillus sp. UNC21...  53.5    1e-05
ref|WP_026320180.1|  alpha-1,3/4-fucosidase [Bacteroides barne...  53.5    1e-05
ref|WP_022215646.1|  uncharacterized protein [Blautia sp. CAG:...  53.1    1e-05
ref|WP_018711191.1|  hypothetical protein [Bacteroides barnesiae]  53.5    1e-05
gb|ACU17937.1|  unknown [Glycine max]                              52.4    1e-05
ref|XP_004705415.1|  PREDICTED: tissue alpha-L-fucosidase [Ech...  53.1    1e-05
emb|CDA84843.1|  uncharacterized protein BN772_03235 [Bacteroi...  53.5    1e-05
ref|WP_026956066.1|  alpha-L-fucosidase [Algoriphagus vanfonge...  53.5    1e-05
ref|WP_022339788.1|  putative uncharacterized protein [Bactero...  53.5    1e-05
ref|WP_004359613.1|  alpha-L-fucosidase [Prevotella melaninoge...  53.1    1e-05
ref|XP_002434692.1|  alpha-L-fucosidase, putative [Ixodes scap...  49.3    1e-05
ref|WP_025655287.1|  alpha-L-fucosidase [Clostridiales bacteri...  53.1    2e-05
ref|WP_015735330.1|  alpha-L-fucosidase [Paenibacillus sp. Y41...  52.8    2e-05
ref|WP_013480192.1|  glycoside hydrolase family 29 (alpha-l-fu...  53.5    2e-05
gb|KDP43984.1|  hypothetical protein JCGZ_05451 [Jatropha curcas]  53.1    2e-05
ref|WP_021254840.1|  alpha-L-fucosidase [Paenibacillus alvei]      53.1    2e-05
gb|EXY31963.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  53.1    2e-05
ref|WP_008645818.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  53.1    2e-05
ref|WP_021896907.1|  alpha-L-fucosidase 1 family protein [Prev...  53.1    2e-05
ref|XP_002993453.1|  hypothetical protein SELMODRAFT_236749 [S...  53.1    2e-05
ref|XP_006362841.1|  PREDICTED: alpha-L-fucosidase 1-like [Sol...  53.1    2e-05
ref|WP_018965468.1|  alpha-1,3/4-fucosidase [Porphyromonas gulae]  53.1    2e-05
ref|WP_010801554.1|  MULTISPECIES: hypothetical protein [Parab...  53.1    2e-05
ref|WP_021670773.1|  f5/8 type C domain protein [Prevotella sp...  53.1    2e-05
ref|WP_018629035.1|  hypothetical protein [Niabella aurantiaca]    52.8    2e-05
gb|AHW60410.1|  alpha-L-fucosidase [Bacteroidetes bacterium FH5]   53.1    2e-05
ref|WP_005941471.1|  hypothetical protein [Bacteroides massili...  53.1    2e-05
ref|WP_022118266.1|  putative uncharacterized protein [Firmicu...  53.5    2e-05
ref|WP_017691196.1|  hypothetical protein [Paenibacillus sp. P...  52.8    2e-05
ref|WP_024346330.1|  alpha-fucosidase [ [Clostridium methoxybe...  53.1    2e-05
ref|WP_024294844.1|  MULTISPECIES: alpha-fucosidase [Lachnoclo...  53.1    2e-05
ref|WP_025849063.1|  alpha-L-fucosidase [Paenibacillus ehimensis]  52.8    2e-05
ref|WP_022142281.1|  glycosyl hydrolase [Clostridium sp. CAG:230]  52.8    2e-05
ref|WP_022260036.1|  putative uncharacterized protein [Eubacte...  53.1    2e-05
ref|WP_026950556.1|  alpha-L-fucosidase [Algoriphagus mannitol...  53.1    2e-05
ref|WP_028729956.1|  alpha-1,3/4-fucosidase [Parabacteroides g...  53.1    2e-05
ref|WP_004316228.1|  MULTISPECIES: alpha-1,3/4-fucosidase [Bac...  53.1    2e-05
emb|CDP07048.1|  unnamed protein product [Coffea canephora]        53.1    2e-05
ref|WP_009040557.1|  alpha-1,3/4-fucosidase [Bacteroides sp. D22]  53.1    2e-05
ref|WP_031339256.1|  alpha-L-fucosidase [Xanthomonas sp. M97]      53.1    2e-05
ref|WP_021687059.1|  Alpha-L-fucosidase [Treponema lecithinoly...  52.8    2e-05
gb|KFI94501.1|  putative alpha-1,3/4-fucosidase [Bifidobacteri...  53.1    2e-05
ref|WP_007655575.1|  hypothetical protein [Parabacteroides gol...  53.1    2e-05
ref|WP_031066379.1|  hypothetical protein [Streptomyces sp. NR...  52.8    2e-05
ref|WP_008682726.1|  Glycoside hydrolase, family 29 [Rhodopire...  53.1    2e-05
ref|XP_008359950.1|  PREDICTED: alpha-L-fucosidase 1-like [Mal...  51.2    2e-05
ref|WP_016461038.1|  hypothetical protein [Actinomyces sp. HPA...  52.8    2e-05
gb|EXY16237.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  53.1    2e-05
ref|WP_004636684.1|  alpha-L-fucosidase [Dolosigranulum pigrum]    52.8    2e-05
emb|CDT04060.1|  Alpha-1,3/4-fucosidase [Sphingobacterium sp. ...  53.1    2e-05
ref|WP_018452478.1|  alpha-1,3/4-fucosidase [Bacteroides massi...  53.1    2e-05
ref|WP_026946359.1|  alpha-L-fucosidase [Algoriphagus marincola]   53.1    2e-05
ref|WP_009279891.1|  alpha-L-fucosidase [Fibrisoma limi]           52.8    2e-05
ref|WP_028796820.1|  glycosyl hydrolase [Streptomyces bottrope...  53.1    2e-05
ref|WP_009295550.1|  hypothetical protein [Streptomyces ipomoeae]  52.8    2e-05
ref|WP_024284398.1|  alpha-L-fucosidase [Algoriphagus marincola]   53.1    2e-05
ref|WP_006962463.1|  Alpha-L-fucosidase [Sphingobium japonicum]    52.8    2e-05
ref|WP_004574432.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.8    2e-05
gb|ETT00305.1|  alpha-L-fucosidase [Prevotella sp. ICM33]          52.8    2e-05
ref|WP_028389772.1|  alpha-L-fucosidase [Bacillus sp. FJAT-14515]  52.8    2e-05
ref|WP_005210615.1|  f5/8 type C domain protein [Clostridium c...  53.1    2e-05
gb|EPS70308.1|  hypothetical protein M569_04449 [Genlisea aurea]   52.8    2e-05
ref|WP_029906453.1|  carbohydrate-binding protein [Prevotella ...  52.8    2e-05
ref|WP_010519009.1|  coagulation factor 5/8 type domain-contai...  52.8    2e-05
ref|WP_005476704.1|  MULTISPECIES: glycosyl hydrolase [Strepto...  52.8    2e-05
ref|WP_014933098.1|  alpha-L-fucosidase [Brachyspira pilosicoli]   52.8    2e-05
gb|KCW50681.1|  hypothetical protein EUGRSUZ_J00367 [Eucalyptu...  52.8    2e-05
gb|AIE86113.1|  coagulation factor 5/8 type domain-containing ...  52.8    2e-05
ref|WP_010538876.1|  alpha-1,3/4-fucosidase [Bacteroides faeci...  52.8    2e-05
gb|EWZ43346.1|  hypothetical protein FOZG_08043 [Fusarium oxys...  52.4    2e-05
ref|WP_029425641.1|  alpha-1,3/4-fucosidase [Bacteroides faecis]   52.8    2e-05
ref|WP_022072979.1|  uncharacterized protein [Anaerotruncus sp...  52.4    2e-05
ref|WP_022241918.1|  alpha-L-fucosidase [Clostridium sp. CAG:413]  52.4    3e-05
ref|WP_016267044.1|  alpha-L-fucosidase [Bacteroides thetaiota...  52.8    3e-05
ref|WP_008767900.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 1...  52.8    3e-05
ref|WP_011107898.1|  alpha-1,3/4-fucosidase [Bacteroides theta...  52.8    3e-05
gb|KFC59798.1|  hypothetical protein FEM08_14660 [Flavobacteri...  52.8    3e-05
dbj|GAF08862.1|  alpha-L-fucosidase [Paenibacillus pini JCM 16...  52.4    3e-05
ref|WP_008762105.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 1...  52.8    3e-05
ref|WP_031441970.1|  alpha-1,3/4-fucosidase [Arenibacter sp. T...  52.8    3e-05
ref|WP_009993891.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.4    3e-05
ref|WP_008026077.1|  alpha-1,3/4-fucosidase [Bacteroides xylan...  52.8    3e-05
ref|WP_031056676.1|  glycosyl hydrolase [Streptomyces sp. NRRL...  52.8    3e-05
ref|WP_022395981.1|  coagulation factor 5/8 type domain protei...  52.8    3e-05
gb|ETT43086.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H7-689]  52.4    3e-05
ref|WP_022396789.1|  coagulation factor 5/8 type domain protei...  52.8    3e-05
ref|WP_021661741.1|  f5/8 type C domain protein [Porphyromonas...  52.8    3e-05
gb|KCW50695.1|  hypothetical protein EUGRSUZ_J00379 [Eucalyptu...  52.4    3e-05
ref|WP_004584751.1|  alpha-L-fucosidase [Porphyromonas gingiva...  52.8    3e-05
ref|WP_021663594.1|  f5/8 type C domain protein [Porphyromonas...  52.4    3e-05
ref|XP_006857991.1|  hypothetical protein AMTR_s00069p00183260...  52.4    3e-05
ref|WP_021665886.1|  f5/8 type C domain protein [Porphyromonas...  52.4    3e-05
ref|WP_004272780.1|  alpha-L-fucosidase [Azospirillum amazonense]  52.8    3e-05
ref|WP_022818001.1|  hypothetical protein [Candidatus Latescib...  52.4    3e-05
ref|WP_009091742.1|  alpha-1,3/4-fucosidase [Elizabethkingia a...  52.8    3e-05
ref|WP_031440156.1|  alpha-L-fucosidase [Sphingomonas sp. FUKU...  52.8    3e-05
ref|WP_014266876.1|  alpha-L-fucosidase [Granulicella mallensis]   52.4    3e-05
gb|KCW50694.1|  hypothetical protein EUGRSUZ_J00379 [Eucalyptu...  52.4    3e-05
ref|WP_019261748.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.4    3e-05
ref|WP_005875390.1|  alpha-1,3/4-fucosidase [Porphyromonas gin...  52.4    3e-05
ref|WP_004120276.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.4    3e-05
gb|KFG08434.1|  glycosyl hydrolase [Streptomyces scabiei]          52.4    3e-05
ref|WP_007655147.1|  hypothetical protein [Parabacteroides gol...  52.0    3e-05
ref|WP_019538399.1|  hypothetical protein [Proteiniphilum acet...  52.4    3e-05
ref|WP_012998313.1|  glycosyl hydrolase [Streptomyces scabiei]     52.4    3e-05
ref|WP_021677040.1|  f5/8 type C domain protein [Porphyromonas...  52.4    3e-05
ref|WP_014232615.1|  alpha-L-fucosidase [Vibrio sp. EJY3]          52.4    3e-05
ref|WP_026034260.1|  alpha-L-fucosidase [Dyella japonica]          52.4    3e-05
ref|WP_004114072.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.4    3e-05
ref|WP_012458461.1|  alpha-1,3/4-fucosidase [Porphyromonas gin...  52.4    3e-05
ref|WP_023847551.1|  alpha-1,3/4-fucosidase [Porphyromonas gin...  52.4    3e-05
ref|WP_021849787.1|  uncharacterized protein [Firmicutes bacte...  52.4    3e-05
ref|WP_020722805.1|  hypothetical protein [Acidobacteriaceae b...  52.4    3e-05
ref|WP_031393883.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  52.4    3e-05
ref|WP_004137675.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.0    3e-05
gb|KFK41653.1|  hypothetical protein AALP_AA2G155500 [Arabis a...  52.0    3e-05
gb|AIM37977.1|  calcium:sodium exchange protein [Sphingobacter...  52.0    3e-05
ref|WP_015030156.1|  glycoside hydrolase family 29 (alpha-L-fu...  52.0    3e-05
ref|WP_009035334.1|  alpha-L-fucosidase [Indibacter alkaliphilus]  52.0    3e-05
ref|WP_014554869.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.0    3e-05
ref|WP_022276999.1|  calx-beta domain protein [Bacteroides cop...  52.0    4e-05
ref|XP_003580318.1|  PREDICTED: putative alpha-L-fucosidase 1-...  52.0    4e-05
ref|WP_008760875.1|  carbohydrate-binding protein [Bacteroides...  52.0    4e-05
ref|WP_004573610.1|  alpha-L-fucosidase [Gardnerella vaginalis]    52.0    4e-05
ref|WP_024629466.1|  MULTISPECIES: alpha-fucosidase [Paenibaci...  52.0    4e-05
ref|WP_009098516.1|  coagulation factor 5/8 type domain protei...  52.4    4e-05
ref|WP_007557738.1|  hypothetical protein [Bacteroides plebeius]   52.0    4e-05
ref|WP_013665337.1|  carbohydrate-binding protein [Sphingobact...  52.0    4e-05
ref|XP_002880953.1|  alpha-L-fucosidase 1 [Arabidopsis lyrata ...  52.0    4e-05
ref|WP_003795385.1|  alpha-L-fucosidase [Actinomyces odontolyt...  52.0    4e-05
ref|WP_031526730.1|  alpha-L-fucosidase [Dyadobacter crusticola]   52.0    4e-05
ref|WP_010801404.1|  MULTISPECIES: alpha-L-fucosidase [Parabac...  52.4    4e-05
gb|EYA37082.1|  alpha-1,3/4-fucosidase domain protein [Bactero...  52.4    4e-05
ref|WP_007379489.1|  glycosyl hydrolase [Streptomyces sviceus]     52.0    4e-05
ref|WP_029985431.1|  alpha-L-fucosidase [Sphingobacterium sp. ...  52.0    4e-05
ref|WP_029951218.1|  MULTISPECIES: hypothetical protein [Hydro...  52.0    4e-05
ref|WP_031396207.1|  alpha-L-fucosidase [Sphingomonas sp. STIS...  52.0    4e-05
dbj|BAK02255.1|  predicted protein [Hordeum vulgare subsp. vul...  52.0    4e-05
ref|WP_003792781.1|  alpha-L-fucosidase [Actinomyces odontolyt...  52.0    4e-05
gb|KFP83665.1|  Tissue alpha-L-fucosidase [Acanthisitta chloris]   51.6    4e-05
ref|XP_003556076.1|  PREDICTED: alpha-L-fucosidase 1-like [Gly...  52.0    4e-05
gb|ETN96649.1|  hypothetical protein P278_00750 [Zhouia amylol...  51.6    4e-05
ref|WP_006449168.1|  alpha-L-fucosidase [Xanthomonas gardneri]     52.0    4e-05
ref|XP_002270674.2|  PREDICTED: alpha-L-fucosidase 1-like [Vit...  52.0    4e-05
ref|WP_022383624.1|  alpha-1 3/4-fucosidase [Bacteroides sp. C...  52.0    4e-05
ref|WP_007588699.1|  alpha-L-fucosidase [Actinomyces sp. ICM39]    51.6    4e-05
ref|XP_003536497.1|  PREDICTED: alpha-L-fucosidase 1 [Glycine ...  52.0    4e-05
ref|WP_031372084.1|  alpha-L-fucosidase [Lysobacter antibioticus]  51.6    5e-05
ref|WP_027745778.1|  glycoside hydrolase [Streptomyces sp. CNT...  51.6    5e-05
ref|WP_029275502.1|  alpha-L-fucosidase [Pedobacter borealis]      51.6    5e-05
gb|AHF15799.1|  alpha-L-fucosidase [Niabella soli DSM 19437]       51.6    5e-05
pdb|3UET|A  Chain A, Crystal Structure Of Alpha-1,34-Fucosidas...  51.6    5e-05
ref|WP_015846784.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]  51.6    5e-05
gb|KFV77903.1|  Tissue alpha-L-fucosidase [Struthio camelus au...  51.6    5e-05
gb|EWC96238.1|  alpha-L-fucosidase [Actinomyces sp. ICM54]         51.6    5e-05
gb|KEO75583.1|  alpha-L-fucosidase [Cytophagaceae bacterium AN...  52.0    5e-05
gb|KCX00335.1|  alpha-L-fucosidase [Xanthomonas arboricola pv....  52.0    5e-05
ref|XP_003764931.1|  PREDICTED: tissue alpha-L-fucosidase-like...  51.6    5e-05
ref|WP_012578563.1|  alpha-L-fucosidase [Bifidobacterium longum]   51.6    5e-05
ref|WP_007575177.1|  Alpha-L-fucosidase [Prevotella multisacch...  51.6    5e-05
ref|WP_022080957.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  51.6    5e-05
ref|WP_009436591.1|  f5/8 type C domain protein [Prevotella sp...  51.6    5e-05
ref|XP_007143337.1|  hypothetical protein PHAVU_007G063900g [P...  51.6    5e-05
ref|WP_005844713.1|  alpha-L-fucosidase [Prevotella dentalis]      51.6    5e-05
ref|WP_009211856.1|  alpha-L-fucosidase [Actinomyces sp. oral ...  51.6    5e-05
pdb|3MO4|A  Chain A, The Crystal Structure Of An Alpha-(1-3,4)...  51.6    5e-05
ref|WP_013305117.1|  hypothetical protein [Maribacter sp. HTCC...  51.6    5e-05
ref|WP_027952341.1|  alpha-L-fucosidase [Hallella seregens]        51.6    6e-05
ref|WP_014773683.1|  alpha-L-fucosidase [Belliella baltica]        51.6    6e-05
ref|XP_002993796.1|  hypothetical protein SELMODRAFT_431829 [S...  51.2    6e-05
ref|WP_013991732.1|  alpha-L-fucosidase [Zobellia galactanivor...  51.6    6e-05
gb|EOA95273.1|  Tissue alpha-L-fucosidase [Anas platyrhynchos]     51.2    6e-05
gb|KEY30716.1|  alpha-L-fucosidase [Bifidobacterium longum sub...  51.6    6e-05
gb|ETT29638.1|  alpha-L-fucosidase [Paenibacillus sp. FSL R5-192]  51.6    6e-05
gb|AIA85807.1|  alpha_L_fucos [uncultured Solibacter sp.]          48.1    6e-05
ref|WP_021951452.1|  uncharacterized protein [Clostridium sp. ...  51.6    6e-05
ref|XP_009076383.1|  PREDICTED: tissue alpha-L-fucosidase [Aca...  50.8    6e-05
ref|WP_020759655.1|  hypothetical protein [Gardnerella vaginalis]  51.2    6e-05
gb|ETT68114.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-457]  51.2    6e-05
ref|WP_025762309.1|  alpha-L-fucosidase [Dyadobacter sp. Y620-1]   51.2    6e-05
ref|WP_023903219.1|  alpha-L-fucosidase [Xanthomonas hortorum]     51.6    6e-05
ref|WP_012438875.1|  alpha-L-fucosidase [Xanthomonas campestris]   51.6    6e-05
ref|WP_011036446.1|  alpha-L-fucosidase [Xanthomonas campestris]   51.6    6e-05
ref|WP_015736742.1|  alpha-fucosidase [Paenibacillus sp. Y412M...  51.2    6e-05
gb|KFF29329.1|  alpha-L-fucosidase [Chryseobacterium sp. CTM]      51.2    6e-05
ref|WP_025580031.1|  alpha-fucosidase [Blautia wexlerae]           51.2    6e-05
ref|WP_009593620.1|  alpha-fucosidase [Paenibacillus sp. HGF5]     51.2    6e-05
gb|KFP76873.1|  Tissue alpha-L-fucosidase [Apaloderma vittatum]    51.2    6e-05
ref|WP_008706707.1|  alpha-fucosidase [Ruminococcus sp. 5_1_39...  51.2    6e-05
