TO85D 4661040

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 85D_scaffold8_1
Annotathon code: TO85D_4661040
Sample :
  • GPS :-62,243679N -49,182663E
  •  : Ushuaia-Puerto Williams station 85 DCM -
  • (-DCMm, 0°C, 0.2-3 microns)
Authors
Team : BioCell2014
Username : BG-L3BC
Annotated on : 2015-02-02 17:38:32
  • belgacem amira
  • guerziz maeva

Synopsis

Genomic Sequence

>85D_scaffold8_1 TO85D_4661040 Genomic DNA
AATAATTCTGTTTGAGCAAAATCTCTTGCTGCATCCCTAATCATCTTGTGTTCTTCCGTCAATTCGAAATTCATTATTGGCTTTTATTTAAATTTACGCA
AAAGTACATTTTTTAAACTATTTTTGGAAACTGATGACTAAGAAAATAAAATACACAGCCTTAGGTATTATGTCCGGCACCTCGCTAGATGGAATTGACC
TTGCAATATGCACCTTTACTAAAAATCAGGTTTGGGAATACAGAATTGAAAAGTCAAACACTCTAAAATATCCTATTTACTGGAAATCAAAATTAGAAAC
TTTACATACTCAAAATAAAGCTACAATTGAACAAGCTAATATTCAATTTGGACAATATGTTGGGGAAATAATCAATGTATTTCTGGATGGTGAAAAAATA
GATTTTATTGCTTCACATGGGCACACCATATTTCATCAGCCAGAAAACAACTACACGCTACAAATCGGTTGCGGAAAAACTATTTCTCAAACTACAAAAA
CAACAACTATTAATGACTTTAGAAGTTTAGACATCTTCCTCAATGGGCAAGGGGCTCCATTAGTTCCAATTGGTGATTTATTGCTTTTTCCAAAACATAA
ATATTGTATTAATATTGGTGGATTTGCCAATATATCCATAAAAAATAATGAGGAAATTATTGCATTTGATATTTGCCCAGCCAATATAGTTTTAAATGAT
ATTTGTAAAAAATTAGGATTTGAGTACGACTATAATGGAAATATTTCTCGAAAAGGGGAAATTGTTCCAGCACTTTTACATCAACTTAATCAGTTAGATT
TTTATATAAAAAAAGCTCCAAAATCATTAGGAAGAGAATGGGTTGAAGAACATATTTTTCCAATACTTAAAAACCAAAAACCTGAAGATTTGCTTTGTAC
ATTTTGTGAACATACAGCTATTCAAATAGGTAAATTTTTAACAGATGAATCAGCACTATTTACAGGTGGTGGAGTGTTTAATTCGTTTTTAATGGAGCGG
ATAACATTTTATTCTAAGTCAGAAATACTTGTGCCAAACAAAGAATTAATTGAATTTAAAGAATCCTTGATTTTTGCTTT

Translation

[134 - 1078/1080]   direct strand
>TO85D_4661040 Translation [134-1078   direct strand]
MTKKIKYTALGIMSGTSLDGIDLAICTFTKNQVWEYRIEKSNTLKYPIYWKSKLETLHTQNKATIEQANIQFGQYVGEIINVFLDGEKIDFIASHGHTIF
HQPENNYTLQIGCGKTISQTTKTTTINDFRSLDIFLNGQGAPLVPIGDLLLFPKHKYCINIGGFANISIKNNEEIIAFDICPANIVLNDICKKLGFEYDY
NGNISRKGEIVPALLHQLNQLDFYIKKAPKSLGREWVEEHIFPILKNQKPEDLLCTFCEHTAIQIGKFLTDESALFTGGGVFNSFLMERITFYSKSEILV
PNKELIEFKESLIFA

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Nous avons choisi d'annoter l'ORF 1 car il était le plus long donc avait le plus de chance d'être codant.  Cet ORF de coordonnées 92 – 1078 est de 1003 nucléotides soit 334 acides aminés. Il est situé sur le brin direct. D’après l’alignement au format CLUSTAL et au format GBLOCKS, la première méthionine de la séquence protéique correspondante est le 14ème acide aminé et l'ORF est tronqué en 3'. Il manquerait potentiellement 90 nucléotides.


Cet ORF est codant car d’après les résultats du blastp, il présente beaucoup d’homologues dans la banque de données NR (4779) dont les e-values s’étendent de 5e-131 à 9,9 mais également dans la banque de données SP (219) pour lesquels les e-values varient de 2e-43 à 9. D'après les résultats obtenus pour le BLASTp contre NR, le BLASTp contre swissprot, et la recherche des domaines protéiques avec InterProScan, on pense que la protéine putative a une fonction d'anhydro-N-acetylmuramic acid kinase car c'est la fonction la plus repésentée et associée aux meilleures e-valeurs (5e-131 à e-10). D'après les fiches d'annotations des BLAST contre swissprot, on a prédit le processus biologique réalisé par la protéine à savoir un processus de métabolisme des carbohydrates. Elle est importante pour le recyclage de la paroi cellulaire notamment pour son implication dans la voie de biosynthèse de la N-acétylglucosamine-phosphate. Nous avons pas pu déterminer le symbole du gène codant notre protéine avec les fiches des Blastp (symbole du gène ANMK).


Le rapport taxonomique nous a permis de déterminer notre groupe d'étude (bacteroidetes) et notre groupe extérieur (toutes les autres bactéries) pour inférer un arbre phylogénétique.

Dans l'ensemble, les bactéroidetes avaient de meilleures e-value (de l'ordre de e-90) que le reste des bactéries (de l'ordre de e-40). Cependant, en comparant nos e-value nous nous sommes rendues compte que les 3 meilleures (5e-131, 2e-111, 8e-105) correspondaient à des séquences homologues de protéobactéries. Nous avons donc pensé que les bacteroidetes ont pu à un moment dans le passé, probablement récent, réalisé un transfert horizontal de gène vers quelques protéobactéries à savoir les 3 qui présentent les meilleures e-value. Dans l'arbre on retrouvait bien notre ORF plus proche parent des 3 protéobactéries en question et dans le groupe des bactéroidetes. Une erreur d'annotation pourrait aussi avoir été commise à propos de l'appartenance taxonomique des 3 séquences des protéobactéries qui est mal identifiée.

Puisque l'ORF est plus proche parent d'une des protéobactéries que des bactéroidetes, nous ne pouvons savoir si notre ORF est une protéobactérie qui aurait subi un transfert horizontal ou si notre ORF est une bacteroidete. De plus, en prenant comme groupê d'étude l'ensemble des bactéries et en groupe extérieur les eucaryotes, nous avons obtenu un arbre dans lequel l'ORF partage un ancêtre commun avec des bactéries et des eucaryotes. Ainsi en ce qui concerne l'origine taxonomique de l'ORF, on ne peut prédire ni l’ordre, ni la classe, ni le phylum d’appartenance de notre ORF.






ORF finding

PROTOCOLE:

a) SMS -> ORF finder/ initiation : any codon / cadre : 1+2+3/ brin : direct / minimum : 60 / code génétique: standard

b) SMS -> ORF finder/ initiation : any codon / cadre : 1+2+3/ brin : inverse / minimum : 60 / code génétique: standard


ANALYSE DES RÉSULTATS:


            ________________________________________________________________________________________________________________

            |Taille         |  Taille  |  Brin | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

            | (nucléotides) |   (aa)   |       | de début  |   de fin   |     en 5'     |     en 3'     |blast NR EV<1E-10 |

___________|______________ |__________|_______|___________|____________|_______________|_______________|__________________|

|           |               |          |       |           |            |               |               |                  |      

|  ORF 1    |    1003       |   334    |direct |    92     |    1078    |      oui      |      non      |       4832       |

|  frame 2  |               |          |       |           |            |               |               |                  |

|___________|_______________|__________|_______|___________|____________|_______________|_______________|__________________|      

|           |               |          |       |           |            |               |               |                  |      

|  ORF 2    |     247       |    81    |inverse|     352   |     594    |      oui      |      oui      |        0         |

|  frame 1  |               |          |       |           |            |               |               |                  |

|___________|_______________|__________|_______|___________|____________|_______________|_______________|__________________|



  L'ORF 1 est long (1003 nucléotides). La protéine putative aurait une taille de 334 acides aminés. Il y a de grandes chances pour qu'il soit codant et non dû au hasard. L'ORF 1 ne commence pas par un codon initiateur car on a utilisé comme paramètres ORF finder initiation : any codon (ORF débute après un codon stop). On déterminera plus tard la position de la méthionine initiatrice lors de l’alignement multiple. Toutefois, on peut identifier les différents codons initiateurs potentiels (ATG). L'ORF 1 présente 16 codons initiateurs potentiels aux positions suivantes: 42, 79, 99, 118, 270, 288, 299, 330, 428, 458, 565, 614, 653, 758, 867, 914. Pour que la protéine soit pertinente pour notre étude, il faut qu'elle présente une taille d'au moins 100 acides aminés soit 300 paires de bases. Ainsi, les codons initiateurs situés au delà de la position 686 ne sont plus pertinents pour notre analyse. Le codon initiateur situé à la position 653 est le dernier codon acceptable. On ne sait pas vraiment où commence la CDS (Coding DNA séquence : séquence traduite en protéine). La phrase ouverte (ORF) est la région de l'ADN qui sépare 2 codons stop. Dans celle-ci, une séquence codante (CDS) commence par un codon start, se termine par un codon stop et est précédée d'un site de liaison aux ribosomes (RBS). Par contre, on peut dire qu'il est incomplet en 3' du fait qu'il ne se termine pas par un codon stop. De plus, il présente des séquences homologues ce qui nous confirme que l'ORF 1 est une séquence conservée entre les espèces et donc pertinent pour la suite de notre analyse.



   L'ORF 2 est suffisamment long pour être potentiellement codant (81 codons). Pour vérifier notre hypothèse, on a fait un BLAST X pour voir si cet ORF présente des homologues. On obtient cinq séquences présentant des e-value de 1,9 à 8,1. Les scores sont compris entre 35,8 à 33,9. Ainsi, on peut dire clairement que les séquences obtenues ne sont pas homologues avec l'ORF 2 puisque les e-value sont trop élevées et les scores trop bas. Donc on pense que cet ORF n'est pas codant pour une protéine. Cependant, on prend un risque de rejeter un petit gène car les bases de données sont incomplètes. Il n'est pas impossible que ce soit un petit gène inconnu provenant d'un organisme non répertorié (ORFAN). L'ORF 2 est complet en 5' et en 3'. L'ORF 2 ne commence pas par un codon initiateur car on a utilisé comme paramètres ORF finder initiation : any codon (ORF débute après un codon stop).  

  

   L'ORF que l'on souhaite donc analyser est l'ORF 1 : il se trouve sur le brin direct, a une taille de 1003 paires de bases, ce qui représente une protéine putative de 334 acides aminés. On ne peut pour l'instant pas déterminer le poids moléculaire de la protéine car nous ne savons pas encore où se trouve le codon initiateur. De plus, l'ORF 1 est incomplet en 3' (pas de codon stop). Cela pose également un problème pour le calcul du poids moléculaire de la protéine. L'ORF 1 présente 16 codons initiateurs potentiels dont 13 acceptables pour obtenir une protéine analysable.

RÉSULTATS BRUTS:

 a) brin direct : 

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 92 to base 1078.
ATTTACGCAAAAGTACATTTTTTAAACTATTTTTGGAAACTGATGACTAAGAAAATAAAA
TACACAGCCTTAGGTATTATGTCCGGCACCTCGCTAGATGGAATTGACCTTGCAATATGC
ACCTTTACTAAAAATCAGGTTTGGGAATACAGAATTGAAAAGTCAAACACTCTAAAATAT
CCTATTTACTGGAAATCAAAATTAGAAACTTTACATACTCAAAATAAAGCTACAATTGAA
CAAGCTAATATTCAATTTGGACAATATGTTGGGGAAATAATCAATGTATTTCTGGATGGT
GAAAAAATAGATTTTATTGCTTCACATGGGCACACCATATTTCATCAGCCAGAAAACAAC
TACACGCTACAAATCGGTTGCGGAAAAACTATTTCTCAAACTACAAAAACAACAACTATT
AATGACTTTAGAAGTTTAGACATCTTCCTCAATGGGCAAGGGGCTCCATTAGTTCCAATT
GGTGATTTATTGCTTTTTCCAAAACATAAATATTGTATTAATATTGGTGGATTTGCCAAT
ATATCCATAAAAAATAATGAGGAAATTATTGCATTTGATATTTGCCCAGCCAATATAGTT
TTAAATGATATTTGTAAAAAATTAGGATTTGAGTACGACTATAATGGAAATATTTCTCGA
AAAGGGGAAATTGTTCCAGCACTTTTACATCAACTTAATCAGTTAGATTTTTATATAAAA
AAAGCTCCAAAATCATTAGGAAGAGAATGGGTTGAAGAACATATTTTTCCAATACTTAAA
AACCAAAAACCTGAAGATTTGCTTTGTACATTTTGTGAACATACAGCTATTCAAATAGGT
AAATTTTTAACAGATGAATCAGCACTATTTACAGGTGGTGGAGTGTTTAATTCGTTTTTA
ATGGAGCGGATAACATTTTATTCTAAGTCAGAAATACTTGTGCCAAACAAAGAATTAATT
GAATTTAAAGAATCCTTGATTTTTGCT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
IYAKVHFLNYFWKLMTKKIKYTALGIMSGTSLDGIDLAICTFTKNQVWEYRIEKSNTLKY
PIYWKSKLETLHTQNKATIEQANIQFGQYVGEIINVFLDGEKIDFIASHGHTIFHQPENN
YTLQIGCGKTISQTTKTTTINDFRSLDIFLNGQGAPLVPIGDLLLFPKHKYCINIGGFAN
ISIKNNEEIIAFDICPANIVLNDICKKLGFEYDYNGNISRKGEIVPALLHQLNQLDFYIK
KAPKSLGREWVEEHIFPILKNQKPEDLLCTFCEHTAIQIGKFLTDESALFTGGGVFNSFL
MERITFYSKSEILVPNKELIEFKESLIFA

No ORFs were found in reading frame 3.

b) brin reverse:

>ORF number 1 in reading frame 1 on the reverse strand extends from base 352 to base 594.
TCGTACTCAAATCCTAATTTTTTACAAATATCATTTAAAACTATATTGGCTGGGCAAATA
TCAAATGCAATAATTTCCTCATTATTTTTTATGGATATATTGGCAAATCCACCAATATTA
ATACAATATTTATGTTTTGGAAAAAGCAATAAATCACCAATTGGAACTAATGGAGCCCCT
TGCCCATTGAGGAAGATGTCTAAACTTCTAAAGTCATTAATAGTTGTTGTTTTTGTAGTT
TGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SYSNPNFLQISFKTILAGQISNAIISSLFFMDILANPPILIQYLCFGKSNKSPIGTNGAP
CPLRKMSKLLKSLIVVVFVV*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:

Phylogeny.fr: multiple alignement: MUSCLE/ paramètres par défaut


Etape de nettoyage (curation)

Gblocks/ paramètres: "allow smaller final blocks" et "allow less strict flancking position"




ANALYSE DES RÉSULTATS:


   On peut déterminer à partir de l’alignement multiple la position de la première méthionine correspondant au codon initiateur de la séquence de l'ORF. Elle correspond au 14ème acide aminé de la séquence protéique de la protéine putative. En effet, la méthionine de la séquence de la protéine putative s'aligne avec la première méthionine de six autres séquences. On a la confirmation que la protéine est tronquée en 3' car les séquences utilisées dans l'alignement multiple continuent à s'aligner entre elles contrairement à la séquence de l'ORF qui s'arrête environ entre 30 à 62 acides aminés avant toutes les autres séquences. On peut, toutefois, faire une approximation du nombre d'acides aminés manquants à l'extrémité 3' par comparaison aux autres séquences homologues alignées. Ainsi, la plupart des séquences homologues se terminent environ 30 acides aminés en aval de la séquence de la protéine putative. On peut supposer que l'ORF est tronqué en 3' de 30*3 nucléotides soit 90.


On pourrait calculer un poids moléculaire hypothétique avec les hypothèses tirées de l'analyse des BLAST:


-la première méthionine est le 14ème acide aminé

-la protéine putative est tronqué en C-terminal de 30 acides aminés


Donc notre protéine putative aurait une taille de (334-13+30)_ 351 acides aminés. Le poids moléculaire d'un acide aminé est d'environ 110Da. Le poids hypothétique de la protéine putative serait de 351*110_38,61kDa.



   Il y a 135 positions conservées soit 29% sur la longueur de la séquence ce qui est satisfaisant en ce qui concerne l'homologie entre les séquences. De plus, il y a 9 domaines conservés dont le plus grand (noté 3 sur les résultats GBlock) compte 45 acides aminés. Le domaine 1 s'étend de la position 25 à la position 36, le domaine 2 de la position 123 à la position 132, le domaine 3 de la position 150 à la position 194, le domaine 4 de la position 210 à la position 216, le domaine 5 de la position 236 à la position 241, le domaine 6 de la position 259 à la position 278, le domaine 7 de la position 286 à la position 297, le domaine 8 de la position 320 à la position 333, le domaine 9 de la position 356 à la position 364.


Parmi ces domaines, certaines séquences sont toutes très conservées les unes par rapport aux autres ce qui va rendre l'inférence phylogénétique compliquée à réaliser. En effet, l'inférence phylogénétique se fait sur les différences entre les séquences homologues. Ainsi, notre arbre ne va probablement pas nous permettre de distinguer clairement l'appartenance de notre ORF à un groupe phylogénétique. Toutefois, notre alignement est excellent pour défendre l'homologie de ces séquences puisque de nombreux acides aminés sont conservés entre toutes les séquences choisies.  