ref|WP_030441230.1|  alpha-L-fucosidase [Actinoplanes sp. RP-A...  51.2    7e-05
ref|WP_015846493.1|  alpha-L-fucosidase [Paenibacillus sp. JDR-2]  51.2    7e-05
emb|CBK22406.2|  unnamed protein product [Blastocystis hominis]    51.2    7e-05
gb|EXC66584.1|  Alpha-L-fucosidase 1 [Morus notabilis]             49.7    7e-05
ref|XP_006421784.1|  hypothetical protein CICLE_v10004832mg [C...  51.2    7e-05
ref|WP_026727651.1|  hypothetical protein [Flavobacterium deni...  51.6    7e-05
ref|WP_027767910.1|  glycoside hydrolase [Streptomyces sp. CNQ...  51.2    7e-05
ref|WP_018853674.1|  hypothetical protein [Streptomyces sp. CN...  51.2    7e-05
ref|WP_022380664.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:9]   51.2    7e-05
ref|XP_005028219.1|  PREDICTED: tissue alpha-L-fucosidase [Ana...  51.2    7e-05
ref|WP_018838616.1|  hypothetical protein [Streptomyces sp. CN...  51.2    7e-05
ref|WP_028703232.1|  alpha-L-fucosidase [Propionibacterium jen...  51.2    7e-05
ref|WP_031439199.1|  alpha-L-fucosidase [Sphingomonas sp. FUKU...  51.2    7e-05
ref|WP_003792646.1|  hypothetical protein [Actinomyces odontol...  51.6    7e-05
ref|WP_020334574.1|  hypothetical protein [Vibrio natriegens]      51.2    7e-05
gb|AHZ59906.1|  alpha-L-fucosidase-like protein [uncultured Ba...  51.2    7e-05
gb|AIA95845.1|  alpha_L_fucos [uncultured Dyadobacter sp.]         49.7    7e-05
gb|KDO65333.1|  hypothetical protein CISIN_1g011170mg [Citrus ...  51.2    7e-05
ref|XP_006468808.1|  PREDICTED: alpha-L-fucosidase 1-like [Cit...  51.2    7e-05
ref|WP_014058594.1|  glycoside hydrolase [Streptomyces violace...  51.2    7e-05
gb|EYU37042.1|  hypothetical protein MIMGU_mgv1a004219mg [Mimu...  51.2    7e-05
ref|WP_022687310.1|  alpha-L-fucosidase [Sphingomonas phyllosp...  51.2    8e-05
ref|WP_007367294.1|  alpha-L-fucosidase [Prevotella multiformis]   51.2    8e-05
ref|WP_013925872.1|  alpha-L-fucosidase [Runella slithyformis]     51.2    8e-05
ref|WP_009443499.1|  alpha-L-fucosidase [Streptococcus sp. ora...  51.2    8e-05
ref|WP_021262981.1|  alpha-L-fucosidase [Paenibacillus alvei]      51.2    8e-05
ref|WP_022185858.1|  ig domain-containing protein group 2 [Bac...  48.5    8e-05
ref|WP_009012157.1|  alpha-L-fucosidase [Prevotella sp. C561]      51.2    8e-05
ref|XP_005494781.1|  PREDICTED: tissue alpha-L-fucosidase [Zon...  50.8    8e-05
ref|WP_024985902.1|  alpha-L-fucosidase [Prevotella veroralis]     51.2    8e-05
ref|XP_003541983.1|  PREDICTED: alpha-L-fucosidase 1-like [Gly...  51.2    8e-05
ref|WP_014507132.1|  alpha-L-fucosidase [Xanthomonas campestris]   51.2    8e-05
ref|WP_020714268.1|  hypothetical protein [Acidobacteriaceae b...  50.8    8e-05
ref|WP_008628279.1|  carbohydrate-binding protein [Paraprevote...  51.2    8e-05
ref|WP_008996041.1|  alpha-L-fucosidase [Novosphingobium sp. R...  51.2    8e-05
ref|WP_024840894.1|  hypothetical protein [Cellulosimicrobium ...  51.2    8e-05
ref|WP_004384447.1|  alpha-L-fucosidase [Prevotella veroralis]     51.2    8e-05
ref|WP_022470830.1|  putative exported fucosidase [Bacteroides...  51.2    8e-05
ref|WP_010599709.1|  coagulation factor 5/8 type domain-contai...  50.8    8e-05
ref|WP_029669146.1|  alpha-L-fucosidase [Caulobacter sp. JGI 0...  50.8    8e-05
emb|CDT08686.1|  Coagulation factor 5/8 type domain protein [S...  50.8    8e-05
ref|WP_009434598.1|  alpha-L-fucosidase [Prevotella sp. oral t...  50.8    8e-05
ref|WP_022144506.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  50.8    8e-05
gb|AIA93287.1|  alpha_L_fucos [uncultured Streptococcus sp.]       47.4    9e-05
ref|WP_018910219.1|  alpha-L-fucosidase [Prevotella veroralis]     50.8    9e-05
ref|XP_002993800.1|  hypothetical protein SELMODRAFT_431823 [S...  50.8    9e-05
ref|WP_000988883.1|  hypothetical protein [Streptococcus sp. G...  48.5    9e-05
ref|WP_003072043.1|  alpha-L-fucosidase [Amycolatopsis vancore...  50.8    9e-05
gb|KFV00020.1|  Tissue alpha-L-fucosidase [Pterocles gutturalis]   50.8    9e-05
ref|WP_010380557.1|  hypothetical protein [Xanthomonas campest...  49.7    9e-05
emb|CBI17157.3|  unnamed protein product [Vitis vinifera]          50.8    9e-05
gb|EXU69954.1|  alpha-L-fucosidase [Streptomyces sp. PRh5]         50.8    9e-05
ref|WP_007404242.1|  alpha-L-fucosidase [Sphingomonas sp. S17]     50.8    1e-04
ref|WP_029561754.1|  alpha-L-fucosidase [Xanthomonas sacchari]     50.8    1e-04
ref|XP_002276131.1|  PREDICTED: alpha-L-fucosidase 1 [Vitis vi...  50.8    1e-04
ref|WP_026144420.1|  alpha-L-fucosidase [Xanthomonas sp. SHU199]   50.8    1e-04
ref|WP_026143404.1|  alpha-L-fucosidase [Xanthomonas sp. SHU308]   50.8    1e-04
ref|WP_007845401.1|  alpha-L-fucosidase [Chryseobacterium sp. ...  50.1    1e-04
ref|WP_015843379.1|  alpha-fucosidase [Paenibacillus sp. JDR-2]    50.8    1e-04
ref|WP_014060727.1|  alpha-L-fucosidase [Streptomyces violaceu...  50.8    1e-04
gb|KFU91860.1|  Tissue alpha-L-fucosidase [Chaetura pelagica]      50.4    1e-04
ref|WP_009647833.1|  alpha-L-fucosidase [Actinomyces sp. ICM47]    50.8    1e-04
ref|WP_009321422.1|  hypothetical protein [Lachnospiraceae bac...  50.8    1e-04
ref|WP_008214447.1|  alpha-L-fucosidase [Rhodanobacter sp. 115]    50.8    1e-04
ref|WP_022148456.1|  putative uncharacterized protein [Bactero...  50.8    1e-04
ref|XP_006851276.1|  hypothetical protein AMTR_s00050p00034460...  49.7    1e-04
ref|WP_017978096.1|  alpha-L-fucosidase [Sphingomonas melonis]     50.8    1e-04
gb|KFQ19252.1|  Tissue alpha-L-fucosidase [Merops nubicus]         50.4    1e-04
emb|CDX77155.1|  BnaC04g39500D [Brassica napus]                    50.4    1e-04
ref|WP_010801878.1|  MULTISPECIES: hypothetical protein [Parab...  50.4    1e-04
ref|WP_018251113.1|  alpha-L-fucosidase [Sphingomonas melonis]     50.8    1e-04
ref|XP_003592377.1|  Alpha-L-fucosidase [Medicago truncatula]      50.4    1e-04
emb|CDP05278.1|  unnamed protein product [Coffea canephora]        50.4    1e-04
ref|WP_009460936.1|  hypothetical protein [Lachnospiraceae bac...  50.8    1e-04
ref|WP_025156097.1|  alpha-L-fucosidase [Leifsonia aquatica]       50.4    1e-04
gb|ETT68953.1|  alpha-L-fucosidase [Paenibacillus sp. FSL H8-237]  50.4    1e-04
ref|WP_009778960.1|  putative lipoprotein [Leeuwenhoekiella bl...  50.4    1e-04
gb|KFZ55945.1|  Tissue alpha-L-fucosidase [Podiceps cristatus]     50.4    1e-04
ref|WP_022015656.1|  alpha-L-fucosidase-like [Bacteroides sp. ...  50.4    1e-04
ref|WP_021838336.1|  putative uncharacterized protein [Alistip...  50.4    1e-04
ref|WP_025077423.1|  alpha-L-fucosidase [Prevotella fusca]         50.4    1e-04
ref|WP_018843728.1|  hypothetical protein [Streptomyces sp. CN...  50.4    1e-04
ref|WP_020711517.1|  hypothetical protein [Acidobacteriaceae b...  50.4    1e-04
ref|WP_008143319.1|  hypothetical protein [Bacteroides coproph...  50.4    1e-04
ref|WP_022396554.1|  coagulation factor 5/8 type domain protei...  50.4    1e-04
ref|WP_021611755.1|  hypothetical protein [Actinomyces sp. ora...  50.4    1e-04
ref|XP_007304824.1|  alpha-L-fucosidase [Stereum hirsutum FP-9...  50.4    1e-04
ref|WP_025829865.1|  alpha-L-fucosidase [Prevotella maculosa]      50.4    1e-04
gb|EWZ99568.1|  hypothetical protein FOWG_00004 [Fusarium oxys...  50.4    1e-04
ref|XP_004496649.1|  PREDICTED: alpha-L-fucosidase 1-like [Cic...  50.4    1e-04
ref|WP_010135334.1|  coagulation factor 5/8 type domain-contai...  50.1    1e-04
ref|WP_026714407.1|  alpha-L-fucosidase [Flavobacterium daejeo...  50.4    1e-04
ref|WP_020674164.1|  hypothetical protein [Amycolatopsis nigre...  50.4    1e-04
gb|KEQ49885.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  50.4    1e-04
ref|WP_005456346.1|  alpha-L-fucosidase [Saccharomonospora cya...  50.4    1e-04
ref|WP_024721274.1|  hypothetical protein [Clostridiales bacte...  50.4    1e-04
ref|WP_009583119.1|  exported alpha-L-fucosidase [Xanthomonas ...  50.4    1e-04
gb|KFP94614.1|  Tissue alpha-L-fucosidase [Haliaeetus albicilla]   50.1    1e-04
emb|CDY30508.1|  BnaA04g16250D [Brassica napus]                    50.1    1e-04
gb|KFP50103.1|  Tissue alpha-L-fucosidase [Cathartes aura]         50.1    1e-04
gb|KFQ46229.1|  Tissue alpha-L-fucosidase [Nestor notabilis]       50.1    1e-04
ref|WP_018189703.1|  hypothetical protein [Leifsonia sp. 109]      50.1    2e-04
ref|WP_026812342.1|  alpha-1,3/4-fucosidase [Arenibacter certe...  50.4    2e-04
ref|WP_009055210.1|  alpha-L-fucosidase [Atopobium sp. ICM58]      50.1    2e-04
gb|EYU25022.1|  hypothetical protein MIMGU_mgv1a005268mg [Mimu...  50.1    2e-04
ref|XP_006348043.1|  PREDICTED: alpha-L-fucosidase 1-like [Sol...  50.1    2e-04
ref|WP_026809576.1|  alpha-1,3/4-fucosidase [Arenibacter later...  50.4    2e-04
gb|KFW72831.1|  Tissue alpha-L-fucosidase [Pygoscelis adeliae]     50.1    2e-04
gb|EZP54187.1|  F5/8 type C domain protein [Sphingomonas sp. R...  50.4    2e-04
gb|KFQ68229.1|  Tissue alpha-L-fucosidase [Phaethon lepturus]      50.1    2e-04
gb|KFP55966.1|  Tissue alpha-L-fucosidase [Cariama cristata]       50.1    2e-04
gb|KFV51285.1|  Tissue alpha-L-fucosidase [Gavia stellata]         50.1    2e-04
ref|WP_016268631.1|  hypothetical protein [Bacteroides thetaio...  50.1    2e-04
gb|KFW97396.1|  Tissue alpha-L-fucosidase [Phalacrocorax carbo]    50.1    2e-04
gb|KFQ74086.1|  Tissue alpha-L-fucosidase [Phoenicopterus rube...  50.1    2e-04
ref|WP_022470360.1|  putative lipoprotein [Bacteroides thetaio...  50.1    2e-04
ref|XP_004234270.1|  PREDICTED: alpha-L-fucosidase 1-like [Sol...  50.1    2e-04
ref|WP_027126186.1|  alpha-1,3/4-fucosidase [Gelidibacter meso...  50.4    2e-04
ref|WP_007810309.1|  alpha-L-fucosidase [Flavobacterium sp. CF...  50.1    2e-04
gb|KFV89505.1|  Tissue alpha-L-fucosidase [Fulmarus glacialis]     50.1    2e-04
ref|WP_020075689.1|  hypothetical protein [Cryocola sp. 340MFS...  50.1    2e-04
gb|KFM05515.1|  Tissue alpha-L-fucosidase [Aptenodytes forsteri]   50.1    2e-04
ref|WP_008763973.1|  MULTISPECIES: hypothetical protein [Bacte...  50.1    2e-04
ref|WP_008759716.1|  alpha-L-fucosidase 1 [Bacteroides sp. 1_1...  50.1    2e-04
gb|KFA69609.1|  hypothetical protein S40285_10765 [Stachybotry...  48.1    2e-04
gb|KFQ49218.1|  Tissue alpha-L-fucosidase [Pelecanus crispus]      50.1    2e-04
ref|XP_006409829.1|  hypothetical protein EUTSA_v10016468mg [E...  50.1    2e-04
ref|WP_028703334.1|  alpha-L-fucosidase [Propionibacterium jen...  50.1    2e-04
ref|XP_006409830.1|  hypothetical protein EUTSA_v10016468mg [E...  50.1    2e-04
gb|KEZ97643.1|  alpha-L-fucosidase [Xanthomonas vasicola pv. v...  50.1    2e-04
ref|XP_002322431.1|  hypothetical protein POPTR_0015s14140g [P...  50.1    2e-04
ref|WP_020871297.1|  alpha-L-fucosidase [Streptomyces rapamyci...  50.1    2e-04
gb|KFP98834.1|  Tissue alpha-L-fucosidase [Leptosomus discolor]    49.7    2e-04
ref|WP_026235742.1|  alpha-1,3/4-fucosidase [Echinicola pacifica]  50.1    2e-04
gb|AHZ48635.1|  alpha-L-fucosidase [Streptococcus sp. VT 162]      50.1    2e-04
gb|KFV07278.1|  Tissue alpha-L-fucosidase [Tauraco erythrolophus]  49.7    2e-04
ref|WP_009101958.1|  Glycoside hydrolase, family 29 [Rhodopire...  50.1    2e-04
emb|CDR09821.1|  glycoside hydrolase family 29 (alpha-L-fucosi...  50.1    2e-04
ref|WP_018518560.1|  MULTISPECIES: hypothetical protein [Strep...  50.1    2e-04
ref|WP_018103522.1|  MULTISPECIES: hypothetical protein [Strep...  50.1    2e-04
ref|WP_022831611.1|  hypothetical protein [Cytophagales str. B6]   49.7    2e-04
ref|WP_026727653.1|  alpha-L-fucosidase [Flavobacterium denitr...  50.1    2e-04
ref|WP_029221759.1|  alpha-L-fucosidase [Xanthomonas cassavae]     50.1    2e-04
ref|WP_009004633.1|  alpha-L-fucosidase 1 [Clostridium sp. D5]     50.1    2e-04
ref|WP_017169646.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   50.1    2e-04
gb|KCW90794.1|  hypothetical protein EUGRSUZ_A02861 [Eucalyptu...  50.1    2e-04
ref|WP_008571141.1|  alpha-L-fucosidase [Xanthomonas perforans]    49.7    2e-04
ref|WP_025839808.1|  alpha-L-fucosidase [Prevotella scopos]        50.1    2e-04
ref|WP_031078976.1|  hypothetical protein [Streptomyces sp. NR...  49.7    2e-04
ref|WP_009947928.1|  alpha-L-fucosidase [Saccharopolyspora ery...  50.1    2e-04
ref|WP_017165684.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   49.7    2e-04
ref|WP_009717901.1|  alpha-L-fucosidase [Streptomyces himastat...  50.1    2e-04
ref|WP_008571179.1|  alpha-L-fucosidase [Xanthomonas perforans]    49.7    2e-04
ref|WP_005802323.1|  hypothetical protein [Bacteroides fragilis]   49.7    2e-04
ref|WP_016903193.1|  alpha-L-fucosidase [Xanthomonas arboricola]   50.1    2e-04
ref|WP_026007130.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   49.7    2e-04
ref|XP_006294057.1|  hypothetical protein CARUB_v10023050mg [C...  49.7    2e-04
ref|WP_013073552.1|  lipoprotein [Zunongwangia profunda]           49.7    2e-04
ref|WP_021930254.1|  uncharacterized protein [Tannerella sp. C...  50.1    2e-04
ref|WP_025065375.1|  alpha-1,3/4-fucosidase [Prevotella enoeca]    50.1    2e-04
ref|WP_021584064.1|  alpha-L-fucosidase [Prevotella pleuritidis]   50.1    2e-04
ref|WP_002875295.1|  alpha-L-fucosidase [Streptococcus oralis]     49.7    2e-04
gb|KFR05780.1|  Tissue alpha-L-fucosidase [Opisthocomus hoazin]    49.7    2e-04
ref|WP_026210493.1|  alpha-1,3/4-fucosidase [Flexithrix doroth...  49.7    2e-04
pdb|3EYP|A  Chain A, Crystal Structure Of Putative Alpha-L-Fuc...  49.7    2e-04
ref|WP_022147243.1|  alpha-L-fucosidase-like [Bacteroides sp. ...  49.7    2e-04
ref|XP_008941483.1|  PREDICTED: tissue alpha-L-fucosidase [Mer...  49.3    2e-04
ref|XP_008376579.1|  PREDICTED: alpha-L-fucosidase 1-like [Mal...  49.7    2e-04
ref|WP_026249342.1|  alpha-L-fucosidase [Streptomyces sp. ATex...  49.7    2e-04
tpg|DAA62344.1|  TPA: hypothetical protein ZEAMMB73_488103 [Ze...  48.5    2e-04
ref|WP_030311105.1|  hypothetical protein [Streptomyces sp. NR...  49.7    2e-04
ref|WP_022365980.1|  putative uncharacterized protein [Firmicu...  49.7    2e-04
gb|EFE57717.1|  F5/8 type C domain protein [Streptococcus oral...  49.7    2e-04
ref|XP_001762481.1|  predicted protein [Physcomitrella patens]     49.7    2e-04
ref|WP_026636356.1|  alpha-L-fucosidase [Dyella japonica]          49.7    2e-04
ref|WP_005591620.1|  alpha-L-fucosidase [Streptococcus cristatus]  49.7    2e-04
gb|KCW90795.1|  hypothetical protein EUGRSUZ_A02862 [Eucalyptu...  49.7    2e-04
gb|EXC20875.1|  Alpha-L-fucosidase 1 [Morus notabilis]             49.7    2e-04
ref|WP_030588727.1|  alpha-L-fucosidase [Streptomyces rimosus]     49.7    2e-04
ref|WP_024938055.1|  alpha-L-fucosidase [Xanthomonas arboricola]   49.7    3e-04
ref|WP_008996043.1|  alpha-L-fucosidase [Novosphingobium sp. R...  49.7    3e-04
ref|WP_021980237.1|  f5/8 type C domain protein [Paraprevotell...  49.7    3e-04
ref|WP_030324775.1|  glycosyl hydrolase [Streptomyces sp. NRRL...  49.7    3e-04
ref|XP_002510887.1|  alpha-l-fucosidase, putative [Ricinus com...  49.3    3e-04
ref|WP_003470874.1|  Alpha-L-fucosidase [Xanthomonas translucens]  49.7    3e-04
ref|WP_015605850.1|  alpha-L-fucosidase [Streptococcus oligofe...  49.7    3e-04
ref|WP_013663964.1|  alpha-L-fucosidase [Sphingobacterium sp. 21]  49.7    3e-04
gb|EFM34801.1|  F5/8 type C domain protein [Streptococcus sp. ...  49.3    3e-04
ref|WP_008240227.1|  carbohydrate-binding protein [Pedobacter ...  49.3    3e-04
gb|KEQ44438.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  49.3    3e-04
ref|WP_030375100.1|  alpha-L-fucosidase [Streptomyces rimosus]     49.3    3e-04
ref|XP_004308143.1|  PREDICTED: alpha-L-fucosidase 1-like [Fra...  49.3    3e-04
ref|WP_008564857.1|  alpha-L-fucosidase [Prevotella maculosa]      49.3    3e-04
ref|XP_007038506.1|  Alpha-L-fucosidase 1 [Theobroma cacao]        49.3    3e-04
ref|WP_004609663.1|  hypothetical protein [ [[Clostridium] spi...  48.9    3e-04
ref|WP_031189002.1|  alpha-L-fucosidase [Streptomyces peucetius]   49.3    3e-04
ref|WP_030631225.1|  alpha-L-fucosidase [Streptomyces rimosus]     49.3    3e-04
ref|WP_026473605.1|  hypothetical protein [Alkaliflexus imshen...  49.3    3e-04
ref|WP_030082154.1|  alpha-L-fucosidase [Streptomyces decoyicus]   49.3    3e-04
gb|KEQ35224.1|  LPXTG-motif cell wall anchor domain protein [S...  49.7    3e-04
ref|WP_030984329.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  49.3    3e-04
ref|WP_016644991.1|  putative Alpha-L-fucosidase 1 [Streptomyc...  49.3    3e-04
ref|WP_004847548.1|  hypothetical protein [ [[Ruminococcus] to...  49.3    3e-04
ref|WP_009255668.1|  MULTISPECIES: hypothetical protein [Clost...  48.9    3e-04
ref|WP_004269896.1|  cell wall surface anchor family protein [...  49.7    3e-04
ref|WP_024492486.1|  alpha-L-fucosidase [Streptomyces sp. AW19...  49.3    3e-04
ref|WP_004371903.1|  alpha-L-fucosidase [Prevotella oris]          49.3    3e-04
ref|WP_025078200.1|  carbohydrate-binding protein [Prevotella ...  49.3    3e-04
ref|WP_030644036.1|  alpha-L-fucosidase [Streptomyces rimosus]     49.3    3e-04
ref|XP_002024012.1|  GL22821 [Drosophila persimilis]               48.9    3e-04
ref|WP_004614906.1|  hypothetical protein [Clostridium nexile]     49.3    4e-04
ref|WP_013670294.1|  alpha-L-fucosidase [Streptococcus oralis]     49.3    4e-04
gb|KEQ46964.1|  LPXTG-motif cell wall anchor domain protein [S...  49.3    4e-04
ref|WP_023959001.1|  alpha-L-fucosidase [Paenibacillus sp. JCM...  48.9    4e-04
ref|XP_003597267.1|  Alpha-L-fucosidase [Medicago truncatula]      48.9    4e-04
gb|EFX58833.1|  LPXTG-motif cell wall anchor domain protein [S...  49.3    4e-04
ref|WP_009243131.1|  hypothetical protein [Lachnospiraceae bac...  49.3    4e-04
ref|WP_030434446.1|  alpha-L-fucosidase [Actinoplanes sp. RP-A...  49.3    4e-04
gb|KFV75100.1|  Tissue alpha-L-fucosidase [Picoides pubescens]     48.9    4e-04
ref|WP_025170434.1|  alpha-L-fucosidase [Streptococcus sp. BS35b]  48.9    4e-04
gb|EJO20980.1|  alpha-L-fucosidase [Streptococcus sp. BS35b]       48.9    4e-04
ref|WP_008620613.1|  carbohydrate-binding protein [Paraprevote...  48.9    4e-04
ref|WP_026055281.1|  alpha-L-fucosidase [Anaerophaga thermohal...  48.9    4e-04
gb|EID25435.1|  alpha-L-fucosidase [Streptococcus oralis SK1074]   48.9    4e-04
gb|ETS91074.1|  alpha-L-fucosidase [Streptococcus sp. BS29a]       48.9    4e-04
ref|WP_022285715.1|  f5/8 type C domain protein [Bacteroides s...  48.9    4e-04
ref|WP_010406762.1|  alpha-L-fucosidase [Sphingomonas echinoides]  48.9    4e-04
ref|WP_004337605.1|  alpha-L-fucosidase [Prevotella bivia]         48.9    4e-04
ref|WP_025171866.1|  alpha-L-fucosidase [Streptococcus oralis]     48.9    4e-04
ref|WP_022003270.1|  lPXTG-motif cell wall anchor domain prote...  49.3    4e-04
ref|WP_026631717.1|  alpha-L-fucosidase [Dyadobacter alkalitol...  48.9    4e-04
ref|WP_013994944.1|  glycoside hydrolase [Zobellia galactanivo...  48.9    4e-04
ref|WP_009095292.1|  alpha-L-fucosidase [Rhodopirellula sp. SWK7]  48.9    4e-04
gb|KEQ33995.1|  LPXTG-motif cell wall anchor domain protein [S...  49.3    4e-04
ref|WP_015881945.1|  alpha-L-fucosidase [Beutenbergia cavernae]    48.9    4e-04
gb|AIE84535.1|  glycoside hydrolase family 29 (alpha-L- fucosi...  48.5    4e-04
gb|AHI53015.1|  alpha-L-fucosidase [Spiroplasma culicicola AES-1]  48.9    4e-04
ref|NP_001151568.1|  alpha-L-fucosidase 1 precursor [Zea mays]     48.9    4e-04
gb|ACR35251.1|  unknown [Zea mays]                                 48.9    4e-04
gb|EPR94856.1|  alpha-L-fucosidase [Streptococcus mitis 18/56]     49.3    4e-04
ref|WP_029693048.1|  alpha-L-fucosidase [Streptococcus sp. M334]   48.9    4e-04
ref|WP_031237736.1|  alpha-L-fucosidase [Streptococcus mitis]      48.9    5e-04
ref|WP_017113030.1|  alpha-L-fucosidase [Xanthomonas campestris]   48.9    5e-04
ref|WP_008467422.1|  alpha-L-fucosidase [Flavobacterium sp. F52]   48.9    5e-04
ref|WP_006354399.1|  hypothetical protein [ [Clostridium methy...  48.9    5e-04
ref|WP_010527333.1|  alpha-L-fucosidase [Anaerophaga sp. HS1]      48.9    5e-04
ref|XP_006424472.1|  hypothetical protein CICLE_v10028210mg [C...  48.5    5e-04
ref|WP_017118152.1|  alpha-L-fucosidase [Xanthomonas vasicola]     48.9    5e-04
ref|WP_017117500.1|  alpha-L-fucosidase [Xanthomonas vasicola]     48.9    5e-04
ref|WP_017116717.1|  alpha-L-fucosidase [Xanthomonas vasicola]     48.9    5e-04
ref|WP_020392368.1|  hypothetical protein [Kribbella catacumbae]   48.9    5e-04
ref|WP_003479220.1|  alpha-L-fucosidase [Xanthomonas translucens]  48.9    5e-04
ref|WP_018841577.1|  MULTISPECIES: hypothetical protein [Strep...  48.9    5e-04
ref|WP_018834245.1|  hypothetical protein [Streptomyces sp. CN...  48.9    5e-04
ref|WP_010365929.1|  alpha-L-fucosidase [Xanthomonas vasicola]     48.9    5e-04
ref|WP_011346801.1|  alpha-L-fucosidase [Xanthomonas euvesicat...  48.9    5e-04
emb|CAH68057.1|  B0103C08-B0602B01.14 [Oryza sativa Indica Group]  48.5    5e-04
ref|WP_009729606.1|  hypothetical protein [Streptococcus sp. F...  48.5    5e-04
ref|XP_004309253.1|  PREDICTED: alpha-L-fucosidase 1-like [Fra...  48.5    5e-04
ref|WP_022012273.1|  f5/8 type C domain protein [Bacteroides f...  48.9    5e-04
ref|WP_016277058.1|  hypothetical protein [Bacteroides massili...  48.5    5e-04
ref|XP_006019450.1|  PREDICTED: tissue alpha-L-fucosidase [All...  48.5    5e-04
gb|KER56817.1|  alpha-1,3/4-fucosidase [Bacteroides fragilis]      48.9    5e-04
gb|AIA84401.1|  alpha_L_fucos [uncultured Bacteroides sp.]         47.0    5e-04
ref|XP_004976488.1|  PREDICTED: putative alpha-L-fucosidase 1-...  48.5    5e-04
gb|EFA25265.1|  F5/8 type C domain protein [Streptococcus sp. ...  48.5    5e-04
ref|XP_006424473.1|  hypothetical protein CICLE_v10028210mg [C...  48.5    5e-04
ref|WP_029013070.1|  alpha-L-fucosidase [Azospirillum irakense]    48.5    6e-04
ref|WP_025168364.1|  alpha-L-fucosidase [Streptococcus sp. M143]   48.5    6e-04
ref|WP_005610279.1|  hypothetical protein [Ruminococcus lactaris]  48.9    6e-04
ref|WP_012445269.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    6e-04
ref|WP_027741897.1|  alpha-L-fucosidase [Streptomyces sp. CNT371]  48.5    6e-04
ref|XP_006488025.1|  PREDICTED: alpha-L-fucosidase 1-like [Cit...  48.5    6e-04
gb|KER86725.1|  alpha-L-fucosidase [Xanthomonas arboricola pv....  48.5    6e-04
ref|WP_029828411.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.5    6e-04
ref|WP_005921492.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.5    6e-04
ref|WP_005931098.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.5    6e-04
ref|WP_031455820.1|  alpha-L-fucosidase [Flavobacterium chunga...  48.5    6e-04
ref|WP_004068884.1|  hypothetical protein [Clostridium sp. ASF...  46.2    6e-04
gb|KER89215.1|  alpha-L-fucosidase [Xanthomonas axonopodis pv....  48.5    6e-04
gb|KDO60247.1|  hypothetical protein CISIN_1g047217mg [Citrus ...  48.1    6e-04
ref|WP_011050833.1|  MULTISPECIES: alpha-L-fucosidase [Xanthom...  48.5    6e-04
ref|WP_015472380.1|  Alpha-L-fucosidase [Xanthomonas citri]        48.5    6e-04
gb|EUC82145.1|  alpha-L-fucosidase [Streptococcus sp. CM6]         48.5    6e-04
ref|WP_019302396.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    6e-04
ref|WP_019068293.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  48.5    6e-04
ref|WP_024710232.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    6e-04
gb|EGV02016.1|  alpha-L-fucosidase [Streptococcus oralis SK313]    48.5    6e-04
ref|WP_025169582.1|  alpha-L-fucosidase [Streptococcus oralis]     48.5    6e-04
ref|WP_014298241.1|  hypothetical protein [Bacteroides fragilis]   48.5    6e-04
ref|WP_004377646.1|  alpha-L-fucosidase [Prevotella oris]          48.5    6e-04
ref|WP_003982446.1|  MULTISPECIES: glycoside hydrolase [Strept...  48.5    6e-04
ref|WP_005801438.1|  hypothetical protein [Bacteroides fragilis]   48.5    6e-04
ref|WP_005991921.1|  alpha-L-fucosidase [Xanthomonas vesicatoria]  48.5    6e-04
ref|WP_011258585.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    6e-04
ref|WP_029818954.1|  alpha-L-fucosidase [Xanthomonas alfalfae]     48.5    6e-04
ref|WP_029669134.1|  alpha-L-fucosidase [Caulobacter sp. JGI 0...  46.2    6e-04
ref|WP_021825088.1|  F5/8 type C domain protein [Prevotella sa...  48.5    7e-04
ref|WP_014504039.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    7e-04
ref|WP_024743889.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.5    7e-04
ref|WP_009133219.1|  hypothetical protein [Alistipes indistinc...  48.1    7e-04
ref|WP_030598266.1|  alpha-1,3/4-fucosidase [Streptomyces fulv...  48.1    7e-04
ref|WP_018384379.1|  hypothetical protein [Streptomyces vitami...  48.5    7e-04
ref|WP_005784787.1|  MULTISPECIES: hypothetical protein [Bacte...  48.1    7e-04
gb|AHF90974.1|  glycoside hydrolase family 29 [Opitutaceae bac...  48.1    7e-04
ref|WP_030667783.1|  alpha-L-fucosidase [Streptomyces rimosus]     48.5    7e-04
ref|XP_008234333.1|  PREDICTED: alpha-L-fucosidase 1-like [Pru...  48.1    7e-04
ref|WP_005796258.1|  hypothetical protein [Bacteroides fragilis]   48.1    7e-04
gb|EXY66882.1|  putative lipoprotein [Bacteroides fragilis str...  48.1    7e-04
ref|WP_008658513.1|  hypothetical protein [Bacteroides sp. 3_2_5]  48.1    7e-04
ref|WP_008280219.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  48.1    7e-04
ref|XP_008234481.1|  PREDICTED: alpha-L-fucosidase 1-like [Pru...  48.1    7e-04
ref|WP_031421771.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.1    7e-04
ref|WP_005918384.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.1    7e-04
ref|WP_008769406.1|  hypothetical protein [Bacteroides sp. 2_1...  48.1    7e-04
ref|WP_007970969.1|  alpha-L-fucosidase [Xanthomonas fuscans]      48.1    7e-04
ref|WP_027703332.1|  alpha-L-fucosidase [Xanthomonas oryzae]       48.1    7e-04
ref|WP_000161453.1|  alpha-L-fucosidase [Streptococcus oralis]     48.1    7e-04
ref|WP_017155582.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.1    7e-04
ref|XP_007219615.1|  hypothetical protein PRUPE_ppa023537mg [P...  48.1    7e-04
ref|WP_007967433.1|  alpha-L-fucosidase [Xanthomonas fuscans]      48.1    7e-04
ref|WP_004614911.1|  hypothetical protein [Clostridium nexile]     48.5    7e-04
ref|WP_023920839.1|  hypothetical protein [Ruminococcus lactaris]  48.5    7e-04
ref|WP_007135674.1|  alpha-L-fucosidase [Prevotella salivae]       48.1    7e-04
ref|WP_017163584.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   48.1    7e-04
ref|WP_004353592.1|  alpha-L-fucosidase [Prevotella denticola]     48.1    7e-04
ref|WP_012419894.1|  coagulation factor 5/8 type domain-contai...  48.1    7e-04
ref|WP_022251023.1|  putative uncharacterized protein [Clostri...  48.5    8e-04
gb|EXZ11308.1|  putative lipoprotein [Bacteroides fragilis str...  48.1    8e-04
ref|WP_014089674.1|  alpha-L-fucosidase [Xanthomonas alfalfae]     48.1    8e-04
ref|WP_022197748.1|  coagulation factor 5/8 type domain protei...  48.1    8e-04
ref|WP_008574322.1|  alpha-L-fucosidase [Xanthomonas perforans]    48.1    8e-04
ref|WP_021670626.1|  f5/8 type C domain protein [Prevotella sp...  48.1    8e-04
ref|XP_002318264.2|  hypothetical protein POPTR_0012s14150g [P...  48.1    8e-04
ref|WP_022144356.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  48.1    8e-04
gb|KFF03556.1|  alpha-L-fucosidase [Flavobacterium reichenbachii]  48.1    8e-04
ref|WP_029693188.1|  alpha-L-fucosidase [Streptococcus sp. SK643]  48.1    8e-04
ref|WP_025172367.1|  alpha-L-fucosidase [Streptococcus oralis]     48.1    8e-04
gb|EJP19294.1|  alpha-L-fucosidase [Streptococcus oralis SK304]    48.1    8e-04
gb|EGR93120.1|  alpha-L-fucosidase [Streptococcus mitis bv. 2 ...  48.1    8e-04
ref|WP_013671766.1|  alpha-L-fucosidase [Prevotella denticola]     48.1    8e-04
ref|WP_022251024.1|  putative uncharacterized protein [Clostri...  48.1    8e-04
ref|WP_010357215.1|  hypothetical protein [Streptomyces acidis...  48.1    8e-04
ref|WP_030613571.1|  alpha-L-fucosidase [Streptomyces scleroti...  48.1    8e-04
ref|WP_018919357.1|  alpha-L-fucosidase [Prevotella oris]          48.1    8e-04
ref|WP_027770145.1|  alpha-L-fucosidase [Streptomyces sp. CNQ329]  48.1    8e-04
ref|WP_025168982.1|  alpha-L-fucosidase [Streptococcus mitis]      48.1    8e-04
ref|WP_007362049.1|  glycoside hydrolase family 29 [Opitutacea...  47.8    9e-04
gb|EFU64233.1|  Gram-positive signal peptide protein, YSIRK fa...  48.1    9e-04
gb|KFC39712.1|  alpha-L-fucosidase [Elizabethkingia meningosep...  48.1    9e-04
ref|WP_029985615.1|  alpha-1,3/4-fucosidase [Sphingobacterium ...  48.1    9e-04
ref|WP_001083126.1|  alpha-L-fucosidase [Streptococcus sp. ora...  48.1    0.001
ref|WP_025068195.1|  alpha-L-fucosidase [Prevotella denticola]     47.8    0.001
gb|AHF11782.1|  alpha-L-fucosidase [Barnesiella viscericola DS...  47.8    0.001
ref|WP_014020226.1|  coagulation factor 5/8 type domain-contai...  48.1    0.001
ref|WP_029712635.1|  hypothetical protein [candidate division ...  47.8    0.001
ref|WP_025076757.1|  hypothetical protein [Bacteroides sartorii]   47.8    0.001
ref|WP_008822195.1|  alpha-L-fucosidase [Prevotella histicola]     47.8    0.001
gb|EIF36202.1|  alpha-L-fucosidase [Streptococcus sp. SK643]       48.1    0.001
ref|XP_004487063.1|  PREDICTED: alpha-L-fucosidase 1-like [Cic...  47.8    0.001
gb|EGL89623.1|  alpha-L-fucosidase [Streptococcus oralis SK255]    47.8    0.001
ref|WP_025791576.1|  alpha-L-fucosidase [Prevotella histicola]     47.8    0.001
ref|WP_009444351.1|  alpha-L-fucosidase [Streptococcus sp. ora...  47.8    0.001
ref|WP_000325171.1|  hypothetical protein [Streptococcus sp. G...  47.0    0.001
ref|WP_031001832.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  47.8    0.001
ref|WP_020710215.1|  hypothetical protein [Acidobacteriaceae b...  47.8    0.001
ref|WP_030020580.1|  alpha-L-fucosidase [Streptomyces monomycini]  47.8    0.001
ref|WP_001083120.1|  alpha-L-fucosidase [Streptococcus oralis]     47.8    0.001
gb|KEQ51034.1|  hypothetical protein SK143_0192 [Streptococcus...  47.8    0.001
ref|WP_001083117.1|  alpha-L-fucosidase [Streptococcus oralis]     47.8    0.001
ref|WP_001083124.1|  alpha-L-fucosidase [Streptococcus sp. GMD5S]  47.8    0.001
ref|WP_020992726.1|  hypothetical protein [Streptococcus sp. 2...  47.8    0.001
ref|WP_025831707.1|  alpha-L-fucosidase 1 [Bacteroides rodentium]  47.4    0.001
ref|WP_011683166.1|  coagulation factor 5/8 type domain-contai...  47.4    0.001
ref|WP_027067584.1|  alpha-1,3/4-fucosidase [Maribacter sp. He...  47.8    0.001
gb|EFA25510.1|  G5 domain protein [Streptococcus sp. M143]         47.8    0.001
ref|WP_025074053.1|  alpha-L-fucosidase 1 [Bacteroides faecich...  47.4    0.001