   On ne voit pas de nettes distinctions entre le groupe d'étude et le groupe d'extérieur mais on distingue deux sous groupes au niveau de l'alignement: un groupe composé en majorité de Bacteroidetes et un autre composé en majorité de protéobactéries. Cependant, on remarque que l'ORF à une séquence plus conservée avec les bacteroidetes qu'avec les protéobactéries tout comme les 3 séquences des protéobactéries qui présentaient les meilleures e-value. Ce résultat est en accord avec notre choix de groupe d'étude (bacteroidetes).





Alignement réalisé avec le groupe d'étude des bactéries et le groupe extérieur des eucaryotes


   On peut déterminer à partir de l’alignement multiple la position de la première méthionine correspondant au codon initiateur de la séquence de l'ORF. Elle correspond au 14ème acide aminé de la séquence protéique de la protéine putative. En effet, la méthionine de la séquence de la protéine putative s'aligne avec la première méthionine de trois autres séquences. On a la confirmation que la protéine est tronquée en 3' car les séquences utilisées dans l'alignement multiple continuent à s’aligner entre elles contrairement à la séquence de l'ORF qui s'arrête environ entre 30 à 62 acides aminés avant toutes les autres séquences. On peut, toutefois, faire une approximation du nombre d'acides aminés manquants à l'extrémité 3' par comparaison aux autres séquences homologues alignées. Ainsi, la plupart des séquences homologues se terminent environ 30 acides aminés en aval de la séquence de la protéine putative. On peut supposer que l'ORF est tronqué en 3' de 30*3 nucléotides soit 90.


   Il y a 128 positions conservées soit 26% sur la longueur de la séquence ce qui est satisfaisant en ce qui concerne l'homologie entre les séquences. De plus, il y a 10 domaines conservés dont le plus grand (noté 3 sur les résultats GBlock) compte 43 acides aminés. Le domaine 1 s'étend de la position 34 à la position 43, le domaine 2 de la position 139 à la position 147, le domaine 3 de la position 160 à la position 203, le domaine 4 de la position 218 à la position 224, le domaine 5 de la position 246 à la position 251, le domaine 6 de la position 269 à la position 288, le domaine 7 de la position 295 à la position 307, le domaine 8 de la position 332 à la position 336, le domaine 9 de la position 371 à la position 379, le domaine 10 de la position 409 à la position 413.


Parmi ces domaines, certaines séquences sont toutes très conservées les unes par rapport aux autres ce qui va rendre l'inférence phylogénétique compliquée à réaliser. En effet, l'inférence phylogénétique se fait sur les différences entre les séquences homologues. Ainsi, notre arbre ne va probablement pas nous permettre de distinguer clairement l'appartenance de notre ORF à un groupe phylogénétique. Toutefois, notre alignement est excellent pour défendre l'homologie de ces séquences puisque de nombreux acides aminés sont conservés entre toutes les séquences choisies.  


   On ne voit pas de nettes distinctions entre le groupe d'étude et le groupe d'extérieur mais on distingue deux sous groupes au niveau de l'alignement: un groupe composé en majorité de Bacteroidetes et un autre composé en majorité de protéobactéries. Cependant, on remarque que l'ORF à une séquence plus conservée avec les bacteroidetes qu'avec les protéobactéries tout comme les 3 séquences des protéobactéries qui présentaient les meilleures e-value. Ce résultat est en accord avec notre choix de groupe d'étude (bacteroidetes).



RÉSULTATS BRUTS:

Alignement multiple avec MUSCLE

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


B.B.Fla_5       -----------------MKIHKVLGLMSGTSLDGLDLAYCHIWKKF------DQWKFEIK
B.B.Sph_1       ------------------MIYRAIGVMSGSSLDGLDIAFVEFHENG------GKWQFEIQ
B.B.Sph_2       ------------------MIYRAIGLMSGSSLDGLDIVFAEIHENG------GRWSYSIV
B.B.Cyt_3       --------------MMTKNQYQTIGLMSGTSGDGLDIAYCEFEKT-------ESWQYKIL
B.B.Cyt_5       --------------MKPVKTYEAIGLMSGTSGDGLDIAYCTFWKN-------DKWHFEIV
B.B.Cyt_6       --------------MEQPRIYPMIGLMSGTSCDGLDMVAVTFEETS------STWNYGIH
B.B.Cyt_2       ---------------MASNTYNMIGLMSGTSGDGLDVAFVNFNKE-------NQWLFEIE
B.B.Cyt_4       ---------------MHTTTYPIIGLMSGTSGDGLDIAFCLFHYD-------GTWTFEMP
B.B.Pro_1       ----------------MKKSITALGLMSGTSLDGIDLALCSFDNNE------SGWSFRVE
BPr2_E-val      --------------MTKIDNYSVIGVMSGTSLDGLDIIKCTFQKG-------DEWSFKIE
ORF             IYAKVHFLNYFWKLMTKKIKYTALGIMSGTSLDGIDLAICTFTKN-------QVWEYRIE
BPr1_E-val      --------------MLDNIKYNVLGVMSGTSLDGIDFVLCTFSKN-------KYWQFKIK
B.B.Cyt_1       -------------MAETTASYTVLGVMSGTSLDGLDLACCHLEKQG------NGYQFHIQ
B.B.Bac_1       ---------------MDDFQIQAIGLMSGTSLDGLDVCCCTFRRKA------GKWSFHID
B.Pro           ----------------MKSIYNVLGVMSGTSIDGIDLCYCCFTLD-------REWTYEII
B.B.Fla_3       ---------------MIKSSYNIIGVMSGTSLDGIDLAHITFEVG-------NKWTFTIR
B.B.Fla_4       ---------------MQNKTYNIVGVMSGTSLDGVDLAHINFSVEN------GKWKFQIF
B.B.Fla_2       ---------------MIINETFAIGLMSGTSLDGIDLVYVCFQND-------DAKSFKIL
B.B.Fla_1       ------------------MRFQAIGLMSGTSLDGLDICFAAFEKQ-------NGWNFQIL
B.Pr.Alp_1      -----------------MEPIWALGLMSGTSLDGIDAALILTD---------GEQIYEFG
B.Th.The_1      ------MYWADFLKLLDKKKRTIAGLMSGTSADGLDIAVVSFDGAS------RETKFKLL
B.Te.Mol_1      ----------------MNTSKLACGIMSGTSLDGIDVAIASISGSG------LETKIEFI
B.F.Clo_1       --------------------MLAVGLMSGTSLDGIDAALVEIKGSG------INTKVDLL
B.Pr.Zet_1      --------------MSPADTPLLLGIMSGTSGDGIDVAIVRFDRH-------ADNKPELI
B.Pr.Gam_5      -------------------MSLYIGLMSGTSMDGIDAALLELPSN------------QLI
B.Pr.Gam_1      ------------------MDFFYIGVMSGSSLDGIDIALLK-----------QDDRSRLL
B.Pr.Bet_3      ----------------MATPQHFIGLMSGTSVDGVDGVLARLR---------DGQPPQVL
B.Pr.Bet_1      -----------MNSGHTYEAEHYVGLMSGTSLDGVDAALAEIGSAG---------QVRLL
B.Pr.Bet_2      -----------------MSTELYIGMMSGTSMDGVDAVIAEL----------DGHSCHVR
B.Pr.Eps_1      -----------------MNKERYIGIMSGTSLDGVDVVLCEI----------DKKSCLLK
B.Pr.Gam_4      --------------------MYYIGVMSGTSLDGVDLALMDF----------FCVQPQLI
B.Pr.Gam_2      ----------------MMSRELYIGVMSGTSMDGVDTALVAI----------DGHHLELL
B.Pr.Gam_3      -----------------MKSGRYIGVMSGTSLDGVDVVLAAI----------DQHMVAQQ
B.F.Bac_1       ----------------MKLVNHAVGMMSGTSLDGIDVAIVEIVEED------GDIELRLK
B.D.Dei_1       --------------------MRVLGLMSGTSADGVDLVLAALEGRP------PHLTWQVR
B.Pl.Pla_1      ----MSPILQRLLELSAKPARIVLGLISGTSADAISVAICRIKGGGIPTPGNPGAEVELI
B.Act.Act       --------------------MRVLGMQSGTSMDGVDAAVLEIEPVA------EGIELRLG
B.C.Chr_1       --------------------MIVVGLMSGTSVDGIDASVVDIQGQG------LDLKVNLL
B.Pr.Del_1      ----------MDSRPPPPNSRLCVGLLSGTSVDAVEAVLCRVEGTG------PEVRISLV
B.Ar.Cht_1      -------MSVHPILYNVQKPVFMVGLMSGTSVDGVHAALIEIDGEA------QQLRWKLL
B.Aci.Aci       -------------MTAKKKSMLVAGIMSGTSADGIDVALCRISPAR------PRPRIELV
B.C.Glo_1       -----------------MAAALAIGLMSGTSLDGIDAALIAIEGSA------EQPEVETL
                                        *: **:* *.:                         

B.B.Fla_5       ETRGISYDNEMRDRLKNSIAL-----PADQLLIFHNTYGSWLGQQSREFIEEKDLDV---
B.B.Sph_1       HTDCQPYAPEWKAKLENAITL-----SALEYQLLHADYGHYIGRQVNAFIEQNALQY-KI
B.B.Sph_2       AADCYPYSAEWAGRLQSATSL-----NALDYQLLHAEYGAYLGAEVNRFIGEKGLDY-KV
B.B.Cyt_3       RSETVPFPKKMGKELQNSHKL-----KGLKLSHLDVAFGKWMGEMVREFCGKNHLQP---
B.B.Cyt_5       QAETIAFPSKLAQKLRQSHLL-----SAEQLALLDVDFGAWMGTQVREFCEKHRLAP---
B.B.Cyt_6       AAETSAFPTKLGKNLSTCHLL-----SAIDLAVLDVDFGKWMGEEVAAFCKKTKFAP---
B.B.Cyt_2       EAKTYTFPDYLGKKLINSHLL-----PALDLALLDVEFGRWMGEKVREFCEEFELKP---
B.B.Cyt_4       HSATLTFPDTLAYQLSNSHML-----SGEALRLLDVAFGKWIGEKVRVFCHDHDLSP---
B.B.Pro_1       ASETVPYSAKWKRKLREAENS-----SAQDILLLHNEYARYTGEVINRFLDGKT-KP---
BPr2_E-val      KGITKKYSKNWLELLKKSHEK-----SSKEIQINDNIYGDYIGKQVSSFIKKNDFKI---
ORF             KSNTLKYPIYWKSKLETLHTQ-----NKATIEQANIQFGQYVGEIINVFLDGEKI-----
BPr1_E-val      KTQTIKYTNYWKLKLGDLHKK-----DINEISRTDVEYGKLIANEINKFIVNEKI-----
B.B.Cyt_1       QATTIPYSAAWQHTLGTLVHS-----SALELQEAHINLGRYIGQEVRKFMEQHQLKP---
B.B.Bac_1       CAKGYGYPEELKYKLGTGAQNM----SALEFITFHSAYGSFLGKRVNEFMQEFGVRP---
B.Pro           KCETISYDNYWFEKLSTAVLL-----SKPEISLLNNEYTFFLASVVNQFIHNNNLTN--I
B.B.Fla_3       NAETVAYPEIWKHKLSNLVNY-----NLEALKIIDEEYTIYLADVINDFLRKYQLNT--M
B.B.Fla_4       ESETVAYSEEWVSQLKNAVSF-----SDAELIVLNEKYTVLLAEIISDFIKKNKIEA--L
B.B.Fla_2       HAETIPYSKEWKLLLQNAIFS-----DEATLQELDITYGQFLGGILNNFISNYKITK--I
B.B.Fla_1       KAETLPYPENWEEKLRNSIHL-----SSEELLELHSEYGFYLGEKVREFIDNNHLEQ--I
B.Pr.Alp_1      ESLYVPYDADFQTQLRSQLG------QQFPDPQIARQSTQHHGEVVKQLLSQTNKPV---
B.Th.The_1      DFRSFDYPETFKKRIIETYDPSKS--TVKDVTFMNFEIARIHAAMLKQLSQE-------I
B.Te.Mol_1      SGKTYPYPRAIYEKVKLAIEDKL---SIRDLSSLNFELGKLYADVVKDLCSLNKIQTSSL
B.F.Clo_1       EFETFKIPSEIKNEIKKACLEDKS--SVDLICSLNFKLGNLFADAVIDILNRANIDIEQL
B.Pr.Zet_1      RFSELPMPAQLREPILRLASPGEDANEIDSMGPLDRQLGEAYAEAALTAIKLAGLEPADI
B.Pr.Gam_5      HGITKQYSDDVRRNLDNLIMGNHL--TLASICQLNTLIGREFAEAVRQLLIEIKVHPKEI
B.Pr.Gam_1      ATHYIPMPEDLHAELLGLCSSGVD--ELARAAIAEQKWCRLVAQGVQTLLEDQNMVPAQI
B.Pr.Bet_3      ASASLSMPAALRAEFLALNLAGDD--ELARAALAANELARLYAQVVADLLAGAKLQARDV
B.Pr.Bet_1      HSHYLPYPDALRTRLLGLHTPQPD--EIHLAAIAANELARLYADTVKSLLD--GFTAGRV
B.Pr.Bet_2      HTYSIPYSAELRAALLDLHTPAHN--ELELAASAANQLAHLYAETVRALLASAYVDKSRI
B.Pr.Eps_1      ASVEYPFPDDLKKEILSMINGKC---TLAQVGSVDVRLGILFSDAVNALLEIEKIDPKSI
B.Pr.Gam_4      HADFYPMPPAIRQQISALCNSGAT--TLQALGELDHQLGLLYTECIQQFLQKYQLSPEQI
B.Pr.Gam_2      AHDDFPMPADLKQRLLDVCLGQQT--NLIEVSELDHLLGHLFADAVNTLLEKSGYNAGQI
B.Pr.Gam_3      ASYCHPIPLALRQQVLAICQGQTL--TLSQLGQLDTRLGQLFAEAVLTLMQQQALEASDI
B.F.Bac_1       YFDMVTYHDAVKQELLKLCDPSKA--TIQMISTMNMLFGTLFAEAANQVIKEAGLRNEDI
B.D.Dei_1       AYREARFPPGLRLEVLQALKDRA---STRQVALLHHALGRFYAEVAAPFRGQA-------
B.Pl.Pla_1      QYYEHPYAASVRRQVFGAADL-----NVRTIAELHVQVGELFADACLSAIQAAKLTPEEI
B.Act.Act       ASRTVPYPDWLRAELGSAVAGAAL--DARTLCLLDTELGKVFGSIAAEF--------DRV
B.C.Chr_1       VGQTFPYSSALRSQILAVCEGKSL--TMAEFAQLDHAIALEFAQAVINIIPKNT----KI
B.Pr.Del_1      AHVSRPFTPEFTRRVLAAN-------DARSLCELNFALGEHFAAAALEVIARAGLRPRDV
B.Ar.Cht_1      GWYYLPWEPELKSEILAACRPDT---PLQKVVLLNYRIAEVFAEAAKKVIAQCGLKTEQI
B.Aci.Aci       RHRAFPYPAVLRKAVLAAMNAPKT--SAAELARLNWRLGEAYGDAVQAAAQGYAL-----
B.C.Glo_1       ATLAVPYPAGLRERLLPVAEGEAV--SVGAISALHRDVAIAFAEAAQQVIEAAGLSGAAI
                              .                                             