ref|XP_002975403.1|  hypothetical protein SELMODRAFT_415432 [S...  47.4    0.001
ref|WP_001083118.1|  alpha-L-fucosidase [Streptococcus oralis]     47.8    0.001
ref|WP_001083125.1|  alpha-L-fucosidase [Streptococcus oralis]     47.8    0.001
ref|WP_031036417.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  47.4    0.001
ref|WP_031469704.1|  hypothetical protein [Sciscionella sp. SE31]  47.4    0.001
ref|WP_023933796.1|  alpha-L-fucosidase [Streptococcus pseudop...  47.4    0.001
gb|KER82385.1|  alpha-L-fucosidase [Xanthomonas arboricola pv....  47.4    0.001
ref|WP_001083119.1|  alpha-L-fucosidase [Streptococcus oralis]     47.8    0.001
gb|EIC76168.1|  alpha-L-fucosidase [Streptococcus oralis SK610]    47.4    0.001
ref|WP_025170979.1|  alpha-L-fucosidase [Streptococcus oralis]     47.4    0.001
ref|WP_009013732.1|  alpha-L-fucosidase 1 [Streptococcus sp. C...  47.4    0.001
ref|WP_001083123.1|  hypothetical protein [Streptococcus sp. G...  47.4    0.001
ref|WP_006377608.1|  Tat pathway signal sequence domain protei...  47.4    0.001
gb|EXY61842.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.001
ref|WP_028038672.1|  alpha-L-fucosidase [Caulobacter sp. URHA0...  47.4    0.001
gb|EXY71572.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.001
ref|WP_025998130.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   47.4    0.001
ref|WP_010546300.1|  alpha-L-fucosidase [Sphingomonas elodea]      47.4    0.001
ref|WP_025984072.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   47.0    0.002
gb|EXY47727.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.002
gb|EXY42344.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.002
ref|WP_020644048.1|  alpha-L-fucosidase [Amycolatopsis balhimy...  47.4    0.002
ref|WP_028658169.1|  alpha-L-fucosidase [Novosphingobium sp. B-7]  47.4    0.002
gb|AAS19690.1|  FucA [Streptococcus gordonii]                      47.4    0.002
gb|EXY14584.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.002
ref|WP_031328354.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   47.0    0.002
gb|EXZ90594.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.002
gb|EXY92283.1|  putative lipoprotein [Bacteroides fragilis str...  47.4    0.002
ref|WP_017169015.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   47.0    0.002
ref|WP_007386361.1|  alpha-1,3/4-fucosidase [Streptomyces svic...  47.4    0.002
ref|WP_013991731.1|  alpha-L-fucosidase [Zobellia galactanivor...  47.4    0.002
gb|EWG13929.1|  Alpha-L-fucosidase [Xylella fastidiosa Mul-MD]     47.0    0.002
ref|WP_022101505.1|  putative uncharacterized protein [Prevote...  47.4    0.002
ref|WP_019057553.1|  alpha-1,3/4-fucosidase [Streptomyces prun...  47.4    0.002
gb|EXZ06878.1|  putative lipoprotein [Bacteroides fragilis str...  47.0    0.002
ref|WP_017166472.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   47.0    0.002
ref|WP_009013597.1|  alpha-L-fucosidase [Streptococcus sp. C300]   47.4    0.002
ref|WP_012130807.1|  alpha-L-fucosidase [Streptococcus gordonii]   47.0    0.002
gb|EXY86175.1|  putative lipoprotein [Bacteroides fragilis str...  47.0    0.002
ref|WP_004085544.1|  alpha-L-fucosidase [Xylella fastidiosa]       47.0    0.002
ref|WP_001083112.1|  hypothetical protein [Streptococcus oralis]   47.4    0.002
ref|WP_010892652.1|  alpha-L-fucosidase [Xylella fastidiosa]       47.0    0.002
ref|WP_030450020.1|  hypothetical protein [Actinocatenispora s...  47.4    0.002
ref|WP_006721740.1|  hypothetical protein [Collinsella stercoris]  47.4    0.002
gb|EIC77561.1|  alpha-L-fucosidase [Streptococcus oralis SK100]    47.0    0.002
ref|XP_002971704.1|  hypothetical protein SELMODRAFT_412246 [S...  47.0    0.002
gb|EUC79833.1|  alpha-L-fucosidase [Streptococcus sp. SR1]         47.0    0.002
ref|WP_025171523.1|  alpha-L-fucosidase [Streptococcus oralis]     47.0    0.002
ref|WP_003488255.1|  alpha-L-fucosidase [Xanthomonas citri]        47.0    0.002
ref|WP_018851210.1|  hypothetical protein [Streptomyces sp. CN...  47.0    0.002
ref|XP_003709498.1|  alpha-L-fucosidase 1 [Magnaporthe oryzae ...  47.0    0.002
ref|WP_004844386.1|  hypothetical protein [ [[Ruminococcus] gn...  47.4    0.002
ref|WP_029708927.1|  alpha-L-fucosidase [Streptococcus sp. GMD3S]  47.0    0.002
ref|WP_019848539.1|  hypothetical protein [Caulobacter sp. JGI...  47.0    0.002
ref|WP_009244507.1|  MULTISPECIES: hypothetical protein [Lachn...  47.4    0.002
ref|WP_000251210.1|  alpha-L-fucosidase [Streptococcus pseudop...  47.0    0.002
ref|WP_001083113.1|  alpha-L-fucosidase [Streptococcus mitis]      47.4    0.002
ref|WP_031441979.1|  glycoside hydrolase family 29 [Arenibacte...  47.0    0.002
ref|WP_013042230.1|  glycoside hydrolase [Coraliomargarita aka...  46.6    0.002
ref|WP_025490402.1|  hypothetical protein [Clostridiales bacte...  47.0    0.002
ref|WP_029707271.1|  alpha-L-fucosidase [Streptococcus oralis]     47.0    0.002
ref|WP_025069718.1|  alpha-L-fucosidase [Prevotella oulorum]       47.0    0.002
ref|WP_020116900.1|  alpha-1,3/4-fucosidase [Streptomyces canus]   47.0    0.002
ref|WP_004380571.1|  alpha-L-fucosidase [Prevotella oulorum]       47.0    0.002
ref|WP_013991727.1|  alpha-L-fucosidase [Zobellia galactanivor...  46.6    0.002
gb|EGV12077.1|  alpha-L-fucosidase [Streptococcus infantis X]      47.0    0.002
ref|WP_028376556.1|  glycoside hydrolase family 29 [Leeuwenhoe...  46.6    0.002
dbj|GAF01926.1|  alpha-L-fucosidase [Cytophaga fermentans DSM ...  46.6    0.002
ref|WP_019369995.1|  alpha-L-fucosidase [Sphingomonas sp. ATCC...  46.6    0.002
gb|EIG39935.1|  alpha-L-fucosidase [Streptococcus infantis ATC...  47.0    0.002
ref|WP_020851798.1|  Coagulation factor 5/8 type, C-terminal [...  46.6    0.002
ref|WP_000962542.1|  hypothetical protein [Streptococcus sp. G...  46.6    0.002
ref|WP_004087646.1|  alpha-L-fucosidase [Xylella fastidiosa]       46.6    0.002
ref|WP_028899882.1|  alpha-L-fucosidase [Prevotella sp. HJM029]    46.6    0.002
gb|EFX35941.1|  Gram-positive signal peptide protein, YSIRK fa...  47.0    0.003
ref|WP_007518047.1|  alpha-L-fucosidase [Streptococcus tigurinus]  46.6    0.003
ref|WP_013223431.1|  alpha-L-fucosidase [Amycolatopsis mediter...  46.6    0.003
ref|WP_028729830.1|  hypothetical protein [Parabacteroides gor...  46.6    0.003
gb|EGV02451.1|  alpha-L-fucosidase [Streptococcus oralis SK313]    46.6    0.003
ref|WP_030127779.1|  alpha-L-fucosidase [Streptococcus pyogenes]   45.8    0.003
gb|EYA40663.1|  putative lipoprotein [Bacteroides fragilis str...  46.6    0.003
ref|WP_023453803.1|  hypothetical protein [Asticcacaulis sp. A...  46.6    0.003
ref|WP_030674179.1|  alpha-1,3/4-fucosidase [Streptomyces cell...  46.6    0.003
ref|WP_030412153.1|  hypothetical protein [Streptomyces sp. NR...  45.8    0.003
ref|WP_023941539.1|  alpha-L-fucosidase [Streptococcus pseudop...  46.6    0.003
ref|WP_003481903.1|  calx-beta domain-containing protein [Clos...  46.6    0.003
ref|WP_023937422.1|  alpha-L-fucosidase [Streptococcus pseudop...  46.6    0.003
ref|WP_009320136.1|  hypothetical protein [Lachnospiraceae bac...  46.6    0.003
ref|WP_009243676.1|  hypothetical protein [Lachnospiraceae bac...  46.6    0.003
ref|WP_030936726.1|  alpha-1,3/4-fucosidase [Streptomyces viol...  46.2    0.003
ref|WP_019026090.1|  hypothetical protein [Colwellia piezophila]   45.1    0.003
ref|WP_007333018.1|  alpha-L-fucosidase 1 [Rhodopirellula balt...  46.2    0.003
ref|WP_009321504.1|  hypothetical protein [Lachnospiraceae bac...  46.6    0.003
ref|WP_022559798.1|  putative alpha-L-fucosidase [Xanthomonas ...  46.2    0.003
gb|ACG47369.1|  alpha-L-fucosidase 1 precursor [Zea mays]          46.2    0.003
ref|NP_001131532.1|  alpha-L-fucosidase 1 precursor [Zea mays]     46.2    0.003
ref|WP_024854348.1|  hypothetical protein [ [[Ruminococcus] gn...  46.6    0.003
ref|WP_021967848.1|  putative lipoprotein [Bacteroides intesti...  46.2    0.003
gb|KDP22366.1|  hypothetical protein JCGZ_26197 [Jatropha curcas]  46.2    0.003
ref|WP_030664180.1|  hypothetical protein [Streptomyces rimosus]   46.2    0.003
ref|WP_001083111.1|  alpha-L-fucosidase [Streptococcus mitis]      46.2    0.003
gb|EGV03550.1|  alpha-L-fucosidase [Streptococcus infantis SK970]  46.2    0.003
ref|WP_028296158.1|  alpha-L-fucosidase [Olivibacter sitiensis]    46.2    0.004
ref|WP_009010394.1|  carbohydrate-binding protein [Prevotella ...  46.2    0.004
gb|EXZ21929.1|  putative lipoprotein [Bacteroides fragilis str...  46.2    0.004
gb|ELT93253.1|  hypothetical protein CAPTEDRAFT_215135 [Capite...  45.4    0.004
ref|WP_023459332.1|  hypothetical protein [Asticcacaulis sp. A...  46.2    0.004
ref|WP_011592731.1|  FucA [Clostridium perfringens]                46.2    0.004
ref|WP_024568721.1|  alpha-L-fucosidase [Elizabethkingia anoph...  46.2    0.004
ref|WP_022689309.1|  alpha-L-fucosidase [Sphingomonas-like bac...  46.2    0.004
ref|WP_022081097.1|  alpha-L-fucosidase [Ruminococcus sp. CAG:...  46.2    0.004
ref|WP_007520898.1|  alpha-L-fucosidase [Streptococcus tigurinus]  46.2    0.004
gb|EPX89814.1|  alpha-L-fucosidase [Streptococcus tigurinus 2425]  46.2    0.004
ref|XP_004995324.1|  hypothetical protein PTSG_03594 [Salpingo...  46.2    0.004
gb|EXY52505.1|  putative lipoprotein [Bacteroides fragilis str...  46.2    0.004
ref|WP_024020248.1|  alpha-L-fucosidase [Sphingobium sp. C100]     46.2    0.004
ref|WP_001083115.1|  hypothetical protein [Streptococcus sp. G...  46.2    0.004
ref|WP_025168422.1|  alpha-L-fucosidase [Streptococcus mitis]      46.2    0.004
ref|WP_023545052.1|  alpha-1,3/4-fucosidase [Streptomyces rose...  45.8    0.004
gb|EGU70314.1|  alpha-L-fucosidase [Streptococcus mitis SK569]     46.2    0.004
gb|AHH94740.1|  alpha-1,3/4-fucosidase [Kutzneria albida DSM 4...  45.8    0.004
ref|WP_030111642.1|  hypothetical protein [Kutzneria albida]       45.8    0.004
ref|WP_029689884.1|  alpha-L-fucosidase [Streptococcus infantis]   45.8    0.004
ref|WP_029689697.1|  alpha-L-fucosidase [Streptococcus infantis]   45.8    0.004
ref|WP_021848443.1|  f5/8 type C domain protein [Bacteroides s...  45.8    0.004
ref|WP_009730654.1|  YSIRK family Gram-positive signal peptide...  46.2    0.004
ref|WP_003463493.1|  calx-beta domain protein [Clostridium per...  46.2    0.004
ref|XP_008812847.1|  PREDICTED: alpha-L-fucosidase 1-like [Pho...  45.8    0.004
ref|WP_024566008.1|  alpha-L-fucosidase [Elizabethkingia anoph...  45.8    0.004
gb|EGU62006.1|  hypothetical protein HMPREF9965_0233 [Streptoc...  45.8    0.004
gb|AIL47158.1|  Alpha-L-fucosidase [Elizabethkingia anophelis ...  45.8    0.004
ref|WP_008685509.1|  Glycoside hydrolase, family 29 [Rhodopire...  45.8    0.004
ref|WP_008642554.1|  hypothetical protein [Bacteroides sp. 1_1...  45.4    0.004
ref|WP_026063106.1|  glycoside hydrolase family 29 [Pedobacter...  45.8    0.005
ref|WP_022479489.1|  putative uncharacterized protein [Prevote...  45.8    0.005
ref|WP_018754168.1|  hypothetical protein [Paenibacillus terri...  45.8    0.005
ref|WP_009086348.1|  MULTISPECIES: alpha-L-fucosidase [Elizabe...  45.8    0.005
gb|EFM32274.1|  hypothetical protein HMPREF8571_0230 [Streptoc...  45.8    0.005
ref|WP_013569166.1|  coagulation factor 5/8 type domain-contai...  45.8    0.005
ref|WP_005775433.1|  hypothetical protein [Bacteroides fragilis]   45.8    0.005
ref|WP_001083121.1|  alpha-L-fucosidase [Streptococcus oralis]     45.8    0.005
ref|WP_001083110.1|  alpha-L-fucosidase [Streptococcus sp. BS35b]  45.8    0.005
ref|XP_002448322.1|  hypothetical protein SORBIDRAFT_06g025200...  45.8    0.005
ref|WP_005810512.1|  MULTISPECIES: hypothetical protein [Bacte...  45.8    0.005
ref|WP_009058423.1|  alpha-L-fucosidase [Atopobium sp. ICM58]      45.8    0.005
ref|WP_001083127.1|  alpha-L-fucosidase [Streptococcus oralis]     45.8    0.005
gb|EWS77658.1|  alpha-L-fucosidase [Xylella fastidiosa PLS229]     45.8    0.005
ref|WP_029689768.1|  alpha-L-fucosidase [Streptococcus infantis]   45.4    0.005
ref|WP_021874662.1|  Putative uncharacterized protein (fragmen...  45.8    0.005
gb|EWM18794.1|  alpha-L-fucosidase 1 [Kutzneria sp. 744]           45.8    0.005
gb|KER07732.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  45.4    0.005
ref|WP_023391147.1|  hypothetical protein [Abiotrophia defectiva]  45.4    0.005
ref|WP_030333651.1|  hypothetical protein [Micromonospora parva]   45.4    0.005
ref|WP_031233091.1|  alpha-L-fucosidase [Streptococcus mitis]      45.4    0.006
ref|WP_004255399.1|  alpha-L-fucosidase [Streptococcus mitis]      45.4    0.006
ref|WP_002999631.1|  alpha-L-fucosidase [Sphingobacterium spir...  45.4    0.006
gb|EZP50841.1|  Alpha-L-fucosidase family protein [Sphingomona...  45.4    0.006
ref|WP_009444053.1|  signal peptide protein, YSIRK family [Str...  45.8    0.006
ref|WP_017159465.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   45.4    0.006
ref|WP_000251212.1|  alpha-L-fucosidase [Streptococcus mitis]      45.4    0.006
ref|WP_017164570.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   45.4    0.006
ref|WP_020702828.1|  hypothetical protein [Oxalobacteraceae ba...  45.4    0.006
gb|ETI92066.1|  Alpha-L-fucosidase 1 protein [Streptococcus sp...  45.4    0.006
ref|WP_029689980.1|  alpha-L-fucosidase [Streptococcus mitis]      45.4    0.006
ref|WP_017162284.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   45.4    0.006
ref|WP_017164070.1|  alpha-L-fucosidase [Xanthomonas axonopodis]   45.4    0.006
gb|ETJ06354.1|  Alpha-L-fucosidase [Streptococcus parasanguini...  45.4    0.006
ref|WP_023947342.1|  alpha-L-fucosidase [Streptococcus mitis]      45.4    0.007
ref|WP_029694759.1|  alpha-L-fucosidase [Streptococcus sp. SK140]  45.4    0.007
gb|KEQ32512.1|  Alpha-Fucosidase [Streptococcus mitis]             45.4    0.007
ref|WP_022973350.1|  alpha-L-fucosidase [Xanthomonas sp. M97]      45.4    0.007
ref|WP_005676756.1|  hypothetical protein [Bacteroides caccae]     45.1    0.008
ref|WP_029728621.1|  MULTISPECIES: alpha-L-fucosidase [Sphingo...  45.1    0.008
ref|WP_013991725.1|  alpha-L-fucosidase [Zobellia galactanivor...  45.1    0.008
ref|WP_029747247.1|  alpha-L-fucosidase [Streptococcus mitis]      45.1    0.008
ref|WP_029728567.1|  alpha-L-fucosidase [Sphingomonas sp. JGI ...  45.1    0.008
ref|WP_003478391.1|  hypothetical protein [Clostridium perfrin...  45.1    0.008
ref|WP_000251208.1|  alpha-L-fucosidase [Streptococcus mitis]      45.1    0.008
ref|WP_025648175.1|  calcium:sodium exchange protein [Clostrid...  45.1    0.008
ref|WP_016268317.1|  hypothetical protein [Bacteroides thetaio...  45.1    0.009
ref|WP_003009031.1|  alpha-L-fucosidase [Streptococcus parasan...  45.1    0.009
ref|WP_003469857.1|  calx-beta domain protein [Clostridium per...  45.1    0.009
ref|WP_003460149.1|  calx-beta domain protein [Clostridium per...  45.1    0.009
ref|WP_003470599.1|  calx-beta domain protein [Clostridium per...  45.1    0.009
ref|WP_008770563.1|  hypothetical protein [Bacteroides sp. 2_1...  45.1    0.009
ref|WP_020138387.1|  glycosyl hydrolase [Streptomyces sp. 351M...  45.1    0.009
ref|WP_031227927.1|  alpha-L-fucosidase [Streptococcus mitis]      45.1    0.009
ref|WP_000251206.1|  alpha-L-fucosidase [Streptococcus mitis]      45.1    0.009
ref|WP_003451168.1|  calx-beta domain protein [Clostridium per...  45.1    0.009
ref|WP_011590977.1|  calx-beta domain-containing protein [Clos...  45.1    0.009
ref|WP_015531764.1|  Alpha-L-fucosidase [Bacteroides xylanisol...  45.1    0.009
ref|WP_028447136.1|  alpha-L-fucosidase [Chitinimonas koreensis]   45.1    0.010
ref|WP_004323098.1|  MULTISPECIES: hypothetical protein [Bacte...  45.1    0.010
ref|WP_000251205.1|  alpha-L-fucosidase [Streptococcus mitis]      44.7    0.010
ref|WP_011446065.1|  alpha-L-fucosidase [Novosphingobium aroma...  44.7    0.010
dbj|GAE21480.1|  alpha-L-fucosidase [Bacteroides pyogenes JCM ...  42.4    0.011
ref|WP_026627671.1|  hypothetical protein [Dysgonomonas capnoc...  44.7    0.011
ref|WP_030746272.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  44.7    0.011
ref|WP_011010652.1|  hypothetical protein [Clostridium perfrin...  44.7    0.011
gb|EJG89415.1|  alpha-L-fucosidase [Streptococcus mitis SPAR10]    44.7    0.011
ref|WP_022102797.1|  putative uncharacterized protein [Prevote...  44.7    0.011
ref|XP_004995323.1|  hypothetical protein, variant [Salpingoec...  44.7    0.012
gb|EXZ95922.1|  putative lipoprotein [Bacteroides fragilis str...  44.7    0.012
ref|WP_014173453.1|  alpha-L-fucosidase [Streptomyces bingchen...  44.7    0.012
ref|WP_027766713.1|  alpha-L-fucosidase [Streptomyces sp. CNQ865]  44.7    0.013
ref|WP_000251213.1|  alpha-L-fucosidase [Streptococcus pseudop...  44.7    0.013
ref|WP_004359196.1|  carbohydrate-binding protein [Prevotella ...  44.3    0.013
gb|EID24538.1|  alpha-L-fucosidase [Streptococcus mitis SK616]     44.7    0.014
ref|WP_026444848.1|  hypothetical protein [Acidobacteriaceae b...  44.3    0.015
ref|WP_003012201.1|  hypothetical protein [Sphingobacterium sp...  43.9    0.015
ref|WP_006146506.1|  alpha-L-fucosidase [Streptococcus infantis]   44.7    0.015
ref|WP_029689611.1|  alpha-L-fucosidase [Streptococcus infantis]   44.3    0.015
gb|AIA92886.1|  CAZy families GH29 protein [uncultured Acidoba...  42.0    0.016
ref|WP_031427510.1|  glycoside hydrolase family 29 [Leeuwenhoe...  44.3    0.016
ref|WP_022480009.1|  f5/8 type C domain protein [Prevotella sp...  44.3    0.016
ref|WP_003012814.1|  alpha-L-fucosidase [Streptococcus parasan...  44.3    0.017
ref|WP_003001987.1|  F5/8 type C domain protein [Streptococcus...  44.3    0.017
ref|WP_021908970.1|  putative uncharacterized protein [Prevote...  43.9    0.018
ref|WP_014221536.1|  hypothetical protein [Niastella koreensis]    43.9    0.018
ref|XP_001750923.1|  hypothetical protein [Monosiga brevicolli...  43.9    0.018
gb|EIF40099.1|  alpha-L-fucosidase [Streptococcus sp. SK140]       44.3    0.019
ref|WP_030935260.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  43.9    0.019
gb|KEQ36458.1|  LPXTG-motif cell wall anchor domain protein [S...  44.3    0.020
ref|WP_016564131.1|  putative uncharacterized protein [Bactero...  43.9    0.020
gb|EGL85682.1|  alpha-L-fucosidase [Streptococcus infantis SK1...  43.9    0.021
ref|WP_022317524.1|  f5/8 type C domain protein [Prevotella sp...  43.9    0.021
ref|WP_009100264.1|  glycosyl hydrolase [Rhodopirellula sp. SWK7]  43.9    0.021
gb|KEQ39231.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  43.9    0.021
ref|WP_005397983.1|  hypothetical protein [Helcococcus kunzii]     43.9    0.021
gb|AHG89157.1|  glycoside hydrolase family 29 (alpha-L-fucosid...  43.9    0.022
ref|XP_001316088.1|  Calx-beta domain containing protein [Tric...  43.9    0.023
sp|Q7XUR3.2|FUCO1_ORYSJ  RecName: Full=Putative alpha-L-fucosi...  43.9    0.023
ref|XP_002993807.1|  hypothetical protein SELMODRAFT_431838 [S...  43.5    0.023
ref|WP_010359589.1|  alpha-L-fucosidase [Streptomyces acidisca...  43.9    0.023
ref|WP_021914336.1|  alpha-L-fucosidase-like protein [Firmicut...  43.5    0.023
ref|WP_008145305.1|  hypothetical protein [Bacteroides coproph...  43.9    0.023
ref|WP_027585393.1|  glycoside hydrolase family 29 [Prolixibac...  43.9    0.023
ref|WP_000721491.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.9    0.024
ref|WP_022276654.1|  uncharacterized protein [Bacteroides copr...  43.9    0.024
ref|WP_000251207.1|  alpha-L-fucosidase [Streptococcus mitis]      43.9    0.025
ref|WP_008245041.1|  hypothetical protein [Pedobacter sp. BAL39]   43.9    0.025
gb|EOB23188.1|  alpha-L-fucosidase [Streptococcus pneumoniae 1...  43.1    0.025
gb|EJH03581.1|  hypothetical protein SPAR160_1787 [Streptococc...  43.1    0.025
ref|WP_010801829.1|  MULTISPECIES: hypothetical protein [Parab...  43.5    0.026
ref|WP_007655240.1|  hypothetical protein [Parabacteroides gol...  43.5    0.027
ref|WP_007364163.1|  beta-galactosidase [Opitutaceae bacterium...  43.5    0.028
gb|EJG52711.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  43.1    0.028
ref|WP_005681984.1|  MULTISPECIES: hypothetical protein [Bacte...  43.5    0.028
gb|EEC84898.1|  hypothetical protein OsI_32076 [Oryza sativa I...  43.5    0.028
ref|WP_018973012.1|  hypothetical protein [Rudaea cellulosilyt...  43.5    0.028
gb|AIM38812.1|  alpha-L-fucosidase [Sphingobacterium sp. ML3W]     43.5    0.028
ref|NP_001063703.1|  Os09g0520800 [Oryza sativa Japonica Group]    43.5    0.029
ref|WP_013991724.1|  alpha-L-fucosidase [Zobellia galactanivor...  43.5    0.029
gb|EPD85642.1|  YSIRK family gram-positive signal peptide [Str...  43.5    0.029
ref|WP_006059711.1|  hypothetical protein [Holdemania filiformis]  43.5    0.029
ref|WP_014760507.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.029
ref|WP_021647856.1|  f5/8 type C domain protein [Bifidobacteri...  43.5    0.030
gb|KFI43685.1|  alpha-1,3/4-fucosidase [Bifidobacterium bifidum]   43.5    0.030
ref|WP_022173314.1|  alpha-L-fucosidase [Bifidobacterium bifid...  43.5    0.030
ref|WP_003817978.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.030
dbj|BAH80310.1|  alpha-L-fucosidase [Bifidobacterium bifidum J...  43.5    0.030
ref|WP_013390134.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.030
ref|WP_026813712.1|  hypothetical protein [Arenibacter certesii]   43.5    0.030
ref|WP_017143529.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.030
ref|XP_007601730.1|  alpha-L-fucosidase 1 [Colletotrichum fior...  43.5    0.031
ref|WP_022511089.1|  putative uncharacterized protein [Prevote...  43.5    0.031
ref|WP_013363743.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.032
ref|XP_004957392.1|  PREDICTED: putative alpha-L-fucosidase 1-...  43.5    0.032
ref|WP_009712689.1|  alpha-L-fucosidase [Streptomyces himastat...  43.5    0.033
ref|WP_003819760.1|  alpha-L-fucosidase [Bifidobacterium bifidum]  43.5    0.033
ref|WP_023396049.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_000721488.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_007902138.1|  carbohydrate-binding protein [Prevotella ...  43.1    0.034
ref|WP_000721474.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_000721458.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
gb|KEQ43805.1|  alpha-L-fucosidase 1 [Streptococcus mitis]         43.1    0.034
ref|WP_022429942.1|  f5/8 type C domain protein [Prevotella st...  43.1    0.034
ref|WP_000721461.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_000721455.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_000721457.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.034
ref|WP_020140608.1|  hypothetical protein [Streptomyces sp. 35...  43.1    0.035
gb|EDK65991.1|  hypothetical protein CGSSp14BS69_00670 [Strept...  42.7    0.035
ref|WP_000721490.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_014059138.1|  alpha-L-fucosidase [Streptomyces violaceu...  43.5    0.035
ref|WP_013568191.1|  coagulation factor 5/8 type domain-contai...  43.1    0.035
ref|WP_009731829.1|  hypothetical protein [Streptococcus sp. F...  43.1    0.035
ref|WP_000721470.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_000721459.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_000721500.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_000721456.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_000721471.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
ref|WP_018759674.1|  hypothetical protein [Paenibacillus terri...  43.5    0.035
gb|KAA02892.1|  alpha-L-fucosidase [Streptococcus pneumoniae D...  43.1    0.035
ref|WP_015545714.1|  putative fucosidase [Streptococcus pneumo...  43.1    0.035
ref|WP_000721462.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.035
gb|KAA04153.1|  alpha-L-fucosidase [Streptococcus pneumoniae D...  43.1    0.036
ref|WP_000721464.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
ref|WP_000721451.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
ref|WP_000721463.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
ref|WP_000721453.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
ref|WP_000721467.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
ref|WP_000721486.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.036
gb|AHF92345.1|  beta-galactosidase [Opitutaceae bacterium TAV5]    43.1    0.036
ref|WP_016431120.1|  hypothetical protein [Streptomyces sp. HG...  43.1    0.036
ref|WP_001862293.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721449.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721454.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721466.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_001866493.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721450.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721483.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721478.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_005818304.1|  hypothetical protein [Bacteroides fragilis]   43.1    0.037
ref|WP_028799823.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  43.1    0.037
ref|WP_000721485.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721487.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721482.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_016397335.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_001851949.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.037
ref|WP_000721468.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_016399392.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_010976670.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_000721452.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_000721484.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_001824454.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_000721477.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.038
ref|WP_001844832.1|  f5/8 type C domain protein [Streptococcus...  43.1    0.038
ref|WP_001843259.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_001834962.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_000721496.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_000721499.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_000721460.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_001846440.1|  f5/8 type C domain protein [Streptococcus...  43.1    0.039
ref|WP_024477941.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_000721494.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.039
ref|WP_000721465.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.040
ref|WP_012386928.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.041
ref|WP_000721481.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.041
ref|WP_000721492.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.041
ref|WP_000251204.1|  alpha-L-fucosidase [Streptococcus mitis]      43.1    0.041
ref|WP_000721498.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.041
ref|WP_000721489.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.041
ref|WP_000721476.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.042
ref|WP_000721501.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.042
ref|WP_000721493.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.042
ref|WP_030470623.1|  alpha-L-fucosidase [Lechevalieria aerocol...  43.1    0.042
ref|WP_000251209.1|  alpha-L-fucosidase [Streptococcus mitis]      43.1    0.042
ref|WP_000721473.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_031077993.1|  hypothetical protein [Streptomyces sp. NR...  43.1    0.043
ref|WP_001863231.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_002672515.1|  hypothetical protein [Streptococcus pneum...  43.1    0.043
ref|WP_000721479.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_000721480.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_023396517.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_001863633.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_000721472.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.043
ref|WP_000721497.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.044
ref|WP_000721495.1|  alpha-L-fucosidase [Streptococcus pneumon...  43.1    0.044
ref|WP_008199609.1|  hypothetical protein [Algoriphagus sp. PR1]   42.7    0.045
ref|WP_030177940.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  43.1    0.045
ref|WP_026176472.1|  alpha-L-fucosidase [Caulobacter sp. JGI 0...  43.1    0.045
ref|WP_003814921.1|  alpha-1,3/4-fucosidase [Bifidobacterium b...  43.1    0.047
ref|WP_029709814.1|  alpha-L-fucosidase [Streptococcus sp. HPH...  42.7    0.048
ref|WP_023027357.1|  alpha-L-fucosidase [Streptococcus sp. I-G2]   43.1    0.048
gb|AHX13288.1|  alpha-L-fucosidase [Dyella jiangningensis]         42.7    0.049
ref|WP_006597017.1|  alpha-L-fucosidase [Streptococcus australis]  42.7    0.050
ref|WP_031482515.1|  alpha-1,3/4-fucosidase [Streptomyces bico...  42.7    0.050
ref|WP_009347345.1|  carbohydrate-binding protein [Alloprevote...  42.7    0.050
ref|WP_018973855.1|  hypothetical protein [Rudaea cellulosilyt...  42.7    0.051
ref|WP_030902108.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  42.7    0.052
ref|WP_020873175.1|  alpha-L-fucosidase [Streptomyces rapamyci...  42.7    0.054
ref|WP_008655973.1|  alpha-1,3/4-fucosidase [Bacteroides sp. 3...  42.7    0.057
ref|WP_006595442.1|  alpha-L-fucosidase [Streptococcus australis]  42.7    0.058
ref|WP_020900944.1|  alpha-L-fucosidase [Streptococcus mitis]      42.7    0.065
ref|WP_015896485.1|  Tat pathway signal sequence domain-contai...  42.4    0.067
ref|WP_030923855.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  42.4    0.069
ref|WP_000251211.1|  alpha-L-fucosidase [Streptococcus pneumon...  42.4    0.070
ref|WP_021154059.1|  glycosyl hydrolase family29(alpha-L-fucos...  42.4    0.075
ref|WP_023024644.1|  alpha-L-fucosidase [Streptococcus sp. I-P16]  42.4    0.075
ref|WP_005682174.1|  hypothetical protein [Bacteroides caccae]     42.4    0.078
gb|KFA70298.1|  hypothetical protein S40285_09346 [Stachybotry...  42.4    0.079
ref|WP_018628878.1|  hypothetical protein [Niabella aurantiaca]    42.0    0.081
ref|WP_014714033.1|  alpha-L-fucosidase [Streptococcus parasan...  42.4    0.082
ref|WP_023919828.1|  hypothetical protein [Streptococcus paras...  42.4    0.083
ref|WP_003016543.1|  alpha-L-fucosidase [Streptococcus parasan...  42.4    0.083
ref|WP_004317212.1|  hypothetical protein [Bacteroides xylanis...  42.4    0.084
emb|CDM01263.1|  Alpha-L-fucosidase [Bacteroides xylanisolvens...  42.4    0.084
ref|WP_013904285.1|  alpha-L-fucosidase [Streptococcus parasan...  42.4    0.084
ref|WP_030929672.1|  alpha-L-fucosidase [Streptomyces violaceo...  42.0    0.086