B.B.Fla_5       DIIASHGHTTHHK------PQQG---M--TFQIGSGQHLANGSRHKTVCDFRTNDIALGG
B.B.Sph_1       AVIGSHGHTTFHL------PERG---L--TGQIGDGAAIAAETDLPVVSDLRAMDVALGG
B.B.Sph_2       ALISSHGHTTFHV------PVKR---M--TAQLGDGAAIAAATKLPVVSDLRAMDVALGG
B.B.Cyt_3       EFVSSHGHTVFHQ------PAKG---L--SLQIGNGWALHQASGLPVINDFRMLDVQLGG
B.B.Cyt_5       LTVCSHGHTVFHQ------PHLG---M--TKQIGSGWTLRENAGFPVINDFRSFDVALGG
B.B.Cyt_6       LAIASHGHTVFHQ------PENC---L--SMQIGNGWSLYAACGVPVVNDFRSLDVRLGG
B.B.Cyt_2       LAVASHGHTVFHQ------PKLG---L--SKQIGNGWALHAACGLPVINDFRMLDVQLGG
B.B.Cyt_4       IAIASHGHTVFHT------PDVG---N--TFQIGNGWSMHIASGIKVINDFRMLDVQLGG
B.B.Pro_1       ELIASHGHTIFHQ------PEKH---F--TFQLGNGTVIAAETGIKTIADFRNMDVALGG
BPr2_E-val      DFVASHGHTVFHQ------PKNK---I--TLQIGNGQNIADISKSTTISDFRSLDINLNG
ORF             DFIASHGHTIFHQ------PENN---Y--TLQIGCGKTISQTTKTTTINDFRSLDIFLNG
BPr1_E-val      EIIACHGHTIFHQ------PENK---Y--TLQIGDGKTISRKTGITTVNNFRNLDVALNG
B.B.Cyt_1       ELVSSHGHTIFHQ------PQKG---F--SLQIGDGYHIMVESGCPVANDFRSLDIALGG
B.B.Bac_1       DIIASHGHTIFHE------PQRK---I--MYQIGDGAAIAAETRIPTVSDFRRLDIMLGG
B.Pro           DFVSSHGHTVFHK------PKSN---Y--TFQLGNLIEFRNLISFPVVCDFRIQDIQLGG
B.B.Fla_3       DVICSHGHTALHQ------PEHN---L--TYQIGNLPSLAKLIGNTVVCDFRIQDVKFNG
B.B.Fla_4       DAVCSHGHTILHQ------PQNG---F--TLQIGNLPEIATLTNQKVVCDFRVQDVKMGG
B.B.Fla_2       DFIASHGHTILHQ------PEKG---I--TLQIGNGQEIAKITNQKVVCDFRTQDVKLGG
B.B.Fla_1       DLIASHGHTVFHQ------PQKK---F--TLQIGDGRAIKIETSLPVIYDFRSQDVLMGG
B.Pr.Alp_1      KLIGYHGQSTFHA------PPI-------TVQMGDGEMLARTVGVPVVYDFRTADCAAGG
B.Th.The_1      DAIGYHGQTVYHL------PENG---A--TLQIGEADVIAVETNLPVIHSFRTKDVALGG
B.Te.Mol_1      SFIASHGQTIYHQAYG---DESR---APSTLQIGHGSVISNLTQTTVVSDFRVADMIAGG
B.F.Clo_1       DYIASHGQTIYHI------PKDREGLVKSTLQIGEASVIAYKTNTLVISNFRVMDMAANG
B.Pr.Zet_1      AAIGCHGQTIRHR------PEGE---YPFTLQIGCAATLAERTGITIVSDFRSRDMAAGG
B.Pr.Gam_5      QAIGSHGQTVCHD------TSGS---IPYTLQLGCGHTISSLTGITVVADFRTRDLVNGG
B.Pr.Gam_1      RAIGSHGQTIRHE------PARG---Y--SIQIGNPALLAELTEITVVSDFRRRDIAAGG
B.Pr.Bet_3      AAIGAHGQTVRHR------PDSG---Y--TVQLNAPALLAELTGIDVVADFRSRDVAAGG
B.Pr.Bet_1      RAIGCHGQTLRHR------PADG---Y--TLQIGNAALLAELTGIAVVADFRSRDIAAGG
B.Pr.Bet_2      RAIGCHGQTIRHR------PELG---F--TLQLGNAALLAELLDMTVIADFRSRDVAAGG
B.Pr.Eps_1      KAIGSHGQTLWHE------PVGK---YPFSMQLGDPSAIAVRTGIKVVADFRQKDMALGG
B.Pr.Gam_4      TAIGCHGQTVWHS------PNSH---YPFTMQIGDANLIAAKTGITTVADFRRKDMAFGG
B.Pr.Gam_2      RAIGNHGQTVFHQ------PSGD---APFTMQLGDANIIATKTGIDTVADFRRKDMALGG
B.Pr.Gam_3      MAIGCHGQTVWHE------PQSA---APNTLQIGDNNQIAAATGVTVVGDFRRRDMALGG
B.F.Bac_1       DFISSHGQTIFHQPEKVNIAGHP---VTSTLQIGDISVIAEQTGITTVGDFRTRDMAVGG
B.D.Dei_1       DLAALHGQTLWHE------PPQA------TLQIGEPAYLAEALGVPVVSDFRPADLALGG
B.Pl.Pla_1      DLIGSHGQTLYHHSSMPGVPRA-------TLQVGDGDQIAERTGICVISDFRSRDIAAGG
B.Act.Act       DLVASMGQTLYHL------VEDGK--TRGTLQLGQPAWIAERAGVPVVADFRPRDVAAGG
B.C.Chr_1       DLIGSHGQTVYHQ------PPHKNE-LGYSLQLGRGDVIFQKTGIQTINNFRVADIALGG
B.Pr.Del_1      DVIGSHGQTVAHL------PASLSE-TPSTLQLGEPAVIAERTGLPVVSDFRTRDVAAGG
B.Ar.Cht_1      DAIASHGQTIWHQAEPMLLVGRL---TRGTLQIGEPAVIAASTGCMVIADFRAADIAVGG
B.Aci.Aci       DLVGCHGQTIYHQ--GIAKPYGGRS-IACTWQFGEPALIAAAAHAPVVSNFRPADMVAGG
B.C.Glo_1       ACIGSHGQTVHHQ------PPTGSA-PGHTLQLGEGAWIAERTGVTTVSNFRSRDMAAGG
                      *::  *                   *..    :          .:*  *   .*

B.B.Fla_5       EGAPLAPIGDQLFFGKYDFC--------LNLGGISNVSFEYDG-------KRIAYDIGLA
B.B.Sph_1       QGAPIVPIGEKLLFSDYRYF--------LNLGGIANLSIKET--------DYKAFDICAA
B.B.Sph_2       QGAPIVPIGEQLLLSGYNYF--------LNLGGIANISRHTEG-------HYAAFDVCAA
B.B.Cyt_3       QGAPLVPIGDQLLFSKYDYC--------LNLGGIANISMEKGG-------LRTAFDICPF
B.B.Cyt_5       QGAPLAPVGDHLLFPDYEGC--------LNLGGISNISMVYKG-------QRIAFDVSPF
B.B.Cyt_6       QGAPLVPIGDKLLFPEYDFC--------LNLGGIANISYQVDG-------RQVAFDVSPF
B.B.Cyt_2       QGAPLVPIGDQLLFPQVDFC--------INLGGISNISFQKGN-------NRVAFDMSPF
B.B.Cyt_4       QGAPLVPIGDSLLFPQYDYC--------LNLGGIANISFHNGP-------NLVAYDVCPF
B.B.Pro_1       QGAPLVPMGDRLLFAEYDYC--------LNLGGFSNISYEEGG-------QRIAFDIGPA
BPr2_E-val      QGAPLVPIGDLMLFPQYKYC--------LNLGGFANISIKRKD-------KIKAYDVCPA
ORF             QGAPLVPIGDLLLFPKHKYC--------INIGGFANISIKNNE-------EIIAFDICPA
BPr1_E-val      QGAPLVPIGDLYLFPDYKYC--------VNLGGFANISIKKNN-------LIKAFDICPA
B.B.Cyt_1       QGAPLVPVGDELLFGTYDFC--------LNLGGIANVSARRQG-------KRVAFDICPV
B.B.Bac_1       QGAPLVPIGDRLLFADYDYC--------LNIGGFSNISFEQDG-------KRIAFDISPV
B.Pro           QGAPLVPIGDLLLFKDYKYC--------INLGGFSNLSVKSEN-------EIIAYDICPV
B.B.Fla_3       QGAPLVPIGDRLLFSGYDNC--------INLGGFANISSEEDN-------KRIAYDICPV
B.B.Fla_4       QGAPLVPIGDRILFSDYEYC--------LNLGGFSNVSFEENG-------NRIAFDVSPV
B.B.Fla_2       QGAPLVPIGDELLFSEYDFC--------VNLGGFSNVSYHKDN-------KRIAFDICPV
B.B.Fla_1       NGAPLVPIGDEFLFSEYDAC--------LNLGGFSNISLKEDG-------KRIAFDIAPV
B.Pr.Alp_1      QGAPLVPIYHQVLFRHKNHP-----LVVVNIGGVANLTYSDGE-------VLIAGDTGPG
B.Th.The_1      EGAPITAYFDWVFFKRPHTV-------VLNIGGIANITYIND--------VVLAFDTGPG
B.Te.Mol_1      QGAPLVPFVDYCLFSDPNKN-----RILQNIGGISNITFLSKSLKKE---DVLAFDTGPG
B.F.Clo_1       EGAPLVPYTEYILYSEKEKG-----IALQNIGGIGNVTVLPESNLID---DIFAFDTGPG
B.Pr.Zet_1      EGAPLVPFAHQSLFGTIDEN-----VVVLNIGGIANITWLGADG------SVTGFDTGPG
B.Pr.Gam_5      QGAPFAPLYHQQIFSKVNES-----VAVVNIGGIANVTFIAKNQ------MTRGWDIGPG
B.Pr.Gam_1      QGAPLVPAFHEALFDDNKDH-----RAVLNIGGFSNLSLIESDR------PVEGFDCGPG
B.Pr.Bet_3      QGAPLVPPFHAAVFGAPHGR------AVLNLGGIANVTLLAPDQ------PPRGFDTGPA
B.Pr.Bet_1      QGAPLVPAFHAQVLRHPDVH-----RVIANIGGIANITDLPTSG------SVRGWDTGPG
B.Pr.Bet_2      QGAPLVPAFHQAVFAHPQAN-----RAVINIGGIANITDLPSAG------EVRGFDSGPG
B.Pr.Eps_1      QGAPFAPAFHAFLFGGTDAS-----VSILNIGGMANITVLGK--------TLLGYDTGPG
B.Pr.Gam_4      QGAPLVPAFHQALFRKPNQA-----TVVLNVGGISNISRLLPNE------EVIGYDTGPG
B.Pr.Gam_2      QGAPLVPAFHKTIFQSSDSS-----VVILNIGGIANISVIRPEQ------PVIGFDTGPG
B.Pr.Gam_3      QGAPLVPAFHQALLMDSVER-----RMVLNIGGIANLSLLIPGQ------PVRGFDTGPG
B.F.Bac_1       QGAPLAPYADYLLFRDKEKG-----RVLVNIGGISNMSILPKDCDEN---DVVAYDTGPG
B.D.Dei_1       EAAPLVPYPDLLLYGQSGVA-----RAIHNLGGISNLTYLPADLDPA---KVLAFDTGPG
B.Pl.Pla_1      EGAPLTPFSDLILYAGPAGASANRRRVILNLGGIANVTILDPDPD-----RVFGFDTGPA
B.Act.Act       QGAPLVPVLDELLLRGFGGSVP---MACVNIGGIANITVVAPGG------PTFGYDTGPG
B.C.Chr_1       QGAPLVSKIDLCLYHHPRHS-----RCLQNIGGIGNATYLPSTHTPQWQEKIIGWDTGPG
B.Pr.Del_1      QGAPLVPYLDWALFRKPGVA-----RALQNIGGIGNVSVVSERIE-----DTIAFDTGPG
B.Ar.Cht_1      QGAPLVPVADRLLFGSDKET-----RVVQNIGGIANATYLPQGCQAREDAEIIAFDTGPG
B.Aci.Aci       QGAPLVPLLDATLFAHPRRA-----RVLQNLGGIANLTLVPAGGNLD---QLIAFDTGPA
B.C.Glo_1       QGAPLVPLVDYLLLRHPERA-----RCIQNLGGIGNVTYLPAGATPK---QVLAFDTGPA
                :.**:..     .                *:**..* :               . *    

B.B.Fla_5       NMLLNHITQKIG---LSYDNNGMLARKGVINMDMLKQLN-NL-SYYELPYPKSTGYEWFV
B.B.Sph_1       NRVLNVLAGELG---KEYDADGDLARSGNINNALLQELN-GL-SYYNQPAPKSLANDFGI
B.B.Sph_2       NRVLNMLAQTAG---HTYDAGGQLAASGAINKKLLEELD-EL-SYYRESAPKSLANDFGT
B.B.Cyt_3       NLLLNHFAGELG---SPFDKDGAFARSGKLLPKLMETLN-DI-PFYRKIEAKSLGREDIA
B.B.Cyt_5       NLLLNEIAARKG---LAYDDRGMLAATGKVNTTFLEQLN-AI-DFYTSKNAKSLGREEIE
B.B.Cyt_6       NLLLNHFANKLG---HPFDRDGRLAEAGVVNHLLLKQLN-EL-PYYQVQGAKSLGREQID
B.B.Cyt_2       NMLLNPEANKLG---LAYDEGGKESRKGELNLPLFTQLN-EL-PFYIQKGAKSLGREDIE
B.B.Cyt_4       NLLLNHFAAKTG---VTYDENGKMAKSGKPIPELENKLN-EL-AFYKKSGSKSLGREDID
B.B.Pro_1       NIVLNFLSQQVG---KEYDRNSLIAQSGKVNIALLNELN-KL-AFYREKPPKSLGKEWLD
BPr2_E-val      NIILNYFTRRLG---KEYDKNGLIGQKGICDLKLLDQLN-NL-KYYSIEKPKSLSREWLE
ORF             NIVLNDICKKLG---FEYDYNGNISRKGEIVPALLHQLN-QL-DFYIKKAPKSLGREWVE
BPr1_E-val      NIVLNKICKSID---TEYDDNGNNARKGKILPIFLDKLN-KL-EFYKSSKPKSLSREWVL
B.B.Cyt_1       NMVLNYLAKREG---QAYDAGGEMAAKGKKDDALLQKLN-SL-DFYRQEGPKSLGYEWVN
B.B.Bac_1       NYVINHYCRQIG---LEFDRDGEIARRGAICRPLLDELN-GM-EFYHQSGPKSLGREWVE
B.Pro           NIVLNKYSRKIG---YEFDKNGSISKSGVINAKLLTDLN-DL-SFYSLKHPKSLGLEWVD
B.B.Fla_3       NIVMNRFAKKLG---CDYDKGGDLAKFGNVDHSLLKLLN-EI-SYYAHKPPKSLGLEWVE
B.B.Fla_4       NTVLNFYADKLG---LKYDDKGQISKSGSISEVLLSELN-AL-DFYRKSYPKSLGFEFVK
B.B.Fla_2       NIVLNFYANKIG---LAYDASGKIASEGKINETLLGKLN-AL-AFYQQQPPKSLGLEWVQ
B.B.Fla_1       NIVLNRLAQKFN---KNFDENGDLARKGAIDEDLLTKLN-SL-EFYSQSHPKSLGIEWCN
B.Pr.Alp_1      NALINDVMLRDFG--QEFDKNGQTARVGRINPNLLQQWL-QD-PYFSKPFPKSLDRDHFS
B.Th.The_1      NCLIDLYVKESFG--ILFDKDGELARRGKVDDKILHELIRRDQEYLNKRPPKTTGREWYN
B.Te.Mol_1      NMMINRAMEICYQ--LPYDESGKIARTGKNIEALYNEVM-QH-PYFLLLPPKSTGRESFG
B.F.Clo_1       NMAIDEACNILFG--IPYDKDGKIASSGVVNDEMLNELM-KM-KYIHEKPPKTTGREDFG
B.Pr.Zet_1      NMVMDGVMLAITAGRNHYDQNGELAAGGIVCARLLNKLM-AH-PYISRKPPKSTGREAFG
B.Pr.Gam_5      NCLMDAWIYKNKG--ALFDKSGVWASQGEVIHPLLEYLL-QD-PFFHLDSPKSIGKEYFS
B.Pr.Gam_1      NVLLDAWIQSQRH--ESYDKDGEWAASGEVDQALLQKLL-SD-QFFLTKGPKSTGREVFN
B.Pr.Bet_3      NVFLDGWCQRHLG--QSYDADGRWAASGQVLAPLLEQLIASE-PWFALPPPKSTGRDLFN
B.Pr.Bet_1      NMLLDAWIKRHSG--VHYDRDGAWAASGSVHPGLLAALM-RH-AYLQLPPPKSAGREQFN
B.Pr.Bet_2      NMLMDAWTEKHLG--ERYDAGGRWAATGTVIEKLLQQWL-QY-PYFSASPPKSTGRDSFN
B.Pr.Eps_1      NVLMDMWVAEHKD--VTYDRNGEWARSGEVIYPLLEAML-ED-PYFSQPHPKSTGREKFN
B.Pr.Gam_4      NTLLDAWIEKHQG--KAYDKDATWAKSGKVNTDLLADLL-DE-PFFALPAPKSTGRELFN
B.Pr.Gam_2      NMLMDAWCQQHTG--HKFDQDGDFARRGKVCQTLLSTLL-QD-PYFARSAPKSTGRELFN
B.Pr.Gam_3      NMLMDAWIWRHKG--LPFDKDAGWARSGQVVPALLEQML-GD-PWFALPPPKSTGREYFN
B.F.Bac_1       NMIIDYFAQQISNGKISYDVDGKLAAKGNVREEWLKRLL-DN-PYYAEQPPKSTGREHFG
B.D.Dei_1       NCLLDEAAGHLG---LSQDSGGQIAASGKPHPGLLERWL-TH-PYFHRRPPKSTGREVWR
B.Pl.Pla_1      NSLLDRLAVQLSGGELTCDLDGRLARSGTVNAALLDDLLTTD-PFLQRRPPKSTGFEMYG
B.Act.Act       NALLDIAWEQGGDQGSPYDVDAALARTGAVHEPMLRALL-ED-PYYARRPPKSTGKEYFD
B.C.Chr_1       NALIDLAVQELTDNQQTFDFNGDWSRQGKPCQPLVKQWL-KQ-DFFHHKPPKSTGRELFG
B.Pr.Del_1      NMVMDGLARRISGGQLQCDLDGSLSRQGRVIPELLAELL-AH-PFLALPPPRSAGREGFG
B.Ar.Cht_1      NMVMDEIVREMTAGLQEYDREGQWAAQGRIQEDLLAECL-AH-PYFQQPPPKSTGREQFG
B.Aci.Aci       NMVIDALAQRLFG--KPYDRGGRLAAAGTPSEPVLTTLL-RD-PYYRLRPPKSAGREQYG
B.C.Glo_1       NLLIDAVAQQLTG--RPFDRDGALAAAGQVDSRLLAGWL-AD-PYFALPPPKSTGRESFG
                *  ::             *  .  .  *                :     ..:   :   