ref|WP_029746327.1|  alpha-L-fucosidase [Streptococcus mitis]      42.0    0.089
ref|WP_010769701.1|  hypothetical protein [Enterococcus phoeni...  42.0    0.091
ref|WP_030993343.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  42.0    0.092
ref|WP_031100819.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  42.0    0.092
ref|WP_031030949.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  42.0    0.092
ref|WP_030658727.1|  MULTISPECIES: alpha-L-fucosidase [Strepto...  42.0    0.092
ref|WP_022042677.1|  uncharacterized protein [Bacteroides cacc...  42.0    0.096
ref|WP_021908782.1|  putative uncharacterized protein [Prevote...  42.0    0.099
ref|WP_030954163.1|  alpha-1,3/4-fucosidase [Streptomyces sp. ...  42.0    0.10 
ref|WP_031120984.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  42.0    0.10 
ref|WP_000251022.1|  alpha-L-fucosidase [Streptococcus pseudop...  42.0    0.11 
ref|WP_014173913.1|  glycoside hydrolase family alpha-L-fucosi...  41.6    0.12 
gb|AIE85927.1|  alpha-L-fucosidase 1 [Fimbriimonas ginsengisol...  41.6    0.12 
ref|WP_031287743.1|  hypothetical protein [Sphingobacterium sp...  40.0    0.12 
ref|XP_002462685.1|  hypothetical protein SORBIDRAFT_02g030220...  41.6    0.13 
ref|WP_014056904.1|  alpha-L-fucosidase [Streptomyces violaceu...  41.6    0.14 
ref|WP_009077568.1|  alpha-L-fucosidase [Streptomyces sp. AA4]     41.6    0.14 
ref|XP_008437474.1|  PREDICTED: putative alpha-L-fucosidase 1 ...  41.6    0.14 
ref|WP_025072901.1|  carbohydrate-binding protein [Prevotella ...  41.6    0.14 
gb|AIA91942.1|  alpha_L_fucos [uncultured Arthrobacter sp.]        39.3    0.14 
gb|ETJ05099.1|  Alpha-L-fucosidase FucA [Streptococcus parasan...  41.6    0.14 
ref|WP_008123778.1|  carbohydrate-binding protein [Prevotella ...  41.6    0.15 
ref|WP_025066963.1|  hypothetical protein [Bacteroides massili...  40.8    0.15 
ref|XP_008437472.1|  PREDICTED: alpha-L-fucosidase 1-like isof...  41.2    0.15 
gb|KEQ41491.1|  alpha-L-fucosidase 1 domain protein [Streptoco...  41.2    0.16 
emb|CDR14167.1|  glycoside hydrolase clan GH-D [Streptomyces i...  41.6    0.16 
ref|XP_004164690.1|  PREDICTED: alpha-L-fucosidase 1-like [Cuc...  41.2    0.16 
gb|EQB48613.1|  alpha-L-fucosidase [Colletotrichum gloeosporio...  41.2    0.17 
ref|XP_004145883.1|  PREDICTED: alpha-L-fucosidase 1-like [Cuc...  41.2    0.17 
ref|WP_013305110.1|  hypothetical protein [Maribacter sp. HTCC...  41.2    0.17 
ref|WP_022237176.1|  f5/8 type C domain protein [Clostridium l...  41.2    0.18 
ref|XP_008805724.1|  PREDICTED: putative alpha-L-fucosidase 1 ...  41.2    0.18 
ref|WP_005944096.1|  hypothetical protein [Bacteroides massili...  40.8    0.18 
gb|AIA95768.1|  alpha_L_fucos [uncultured Beutenbergia sp.]        39.3    0.18 
gb|ABG73453.1|  glycosyl hydrolase family 29 [Oryza brachyantha]   41.2    0.18 
ref|XP_008805723.1|  PREDICTED: putative alpha-L-fucosidase 1 ...  41.2    0.18 
gb|ETI82931.1|  hypothetical protein Q618_VCMC00001G0512 [Vari...  41.2    0.18 
ref|XP_001751094.1|  hypothetical protein [Monosiga brevicolli...  40.4    0.19 
ref|WP_003527797.1|  hypothetical protein [ [Clostridium leptum]   41.2    0.20 
ref|WP_005679074.1|  hypothetical protein [Bacteroides caccae]     41.2    0.20 
ref|WP_007028086.1|  alpha-L-fucosidase/alpha-galactosidase [A...  41.2    0.20 
gb|ETN96456.1|  hypothetical protein P278_05340 [Zhouia amylol...  40.8    0.20 
ref|WP_028726222.1|  hypothetical protein [Parabacteroides gor...  41.2    0.20 
ref|WP_031576750.1|  alpha-L-fucosidase [Streptococcus parasan...  41.2    0.22 
gb|EID30628.1|  Gram-positive signal peptide protein, YSIRK fa...  41.2    0.23 
ref|XP_007285933.1|  calx-beta domain protein [Colletotrichum ...  40.8    0.23 
ref|WP_020629693.1|  hypothetical protein [Amycolatopsis alba]     40.8    0.24 
ref|XP_001320164.1|  Calx-beta domain containing protein [Tric...  40.8    0.24 
gb|AIA86688.1|  alpha_L_fucos [uncultured Asticcacaulis sp.]       40.0    0.24 
ref|WP_028071901.1|  alpha-L-fucosidase [Sphingobacterium thal...  40.8    0.25 
ref|WP_030973516.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  40.8    0.25 
ref|WP_011965022.1|  glycoside hydrolase [Bacteroides vulgatus]    40.8    0.26 
ref|WP_008781343.1|  MULTISPECIES: glycoside hydrolase family ...  40.8    0.27 
gb|ADC45582.1|  hypothetical protein [Streptomyces nanchangensis]  40.8    0.27 
ref|WP_031060152.1|  glycoside hydrolase [Streptomyces sp. NRR...  40.8    0.27 
gb|ETO30743.1|  hypothetical protein RFI_06375 [Reticulomyxa f...  40.4    0.29 
tpg|DAA40577.1|  TPA: hypothetical protein ZEAMMB73_948195 [Ze...  40.4    0.29 
ref|WP_031133322.1|  alpha-L-fucosidase [Streptomyces flavovar...  40.4    0.30 
dbj|BAK04990.1|  predicted protein [Hordeum vulgare subsp. vul...  40.4    0.31 
ref|WP_014173384.1|  alpha-L-fucosidase [Streptomyces bingchen...  40.4    0.32 
ref|XP_001743021.1|  hypothetical protein [Monosiga brevicolli...  40.0    0.33 
ref|WP_008504544.1|  hypothetical protein [Mucilaginibacter pa...  40.4    0.33 
ref|WP_012246711.1|  alpha-L-fucosidase [Renibacterium salmoni...  40.0    0.33 
ref|WP_022054362.1|  putative uncharacterized protein [Bactero...  40.4    0.33 
gb|AII67392.1|  glycoside hydrolase family 29 [Bacteroides dorei]  40.4    0.35 
ref|WP_007848075.1|  MULTISPECIES: hypothetical protein [Bacte...  40.4    0.35 
ref|WP_013928327.1|  alpha-L-fucosidase [Runella slithyformis]     40.4    0.35 
dbj|BAJ87504.1|  predicted protein [Hordeum vulgare subsp. vul...  40.4    0.35 
ref|WP_022276887.1|  alpha-L-fucosidase [Bacteroides coprophil...  40.0    0.37 
ref|WP_022511095.1|  calx-beta domain protein [Prevotella sp. ...  40.0    0.40 
emb|CDT00290.1|  Alpha-L-fucosidase [Sphingobacterium sp. PM2-...  40.0    0.40 
ref|WP_030049959.1|  alpha-L-fucosidase [Streptomyces peruvien...  38.5    0.42 
ref|WP_022456841.1|  putative uncharacterized protein [Parabac...  40.0    0.42 
ref|WP_007558777.1|  hypothetical protein [Bacteroides plebeius]   40.0    0.43 
ref|WP_007854712.1|  hypothetical protein [Bacteroides dorei]      40.0    0.44 
ref|WP_007833866.1|  MULTISPECIES: hypothetical protein [Bacte...  40.0    0.45 
ref|WP_018532768.1|  hypothetical protein [Streptomyces sp. Hm...  40.0    0.46 
ref|WP_005159207.1|  melibiase [Amycolatopsis azurea]              40.0    0.46 
ref|WP_030054807.1|  hypothetical protein [Streptomyces peruvi...  38.1    0.49 
ref|WP_005850144.1|  hypothetical protein [Bacteroides vulgatus]   39.7    0.51 
ref|WP_022508150.1|  glycoside hydrolase family 29 [Bacteroide...  39.7    0.51 
ref|WP_008666609.1|  glycoside hydrolase family 29 [Bacteroide...  39.7    0.51 
ref|WP_009100266.1|  putative secreted protein [Rhodopirellula...  39.7    0.53 
ref|XP_001743020.1|  hypothetical protein [Monosiga brevicolli...  39.7    0.53 
ref|WP_020641830.1|  alpha-L-fucosidase [Amycolatopsis balhimy...  40.0    0.53 
ref|WP_021189122.1|  hypothetical protein [Sphingobacterium sp...  38.5    0.56 
gb|KEQ31545.1|  alpha-L-fucosidase [Sphingobacterium antarctic...  39.7    0.59 
gb|EKG11614.1|  Coagulation factor 5/8 type [Macrophomina phas...  39.7    0.61 
ref|WP_026309826.1|  glycoside hydrolase family 29 [Niabella a...  39.7    0.64 
gb|KFG08395.1|  alpha-L-fucosidase [Streptomyces scabiei]          39.7    0.64 
ref|WP_012998330.1|  alpha-L-fucosidase [Streptomyces scabiei]     39.7    0.65 
ref|WP_006376308.1|  ricin-type beta-trefoil lectin domain pro...  39.7    0.68 
ref|WP_031050379.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  39.7    0.69 
ref|WP_030477178.1|  alpha-L-fucosidase [Lentzea albidocapillata]  39.7    0.75 
ref|WP_020122224.1|  alpha-L-fucosidase [Streptomyces canus]       39.3    0.77 
ref|XP_004996324.1|  hypothetical protein PTSG_02815 [Salpingo...  39.3    0.79 
ref|WP_016198876.1|  alpha-L-fucosidase [Elizabethkingia menin...  39.3    0.86 
gb|KFZ78287.1|  alpha-L-fucosidase [Amycolatopsis sp. MJM2582]     39.3    0.86 
ref|XP_003578460.1|  PREDICTED: alpha-L-fucosidase 1-like [Bra...  39.3    0.88 
ref|WP_007386066.1|  alpha-L-fucosidase [Streptomyces sviceus]     39.3    0.91 
gb|KFU76392.1|  alpha-L-fucosidase [Amycolatopsis lurida NRRL ...  39.3    0.97 
ref|WP_026443707.1|  alpha-L-fucosidase [Acidobacterium sp. PM...  38.9    0.97 
ref|WP_004299923.1|  hypothetical protein [Bacteroides ovatus]     38.9    0.99 
emb|CDA83533.1|  uncharacterized protein BN772_00157 [Bacteroi...  38.9    1.00 
ref|WP_016335440.1|  alpha-L-fucosidase/alpha-galactosidase [A...  39.3    1.0  
emb|CDN30832.1|  Alpha-L-fucosidase [Rikenellaceae bacterium M3]   38.9    1.0  
gb|KER59136.1|  glycoside hydrolase family 29 [Bacteroides fra...  38.9    1.0  
ref|WP_005810234.1|  MULTISPECIES: hypothetical protein [Bacte...  38.9    1.0  
ref|WP_005775603.1|  hypothetical protein [Bacteroides fragilis]   38.9    1.1  
gb|KFG05849.1|  alpha-L-fucosidase [Streptomyces scabiei]          38.9    1.2  
ref|WP_010536439.1|  MULTISPECIES: hypothetical protein [Bacte...  38.9    1.2  
ref|WP_008762733.1|  hypothetical protein [Bacteroides sp. 1_1...  38.9    1.2  
ref|XP_008670330.1|  PREDICTED: alpha-L-fucosidase 1-like [Zea...  38.9    1.2  
ref|WP_011108981.1|  hypothetical protein [Bacteroides thetaio...  38.5    1.3  
ref|WP_005844286.1|  hypothetical protein [Bacteroides vulgatus]   38.5    1.3  
gb|KDS25571.1|  putative exported fucosidase [Bacteroides vulg...  38.5    1.3  
ref|WP_015656398.1|  calx-beta domain-containing protein [Stre...  38.9    1.3  
ref|XP_001745228.1|  hypothetical protein [Monosiga brevicolli...  38.5    1.3  
pdb|3GZA|A  Chain A, Crystal Structure Of Putative Alpha-L-Fuc...  38.5    1.4  
ref|WP_013928329.1|  alpha-L-fucosidase [Runella slithyformis]     38.5    1.4  
gb|AIG75664.1|  alpha-L-fucosidase [Amycolatopsis japonica]        38.5    1.5  
ref|WP_031484120.1|  alpha-L-fucosidase [Streptomyces bicolor]     38.5    1.5  
ref|WP_008649713.1|  hypothetical protein [Bacteroides sp. 3_1...  38.5    1.5  
ref|WP_008766936.1|  MULTISPECIES: hypothetical protein [Bacte...  38.5    1.7  
ref|WP_009100262.1|  secreted protein [Rhodopirellula sp. SWK7]    38.5    1.7  
ref|XP_006674433.1|  alpha-L-fucosidase [Cordyceps militaris C...  38.1    1.7  
ref|WP_016269853.1|  hypothetical protein [Bacteroides thetaio...  38.1    1.8  
gb|KFX94204.1|  hypothetical protein O988_06417 [Pseudogymnoas...  38.1    1.9  
ref|WP_022480722.1|  coagulation factor 5/8 type domain protei...  38.1    1.9  
gb|KFZ00236.1|  hypothetical protein V500_01121 [Pseudogymnoas...  38.1    2.0  
ref|WP_003993882.1|  alpha-L-fucosidase [Streptomyces viridoch...  38.1    2.0  
gb|KFF96105.1|  alpha-L-fucosidase [Streptomyces scabiei]          38.1    2.1  
gb|KFZ25385.1|  hypothetical protein V502_00136 [Pseudogymnoas...  38.1    2.2  
ref|WP_013546458.1|  alpha-L-fucosidase [Bacteroides helcogenes]   37.7    2.3  
ref|WP_020139771.1|  alpha-L-fucosidase [Streptomyces sp. 351M...  38.1    2.3  
ref|WP_014174697.1|  alpha-L-fucosidase [Streptomyces bingchen...  38.1    2.4  
ref|XP_007811710.1|  alpha-L-fucosidase, putative [Metarhizium...  37.7    2.6  
ref|WP_030662459.1|  alpha-L-fucosidase [Streptomyces cellulosae]  37.7    2.6  
ref|WP_022340542.1|  glycoside hydrolase family 29 [Bacteroide...  37.7    2.8  
ref|WP_018709545.1|  glycoside hydrolase family 29 [Bacteroide...  37.7    3.0  
ref|WP_022130806.1|  alpha-L-fucosidase [Bacteroides sp. CAG:530]  37.7    3.0  
ref|XP_006652638.1|  PREDICTED: LOW QUALITY PROTEIN: putative ...  37.4    3.4  
ref|WP_026389031.1|  alpha-L-fucosidase [Acidobacteria bacteri...  37.4    3.4  
ref|WP_013230382.1|  alpha-L-fucosidase [Amycolatopsis mediter...  37.4    3.5  
ref|XP_001745360.1|  hypothetical protein [Monosiga brevicolli...  37.4    3.7  
gb|KFY38444.1|  hypothetical protein V495_06565 [Pseudogymnoas...  37.4    3.8  
ref|WP_030936703.1|  hypothetical protein [Streptomyces sp. NR...  37.4    3.9  
ref|WP_030466920.1|  alpha-L-fucosidase [Lechevalieria aerocol...  37.4    3.9  
gb|EXU64799.1|  alpha-L-fucosidase [Streptomyces sp. PRh5]         37.4    4.1  
gb|EXZ01984.1|  putative exported fucosidase [Bacteroides frag...  37.0    4.3  
ref|XP_008601831.1|  glycoside hydrolase family 29 protein [Be...  37.0    4.3  
ref|WP_021989160.1|  putative uncharacterized protein [Odoriba...  37.0    4.3  
ref|WP_030327118.1|  glycoside hydrolase [Streptomyces sp. NRR...  37.4    4.4  
ref|WP_013994798.1|  hypothetical protein [Zobellia galactaniv...  37.0    4.7  
gb|EYB01952.1|  putative exported fucosidase [Bacteroides frag...  37.0    4.7  
gb|EXZ30011.1|  putative exported fucosidase [Bacteroides frag...  37.0    4.7  
gb|EYA00400.1|  putative exported fucosidase [Bacteroides frag...  37.0    4.9  
gb|EXY85907.1|  putative exported fucosidase [Bacteroides frag...  37.0    4.9  
ref|WP_005813198.1|  hypothetical protein [Bacteroides fragilis]   37.0    4.9  
ref|WP_005801319.1|  hypothetical protein [Bacteroides fragilis]   37.0    4.9  
ref|WP_030686024.1|  alpha-L-fucosidase [Streptomyces sp. NRRL...  37.0    4.9  
ref|WP_005796064.1|  MULTISPECIES: hypothetical protein [Bacte...  37.0    4.9  
ref|WP_014298290.1|  hypothetical protein [Bacteroides fragilis]   37.0    4.9  
ref|WP_008769492.1|  hypothetical protein [Bacteroides sp. 2_1...  37.0    5.0  
gb|EYA30839.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.0  
ref|WP_005785074.1|  MULTISPECIES: hypothetical protein [Bacte...  37.0    5.0  
ref|WP_008658696.1|  hypothetical protein [Bacteroides sp. 3_2_5]  37.0    5.0  
gb|EXZ20799.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.1  
gb|EYB20318.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.1  
ref|WP_019941975.1|  hypothetical protein [Dyadobacter beijing...  37.0    5.2  
gb|EXZ90505.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
gb|EXZ49991.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
gb|EXY52365.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
gb|EXZ79832.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
gb|EXZ65040.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
gb|EXZ15347.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.3  
ref|WP_020971672.1|  alpha-L-fucosidase/alpha-galactosidase [A...  37.0    5.3  
gb|EXY28732.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.4  
gb|EXY14521.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.4  
gb|EYA35887.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.4  
gb|EXZ84537.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.4  
gb|EXY23971.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.5  
gb|EXY92114.1|  putative exported fucosidase [Bacteroides frag...  37.0    5.6  
ref|WP_028726600.1|  glycoside hydrolase family 29 [Parabacter...  36.6    5.7  
gb|KFX99384.1|  hypothetical protein V490_01821 [Pseudogymnoas...  37.0    5.7  
ref|WP_007379486.1|  alpha-L-fucosidase [Streptomyces sviceus]     37.0    5.8  
ref|WP_007911413.1|  PAS/PAC sensor signal transduction histid...  36.6    5.8  
ref|WP_020866376.1|  alpha-L-fucosidase [Streptomyces rapamyci...  36.6    6.0  
ref|WP_006723422.1|  potassium transporter Kup [Collinsella in...  36.6    7.9  
ref|WP_007385911.1|  glycoside hydrolase [Streptomyces sviceus]    36.6    8.1  
gb|EMP34717.1|  Semaphorin-3D [Chelonia mydas]                     35.8    9.8  