B.B.Fla_5       EKVAPIVN----ATEDTTENLLHTAVHHICEQVAMQIKTN--A--KKDHSTLLVTGGGAL
B.B.Sph_1       ATVYPLIK----KYEGSVEDQLRTYVEHVVQQVDKALSTDPAY--LRETHQLLVTGGGAL
B.B.Sph_2       DTVYPIIQ----AAGLSVNDALRTYTEHIARQIAAALLTT-GP--VNENAKLLVTGGGAL
B.B.Cyt_3       HDFMKILT----AKSHQPENILHTLALHFTQQIIRTLWRE-----PGKQQSLLVTGGGAF
B.B.Cyt_5       GLFLPLLE----KHNDSEENLLATLVEHYAVQISTVVQQFF----PPANNRLLVTGGGAY
B.B.Cyt_6       RDFLPLVT----NSGVGDQDLLATLSAHMADQVAASIKNG-----KQGNGKLLCTGGGAY
B.B.Cyt_2       ESFLPLIR----KSNLKPRDVLRTLVEHFAFQIGKVILEEK----QQEKPLILITGGGAY
B.B.Cyt_4       KDFIPLLE----KQNENIEDILSTLIAHYTYQISQVI-----I--PRHDHRLLITGGGAY
B.B.Pro_1       SELIPMLK----KSSLTLPDQMRTLYEHIAIQIGEVI---------RNSGTMLVTGGGAH
BPr2_E-val      NNLLNLKA----LQNLEIENILATLYEHIGYQIGKIL----------NEKNVLVTGGGAH
ORF             EHIFPILK------NQKPEDLLCTFCEHTAIQIGKFL----------TDESALFTGGGVF
BPr1_E-val      EHIQPLFT------NDEPQDLLRTFCEHIAIQISHNL----------RDGTALLSGGGTF
B.B.Cyt_1       AAVFPMLE----SATLSTNDLLHTFCLHIAEQLYLAL-LPLAP--VVQKQKLLLTGGGAF
B.B.Bac_1       TQVYPMLE----RYGLSLEDKLRTFYEHAAFQIFRIINAN-PS--SAGNGKLLITGGGAF
B.Pro           KNIFPIID----SYNLTIPDILRTFSEHVSIQVSKTI--------NDKNASILFTGGGVK
B.B.Fla_3       SQVFPILE----SSKISEENILRTFVEHIAIQIAKAF---------NTNSKVLFTGGGSF
B.B.Fla_4       ETVLPMME----KYSIPVEDKLRTFTEHVAFQIASAL--------PEKRGKLLVTGGGAY
B.B.Fla_2       TTIFPLID----ALETDVPSILRTFVAHIAIQISKVI---------TKNNQVLFTGGGVF
B.B.Fla_1       EHIFPLLE------NMETADAMATFTEHVAHQISRII-----N--QKNLQNILFTGGGTY
B.Pr.Alp_1      KFLREAQG----------TEGVATLTALTVHSILMGI---DVL--PKSPQEILVCGGGVK
B.Th.The_1      ERFIEGVE-------KGSFDVLRTLTYFTAFCVHENMKRY-----LPEVERIYVFGGGAF
B.Te.Mol_1      VEYTDQLI--RKYAFEKHEDIVHTFTRITADSITSSIKDFVLK--KSSVDELIISGGGVH
B.F.Clo_1       QRFVEKVI--DKYSELKSEDIIATLTMFTAKSISYNYKKFIIP--NNKLEKVIIAGGGAH
B.Pr.Zet_1      DEIVQRIL---TWPEITDADKMATACRFTVESIAKSC---RFL--PGTPQRWLICGGGAR
B.Pr.Gam_5      LSWLQKHL----KPDYTPADIQATLLALTAHTIAETI---LNE--SGEIKQLYLCGGGAH
B.Pr.Gam_1      LGWVHHHL--FQLPTLTPEDVQATLLELTALTITESL---QSA--QAITKELLVCGGGAH
B.Pr.Bet_3      MRWLDDRLAAYDGPRPAPQDVQATLQRLTARTVANAI---DAA--GTDVRELYVCGGGAC
B.Pr.Bet_1      LDWLDTRL-GSLDEALAPPDVQATLVEFTTMSLADAVNRE-----CTGAQELYVCGGGAY
B.Pr.Bet_2      MAWLEQHL----EYPYAPEDVQRTLLELTARSIANAINDF-----CDNVDEAYICGGGAH
B.Pr.Eps_1      EAWLQKHL-NAQHSTLNAHDVQRTLLELTAVSISNEV-----L--KFNQDILLLCGGGAK
B.Pr.Gam_4      LAWLNKKL--EKHTALLPQDVQATLVELTAQSIVDQLNQI--E--TELDRHLLVCGGGVK
B.Pr.Gam_2      LPWMTQHLA---NQTLKPEDVQRTLCEFTATTIARDVLSF--Q--SGPQPTLLVCGGGAR
B.Pr.Gam_3      LGWVEQQL--QRFPALAPQDVQATLCELTALTIAHQVQL------NDGCDRLLVCGGGSR
B.F.Bac_1       ERYAKKLWDEAEDMSIYPYDRIATVTKLTAITITNEINRY-IV--KSGIREVFISGGGSY
B.D.Dei_1       LEHLEGTQ------TVSPPDLLASLTELTARSIAQAYRDF-IL--PKGLDEVWVAGGGAY
B.Pl.Pla_1      DAFLERAV---AAHGRRDHDLMATLTEFTARSITKALDRF-VV--DPPVGEIIVAGGGAR
B.Act.Act       ARMIGPYR------ELPLADLLATLTELTAIPIARAC-----A--EHRVAEVLLSGGGAA
B.C.Chr_1       HHYLAHCRQDAQHYNLSDADWLATITELTVASIADSYHRF--L--PSLPHEVILAGGGSR
B.Pr.Del_1      DALVERLW--ERHGASRPHDLMATAVAFTVEATARAYERWLMP--RFALEAVYVSGGGTR
B.Ar.Cht_1      KAYVQWFCQRARELGLRWEDMLATASALTVESIAQAYERWLLP--KAPIHRVIVGGGGVH
B.Aci.Aci       TSFVERLLALARQRRLSPHDTLAAATALTSRSIALAWRLFLAPHLAGTSVDYIVAGGGAR
B.C.Glo_1       YARAGQLL--AEAAHLSPADLLATVSELTVESIARAYGDW--L--PTAPAEVFLGGGGVR
                                   .   :                               ***  

B.B.Fla_5       NTFMMELLQSYLEP---VVNLVIPEKKLIEYKEALIFALMGVLRVEQEINVLKSVTGAST
B.B.Sph_1       NRFLIERMENQLHA-----KVVVPEKDLVQFKEAMIMALIAVLRWREENTVLSSVTGAKR
B.B.Sph_2       NTFLIERLRVSLDA--IGIAVEVPADELVNYKEALIMALIGVLRWREENNVLSSVTGASR
B.B.Cyt_3       NTFFMEKLQEELGN---EILIEKADPQIIGFKEALIFAFLGVLKVRGENNCLASVTGASR
B.B.Cyt_5       HAFFIDQLQKKLGN---ETTVIVPEPSIVEFKEALIFAFLGVLRINNEINTLAAVTGASR
B.B.Cyt_6       NAFFIHQLREKTKG---HVEITVPSAHLVEFKEALIFALLGVLRLTGRPNCLASVTGASK
B.B.Cyt_2       HEFFEERLSHYLHQ---EWEKYAASSELIEFKEALIFAFLGILRLQREVNSLSSVTGASR
B.B.Cyt_4       HSYFIDQLKLALEG---KVQVVLPDRTLIDFKEALIFGFLGVLRLRGEINCLSTVTGASR
B.B.Pro_1       NPLLMERITACSKA-----EVIIPQNEIIDFKEALIFAFLGVLANEHQINCLAAVTGASR
BPr2_E-val      NHFLIEKIKQYSKS-----KIIIPSKEIIDFKEALIFGFIGVLKLRNEVNCLKEVTGADR
ORF             NSFLMERITFYSKS-----EILVPNKELIEFKESLIFA----------------------
BPr1_E-val      NSFLVERIKHYSTS-----KIIIPNNTIINFKEAIIFGFLGVLKVRNEVNCLRSVTGADM
B.B.Cyt_1       NTFLIDLLKEKLEP--LNIMVVVPERQIIEYKEALIFALLGVLRLRGEINCLASVTGARR
B.B.Bac_1       NKFLVERIEALCPC-----QIVIPGRQIIEYKEALIFAFLGALYMADEPGCLASVTGASM
B.Pro           NNFLFSLIRKRLPN-----SFCKPNNDLIDFKEALIFGFLGVLKIRNEVNCLKSVTGALK
B.B.Fla_3       NNFLLERIKAQKYF-----ELILPSNEIIEFKEALIFGLLGVLKLRGEVNCLSSVTGADC
B.B.Fla_4       NDFLIERMQIYLPE----MQIVIPDAKTIEFKEALIFGLLGVLRLRNEANVLASVTGAMH
B.B.Fla_2       NTFLMDEIQQHAKS-----RISLPTKELIDYKEALIFAFLGLLKVTNQINCLQSVTGASK
B.B.Fla_1       NSFLIEKIKEKTES-----AIIIPEKEIIDFKEALIFAFMGVLRLNNEINVLASATGSTA
B.Pr.Alp_1      NKTLMALLGKKAAP--------LPDSEMIEAQA---FAFLAVRVLRGLPTSFPTTTGCRV
B.Th.The_1      NKLLLEDLMR------FGYRVFVPNRTFAKAREAICMALLANEFLNGVTTGMPSVTGAKR
B.Te.Mol_1      NKFLVELISKGLPG--IKVLSTDDINFSSDFKEALAFIILGNQTLLGLTSNLKEATGAVK
B.F.Clo_1       NKTLIKFIKEELEG--IEVLIQEDLGFSSDAKEAIAFAVLGNETLNNNFSNVPSATGANE
B.Pr.Zet_1      NHHLMQQLTQVLAP--AEVLPSDAAGMPAQAVEAASFAMLARATLTGEYNTLSAVTGASH
B.Pr.Gam_5      NTHLKENLARLLPG--IAVKSIVELGISPDYLEAMMFAWLAAQTINQIPVNLTSITGAKS
B.Pr.Gam_1      NKALMKRLAELLPD--TEVSSTEKFGVDPDWVEAMAFAWLAHCCLEGVPANRPTVTGAKG
B.Pr.Bet_3      NPGLMRELAYCLQR---PVHATDALGVPAQQVEALAFAWLAQAFLARRPAGLPGVTGARG
B.Pr.Bet_1      NRTLMQRLSALLPS--LRVATTATLGIDPDWVEALAFAWLARQMLHHAPGNLPAVTGARG
B.Pr.Bet_2      NSLLLERLQEVLPA--IKIRLSDSLGIGVNWVEAAAFAWLAQQCMEGKPANLPAVTGAKG
B.Pr.Eps_1      NAFLVERLGTLMPN------IQIGIANDADNIEAMTFAWLAYKRLHNEHVDLKDVTGARQ
B.Pr.Gam_4      NCLLMARLTTLLPR--WQVQTTNDYGLDADYVEAAAFAWLAYQRLNDLPGNLPSVTGAKS
B.Pr.Gam_2      NPLLMERLTALLSD--WQVSTTSDKGIDSDYMEAMAFAWLAQRRIHNLPSNLPEVTGASR
B.Pr.Gam_3      NPLLMARLAAHLSG--TEVGTTDQAGISGDDMEALAFAWLAFRTLSGLPGNLPAVTGARE
B.F.Bac_1       NPVLMQAISNGLPP-KVVVRKLDEIGMPADAKEAMVFALLGYQYLNKRTNNLPKATGAKQ
B.D.Dei_1       NTTLMRRLKALLPV---TVYTFEERGLHAKHREALCFAVLGYLRYLEQPNTLAQVTGAQK
B.Pl.Pla_1      NPALMERIRANMNP--VPVRDSEEVGVSSSAREAMAFALFANEALLGHPTSLPSVTGART
B.Act.Act       NPLLCARIGEHLRG-KTVVRTSAEAGLPVDAKEAVLAGLLGWLTWHGVAGNVPSATGADA
B.C.Chr_1       NSYLIERLQSYLLD--THLLTSDELGISSEFKESIAFAILAYWHVHNFAGNLPCVTGAKK
B.Pr.Del_1      NPVLMERLTARLAP--LPVRPLDVLGLPEGAKEAVCFALLANEHLSGTPANVPSATGAKR
B.Ar.Cht_1      NRWLMQQLQRRLAP--MTLSTHEEFGVPDDAKEAIAFALLGYLTLRGMPGNLPSATGATR
B.Aci.Aci       NQTLMRMLATDLAPFHCRIQTTDDLGIPSEAKEAVAFALLAWHTWHRVPGNVPAATGAAH
B.C.Glo_1       NRYLVRRLRERLAP--ATVASTAEVGIDSDFKEAIAFAVLAWLRCSNRPGNLPSVSGAAR
                :  :   :                                                    

B.B.Fla_5       DSSSGVVYLPS-----------------------------
B.B.Sph_1       DSAGGAMWLGALD---------------------------
B.B.Sph_2       NSVGGAMWMGQED---------------------------
B.B.Cyt_3       DNSGGSVFGM------------------------------
B.B.Cyt_5       DSCGGVYYP-------------------------------
B.B.Cyt_6       DSCGGTLFGLIS----------------------------
B.B.Cyt_2       DSSGGTVYP-------------------------------
B.B.Cyt_4       DSIGGVIYG-------------------------------
B.B.Pro_1       DNTGGTIHLS------------------------------
BPr2_E-val      DNIGGEIFQPN-----------------------------
ORF             ----------------------------------------
BPr1_E-val      DNCGGIIHEP------------------------------
B.B.Cyt_1       NSCGGQLYGKI-----------------------------
B.B.Bac_1       DNIGGILFKV------------------------------
B.Pro           DHSSGIIFE-------------------------------
B.B.Fla_3       DHSSGVIYYP------------------------------
B.B.Fla_4       DHCSGEIYEFSL----------------------------
B.B.Fla_2       DHSSGVIFYP------------------------------
B.B.Fla_1       DHSSGLIC--------------------------------
B.Pr.Alp_1      PVCGGRLVYPESFSTQR-----------------------
B.Th.The_1      PAVLGKIAFPW-----------------------------
B.Te.Mol_1      NVILGTVSYYT-----------------------------
B.F.Clo_1       KVILGQITMSPRIF--------------------------
B.Pr.Zet_1      DVCGGEITPGDNWTTLLQELPRWIR---------------
B.Pr.Gam_5      IAILGAVYPIIKSY--------------------------
B.Pr.Gam_1      RRVLGAIYPA------------------------------
B.Pr.Bet_3      ARILGALYPA------------------------------
B.Pr.Bet_1      ERVLGAIYPA------------------------------
B.Pr.Bet_2      PRILGAIYAR------------------------------
B.Pr.Eps_1      NAILGGVYV-------------------------------
B.Pr.Gam_4      AVSLGAIYPKEKDVAA------------------------
B.Pr.Gam_2      LASLGVLYFA------------------------------
B.Pr.Gam_3      LSVLGAIYPANPHAIR------------------------
B.F.Bac_1       KVMMGKVAWGKGRR--------------------------
B.D.Dei_1       NALAGKITLPAPAGA-------------------------
B.Pl.Pla_1      PVILGKWSFPSA----------------------------
B.Act.Act       PRVLGSITPAGTGARLGEPRPGPPEWLRVVATSEGEGTGR
B.C.Chr_1       EVVLGVSHKE------------------------------
B.Pr.Del_1      RVVLGKLTP-------------------------------
B.Ar.Cht_1      PVVLGKIVFP------------------------------
B.Aci.Aci       PAILGQVTYV------------------------------
B.C.Glo_1       AVLLGDVHPGR-----------------------------

_________________________________________________________________________________________
                                                        
G Block:


Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 42
Alignment assumed to be: Protein
New number of positions: 135 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  -----------------MKIHKVLGLMSGTSLDGLDLAYCHIWKKF------DQWKFEIK
Bac_Bac_Sph_1_E  ------------------MIYRAIGVMSGSSLDGLDIAFVEFHENG------GKWQFEIQ
Bac_Bac_Sph_2_E  ------------------MIYRAIGLMSGSSLDGLDIVFAEIHENG------GRWSYSIV
Bac_Bac_Cyt_3_E  --------------MMTKNQYQTIGLMSGTSGDGLDIAYCEFEKT-------ESWQYKIL
Bac_Bac_Cyt_5_E  --------------MKPVKTYEAIGLMSGTSGDGLDIAYCTFWKN-------DKWHFEIV
Bac_Bac_Cyt_6_E  --------------MEQPRIYPMIGLMSGTSCDGLDMVAVTFEETS------STWNYGIH
Bac_Bac_Cyt_2_E  ---------------MASNTYNMIGLMSGTSGDGLDVAFVNFNKE-------NQWLFEIE
Bac_Bac_Cyt_4_E  ---------------MHTTTYPIIGLMSGTSGDGLDIAFCLFHYD-------GTWTFEMP
Bac_Bac_Pro_1_E  ----------------MKKSITALGLMSGTSLDGIDLALCSFDNNE------SGWSFRVE
Bac_Pro_2_E-val  --------------MTKIDNYSVIGVMSGTSLDGLDIIKCTFQKG-------DEWSFKIE
ORF              IYAKVHFLNYFWKLMTKKIKYTALGIMSGTSLDGIDLAICTFTKN-------QVWEYRIE
Bac_Pro_1_E-val  --------------MLDNIKYNVLGVMSGTSLDGIDFVLCTFSKN-------KYWQFKIK
Bac_Bac_Cyt_1_E  -------------MAETTASYTVLGVMSGTSLDGLDLACCHLEKQG------NGYQFHIQ
Bac_Bac_Bac_1_E  ---------------MDDFQIQAIGLMSGTSLDGLDVCCCTFRRKA------GKWSFHID
Bac_Pro_3_E-val  ----------------MKSIYNVLGVMSGTSIDGIDLCYCCFTLD-------REWTYEII
Bac_Bac_Fla_3_E  ---------------MIKSSYNIIGVMSGTSLDGIDLAHITFEVG-------NKWTFTIR
Bac_Bac_Fla_4_E  ---------------MQNKTYNIVGVMSGTSLDGVDLAHINFSVEN------GKWKFQIF
Bac_Bac_Fla_2_E  ---------------MIINETFAIGLMSGTSLDGIDLVYVCFQND-------DAKSFKIL
Bac_Bac_Fla_1_E  ------------------MRFQAIGLMSGTSLDGLDICFAAFEKQ-------NGWNFQIL
Bac_Pro_Alp_1_E  -----------------MEPIWALGLMSGTSLDGIDAALILTD---------GEQIYEFG
Bac_The_The_1_E  ------MYWADFLKLLDKKKRTIAGLMSGTSADGLDIAVVSFDGAS------RETKFKLL
Bac_Ten_Mol_1_E  ----------------MNTSKLACGIMSGTSLDGIDVAIASISGSG------LETKIEFI
Bac_Fir_Clo_1_E  --------------------MLAVGLMSGTSLDGIDAALVEIKGSG------INTKVDLL
Bac_Pro_Zet_1_E  --------------MSPADTPLLLGIMSGTSGDGIDVAIVRFDRH-------ADNKPELI
Bac_Pro_Gam_5_E  -------------------MSLYIGLMSGTSMDGIDAALLELPSN------------QLI
Bac_Pro_Gam_1_E  ------------------MDFFYIGVMSGSSLDGIDIALLK-----------QDDRSRLL
Bac_Pro_Bet_3_E  ----------------MATPQHFIGLMSGTSVDGVDGVLARLR---------DGQPPQVL
Bac_Pro_Bet_1_E  -----------MNSGHTYEAEHYVGLMSGTSLDGVDAALAEIGSAG---------QVRLL
Bac_Pro_Bet_2_E  -----------------MSTELYIGMMSGTSMDGVDAVIAEL----------DGHSCHVR
Bac_Pro_Eps_1_E  -----------------MNKERYIGIMSGTSLDGVDVVLCEI----------DKKSCLLK
Bac_Pro_Gam_4_E  --------------------MYYIGVMSGTSLDGVDLALMDF----------FCVQPQLI
Bac_Pro_Gam_2_E  ----------------MMSRELYIGVMSGTSMDGVDTALVAI----------DGHHLELL
Bac_Pro_Gam_3_E  -----------------MKSGRYIGVMSGTSLDGVDVVLAAI----------DQHMVAQQ
Bac_Fir_Bac_1_E  ----------------MKLVNHAVGMMSGTSLDGIDVAIVEIVEED------GDIELRLK
Bac_Dei_Dei_1_E  --------------------MRVLGLMSGTSADGVDLVLAALEGRP------PHLTWQVR
Bac_Pla_Pla_1_E  ----MSPILQRLLELSAKPARIVLGLISGTSADAISVAICRIKGGGIPTPGNPGAEVELI
Bac_Act_Act_1_E  --------------------MRVLGMQSGTSMDGVDAAVLEIEPVA------EGIELRLG
Bac_Cya_Chr_1_E  --------------------MIVVGLMSGTSVDGIDASVVDIQGQG------LDLKVNLL
Bac_Pro_Del_1_E  ----------MDSRPPPPNSRLCVGLLSGTSVDAVEAVLCRVEGTG------PEVRISLV
Bac_Arm_Cht_1_E  -------MSVHPILYNVQKPVFMVGLMSGTSVDGVHAALIEIDGEA------QQLRWKLL
Bac_Aci_Aci_1_E  -------------MTAKKKSMLVAGIMSGTSADGIDVALCRISPAR------PRPRIELV
Bac_Cya_Glo_1_E  -----------------MAAALAIGLMSGTSLDGIDAALIAIEGSA------EQPEVETL
                                         ############                        
                                         <=====1====>

                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  ETRGISYDNEMRDRLKNSIAL-----PADQLLIFHNTYGSWLGQQSREFIEEKDLDV---
Bac_Bac_Sph_1_E  HTDCQPYAPEWKAKLENAITL-----SALEYQLLHADYGHYIGRQVNAFIEQNALQY-KI
Bac_Bac_Sph_2_E  AADCYPYSAEWAGRLQSATSL-----NALDYQLLHAEYGAYLGAEVNRFIGEKGLDY-KV
Bac_Bac_Cyt_3_E  RSETVPFPKKMGKELQNSHKL-----KGLKLSHLDVAFGKWMGEMVREFCGKNHLQP---
Bac_Bac_Cyt_5_E  QAETIAFPSKLAQKLRQSHLL-----SAEQLALLDVDFGAWMGTQVREFCEKHRLAP---
Bac_Bac_Cyt_6_E  AAETSAFPTKLGKNLSTCHLL-----SAIDLAVLDVDFGKWMGEEVAAFCKKTKFAP---
Bac_Bac_Cyt_2_E  EAKTYTFPDYLGKKLINSHLL-----PALDLALLDVEFGRWMGEKVREFCEEFELKP---
Bac_Bac_Cyt_4_E  HSATLTFPDTLAYQLSNSHML-----SGEALRLLDVAFGKWIGEKVRVFCHDHDLSP---
Bac_Bac_Pro_1_E  ASETVPYSAKWKRKLREAENS-----SAQDILLLHNEYARYTGEVINRFLDGKT-KP---
Bac_Pro_2_E-val  KGITKKYSKNWLELLKKSHEK-----SSKEIQINDNIYGDYIGKQVSSFIKKNDFKI---
ORF              KSNTLKYPIYWKSKLETLHTQ-----NKATIEQANIQFGQYVGEIINVFLDGEKI-----
Bac_Pro_1_E-val  KTQTIKYTNYWKLKLGDLHKK-----DINEISRTDVEYGKLIANEINKFIVNEKI-----
Bac_Bac_Cyt_1_E  QATTIPYSAAWQHTLGTLVHS-----SALELQEAHINLGRYIGQEVRKFMEQHQLKP---
Bac_Bac_Bac_1_E  CAKGYGYPEELKYKLGTGAQNM----SALEFITFHSAYGSFLGKRVNEFMQEFGVRP---
Bac_Pro_3_E-val  KCETISYDNYWFEKLSTAVLL-----SKPEISLLNNEYTFFLASVVNQFIHNNNLTN--I
Bac_Bac_Fla_3_E  NAETVAYPEIWKHKLSNLVNY-----NLEALKIIDEEYTIYLADVINDFLRKYQLNT--M
Bac_Bac_Fla_4_E  ESETVAYSEEWVSQLKNAVSF-----SDAELIVLNEKYTVLLAEIISDFIKKNKIEA--L
Bac_Bac_Fla_2_E  HAETIPYSKEWKLLLQNAIFS-----DEATLQELDITYGQFLGGILNNFISNYKITK--I
Bac_Bac_Fla_1_E  KAETLPYPENWEEKLRNSIHL-----SSEELLELHSEYGFYLGEKVREFIDNNHLEQ--I
Bac_Pro_Alp_1_E  ESLYVPYDADFQTQLRSQLG------QQFPDPQIARQSTQHHGEVVKQLLSQTNKPV---
Bac_The_The_1_E  DFRSFDYPETFKKRIIETYDPSKS--TVKDVTFMNFEIARIHAAMLKQLSQE-------I
Bac_Ten_Mol_1_E  SGKTYPYPRAIYEKVKLAIEDKL---SIRDLSSLNFELGKLYADVVKDLCSLNKIQTSSL
Bac_Fir_Clo_1_E  EFETFKIPSEIKNEIKKACLEDKS--SVDLICSLNFKLGNLFADAVIDILNRANIDIEQL
Bac_Pro_Zet_1_E  RFSELPMPAQLREPILRLASPGEDANEIDSMGPLDRQLGEAYAEAALTAIKLAGLEPADI
Bac_Pro_Gam_5_E  HGITKQYSDDVRRNLDNLIMGNHL--TLASICQLNTLIGREFAEAVRQLLIEIKVHPKEI
Bac_Pro_Gam_1_E  ATHYIPMPEDLHAELLGLCSSGVD--ELARAAIAEQKWCRLVAQGVQTLLEDQNMVPAQI
Bac_Pro_Bet_3_E  ASASLSMPAALRAEFLALNLAGDD--ELARAALAANELARLYAQVVADLLAGAKLQARDV
Bac_Pro_Bet_1_E  HSHYLPYPDALRTRLLGLHTPQPD--EIHLAAIAANELARLYADTVKSLLD--GFTAGRV
Bac_Pro_Bet_2_E  HTYSIPYSAELRAALLDLHTPAHN--ELELAASAANQLAHLYAETVRALLASAYVDKSRI
Bac_Pro_Eps_1_E  ASVEYPFPDDLKKEILSMINGKC---TLAQVGSVDVRLGILFSDAVNALLEIEKIDPKSI
Bac_Pro_Gam_4_E  HADFYPMPPAIRQQISALCNSGAT--TLQALGELDHQLGLLYTECIQQFLQKYQLSPEQI
Bac_Pro_Gam_2_E  AHDDFPMPADLKQRLLDVCLGQQT--NLIEVSELDHLLGHLFADAVNTLLEKSGYNAGQI
Bac_Pro_Gam_3_E  ASYCHPIPLALRQQVLAICQGQTL--TLSQLGQLDTRLGQLFAEAVLTLMQQQALEASDI
Bac_Fir_Bac_1_E  YFDMVTYHDAVKQELLKLCDPSKA--TIQMISTMNMLFGTLFAEAANQVIKEAGLRNEDI
Bac_Dei_Dei_1_E  AYREARFPPGLRLEVLQALKDRA---STRQVALLHHALGRFYAEVAAPFRGQA-------
Bac_Pla_Pla_1_E  QYYEHPYAASVRRQVFGAADL-----NVRTIAELHVQVGELFADACLSAIQAAKLTPEEI
Bac_Act_Act_1_E  ASRTVPYPDWLRAELGSAVAGAAL--DARTLCLLDTELGKVFGSIAAEF--------DRV
Bac_Cya_Chr_1_E  VGQTFPYSSALRSQILAVCEGKSL--TMAEFAQLDHAIALEFAQAVINIIPKNT----KI
Bac_Pro_Del_1_E  AHVSRPFTPEFTRRVLAAN-------DARSLCELNFALGEHFAAAALEVIARAGLRPRDV
Bac_Arm_Cht_1_E  GWYYLPWEPELKSEILAACRPDT---PLQKVVLLNYRIAEVFAEAAKKVIAQCGLKTEQI
Bac_Aci_Aci_1_E  RHRAFPYPAVLRKAVLAAMNAPKT--SAAELARLNWRLGEAYGDAVQAAAQGYAL-----
Bac_Cya_Glo_1_E  ATLAVPYPAGLRERLLPVAEGEAV--SVGAISALHRDVAIAFAEAAQQVIEAAGLSGAAI
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  DIIASHGHTTHHK------PQQG---M--TFQIGSGQHLANGSRHKTVCDFRTNDIALGG
Bac_Bac_Sph_1_E  AVIGSHGHTTFHL------PERG---L--TGQIGDGAAIAAETDLPVVSDLRAMDVALGG
Bac_Bac_Sph_2_E  ALISSHGHTTFHV------PVKR---M--TAQLGDGAAIAAATKLPVVSDLRAMDVALGG
Bac_Bac_Cyt_3_E  EFVSSHGHTVFHQ------PAKG---L--SLQIGNGWALHQASGLPVINDFRMLDVQLGG
Bac_Bac_Cyt_5_E  LTVCSHGHTVFHQ------PHLG---M--TKQIGSGWTLRENAGFPVINDFRSFDVALGG
Bac_Bac_Cyt_6_E  LAIASHGHTVFHQ------PENC---L--SMQIGNGWSLYAACGVPVVNDFRSLDVRLGG
Bac_Bac_Cyt_2_E  LAVASHGHTVFHQ------PKLG---L--SKQIGNGWALHAACGLPVINDFRMLDVQLGG
Bac_Bac_Cyt_4_E  IAIASHGHTVFHT------PDVG---N--TFQIGNGWSMHIASGIKVINDFRMLDVQLGG
Bac_Bac_Pro_1_E  ELIASHGHTIFHQ------PEKH---F--TFQLGNGTVIAAETGIKTIADFRNMDVALGG
Bac_Pro_2_E-val  DFVASHGHTVFHQ------PKNK---I--TLQIGNGQNIADISKSTTISDFRSLDINLNG
ORF              DFIASHGHTIFHQ------PENN---Y--TLQIGCGKTISQTTKTTTINDFRSLDIFLNG
Bac_Pro_1_E-val  EIIACHGHTIFHQ------PENK---Y--TLQIGDGKTISRKTGITTVNNFRNLDVALNG
Bac_Bac_Cyt_1_E  ELVSSHGHTIFHQ------PQKG---F--SLQIGDGYHIMVESGCPVANDFRSLDIALGG
Bac_Bac_Bac_1_E  DIIASHGHTIFHE------PQRK---I--MYQIGDGAAIAAETRIPTVSDFRRLDIMLGG
Bac_Pro_3_E-val  DFVSSHGHTVFHK------PKSN---Y--TFQLGNLIEFRNLISFPVVCDFRIQDIQLGG
Bac_Bac_Fla_3_E  DVICSHGHTALHQ------PEHN---L--TYQIGNLPSLAKLIGNTVVCDFRIQDVKFNG
Bac_Bac_Fla_4_E  DAVCSHGHTILHQ------PQNG---F--TLQIGNLPEIATLTNQKVVCDFRVQDVKMGG
Bac_Bac_Fla_2_E  DFIASHGHTILHQ------PEKG---I--TLQIGNGQEIAKITNQKVVCDFRTQDVKLGG
Bac_Bac_Fla_1_E  DLIASHGHTVFHQ------PQKK---F--TLQIGDGRAIKIETSLPVIYDFRSQDVLMGG
Bac_Pro_Alp_1_E  KLIGYHGQSTFHA------PPI-------TVQMGDGEMLARTVGVPVVYDFRTADCAAGG
Bac_The_The_1_E  DAIGYHGQTVYHL------PENG---A--TLQIGEADVIAVETNLPVIHSFRTKDVALGG
Bac_Ten_Mol_1_E  SFIASHGQTIYHQAYG---DESR---APSTLQIGHGSVISNLTQTTVVSDFRVADMIAGG
Bac_Fir_Clo_1_E  DYIASHGQTIYHI------PKDREGLVKSTLQIGEASVIAYKTNTLVISNFRVMDMAANG
Bac_Pro_Zet_1_E  AAIGCHGQTIRHR------PEGE---YPFTLQIGCAATLAERTGITIVSDFRSRDMAAGG
Bac_Pro_Gam_5_E  QAIGSHGQTVCHD------TSGS---IPYTLQLGCGHTISSLTGITVVADFRTRDLVNGG
Bac_Pro_Gam_1_E  RAIGSHGQTIRHE------PARG---Y--SIQIGNPALLAELTEITVVSDFRRRDIAAGG
Bac_Pro_Bet_3_E  AAIGAHGQTVRHR------PDSG---Y--TVQLNAPALLAELTGIDVVADFRSRDVAAGG
Bac_Pro_Bet_1_E  RAIGCHGQTLRHR------PADG---Y--TLQIGNAALLAELTGIAVVADFRSRDIAAGG
Bac_Pro_Bet_2_E  RAIGCHGQTIRHR------PELG---F--TLQLGNAALLAELLDMTVIADFRSRDVAAGG
Bac_Pro_Eps_1_E  KAIGSHGQTLWHE------PVGK---YPFSMQLGDPSAIAVRTGIKVVADFRQKDMALGG
Bac_Pro_Gam_4_E  TAIGCHGQTVWHS------PNSH---YPFTMQIGDANLIAAKTGITTVADFRRKDMAFGG
Bac_Pro_Gam_2_E  RAIGNHGQTVFHQ------PSGD---APFTMQLGDANIIATKTGIDTVADFRRKDMALGG
Bac_Pro_Gam_3_E  MAIGCHGQTVWHE------PQSA---APNTLQIGDNNQIAAATGVTVVGDFRRRDMALGG
Bac_Fir_Bac_1_E  DFISSHGQTIFHQPEKVNIAGHP---VTSTLQIGDISVIAEQTGITTVGDFRTRDMAVGG
Bac_Dei_Dei_1_E  DLAALHGQTLWHE------PPQA------TLQIGEPAYLAEALGVPVVSDFRPADLALGG
Bac_Pla_Pla_1_E  DLIGSHGQTLYHHSSMPGVPRA-------TLQVGDGDQIAERTGICVISDFRSRDIAAGG
Bac_Act_Act_1_E  DLVASMGQTLYHL------VEDGK--TRGTLQLGQPAWIAERAGVPVVADFRPRDVAAGG
Bac_Cya_Chr_1_E  DLIGSHGQTVYHQ------PPHKNE-LGYSLQLGRGDVIFQKTGIQTINNFRVADIALGG
Bac_Pro_Del_1_E  DVIGSHGQTVAHL------PASLSE-TPSTLQLGEPAVIAERTGLPVVSDFRTRDVAAGG
Bac_Arm_Cht_1_E  DAIASHGQTIWHQAEPMLLVGRL---TRGTLQIGEPAVIAASTGCMVIADFRAADIAVGG
Bac_Aci_Aci_1_E  DLVGCHGQTIYHQ--GIAKPYGGRS-IACTWQFGEPALIAAAAHAPVVSNFRPADMVAGG
Bac_Cya_Glo_1_E  ACIGSHGQTVHHQ------PPTGSA-PGHTLQLGEGAWIAERTGVTTVSNFRSRDMAAGG
                   ##########                 ###############################
                   <===2====>                 <=========================3====