ALIGNMENTS
>ref|WP_018199881.1| hypothetical protein [Candidatus Hydrogenedens terephthalicus]
Length=439

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 122/160 (76%), Gaps = 0/160 (0%)

Query  8    LILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYL  67
            L    + + IA  YEP WESLD RP PQW++DAKFGIFIHWG+YSVP+W P+ +Y+EWY 
Sbjct  3    LTSFVIATAIATVYEPTWESLDQRPNPQWFEDAKFGIFIHWGVYSVPSWAPKDTYSEWYW  62

Query  68   NGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHH  127
            N +++ +    K+H E YG+ F Y+DF  +FK+E Y+P++WA++FK SGAKY+VLTSKHH
Sbjct  63   NHMQNKEGATWKFHVEKYGEKFQYQDFAPMFKAELYDPDQWADIFKRSGAKYVVLTSKHH  122

Query  128  DGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLKS  167
            DGFC+WPS +S  +N+++    RDL G+L  AVKK+G+K+
Sbjct  123  DGFCMWPSAQSWNWNAMDIGPHRDLAGELINAVKKAGIKA  162


>ref|WP_026307819.1| alpha-L-fucosidase [Hydrogenedentes bacterium JGI 0000039-J10]
Length=445

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 122/160 (76%), Gaps = 0/160 (0%)

Query  8    LILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYL  67
            L    + + IA  YEP WESLD RP PQW++DAKFGIFIHWG+YSVP+W P+ +Y+EWY 
Sbjct  9    LTSFVIATAIATVYEPTWESLDQRPNPQWFEDAKFGIFIHWGVYSVPSWAPKDTYSEWYW  68

Query  68   NGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHH  127
            N +++ +    K+H E YG+ F Y+DF  +FK+E Y+P++WA++FK SGAKY+VLTSKHH
Sbjct  69   NHMQNKEGATWKFHVEKYGEKFQYQDFAPMFKAELYDPDQWADIFKRSGAKYVVLTSKHH  128

Query  128  DGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLKS  167
            DGFC+WPS +S  +N+++    RDL G+L  AVKK+G+K+
Sbjct  129  DGFCMWPSAQSWNWNAMDIGPHRDLAGELINAVKKAGIKA  168


>ref|WP_013665054.1| alpha-L-fucosidase [Sphingobacterium sp. 21]
 ref|YP_004317000.1| alpha-L-fucosidase [Sphingobacterium sp. 21]
 gb|ADZ78330.1| glycoside hydrolase family 29 (alpha-L-fucosidase) [Sphingobacterium 
sp. 21]
Length=461

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 123/173 (71%), Gaps = 8/173 (5%)

Query  2    FMRYFGLIL-LSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRG  60
             ++Y  L + L   SL A+DY+ NW+S+D R  PQW++DAKFGIFIHWG YSVPA+ P  
Sbjct  4    IVKYLLLCMFLFSQSLRAQDYQANWQSIDQREIPQWWQDAKFGIFIHWGPYSVPAYAPIK  63

Query  61   S-------YAEWYLNGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFK  113
                    YAE Y N LK+ +   L +H + YG +F Y+DF  LFK+E ++PE+WAELFK
Sbjct  64   EVEGVYEKYAEHYENRLKTKNKLFLDFHNKTYGPNFTYQDFAPLFKAEHFKPEQWAELFK  123

Query  114  ESGAKYIVLTSKHHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
            ++GAKY+VLTSKHHDGFCLWPSK S  +NSV+  A RDL GDL  AV+ SGL+
Sbjct  124  KAGAKYVVLTSKHHDGFCLWPSKYSPNWNSVDIGAHRDLAGDLTKAVRTSGLR  176


>ref|WP_027126168.1| alpha-L-fucosidase [Gelidibacter mesophilus]
Length=497

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 130/179 (73%), Gaps = 14/179 (8%)

Query  2    FMRYFGLILLSVMSLIAKD-YEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRG  60
            F+   G + L + SL A++ Y+P WESLDSRP P W+ DAKFGIFIHWG YSVPAW P+G
Sbjct  10   FVCLMGSLFLCIGSLQAQENYKPTWESLDSRPVPDWFHDAKFGIFIHWGPYSVPAWSPKG  69

Query  61   SYAEWYLNGLK------SGDSTR---LKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAEL  111
            +Y+EWY   L+      +GD T    + +H E YG+D+ Y DF K FK++ +EP++WA L
Sbjct  70   TYSEWYQYWLQDETLFGNGDFTGKEIVDFHNETYGEDYSYYDFGKEFKADLFEPDQWASL  129

Query  112  FKESGAKYIVLTSKHHDGFCLWPSKESNG----YNSVEGAAKRDLLGDLNTAVKKSGLK  166
            FKESGA+Y++LTSKHHDGF LWPS+E+N     +NS E  A++DLLG+L+ +VK +GLK
Sbjct  130  FKESGARYVILTSKHHDGFALWPSEEANDRGFPWNSKEVGARKDLLGELSESVKSAGLK  188


>gb|ETN95141.1| alpha-L-fucosidase [Zhouia amylolytica AD3]
Length=490

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 125/185 (68%), Gaps = 22/185 (12%)

Query  3    MRYFGLILLSVMSLIA-------KDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPA  55
            MR   + +L +M L         K YEP WES+DSR TP W+ +AKFGIFIHWG YSVPA
Sbjct  1    MRKIWVFVLIMMLLFGSEKLTAQKKYEPTWESIDSRKTPDWFGNAKFGIFIHWGPYSVPA  60

Query  56   WGPRGSYAEWYL----------NGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEP  105
            W P+G+Y+EWY           NG   GD   + YHE+ YGKDF Y DF ++F ++ +EP
Sbjct  61   WSPKGTYSEWYQYWLQNKTLFGNGNFKGDEV-VNYHEKTYGKDFTYYDFGEMFTADLFEP  119

Query  106  EKWAELFKESGAKYIVLTSKHHDGFCLWPSKESN----GYNSVEGAAKRDLLGDLNTAVK  161
            + WA LFK SGAKYIVLTSKHHDG+ LWP+KE+N     +NS+E  AKRDL+G+L+ +VK
Sbjct  120  DAWATLFKNSGAKYIVLTSKHHDGYTLWPNKEANDRGFAWNSMEVGAKRDLVGELSKSVK  179

Query  162  KSGLK  166
              GLK
Sbjct  180  AVGLK  184


>ref|WP_015267678.1| alpha-L-fucosidase [Echinicola vietnamensis]
 ref|YP_007226150.1| alpha-L-fucosidase [Echinicola vietnamensis DSM 17526]
 gb|AGA80140.1| alpha-L-fucosidase [Echinicola vietnamensis DSM 17526]
Length=488

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 128/182 (70%), Gaps = 19/182 (10%)

Query  3    MRYFGLILLSVM----SLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGP  58
            M+   L+LL +M    SL A++YE NW SLD RP P W++DAKFGIFIHWG YSVPAW P
Sbjct  1    MKTKRLLLLCLMVVTVSLQAQEYEANWASLDQRPVPAWFEDAKFGIFIHWGPYSVPAWSP  60

Query  59   RGSYAEWYL----------NGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKW  108
            +G+Y EWY           NG   GD    +YH + YG+DFPY +F ++F ++ ++P++W
Sbjct  61   KGTYTEWYQYWLQSKKLFGNGDFEGDEV-YRYHVKTYGEDFPYYNFGEMFTADLFDPKEW  119

Query  109  AELFKESGAKYIVLTSKHHDGFCLWPSKESN----GYNSVEGAAKRDLLGDLNTAVKKSG  164
            A LF+E+GAKYIVLTSKHHDGF LWP++++N     +NS+E  A RDL+G+L  AV+K+ 
Sbjct  120  AALFEEAGAKYIVLTSKHHDGFTLWPNEQANDRGFAWNSMEVGAHRDLVGELTKAVRKTE  179

Query  165  LK  166
            +K
Sbjct  180  VK  181


>ref|WP_015808420.1| alpha-L-fucosidase [Pedobacter heparinus]
 ref|YP_003092871.1| alpha-L-fucosidase [Pedobacter heparinus DSM 2366]
 gb|ACU04809.1| Alpha-L-fucosidase [Pedobacter heparinus DSM 2366]
Length=463

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 110/156 (71%), Gaps = 7/156 (4%)

Query  18   AKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGS-------YAEWYLNGL  70
            A+ Y+P W+SLD R TP W+ DAKFGIFIHWGLYSVPA+ P          YAE Y N L
Sbjct  25   AQTYQPEWQSLDKRQTPSWWTDAKFGIFIHWGLYSVPAYAPVNEVKGVYEKYAEHYENRL  84

Query  71   KSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGF  130
              G+     +H++ YG+ F Y DF  +FK+E ++PE+WA+LF +SGAKY+VLTSKHHDGF
Sbjct  85   IQGNKLFTDHHKQFYGEQFKYSDFAAMFKAEYFKPEEWADLFAKSGAKYVVLTSKHHDGF  144

Query  131  CLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
            CLWPS ESN +NSV+    RDL GDL  AVK  GLK
Sbjct  145  CLWPSAESNKWNSVDAGPHRDLAGDLTNAVKDKGLK  180


>ref|WP_026210216.1| alpha-L-fucosidase [Flexithrix dorotheae]
Length=464

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 118/168 (70%), Gaps = 9/168 (5%)

Query  8    LILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGS-----Y  62
             ++ S +   A+ YE NWES+DSRP P+W+ DAKFGIFIHWGLY+VPAWGP  +     Y
Sbjct  16   FLIFSPLFSFAQKYEANWESIDSRPIPEWFSDAKFGIFIHWGLYAVPAWGPTDAGVYDKY  75

Query  63   AEWYLNGLKSGDS----TRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAK  118
            AEWY + L + DS       K+H E YG+DF Y+DF+  F  E + P+ WA+LFK+SGAK
Sbjct  76   AEWYWSKLMNKDSKVHENFKKFHHETYGEDFKYQDFVNGFNCEMFNPDDWAKLFKKSGAK  135

Query  119  YIVLTSKHHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
            Y+VLTSKHH+GF LWPS++S  +N+V+    RDL GDL  +VK  GLK
Sbjct  136  YVVLTSKHHEGFTLWPSEQSWNWNAVDVGPHRDLAGDLIKSVKGEGLK  183


>ref|WP_013305118.1| alpha-L-fucosidase [Maribacter sp. HTCC2170]
 ref|YP_003861349.1| alpha-L-fucosidase [Maribacter sp. HTCC2170]
 gb|EAR02046.1| alpha-L-fucosidase [Maribacter sp. HTCC2170]
Length=493

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 123/175 (70%), Gaps = 15/175 (9%)

Query  6    FGLILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEW  65
            F  I+ S ++   K Y+P WES+DSR  P W+  AKFGIFIHWG YSVPAW P+G+Y+EW
Sbjct  11   FLCIVYSGVAQTQKQYQPTWESIDSRSVPNWFGGAKFGIFIHWGPYSVPAWSPKGTYSEW  70