                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  EGAPLAPIGDQLFFGKYDFC--------LNLGGISNVSFEYDG-------KRIAYDIGLA
Bac_Bac_Sph_1_E  QGAPIVPIGEKLLFSDYRYF--------LNLGGIANLSIKET--------DYKAFDICAA
Bac_Bac_Sph_2_E  QGAPIVPIGEQLLLSGYNYF--------LNLGGIANISRHTEG-------HYAAFDVCAA
Bac_Bac_Cyt_3_E  QGAPLVPIGDQLLFSKYDYC--------LNLGGIANISMEKGG-------LRTAFDICPF
Bac_Bac_Cyt_5_E  QGAPLAPVGDHLLFPDYEGC--------LNLGGISNISMVYKG-------QRIAFDVSPF
Bac_Bac_Cyt_6_E  QGAPLVPIGDKLLFPEYDFC--------LNLGGIANISYQVDG-------RQVAFDVSPF
Bac_Bac_Cyt_2_E  QGAPLVPIGDQLLFPQVDFC--------INLGGISNISFQKGN-------NRVAFDMSPF
Bac_Bac_Cyt_4_E  QGAPLVPIGDSLLFPQYDYC--------LNLGGIANISFHNGP-------NLVAYDVCPF
Bac_Bac_Pro_1_E  QGAPLVPMGDRLLFAEYDYC--------LNLGGFSNISYEEGG-------QRIAFDIGPA
Bac_Pro_2_E-val  QGAPLVPIGDLMLFPQYKYC--------LNLGGFANISIKRKD-------KIKAYDVCPA
ORF              QGAPLVPIGDLLLFPKHKYC--------INIGGFANISIKNNE-------EIIAFDICPA
Bac_Pro_1_E-val  QGAPLVPIGDLYLFPDYKYC--------VNLGGFANISIKKNN-------LIKAFDICPA
Bac_Bac_Cyt_1_E  QGAPLVPVGDELLFGTYDFC--------LNLGGIANVSARRQG-------KRVAFDICPV
Bac_Bac_Bac_1_E  QGAPLVPIGDRLLFADYDYC--------LNIGGFSNISFEQDG-------KRIAFDISPV
Bac_Pro_3_E-val  QGAPLVPIGDLLLFKDYKYC--------INLGGFSNLSVKSEN-------EIIAYDICPV
Bac_Bac_Fla_3_E  QGAPLVPIGDRLLFSGYDNC--------INLGGFANISSEEDN-------KRIAYDICPV
Bac_Bac_Fla_4_E  QGAPLVPIGDRILFSDYEYC--------LNLGGFSNVSFEENG-------NRIAFDVSPV
Bac_Bac_Fla_2_E  QGAPLVPIGDELLFSEYDFC--------VNLGGFSNVSYHKDN-------KRIAFDICPV
Bac_Bac_Fla_1_E  NGAPLVPIGDEFLFSEYDAC--------LNLGGFSNISLKEDG-------KRIAFDIAPV
Bac_Pro_Alp_1_E  QGAPLVPIYHQVLFRHKNHP-----LVVVNIGGVANLTYSDGE-------VLIAGDTGPG
Bac_The_The_1_E  EGAPITAYFDWVFFKRPHTV-------VLNIGGIANITYIND--------VVLAFDTGPG
Bac_Ten_Mol_1_E  QGAPLVPFVDYCLFSDPNKN-----RILQNIGGISNITFLSKSLKKE---DVLAFDTGPG
Bac_Fir_Clo_1_E  EGAPLVPYTEYILYSEKEKG-----IALQNIGGIGNVTVLPESNLID---DIFAFDTGPG
Bac_Pro_Zet_1_E  EGAPLVPFAHQSLFGTIDEN-----VVVLNIGGIANITWLGADG------SVTGFDTGPG
Bac_Pro_Gam_5_E  QGAPFAPLYHQQIFSKVNES-----VAVVNIGGIANVTFIAKNQ------MTRGWDIGPG
Bac_Pro_Gam_1_E  QGAPLVPAFHEALFDDNKDH-----RAVLNIGGFSNLSLIESDR------PVEGFDCGPG
Bac_Pro_Bet_3_E  QGAPLVPPFHAAVFGAPHGR------AVLNLGGIANVTLLAPDQ------PPRGFDTGPA
Bac_Pro_Bet_1_E  QGAPLVPAFHAQVLRHPDVH-----RVIANIGGIANITDLPTSG------SVRGWDTGPG
Bac_Pro_Bet_2_E  QGAPLVPAFHQAVFAHPQAN-----RAVINIGGIANITDLPSAG------EVRGFDSGPG
Bac_Pro_Eps_1_E  QGAPFAPAFHAFLFGGTDAS-----VSILNIGGMANITVLGK--------TLLGYDTGPG
Bac_Pro_Gam_4_E  QGAPLVPAFHQALFRKPNQA-----TVVLNVGGISNISRLLPNE------EVIGYDTGPG
Bac_Pro_Gam_2_E  QGAPLVPAFHKTIFQSSDSS-----VVILNIGGIANISVIRPEQ------PVIGFDTGPG
Bac_Pro_Gam_3_E  QGAPLVPAFHQALLMDSVER-----RMVLNIGGIANLSLLIPGQ------PVRGFDTGPG
Bac_Fir_Bac_1_E  QGAPLAPYADYLLFRDKEKG-----RVLVNIGGISNMSILPKDCDEN---DVVAYDTGPG
Bac_Dei_Dei_1_E  EAAPLVPYPDLLLYGQSGVA-----RAIHNLGGISNLTYLPADLDPA---KVLAFDTGPG
Bac_Pla_Pla_1_E  EGAPLTPFSDLILYAGPAGASANRRRVILNLGGIANVTILDPDPD-----RVFGFDTGPA
Bac_Act_Act_1_E  QGAPLVPVLDELLLRGFGGSVP---MACVNIGGIANITVVAPGG------PTFGYDTGPG
Bac_Cya_Chr_1_E  QGAPLVSKIDLCLYHHPRHS-----RCLQNIGGIGNATYLPSTHTPQWQEKIIGWDTGPG
Bac_Pro_Del_1_E  QGAPLVPYLDWALFRKPGVA-----RALQNIGGIGNVSVVSERIE-----DTIAFDTGPG
Bac_Arm_Cht_1_E  QGAPLVPVADRLLFGSDKET-----RVVQNIGGIANATYLPQGCQAREDAEIIAFDTGPG
Bac_Aci_Aci_1_E  QGAPLVPLLDATLFAHPRRA-----RVLQNLGGIANLTLVPAGGNLD---QLIAFDTGPA
Bac_Cya_Glo_1_E  QGAPLVPLVDYLLLRHPERA-----RCIQNLGGIGNVTYLPAGATPK---QVLAFDTGPA
                 ##############               #######                   #####
                 =============>               <==4==>                   <===5

                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  NMLLNHITQKIG---LSYDNNGMLARKGVINMDMLKQLN-NL-SYYELPYPKSTGYEWFV
Bac_Bac_Sph_1_E  NRVLNVLAGELG---KEYDADGDLARSGNINNALLQELN-GL-SYYNQPAPKSLANDFGI
Bac_Bac_Sph_2_E  NRVLNMLAQTAG---HTYDAGGQLAASGAINKKLLEELD-EL-SYYRESAPKSLANDFGT
Bac_Bac_Cyt_3_E  NLLLNHFAGELG---SPFDKDGAFARSGKLLPKLMETLN-DI-PFYRKIEAKSLGREDIA
Bac_Bac_Cyt_5_E  NLLLNEIAARKG---LAYDDRGMLAATGKVNTTFLEQLN-AI-DFYTSKNAKSLGREEIE
Bac_Bac_Cyt_6_E  NLLLNHFANKLG---HPFDRDGRLAEAGVVNHLLLKQLN-EL-PYYQVQGAKSLGREQID
Bac_Bac_Cyt_2_E  NMLLNPEANKLG---LAYDEGGKESRKGELNLPLFTQLN-EL-PFYIQKGAKSLGREDIE
Bac_Bac_Cyt_4_E  NLLLNHFAAKTG---VTYDENGKMAKSGKPIPELENKLN-EL-AFYKKSGSKSLGREDID
Bac_Bac_Pro_1_E  NIVLNFLSQQVG---KEYDRNSLIAQSGKVNIALLNELN-KL-AFYREKPPKSLGKEWLD
Bac_Pro_2_E-val  NIILNYFTRRLG---KEYDKNGLIGQKGICDLKLLDQLN-NL-KYYSIEKPKSLSREWLE
ORF              NIVLNDICKKLG---FEYDYNGNISRKGEIVPALLHQLN-QL-DFYIKKAPKSLGREWVE
Bac_Pro_1_E-val  NIVLNKICKSID---TEYDDNGNNARKGKILPIFLDKLN-KL-EFYKSSKPKSLSREWVL
Bac_Bac_Cyt_1_E  NMVLNYLAKREG---QAYDAGGEMAAKGKKDDALLQKLN-SL-DFYRQEGPKSLGYEWVN
Bac_Bac_Bac_1_E  NYVINHYCRQIG---LEFDRDGEIARRGAICRPLLDELN-GM-EFYHQSGPKSLGREWVE
Bac_Pro_3_E-val  NIVLNKYSRKIG---YEFDKNGSISKSGVINAKLLTDLN-DL-SFYSLKHPKSLGLEWVD
Bac_Bac_Fla_3_E  NIVMNRFAKKLG---CDYDKGGDLAKFGNVDHSLLKLLN-EI-SYYAHKPPKSLGLEWVE
Bac_Bac_Fla_4_E  NTVLNFYADKLG---LKYDDKGQISKSGSISEVLLSELN-AL-DFYRKSYPKSLGFEFVK
Bac_Bac_Fla_2_E  NIVLNFYANKIG---LAYDASGKIASEGKINETLLGKLN-AL-AFYQQQPPKSLGLEWVQ
Bac_Bac_Fla_1_E  NIVLNRLAQKFN---KNFDENGDLARKGAIDEDLLTKLN-SL-EFYSQSHPKSLGIEWCN
Bac_Pro_Alp_1_E  NALINDVMLRDFG--QEFDKNGQTARVGRINPNLLQQWL-QD-PYFSKPFPKSLDRDHFS
Bac_The_The_1_E  NCLIDLYVKESFG--ILFDKDGELARRGKVDDKILHELIRRDQEYLNKRPPKTTGREWYN
Bac_Ten_Mol_1_E  NMMINRAMEICYQ--LPYDESGKIARTGKNIEALYNEVM-QH-PYFLLLPPKSTGRESFG
Bac_Fir_Clo_1_E  NMAIDEACNILFG--IPYDKDGKIASSGVVNDEMLNELM-KM-KYIHEKPPKTTGREDFG
Bac_Pro_Zet_1_E  NMVMDGVMLAITAGRNHYDQNGELAAGGIVCARLLNKLM-AH-PYISRKPPKSTGREAFG
Bac_Pro_Gam_5_E  NCLMDAWIYKNKG--ALFDKSGVWASQGEVIHPLLEYLL-QD-PFFHLDSPKSIGKEYFS
Bac_Pro_Gam_1_E  NVLLDAWIQSQRH--ESYDKDGEWAASGEVDQALLQKLL-SD-QFFLTKGPKSTGREVFN
Bac_Pro_Bet_3_E  NVFLDGWCQRHLG--QSYDADGRWAASGQVLAPLLEQLIASE-PWFALPPPKSTGRDLFN
Bac_Pro_Bet_1_E  NMLLDAWIKRHSG--VHYDRDGAWAASGSVHPGLLAALM-RH-AYLQLPPPKSAGREQFN
Bac_Pro_Bet_2_E  NMLMDAWTEKHLG--ERYDAGGRWAATGTVIEKLLQQWL-QY-PYFSASPPKSTGRDSFN
Bac_Pro_Eps_1_E  NVLMDMWVAEHKD--VTYDRNGEWARSGEVIYPLLEAML-ED-PYFSQPHPKSTGREKFN
Bac_Pro_Gam_4_E  NTLLDAWIEKHQG--KAYDKDATWAKSGKVNTDLLADLL-DE-PFFALPAPKSTGRELFN
Bac_Pro_Gam_2_E  NMLMDAWCQQHTG--HKFDQDGDFARRGKVCQTLLSTLL-QD-PYFARSAPKSTGRELFN
Bac_Pro_Gam_3_E  NMLMDAWIWRHKG--LPFDKDAGWARSGQVVPALLEQML-GD-PWFALPPPKSTGREYFN
Bac_Fir_Bac_1_E  NMIIDYFAQQISNGKISYDVDGKLAAKGNVREEWLKRLL-DN-PYYAEQPPKSTGREHFG
Bac_Dei_Dei_1_E  NCLLDEAAGHLG---LSQDSGGQIAASGKPHPGLLERWL-TH-PYFHRRPPKSTGREVWR
Bac_Pla_Pla_1_E  NSLLDRLAVQLSGGELTCDLDGRLARSGTVNAALLDDLLTTD-PFLQRRPPKSTGFEMYG
Bac_Act_Act_1_E  NALLDIAWEQGGDQGSPYDVDAALARTGAVHEPMLRALL-ED-PYYARRPPKSTGKEYFD
Bac_Cya_Chr_1_E  NALIDLAVQELTDNQQTFDFNGDWSRQGKPCQPLVKQWL-KQ-DFFHHKPPKSTGRELFG
Bac_Pro_Del_1_E  NMVMDGLARRISGGQLQCDLDGSLSRQGRVIPELLAELL-AH-PFLALPPPRSAGREGFG
Bac_Arm_Cht_1_E  NMVMDEIVREMTAGLQEYDREGQWAAQGRIQEDLLAECL-AH-PYFQQPPPKSTGREQFG
Bac_Aci_Aci_1_E  NMVIDALAQRLFG--KPYDRGGRLAAAGTPSEPVLTTLL-RD-PYYRLRPPKSAGREQYG
Bac_Cya_Glo_1_E  NLLIDAVAQQLTG--RPFDRDGALAAAGQVDSRLLAGWL-AD-PYFALPPPKSTGRESFG
                 #                 ####################       ############   
                 >                 <=========6========>       <=====7====>

                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  EKVAPIVN----ATEDTTENLLHTAVHHICEQVAMQIKTN--A--KKDHSTLLVTGGGAL
Bac_Bac_Sph_1_E  ATVYPLIK----KYEGSVEDQLRTYVEHVVQQVDKALSTDPAY--LRETHQLLVTGGGAL
Bac_Bac_Sph_2_E  DTVYPIIQ----AAGLSVNDALRTYTEHIARQIAAALLTT-GP--VNENAKLLVTGGGAL
Bac_Bac_Cyt_3_E  HDFMKILT----AKSHQPENILHTLALHFTQQIIRTLWRE-----PGKQQSLLVTGGGAF
Bac_Bac_Cyt_5_E  GLFLPLLE----KHNDSEENLLATLVEHYAVQISTVVQQFF----PPANNRLLVTGGGAY
Bac_Bac_Cyt_6_E  RDFLPLVT----NSGVGDQDLLATLSAHMADQVAASIKNG-----KQGNGKLLCTGGGAY
Bac_Bac_Cyt_2_E  ESFLPLIR----KSNLKPRDVLRTLVEHFAFQIGKVILEEK----QQEKPLILITGGGAY
Bac_Bac_Cyt_4_E  KDFIPLLE----KQNENIEDILSTLIAHYTYQISQVI-----I--PRHDHRLLITGGGAY
Bac_Bac_Pro_1_E  SELIPMLK----KSSLTLPDQMRTLYEHIAIQIGEVI---------RNSGTMLVTGGGAH
Bac_Pro_2_E-val  NNLLNLKA----LQNLEIENILATLYEHIGYQIGKIL----------NEKNVLVTGGGAH
ORF              EHIFPILK------NQKPEDLLCTFCEHTAIQIGKFL----------TDESALFTGGGVF
Bac_Pro_1_E-val  EHIQPLFT------NDEPQDLLRTFCEHIAIQISHNL----------RDGTALLSGGGTF
Bac_Bac_Cyt_1_E  AAVFPMLE----SATLSTNDLLHTFCLHIAEQLYLAL-LPLAP--VVQKQKLLLTGGGAF
Bac_Bac_Bac_1_E  TQVYPMLE----RYGLSLEDKLRTFYEHAAFQIFRIINAN-PS--SAGNGKLLITGGGAF
Bac_Pro_3_E-val  KNIFPIID----SYNLTIPDILRTFSEHVSIQVSKTI--------NDKNASILFTGGGVK
Bac_Bac_Fla_3_E  SQVFPILE----SSKISEENILRTFVEHIAIQIAKAF---------NTNSKVLFTGGGSF
Bac_Bac_Fla_4_E  ETVLPMME----KYSIPVEDKLRTFTEHVAFQIASAL--------PEKRGKLLVTGGGAY
Bac_Bac_Fla_2_E  TTIFPLID----ALETDVPSILRTFVAHIAIQISKVI---------TKNNQVLFTGGGVF
Bac_Bac_Fla_1_E  EHIFPLLE------NMETADAMATFTEHVAHQISRII-----N--QKNLQNILFTGGGTY
Bac_Pro_Alp_1_E  KFLREAQG----------TEGVATLTALTVHSILMGI---DVL--PKSPQEILVCGGGVK
Bac_The_The_1_E  ERFIEGVE-------KGSFDVLRTLTYFTAFCVHENMKRY-----LPEVERIYVFGGGAF
Bac_Ten_Mol_1_E  VEYTDQLI--RKYAFEKHEDIVHTFTRITADSITSSIKDFVLK--KSSVDELIISGGGVH
Bac_Fir_Clo_1_E  QRFVEKVI--DKYSELKSEDIIATLTMFTAKSISYNYKKFIIP--NNKLEKVIIAGGGAH
Bac_Pro_Zet_1_E  DEIVQRIL---TWPEITDADKMATACRFTVESIAKSC---RFL--PGTPQRWLICGGGAR
Bac_Pro_Gam_5_E  LSWLQKHL----KPDYTPADIQATLLALTAHTIAETI---LNE--SGEIKQLYLCGGGAH
Bac_Pro_Gam_1_E  LGWVHHHL--FQLPTLTPEDVQATLLELTALTITESL---QSA--QAITKELLVCGGGAH
Bac_Pro_Bet_3_E  MRWLDDRLAAYDGPRPAPQDVQATLQRLTARTVANAI---DAA--GTDVRELYVCGGGAC
Bac_Pro_Bet_1_E  LDWLDTRL-GSLDEALAPPDVQATLVEFTTMSLADAVNRE-----CTGAQELYVCGGGAY
Bac_Pro_Bet_2_E  MAWLEQHL----EYPYAPEDVQRTLLELTARSIANAINDF-----CDNVDEAYICGGGAH
Bac_Pro_Eps_1_E  EAWLQKHL-NAQHSTLNAHDVQRTLLELTAVSISNEV-----L--KFNQDILLLCGGGAK
Bac_Pro_Gam_4_E  LAWLNKKL--EKHTALLPQDVQATLVELTAQSIVDQLNQI--E--TELDRHLLVCGGGVK
Bac_Pro_Gam_2_E  LPWMTQHLA---NQTLKPEDVQRTLCEFTATTIARDVLSF--Q--SGPQPTLLVCGGGAR
Bac_Pro_Gam_3_E  LGWVEQQL--QRFPALAPQDVQATLCELTALTIAHQVQL------NDGCDRLLVCGGGSR
Bac_Fir_Bac_1_E  ERYAKKLWDEAEDMSIYPYDRIATVTKLTAITITNEINRY-IV--KSGIREVFISGGGSY
Bac_Dei_Dei_1_E  LEHLEGTQ------TVSPPDLLASLTELTARSIAQAYRDF-IL--PKGLDEVWVAGGGAY
Bac_Pla_Pla_1_E  DAFLERAV---AAHGRRDHDLMATLTEFTARSITKALDRF-VV--DPPVGEIIVAGGGAR
Bac_Act_Act_1_E  ARMIGPYR------ELPLADLLATLTELTAIPIARAC-----A--EHRVAEVLLSGGGAA
Bac_Cya_Chr_1_E  HHYLAHCRQDAQHYNLSDADWLATITELTVASIADSYHRF--L--PSLPHEVILAGGGSR
Bac_Pro_Del_1_E  DALVERLW--ERHGASRPHDLMATAVAFTVEATARAYERWLMP--RFALEAVYVSGGGTR
Bac_Arm_Cht_1_E  KAYVQWFCQRARELGLRWEDMLATASALTVESIAQAYERWLLP--KAPIHRVIVGGGGVH
Bac_Aci_Aci_1_E  TSFVERLLALARQRRLSPHDTLAAATALTSRSIALAWRLFLAPHLAGTSVDYIVAGGGAR
Bac_Cya_Glo_1_E  YARAGQLL--AEAAHLSPADLLATVSELTVESIARAYGDW--L--PTAPAEVFLGGGGVR
                                    ##############                      #####
                                    <=====8======>                      <===9