Query  66   YL----------NGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKES  115
            Y           NG   GD    KYH + YGK+F Y  F ++FK++ +EP+KWA LF+E+
Sbjct  71   YQYWLQSEALFGNGDFKGDEVT-KYHHKTYGKNFDYYKFGEMFKADLFEPDKWASLFEEA  129

Query  116  GAKYIVLTSKHHDGFCLWPSKESN----GYNSVEGAAKRDLLGDLNTAVKKSGLK  166
            GAKY+VLTSKHHDGF LWP+KE+N     +NS+E  +K+DL+G+L+ AVKK G+K
Sbjct  130  GAKYVVLTSKHHDGFTLWPNKEANDRGFAWNSMEVGSKKDLVGELSNAVKKKGIK  184


>gb|AHW59243.1| alpha-L-fucosidase [Draconibacterium orientale]
Length=458

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 19/175 (11%)

Query  8    LILLSVMSLI-----AKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGS-  61
            +ILLS +SL      A+ Y+ NW+S+DSRP PQW++D KFGIFIHWG+YSVPAW P  + 
Sbjct  4    VILLSFLSLFITFSYAQKYKANWKSIDSRPIPQWFEDVKFGIFIHWGVYSVPAWAPANAD  63

Query  62   ------YAEWYLNGLKSGDSTRL-----KYHEENYGKDFPYRDFIKLFKSEKYEPEKWAE  110
                  YAEWY  G +  D+++      +YH + YG+DF Y+DF   FK++ + PE+WAE
Sbjct  64   IGVYAKYAEWY--GFRINDNSKAGKLFREYHNKMYGEDFLYQDFAPRFKAQHWNPEQWAE  121

Query  111  LFKESGAKYIVLTSKHHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGL  165
            LFK +GA+Y+VLTSKHH+GF LWPS +S  +NSV+    RD+ GDL TAVK +GL
Sbjct  122  LFKRAGARYVVLTSKHHEGFTLWPSAQSWNWNSVDIGPHRDICGDLTTAVKNAGL  176

____________________________________________________________________________________________________________________

b) ORF 3 contre Swissprot
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q9VTJ4.2|FUCO_DROME  RecName: Full=Putative alpha-L-fucosid...    152   1e-42
sp|P10901.1|FUCO_DICDI  RecName: Full=Alpha-L-fucosidase; AltN...    148   3e-41
sp|P17164.1|FUCO_RAT  RecName: Full=Tissue alpha-L-fucosidase;...    148   4e-41
sp|Q2KIM0.1|FUCO_BOVIN  RecName: Full=Tissue alpha-L-fucosidas...    144   2e-39
sp|Q99LJ1.1|FUCO_MOUSE  RecName: Full=Tissue alpha-L-fucosidas...    143   3e-39
sp|P49713.2|FUCO_CAEEL  RecName: Full=Putative alpha-L-fucosid...    143   3e-39
sp|P04066.4|FUCO_HUMAN  RecName: Full=Tissue alpha-L-fucosidas...    142   4e-39
sp|Q60HF8.1|FUCO_MACFA  RecName: Full=Tissue alpha-L-fucosidas...    140   2e-38
sp|C3YWU0.2|FUCO_BRAFL  RecName: Full=Alpha-L-fucosidase; AltN...    140   4e-38
sp|P48300.1|FUCO_CANFA  RecName: Full=Tissue alpha-L-fucosidas...    137   3e-37
sp|Q99KR8.1|FUCO2_MOUSE  RecName: Full=Plasma alpha-L-fucosida...    132   2e-35
sp|Q6AYS4.1|FUCO2_RAT  RecName: Full=Plasma alpha-L-fucosidase...    132   2e-35
sp|Q9BTY2.2|FUCO2_HUMAN  RecName: Full=Plasma alpha-L-fucosida...    129   3e-34
sp|Q5RFI5.1|FUCO2_PONAB  RecName: Full=Plasma alpha-L-fucosida...    128   6e-34
sp|Q8GW72.2|FUCO1_ARATH  RecName: Full=Alpha-L-fucosidase 1; A...  54.7    5e-08
sp|Q7XUR3.2|FUCO1_ORYSJ  RecName: Full=Putative alpha-L-fucosi...  43.9    2e-04
sp|Q8ML70.2|IM10_DROME  RecName: Full=Immune-induced peptides;...  33.9    0.51 
sp|Q1LTM3.1|LIPA_BAUCH  RecName: Full=Lipoyl synthase; AltName...  32.7    1.0  
sp|Q4QPL8.1|LIPA_HAEI8  RecName: Full=Lipoyl synthase; AltName...  32.7    1.1  
sp|A5UFJ8.1|LIPA_HAEIG  RecName: Full=Lipoyl synthase; AltName...  32.7    1.2  
sp|Q7VKB1.1|LIPA_HAEDU  RecName: Full=Lipoyl synthase; AltName...  32.3    1.4  
sp|B8F679.1|LIPA_HAEPS  RecName: Full=Lipoyl synthase; AltName...  32.3    1.4  
sp|C5A2C2.1|PSA_THEGJ  RecName: Full=Proteasome subunit alpha;...  32.0    1.8  
sp|Q6LV34.1|RAPA_PHOPR  RecName: Full=RNA polymerase-associate...  32.0    2.4  
sp|O80642.1|PGTB1_ARATH  RecName: Full=Geranylgeranyl transfer...  32.0    2.4  
sp|Q5JIU9.1|PSA_THEKO  RecName: Full=Proteasome subunit alpha;...  31.6    2.5  
sp|O24733.1|PSA_THEK1  RecName: Full=Proteasome subunit alpha;...  31.6    2.6  
sp|P44463.1|LIPA_HAEIN  RecName: Full=Lipoyl synthase; AltName...  31.2    3.3  
sp|Q30PQ0.2|MLTF_SULDN  RecName: Full=Membrane-bound lytic mur...  31.2    3.9  
sp|A5UBB2.1|LIPA_HAEIE  RecName: Full=Lipoyl synthase; AltName...  30.8    4.3  
sp|B3EKW7.1|HIS6_CHLPB  RecName: Full=Imidazole glycerol phosp...  30.8    4.5  
sp|A1JPR9.1|LIPA_YERE8  RecName: Full=Lipoyl synthase; AltName...  30.8    5.1  
sp|P57978.1|LIPA_PASMU  RecName: Full=Lipoyl synthase; AltName...  30.4    6.1  
sp|B6YSH9.1|PSA_THEON  RecName: Full=Proteasome subunit alpha;...  30.4    6.5  
sp|Q0I1H8.2|LIPA_HISS1  RecName: Full=Lipoyl synthase; AltName...  30.4    7.1  
sp|Q8U0L6.1|PSA_PYRFU  RecName: Full=Proteasome subunit alpha;...  30.0    7.2  
sp|Q9QF31.3|POLG_CX16T  RecName: Full=Genome polyprotein; Cont...  30.4    8.0  
sp|Q7SGY1.1|ALO_NEUCR  RecName: Full=Putative D-arabinono-1,4-...  30.4    8.0  
sp|Q9URV2.1|APC1_SCHPO  RecName: Full=Anaphase-promoting compl...  30.4    8.1  
sp|C6A459.1|PSA_THESM  RecName: Full=Proteasome subunit alpha;...  30.0    8.2  
sp|A3N2P1.1|LIPA_ACTP2  RecName: Full=Lipoyl synthase; AltName...  30.0    8.2  

ALIGNMENTS
>sp|Q9VTJ4.2|FUCO_DROME RecName: Full=Putative alpha-L-fucosidase; AltName: Full=Alpha-L-fucoside 
fucohydrolase; Flags: Precursor [Drosophila melanogaster]
Length=494

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 101/143 (71%), Gaps = 6/143 (4%)

Query  21   YEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKS-GDSTRLK  79
            Y+PNW SLD RP PQWY DAK GIF+H+G+YSVP++G     +EW+    K+  +   ++
Sbjct  34   YQPNWASLDQRPLPQWYDDAKVGIFLHYGVYSVPSFG-----SEWFWTNWKNLRNPEYVQ  88

Query  80   YHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKESN  139
            + + NY  DF Y++F   F +E +   KWA LFK+SGA+Y+VLTSKHHDGF LWPSK S 
Sbjct  89   FMQRNYKPDFTYQEFASQFTAELFNATKWALLFKDSGARYVVLTSKHHDGFTLWPSKNSY  148

Query  140  GYNSVEGAAKRDLLGDLNTAVKK  162
            G+NS++   KRD++ +L  A++K
Sbjct  149  GWNSMDVGPKRDIVKELAAAIRK  171


>sp|P10901.1|FUCO_DICDI RecName: Full=Alpha-L-fucosidase; AltName: Full=Alpha-L-fucoside 
fucohydrolase; Flags: Precursor [Dictyostelium discoideum]
Length=461

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 6/152 (4%)

Query  18   AKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKS----G  73
            ++ Y P W+ ++SRP P WY D KFGIFIH+G+YSVPA+   G YAEWY   LK+    G
Sbjct  18   SQQYGPTWDQINSRPLPGWYDDVKFGIFIHFGIYSVPAFA-NGGYAEWYWWTLKNPSSDG  76

Query  74   DSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLW  133
             +T+ +YHE+ +G +F Y+DF+  F    ++  +WA + ++SGAKY+VLTSKHH+G+ LW
Sbjct  77   GATQ-RYHEKEFGANFTYQDFVSRFDCRLFDANEWASIIEKSGAKYVVLTSKHHEGYTLW  135

Query  134  PSKESNGYNSVEGAAKRDLLGDLNTAVKKSGL  165
             S++S  +NSVE     D++G+L  +VK  GL
Sbjct  136  NSEQSWNWNSVETGPGIDIVGELTKSVKNMGL  167


>sp|P17164.1|FUCO_RAT RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor
Length=462

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 101/151 (67%), Gaps = 4/151 (3%)

Query  16   LIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDS  75
            L    Y P+W SLDSRP P+W+ +AKFG+F+HWG+YSVPAWG    +  W+  G +S  S
Sbjct  28   LAPHHYTPDWPSLDSRPLPRWFDEAKFGLFVHWGVYSVPAWG--SEWFWWHWQGEQS--S  83

Query  76   TRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPS  135
              +++ +ENY   F Y DF   F +  + PE+WA+LF+ +GAKY+VLT+KHH+GF  WPS
Sbjct  84   AYVRFMKENYPPGFSYADFAPQFTARFFHPEEWADLFQAAGAKYVVLTAKHHEGFTNWPS  143

Query  136  KESNGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
              S  +NS +    RDL+G+L  AV+K  ++
Sbjct  144  AVSWNWNSKDVGPHRDLVGELGAAVRKRNIR  174


>sp|Q2KIM0.1|FUCO_BOVIN RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor [Bos taurus]
Length=468

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 96/146 (66%), Gaps = 4/146 (3%)

Query  21   YEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDSTRLKY  80
            Y P+W SLDSRP P W+ +AKFG+F+HWG++SVPAWG    +  W    L   +S    +
Sbjct  40   YTPDWPSLDSRPLPAWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGEKLPQYES----F  95

Query  81   HEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKESNG  140
             +ENY  DF Y DF   F +  + P+ WA+LFK +GAKY+VLT+KHH+G+  WPS  S  
Sbjct  96   MKENYPPDFSYADFGPRFTARFFNPDSWADLFKAAGAKYVVLTTKHHEGYTNWPSPVSWN  155

Query  141  YNSVEGAAKRDLLGDLNTAVKKSGLK  166
            +NS +    RDL+G+L TA++K  ++
Sbjct  156  WNSKDVGPHRDLVGELGTAIRKRNIR  181


>sp|Q99LJ1.1|FUCO_MOUSE RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor [Mus musculus]
Length=452

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 97/148 (66%), Gaps = 4/148 (3%)

Query  19   KDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDSTRL  78
            + + P+W+SLDSRP P W+ +AKFG+F+HWG++SVPAWG    +  W  + + +      
Sbjct  21   RRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQ----  76

Query  79   KYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKES  138
            ++  ENY   F Y DF   F +  + P++WAELF+ +GAKY+VLT+KHH+GF  WPS  S
Sbjct  77   RFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVS  136

Query  139  NGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
              +NS +    RDL+G+L  AV+K  ++
Sbjct  137  WNWNSKDVGPHRDLVGELGAAVRKRNIR  164


>sp|P49713.2|FUCO_CAEEL RecName: Full=Putative alpha-L-fucosidase; AltName: Full=Alpha-L-fucoside 
fucohydrolase; Flags: Precursor [Caenorhabditis 
elegans]
Length=482

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 3/160 (2%)

Query  6    FGLILLSVMSLIAKDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEW  65
            F +  +  + L   DY P+WESLD+RP P WY D+KFGIF HWGLYSVPA+  R  +  W
Sbjct  3    FLIFSILFLHLANCDYTPDWESLDNRPLPSWYDDSKFGIFCHWGLYSVPAF--RSEWMWW  60

Query  66   YLNGLKSGDSTRLKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSK  125
            Y  G +  D   + + ++NY     Y DF K F +E +   ++AE  K SGA+Y V TSK
Sbjct  61   YWKGTQP-DKDVVNFVDKNYKPGTTYADFAKDFTAEYFNANQFAETVKTSGARYFVFTSK  119

Query  126  HHDGFCLWPSKESNGYNSVEGAAKRDLLGDLNTAVKKSGL  165
            HH+GF +WPS+ S  +NS++   KRD++G+L  A KK+ +
Sbjct  120  HHEGFTMWPSRTSWNWNSMDIGPKRDIVGELRDAFKKTDV  159


>sp|P04066.4|FUCO_HUMAN RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor [Homo sapiens]
Length=466

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 4/148 (3%)

Query  19   KDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDSTRL  78
            + Y P+W SLDSRP P W+ +AKFG+FIHWG++SVPAWG    +  W+  G   G     
Sbjct  35   RRYTPDWPSLDSRPLPAWFDEAKFGVFIHWGVFSVPAWG--SEWFWWHWQG--EGRPQYQ  90

Query  79   KYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKES  138
            ++  +NY   F Y DF   F +  + PE+WA+LF+ +GAKY+VLT+KHH+GF  WPS  S
Sbjct  91   RFMRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHEGFTNWPSPVS  150

Query  139  NGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
              +NS +    RDL+G+L TA++K  ++
Sbjct  151  WNWNSKDVGPHRDLVGELGTALRKRNIR  178


>sp|Q60HF8.1|FUCO_MACFA RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor
Length=468

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 97/149 (65%), Gaps = 6/149 (4%)

Query  19   KDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYL-NGLKSGDSTR  77
            + Y P+W SLDSRP P W+ +AKFG+FIHWG++SVPAWG     +EW+  N    G    
Sbjct  37   RRYTPDWPSLDSRPLPSWFDEAKFGVFIHWGVFSVPAWG-----SEWFWWNWQGEGRPQY  91

Query  78   LKYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKE  137
             ++  +NY     Y DF   F +  + PE+WA+LF+ +GAKY+VLT+KHH+GF  WPS  
Sbjct  92   QRFMRDNYPPGSSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHEGFTNWPSPV  151

Query  138  SNGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
            S  +NS +    RDL+G+L TA++K  ++
Sbjct  152  SWNWNSKDVGPHRDLVGELGTALRKRNIR  180


>sp|C3YWU0.2|FUCO_BRAFL RecName: Full=Alpha-L-fucosidase; AltName: Full=Alpha-L-fucoside 
fucohydrolase; Flags: Precursor
Length=449

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 7/145 (5%)

Query  21   YEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSG-DSTRLK  79
            Y P W+SLD RP P WY +AKFGIF+HWG++SVP++G     +EW+    K   D   +K
Sbjct  18   YAPTWDSLDQRPLPSWYDEAKFGIFMHWGVFSVPSFG-----SEWFWWDWKGAHDQNFIK  72

Query  80   -YHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKES  138
             + + NY   F Y DF  +F +E Y P +WAE+ + SGAKY+VLTSKHH+GF  WPSK S
Sbjct  73   DFMKRNYPPGFRYADFAPMFTAEWYNPLQWAEVLQASGAKYVVLTSKHHEGFTNWPSKYS  132

Query  139  NGYNSVEGAAKRDLLGDLNTAVKKS  163
              +NSV+    RDL+G+L  A++ +
Sbjct  133  WNWNSVDNGPHRDLVGELAMAIRNN  157


>sp|P48300.1|FUCO_CANFA RecName: Full=Tissue alpha-L-fucosidase; AltName: Full=Alpha-L-fucosidase 
I; AltName: Full=Alpha-L-fucoside fucohydrolase 
1; Short=Alpha-L-fucosidase 1; Flags: Precursor [Canis lupus 
familiaris]
Length=465

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 94/148 (64%), Gaps = 4/148 (3%)

Query  19   KDYEPNWESLDSRPTPQWYKDAKFGIFIHWGLYSVPAWGPRGSYAEWYLNGLKSGDSTRL  78
            + Y P+W+SLDSRP P W+  AKFG+F+HWG ++VPAWG    +  W   GL   +    
Sbjct  35   RRYTPDWQSLDSRPLPDWFDKAKFGVFVHWGEFAVPAWGSEWFWWHWKGEGLPQYE----  90

Query  79   KYHEENYGKDFPYRDFIKLFKSEKYEPEKWAELFKESGAKYIVLTSKHHDGFCLWPSKES  138
            ++  ENY   F Y DF   F +  + P+ WA+LF+ +GA+Y+VLT+KHH+GF  WPS  S
Sbjct  91   QFMSENYPPGFSYADFGPQFTARFFHPDTWADLFQAAGARYVVLTTKHHEGFTNWPSSVS  150

Query  139  NGYNSVEGAAKRDLLGDLNTAVKKSGLK  166
              +NS +    RDL+G+L  A++K  ++
Sbjct  151  WNWNSNDVGPHRDLVGELGRALRKRNIR  178