                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Fla_5_E  NTFMMELLQSYLEP---VVNLVIPEKKLIEYKEALIFALMGVLRVEQEINVLKSVTGAST
Bac_Bac_Sph_1_E  NRFLIERMENQLHA-----KVVVPEKDLVQFKEAMIMALIAVLRWREENTVLSSVTGAKR
Bac_Bac_Sph_2_E  NTFLIERLRVSLDA--IGIAVEVPADELVNYKEALIMALIGVLRWREENNVLSSVTGASR
Bac_Bac_Cyt_3_E  NTFFMEKLQEELGN---EILIEKADPQIIGFKEALIFAFLGVLKVRGENNCLASVTGASR
Bac_Bac_Cyt_5_E  HAFFIDQLQKKLGN---ETTVIVPEPSIVEFKEALIFAFLGVLRINNEINTLAAVTGASR
Bac_Bac_Cyt_6_E  NAFFIHQLREKTKG---HVEITVPSAHLVEFKEALIFALLGVLRLTGRPNCLASVTGASK
Bac_Bac_Cyt_2_E  HEFFEERLSHYLHQ---EWEKYAASSELIEFKEALIFAFLGILRLQREVNSLSSVTGASR
Bac_Bac_Cyt_4_E  HSYFIDQLKLALEG---KVQVVLPDRTLIDFKEALIFGFLGVLRLRGEINCLSTVTGASR
Bac_Bac_Pro_1_E  NPLLMERITACSKA-----EVIIPQNEIIDFKEALIFAFLGVLANEHQINCLAAVTGASR
Bac_Pro_2_E-val  NHFLIEKIKQYSKS-----KIIIPSKEIIDFKEALIFGFIGVLKLRNEVNCLKEVTGADR
ORF              NSFLMERITFYSKS-----EILVPNKELIEFKESLIFA----------------------
Bac_Pro_1_E-val  NSFLVERIKHYSTS-----KIIIPNNTIINFKEAIIFGFLGVLKVRNEVNCLRSVTGADM
Bac_Bac_Cyt_1_E  NTFLIDLLKEKLEP--LNIMVVVPERQIIEYKEALIFALLGVLRLRGEINCLASVTGARR
Bac_Bac_Bac_1_E  NKFLVERIEALCPC-----QIVIPGRQIIEYKEALIFAFLGALYMADEPGCLASVTGASM
Bac_Pro_3_E-val  NNFLFSLIRKRLPN-----SFCKPNNDLIDFKEALIFGFLGVLKIRNEVNCLKSVTGALK
Bac_Bac_Fla_3_E  NNFLLERIKAQKYF-----ELILPSNEIIEFKEALIFGLLGVLKLRGEVNCLSSVTGADC
Bac_Bac_Fla_4_E  NDFLIERMQIYLPE----MQIVIPDAKTIEFKEALIFGLLGVLRLRNEANVLASVTGAMH
Bac_Bac_Fla_2_E  NTFLMDEIQQHAKS-----RISLPTKELIDYKEALIFAFLGLLKVTNQINCLQSVTGASK
Bac_Bac_Fla_1_E  NSFLIEKIKEKTES-----AIIIPEKEIIDFKEALIFAFMGVLRLNNEINVLASATGSTA
Bac_Pro_Alp_1_E  NKTLMALLGKKAAP--------LPDSEMIEAQA---FAFLAVRVLRGLPTSFPTTTGCRV
Bac_The_The_1_E  NKLLLEDLMR------FGYRVFVPNRTFAKAREAICMALLANEFLNGVTTGMPSVTGAKR
Bac_Ten_Mol_1_E  NKFLVELISKGLPG--IKVLSTDDINFSSDFKEALAFIILGNQTLLGLTSNLKEATGAVK
Bac_Fir_Clo_1_E  NKTLIKFIKEELEG--IEVLIQEDLGFSSDAKEAIAFAVLGNETLNNNFSNVPSATGANE
Bac_Pro_Zet_1_E  NHHLMQQLTQVLAP--AEVLPSDAAGMPAQAVEAASFAMLARATLTGEYNTLSAVTGASH
Bac_Pro_Gam_5_E  NTHLKENLARLLPG--IAVKSIVELGISPDYLEAMMFAWLAAQTINQIPVNLTSITGAKS
Bac_Pro_Gam_1_E  NKALMKRLAELLPD--TEVSSTEKFGVDPDWVEAMAFAWLAHCCLEGVPANRPTVTGAKG
Bac_Pro_Bet_3_E  NPGLMRELAYCLQR---PVHATDALGVPAQQVEALAFAWLAQAFLARRPAGLPGVTGARG
Bac_Pro_Bet_1_E  NRTLMQRLSALLPS--LRVATTATLGIDPDWVEALAFAWLARQMLHHAPGNLPAVTGARG
Bac_Pro_Bet_2_E  NSLLLERLQEVLPA--IKIRLSDSLGIGVNWVEAAAFAWLAQQCMEGKPANLPAVTGAKG
Bac_Pro_Eps_1_E  NAFLVERLGTLMPN------IQIGIANDADNIEAMTFAWLAYKRLHNEHVDLKDVTGARQ
Bac_Pro_Gam_4_E  NCLLMARLTTLLPR--WQVQTTNDYGLDADYVEAAAFAWLAYQRLNDLPGNLPSVTGAKS
Bac_Pro_Gam_2_E  NPLLMERLTALLSD--WQVSTTSDKGIDSDYMEAMAFAWLAQRRIHNLPSNLPEVTGASR
Bac_Pro_Gam_3_E  NPLLMARLAAHLSG--TEVGTTDQAGISGDDMEALAFAWLAFRTLSGLPGNLPAVTGARE
Bac_Fir_Bac_1_E  NPVLMQAISNGLPP-KVVVRKLDEIGMPADAKEAMVFALLGYQYLNKRTNNLPKATGAKQ
Bac_Dei_Dei_1_E  NTTLMRRLKALLPV---TVYTFEERGLHAKHREALCFAVLGYLRYLEQPNTLAQVTGAQK
Bac_Pla_Pla_1_E  NPALMERIRANMNP--VPVRDSEEVGVSSSAREAMAFALFANEALLGHPTSLPSVTGART
Bac_Act_Act_1_E  NPLLCARIGEHLRG-KTVVRTSAEAGLPVDAKEAVLAGLLGWLTWHGVAGNVPSATGADA
Bac_Cya_Chr_1_E  NSYLIERLQSYLLD--THLLTSDELGISSEFKESIAFAILAYWHVHNFAGNLPCVTGAKK
Bac_Pro_Del_1_E  NPVLMERLTARLAP--LPVRPLDVLGLPEGAKEAVCFALLANEHLSGTPANVPSATGAKR
Bac_Arm_Cht_1_E  NRWLMQQLQRRLAP--MTLSTHEEFGVPDDAKEAIAFALLGYLTLRGMPGNLPSATGATR
Bac_Aci_Aci_1_E  NQTLMRMLATDLAPFHCRIQTTDDLGIPSEAKEAVAFALLAWHTWHRVPGNVPAATGAAH
Bac_Cya_Glo_1_E  NRYLVRRLRERLAP--ATVASTAEVGIDSDFKEAIAFAVLAWLRCSNRPGNLPSVSGAAR
                 ####                                                        
                 ===>

                        430       440       450       460
                 =========+=========+=========+=========+
Bac_Bac_Fla_5_E  DSSSGVVYLPS-----------------------------
Bac_Bac_Sph_1_E  DSAGGAMWLGALD---------------------------
Bac_Bac_Sph_2_E  NSVGGAMWMGQED---------------------------
Bac_Bac_Cyt_3_E  DNSGGSVFGM------------------------------
Bac_Bac_Cyt_5_E  DSCGGVYYP-------------------------------
Bac_Bac_Cyt_6_E  DSCGGTLFGLIS----------------------------
Bac_Bac_Cyt_2_E  DSSGGTVYP-------------------------------
Bac_Bac_Cyt_4_E  DSIGGVIYG-------------------------------
Bac_Bac_Pro_1_E  DNTGGTIHLS------------------------------
Bac_Pro_2_E-val  DNIGGEIFQPN-----------------------------
ORF              ----------------------------------------
Bac_Pro_1_E-val  DNCGGIIHEP------------------------------
Bac_Bac_Cyt_1_E  NSCGGQLYGKI-----------------------------
Bac_Bac_Bac_1_E  DNIGGILFKV------------------------------
Bac_Pro_3_E-val  DHSSGIIFE-------------------------------
Bac_Bac_Fla_3_E  DHSSGVIYYP------------------------------
Bac_Bac_Fla_4_E  DHCSGEIYEFSL----------------------------
Bac_Bac_Fla_2_E  DHSSGVIFYP------------------------------
Bac_Bac_Fla_1_E  DHSSGLIC--------------------------------
Bac_Pro_Alp_1_E  PVCGGRLVYPESFSTQR-----------------------
Bac_The_The_1_E  PAVLGKIAFPW-----------------------------
Bac_Ten_Mol_1_E  NVILGTVSYYT-----------------------------
Bac_Fir_Clo_1_E  KVILGQITMSPRIF--------------------------
Bac_Pro_Zet_1_E  DVCGGEITPGDNWTTLLQELPRWIR---------------
Bac_Pro_Gam_5_E  IAILGAVYPIIKSY--------------------------
Bac_Pro_Gam_1_E  RRVLGAIYPA------------------------------
Bac_Pro_Bet_3_E  ARILGALYPA------------------------------
Bac_Pro_Bet_1_E  ERVLGAIYPA------------------------------
Bac_Pro_Bet_2_E  PRILGAIYAR------------------------------
Bac_Pro_Eps_1_E  NAILGGVYV-------------------------------
Bac_Pro_Gam_4_E  AVSLGAIYPKEKDVAA------------------------
Bac_Pro_Gam_2_E  LASLGVLYFA------------------------------
Bac_Pro_Gam_3_E  LSVLGAIYPANPHAIR------------------------
Bac_Fir_Bac_1_E  KVMMGKVAWGKGRR--------------------------
Bac_Dei_Dei_1_E  NALAGKITLPAPAGA-------------------------
Bac_Pla_Pla_1_E  PVILGKWSFPSA----------------------------
Bac_Act_Act_1_E  PRVLGSITPAGTGARLGEPRPGPPEWLRVVATSEGEGTGR
Bac_Cya_Chr_1_E  EVVLGVSHKE------------------------------
Bac_Pro_Del_1_E  RVVLGKLTP-------------------------------
Bac_Arm_Cht_1_E  PVVLGKIVFP------------------------------
Bac_Aci_Aci_1_E  PAILGQVTYV------------------------------
Bac_Cya_Glo_1_E  AVLLGDVHPGR-----------------------------
                                                         






Parameters used
Minimum Number Of Sequences For A Conserved Position: 22
Minimum Number Of Sequences For A Flanking Position: 35
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 5
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 9 selected block(s)
Flanks: [25  36]  [123  132]  [150  194]  [210  216]  [236  241]  [259  278]  [286  297]  [320  333]  [356  364]  

New number of positions in input.fasta-gb:  135  (29% of the original 460 positions)






__________________________________________________________________________________________
__________________________________________________________________________________________

Alignement multiple 2:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


B.B.Sph_1       ------------------MIYRAIG-------LMSGSSLDGLDIVFAEIHENGGR-----
E.M.Art_1       ----------MTGGAQDMAQYRVIG-------VMSGSSLDGLDIIYAVFNVQPDNT----
E.Al.Cil_2      ------------MTDNQIKTLNIIG-------VMSGTSLDGLDLAYFKFKYLENQKQTFN
E.Al.Cil_3      --MKARFELAPFRNRALIYRLRPLGHFIFSESVMSGTSLDGLDLAYFKFKYLENQKQTFN
B.B.Fla_1       ---------------MNGDCCFIIG-------LMSGTSLDGIDLVYVKFNKKNY------
BP2_E-valu      --------------MTKIDNYSVIG-------VMSGTSLDGLDIIKCTFQKGDE------
ORF             IYAKVHFLNYFWKLMTKKIKYTALG-------IMSGTSLDGIDLAICTFTKNQV------
BP1_E-valu      --------------MLDNIKYNVLG-------VMSGTSLDGIDFVLCTFSKNKY------
E.Al.Cil_1      ---------------MDQQNYTIVG-------VMSGTSLDGIDLALIQFENMNQQ-----
B.Pro           ----------------MKSIYNVLG-------VMSGTSIDGIDLCYCCFTLDRE------
E.M.Ann_1       ------MASWQKFTDPTRKSWTGLG-------IMSGTSLDGIDLCVVSFTKEGGV-----
E.M.Mol_2       -----------------MTSYVGIG-------CMSGSSLDGLDLCCVEFTGDRDTDV---
E.M.Mol_1       --------------------------------VMSGTSLDGLDLCYTQFTGDVSTDV---
B.Th.The_1      ------MYWADFLKLLDKKKRTIAG-------LMSGTSADGLDIAVVSFDGASRE-----
B.C.Chr_1       --------------------MIVVG-------LMSGTSVDGIDASVVDIQGQGLD-----
B.P.Alp_1       -----------------MEPIWALG-------LMSGTSLDGIDAALILTDGEQI------
B.F.Bac_1       ----------------MKLVNHAVG-------MMSGTSLDGIDVAIVEIVEEDGD-----
B.Te.Mol_1      ----------------MNTSKLACG-------IMSGTSLDGIDVAIASISGSGLE-----
E.Am.Myc_1      ------------MDLINNNKNLYIG-------IMSGTSLDGIDVVLTEINNSG-------
B.P.Gam_1       ------------------MDFFYIG-------VMSGSSLDGIDIALLKQDDRS-------
B.P.Bet_1       -----------MNSGHTYEAEHYVG-------LMSGTSLDGVDAALAEIGSAGQ------
B.D.Dei_1       --------------------MRVLG-------LMSGTSADGVDLVLAALEGRPPH-----
B.P.Del_1       ----------MDSRPPPPNSRLCVG-------LLSGTSVDAVEAVLCRVEGTGPE-----
B.Ac.Act_1      --------------------MRVLG-------MQSGTSMDGVDAAVLEIEPVAEG-----
                                                  **:* *.::                 

B.B.Sph_1       ---WSYSIVAADCYPYSAEWAGR----LQSATSLNALDYQLLHAEYGAYLGAEVNRFI--
E.M.Art_1       ---WKFSIEHTQCQPYKTYWLDK----LRHVAAMNALEYQLVHTEYGRALGDHVNNFI--
E.Al.Cil_2      SKSFTYEIINAETIAYDENMRSN----LINTMQMSGVELSKFDREYGKFIGESIVKFIK-
E.Al.Cil_3      SKSFTYEIINAETIAYDENMRSN----LINTMQMSGVELSKFDREYGKFIGESIVKFIK-
B.B.Fla_1       ---KSFKILAATTISYSNKWKNE----LKTAIHFSKDDLIILDIEYGKLLGKEINLFIK-
BP2_E-valu      ---WSFKIEKGITKKYSKNWLEL----LKKSHEKSSKEIQINDNIYGDYIGKQVSSFI--
ORF             ---WEYRIEKSNTLKYPIYWKSK----LETLHTQNKATIEQANIQFGQYVGEIINVFL--
BP1_E-valu      ---WQFKIKKTQTIKYTNYWKLK----LGDLHKKDINEISRTDVEYGKLIANEINKFI--
E.Al.Cil_1      ---WHYKILSAQTYLYEQSWIDL----LKNAHTLQQGEIESFNLNYTHHLAQKINKFTS-
B.Pro           ---WTYEIIKCETISYDNYWFEK----LSTAVLLSKPEISLLNNEYTFFLASVVNQFIH-
E.M.Ann_1       ---WNYVIKHAVTREYTTEIENV----LKSAHNLSGFDLIKAHLRYGRYLGETIRDFL--
E.M.Mol_2       ---WGYRILKAVTLPYDANWTSR----LAGARDLSGEALIRLHVEYGHLLGKLIKKFV--
E.M.Mol_1       ---WSFRIEKAITIPYTDTWKGR----LSGSVNLNGADLIQLHVEYGHFVGQTVRDFI--
B.Th.The_1      ---TKFKLLDFRSFDYPETFKKR-IIETYDPSKSTVKDVTFMNFEIARIHAAMLKQLS--
B.C.Chr_1       ---LKVNLLVGQTFPYSSALRSQ-ILAVCEGKSLTMAEFAQLDHAIALEFAQAVINII--
B.P.Alp_1       -----YEFGESLYVPYDADFQTQ----LRSQLGQQFPD-PQIARQSTQHHGEVVKQLL--
B.F.Bac_1       ---IELRLKYFDMVTYHDAVKQE-LLKLCDPSKATIQMISTMNMLFGTLFAEAANQVIK-
B.Te.Mol_1      ---TKIEFISGKTYPYPRAIYEK--VKLAIEDKLSIRDLSSLNFELGKLYADVVKDLCS-
E.Am.Myc_1      -----IKVLKSYTHPLPETTRKE-ILSINQGQQTTLVKIGKINRDLGILYGEAVIELLKL
B.P.Gam_1       ------RLLATHYIPMPEDLHAE-LLGLCSSGVDELARAAIAEQKWCRLVAQGVQTLLE-
B.P.Bet_1       -----VRLLHSHYLPYPDALRTR-LLGLHTPQPDEIHLAAIAANELARLYADTVKSLLD-
B.D.Dei_1       ---LTWQVRAYREARFPPGLRLEVLQALKD--RASTRQVALLHHALGRFYAEVAAPFR--
B.P.Del_1       ---VRISLVAHVSRPFTPEFTRR------VLAANDARSLCELNFALGEHFAAAALEVIA-
B.Ac.Act_1      ---IELRLGASRTVPY-PDWLRAELGSAVAGAALDARTLCLLDTELGKVFGSIAAEF---
                       .                                          .     .   

B.B.Sph_1       ----GEKGLDYKVALISSHGHTTFHVPV--------KRMTAQLGDGAAIAAATKLPVVSD
E.M.Art_1       ----REKKLTDKIDLVACHGHTVFHLPM--------QMTTTQLGDGATVAAVTGLPTVSD
E.Al.Cil_2      ----KFNIHHKSVDYVSSHGHTVFHNPS--------EQYTVQIGHGSSIAASCKIPTICD
E.Al.Cil_3      ----KFNIHHKSVDYVSSHGHTVFHNPS--------EQYTVQIGHGSSIAASCKIPTICD
B.B.Fla_1       ------KNDIVDVDFIASHGHTVLHQPG--------KGVTLQVGSGKTISEITNQKVVCD
BP2_E-valu      ------KKNDFKIDFVASHGHTVFHQPK--------NKITLQIGNGQNIADISKSTTISD
ORF             --------DGEKIDFIASHGHTIFHQPE--------NNYTLQIGCGKTISQTTKTTTIND
BP1_E-valu      --------VNEKIEIIACHGHTIFHQPE--------NKYTLQIGDGKTISRKTGITTVNN
E.Al.Cil_1      ------QFQDVKIDAICSHGHTIIHKPK--------EGITIQIGNLPILSQLVKTTVVCD
B.Pro           ------NNNLTNIDFVSSHGHTVFHKPK--------SNYTFQLGNLIEFRNLISFPVVCD
E.M.Ann_1       ------TDCQTEVDFVGCHGHTIFHQPD--------DHVTFQLGDGETMASYMYCPLVNN
E.M.Mol_2       ------DENQLDVEFVASHGHTIFHNPT--------LNYTFQLGDGETVSRYLNCPFVCN
E.M.Mol_1       ------KEGNLKPDFVASHGHTVFHQVD--------KGFTFQLGEGETTSIYLTCPFITN
B.Th.The_1      ----------QEIDAIGYHGQTVYHLPE--------NGATLQIGEADVIAVETNLPVIHS
B.C.Chr_1       -------PKNTKIDLIGSHGQTVYHQPP----HKNELGYSLQLGRGDVIFQKTGIQTINN
B.P.Alp_1       ------SQTNKPVKLIGYHGQSTFHAPP----------ITVQMGDGEMLARTVGVPVVYD
B.F.Bac_1       ----EAGLRNEDIDFISSHGQTIFHQPEKVNIAGHPVTSTLQIGDISVIAEQTGITTVGD
B.Te.Mol_1      ----LNKIQTSSLSFIASHGQTIYHQAYG---DESRAPSTLQIGHGSVISNLTQTTVVSD
E.Am.Myc_1      VKRDNNSFSKDDIVAIGNHGTTVYHMPE--------EGFTIQLGDNNRVAAMTNINVVGD
B.P.Gam_1       ----DQNMVPAQIRAIGSHGQTIRHEPA--------RGYSIQIGNPALLAELTEITVVSD
B.P.Bet_1       ------GFTAGRVRAIGCHGQTLRHRPA--------DGYTLQIGNAALLAELTGIAVVAD
B.D.Dei_1       ----------GQADLAALHGQTLWHEPP---------QATLQIGEPAYLAEALGVPVVSD
B.P.Del_1       ----RAGLRPRDVDVIGSHGQTVAHLPA----SLSETPSTLQLGEPAVIAERTGLPVVSD
B.Ac.Act_1      ----------DRVDLVASMGQTLYHLVE-----DGKTRGTLQLGQPAWIAERAGVPVVAD
                                   * :  *              : *:*             : .

B.B.Sph_1       LRAMDVALGGQGAPIVPIGEQLLL-SGYN-----YFLNLGGIANISR------HTE---G
E.M.Art_1       FRSVDVALMGQGSPFSIAAERRLFGTEYQ-----FFLNIGGMACLTY----VGKGN---D
E.Al.Cil_2      FRSLDVALGGQGAPLVPIGDKLLF-AEYK-----YCLNIGGIINISFDINQSDEIN---Q
E.Al.Cil_3      FRSLDVALGGQGAPLVPIGDKLLF-AEYK-----YCLNIGGIINISFDINQSDEIN---Q
B.B.Fla_1       FRTQDVNLGGQGAPLVPIGDELLF-ADFD-----FCVNLGGFANVSY------KIK---E
BP2_E-valu      FRSLDINLNGQGAPLVPIGDLMLF-PQYK-----YCLNLGGFANISI------KRK---D
ORF             FRSLDIFLNGQGAPLVPIGDLLLF-PKHK-----YCINIGGFANISI------KNN---E
BP1_E-valu      FRNLDVALNGQGAPLVPIGDLYLF-PDYK-----YCVNLGGFANISI------KKN---N
E.Al.Cil_1      FRVQDVKLGGNGAPLVPLGDRILF-HEYH-----YRINLGGFSNISY------ERE---N
B.Pro           FRIQDIQLGGQGAPLVPIGDLLLF-KDYK-----YCINLGGFSNLSV------KSE---N
E.M.Ann_1       FRTKDVALGGQGAPLVPLAEQHLF-ADFD-----FCLNLGGIANISI--------R---D
E.M.Mol_2       FRNKDVAYGGQGAPFVPCGEKYLF-QAYD-----ICINLGGIANIGI------------N
E.M.Mol_1       FRSKDLALGGQGAPLVPSGERFLF-SQTD-----ICLNLGGIANIGL------------K
B.Th.The_1      FRTKDVALGGEGAPITAYFDWVFF-KRPH----TVVLNIGGIANITY-------IN---D
B.C.Chr_1       FRVADIALGGQGAPLVSKIDLCLY-HHPR--HSRCLQNIGGIGNATY--LPSTHTPQWQE
B.P.Alp_1       FRTADCAAGGQGAPLVPIYHQVLF-RHKN--HPLVVVNIGGVANLTY------SDG---E
B.F.Bac_1       FRTRDMAVGGQGAPLAPYADYLLF-RDKE--KGRVLVNIGGISNMSI--LPKDCDE---N
B.Te.Mol_1      FRVADMIAGGQGAPLVPFVDYCLF-SDPN--KNRILQNIGGISNITF--LSKSLKK---E
E.Am.Myc_1      FRSRDIALGGQGAPLVPAFHKFIL-SDDT--EKRIVLNIGGISNITL-----LIPN---G
B.P.Gam_1       FRRRDIAAGGQGAPLVPAFHEALF-DDNK--DHRAVLNIGGFSNLSL-----IESD---R
B.P.Bet_1       FRSRDIAAGGQGAPLVPAFHAQVL-RHPD--VHRVIANIGGIANITD--LPTS------G
B.D.Dei_1       FRPADLALGGEAAPLVPYPDLLLY-GQSG--VARAIHNLGGISNLTY--LPADLDP---A
B.P.Del_1       FRTRDVAAGGQGAPLVPYLDWALF-RKPG--VARALQNIGGIGNVSV----VSERI---E
B.Ac.Act_1      FRPRDVAAGGQGAPLVPVLDELLL-RGFGGSVPMACVNIGGIANITV--VAPG------G
                :*  *    *:.:*:       .              *:**.                  

B.B.Sph_1       HYAAFDVCAANRVLNMLAQTAG---HTYDAGGQLAASGAINKKLLEELDELS--YYRESA
E.M.Art_1       DSFAADVCPANQLLNLLAQRES---KNYDNEGEMASSGSINCRLLQDLDGFD--YYKASF
E.Al.Cil_2      IRKAFDVSPGNMILNYLCKKYLN--KEYDADGQEARLGKTHQELLNQLLNVE--FFLKAG
E.Al.Cil_3      IRKAFDVSPGNMILNYLCKKYLN--KEYDADGQEARLGKTHQELLNQLLNVE--FFLKAG
B.B.Fla_1       NRIAFDICPVNIVLNHYVQKLG---FDYDDKGNIAAKGKINEDLLKELNSLE--FYKKAA
BP2_E-valu      KIKAYDVCPANIILNYFTRRLG---KEYDKNGLIGQKGICDLKLLDQLNNLK--YYSIEK
ORF             EIIAFDICPANIVLNDICKKLG---FEYDYNGNISRKGEIVPALLHQLNQLD--FYIKKA
BP1_E-valu      LIKAFDICPANIVLNKICKSID---TEYDDNGNNARKGKILPIFLDKLNKLE--FYKSSK
E.Al.Cil_1      VTLAYDICPVNTVLNRLAFP-----KNYDENGDISKSGNVNPNLLDQLNNLE--YYKLSH
B.Pro           EIIAYDICPVNIVLNKYSRKIG---YEFDKNGSISKSGVINAKLLTDLNDLS--FYSLKH
E.M.Ann_1       EAQGFDVGPCNLLLNHFASAHDSS-LKFDKNGEIAETGTVIDELLSSWNALP--FFKLVP
E.M.Mol_2       GKKGYDISPCNYVMNKLAALFDSS-LTFDTDGRIAGQGQVLYNVLEKLDSLP--YYSTSP
E.M.Mol_1       NGKGYDICPCNIVFNRLAGLHTAF-MDYDEDGKLASRGKIKPDLLDQLNDLD--YYKLKC
B.Th.The_1      VVLAFDTGPGNCLIDLYVKESFG--ILFDKDGELARRGKVDDKILHELIRRDQEYLNKRP
B.C.Chr_1       KIIGWDTGPGNALIDLAVQELTDNQQTFDFNGDWSRQGKPCQPLVKQWLKQD--FFHHKP
B.P.Alp_1       VLIAGDTGPGNALINDVMLRDFG--QEFDKNGQTARVGRINPNLLQQWLQDP--YFSKPF
B.F.Bac_1       DVVAYDTGPGNMIIDYFAQQISNGKISYDVDGKLAAKGNVREEWLKRLLDNP--YYAEQP
B.Te.Mol_1      DVLAFDTGPGNMMINRAMEICYQ--LPYDESGKIARTGKNIEALYNEVMQHP--YFLLLP
E.Am.Myc_1      DTLGFDTGPGNIVMDSWIQQIKN--EAFDQDGQWAKSGTINVKLLDAMLNSTD-YFIKSP
B.P.Gam_1       PVEGFDCGPGNVLLDAWIQSQRH--ESYDKDGEWAASGEVDQALLQKLLSDQ--FFLTKG
B.P.Bet_1       SVRGWDTGPGNMLLDAWIKRHSG--VHYDRDGAWAASGSVHPGLLAALMRHA--YLQLPP
B.D.Dei_1       KVLAFDTGPGNCLLDEAAGHLG---LSQDSGGQIAASGKPHPGLLERWLTHP--YFHRRP
B.P.Del_1       DTIAFDTGPGNMVMDGLARRISGGQLQCDLDGSLSRQGRVIPELLAELLAHP--FLALPP
B.Ac.Act_1      PTFGYDTGPGNALLDIAWEQGGDQGSPYDVDAALARTGAVHEPMLRALLEDP--YYARRP
                   . *  . * :::             *  .  .  *                :     

B.B.Sph_1       PKSLANDFGTDTVYP---IIQ-AAGLS--VNDALRTYTEHIARQIAAALLTTGPVNENAK
E.M.Art_1       PKSLGVDFGPEILYP---LIR-ARDLT--TCDALRTFTEHICNQVATIVELVKERVGRDN
E.Al.Cil_2      PKSLGKEHVEKDFLP---LIEANQDLS--VQDKLNTVVEMMAQTTAEQIKVNDSKQEDDI
E.Al.Cil_3      PKSLGKEHVEKDFLP---LIEANQDLS--VQDKLNTVVEMMAQTTAEQIKVNDSKQEDDI
B.B.Fla_1       PKSLGLEWVLSNILP---LID-KKEKD--VSIILRTFIEHSAIQIGKIIHNSSA------
BP2_E-valu      PKSLSREWLENNLLN---LKA-LQNLE--IENILATLYEHIGYQIGKILNEKNV------
ORF             PKSLGREWVEEHIFP---I---LKNQK--PEDLLCTFCEHTAIQIGKFLTDESA------
BP1_E-valu      PKSLSREWVLEHIQP---L---FTNDE--PQDLLRTFCEHIAIQISHNLRDGTA------
E.Al.Cil_1      PKSLGVEWVYDCILP---LLD-SSNLS--QQDKLCTFCEHIAYQIGKSIEKKDEK-----
B.Pro           PKSLGLEWVDKNIFP---IID-SYNLT--IPDILRTFSEHVSIQVSKTINDKNAS-----
E.M.Ann_1       PKSTGREWLEDEVIP---LAQ-NKGYS--THNILATACRLIAAQIGEILTSTSTSTNPRR
E.M.Mol_2       PKSLGAEWIEENIFP---ILD-TTSYK--ITDLMRTFVEHVACKLADACASAQAPPDDQK
E.M.Mol_1       PKSLGIEWISAKVFP---LLD-AKQYT--YEDMMRTLAEHVAQKIAQACVDSKPSTKDDE
B.Th.The_1      PKTTGREWYNERFIE-------GVEKG--SFDVLRTLTYFTAFCVHENMKRYLPEVER--
B.C.Chr_1       PKSTGRELFGHHYLAHCRQDAQHYNLS--DADWLATITELTVASIADSYHRFLPSLPHE-
B.P.Alp_1       PKSLDRDHFSKF----------LREAQ--GTEGVATLTALTVHSILMGIDVLPKSPQE--
B.F.Bac_1       PKSTGREHFGERYAKK--LWDEAEDMSIYPYDRIATVTKLTAITITNEINRYIVKSGIRE
B.Te.Mol_1      PKSTGRESFGVEYTDQ--LIRKYAFEK--HEDIVHTFTRITADSITSSIKDFVLKKSSVD
E.Am.Myc_1      PKSTGRELFNIGWLNKILLQDAFKEIK--SEDVQATLLELTCKSIVEEIKKTNITFDR--
B.P.Gam_1       PKSTGREVFNLGWVHH--HLFQLPTLT--PEDVQATLLELTALTITESLQSAQAITKE--
B.P.Bet_1       PKSAGREQFNLDWLDTR-LGSLDEALA--PPDVQATLVEFTTMSLADAVNRECTGAQE--
B.D.Dei_1       PKSTGREVWRLE------HLEGTQTVS--PPDLLASLTELTARSIAQAYRDFILPKGLDE
B.P.Del_1       PRSAGREGFGDALVER--LWERHGASR--PHDLMATAVAFTVEATARAYERWLMPRFALE
B.Ac.Act_1      PKSTGKEYFDAR------MIGPYRELP--LADLLATLTELTAIPIARACAEHRVAE----
                *.:   :                            :                        

B.B.Sph_1       ------LLVTGGGALNTFLIERLRVSLDA--IGIAVEVPA-DELVNYKEALIMALIGVLR
E.M.Art_1       WPKECKMLVTGGGARNTFLVQRLSEALKA--HGILVVVPT-DELVKFKEALMTAALAVLR
E.Al.Cil_2      K-----VLATGGGAYNKYFIERLNFYLRD--TKVQVIVPN-NLIVEFKEALLFAFLGFLR
E.Al.Cil_3      K-----VLATGGGAYNKYFIERLNFYLRD--TKVQVIVPN-NLIVEFKEALLFAFLGFLR
B.B.Fla_1       ------VLITGGGVFNSFLMKRIEFYSKK-----KVEIQT-IELINYKEALIFAFLGLLR
BP2_E-valu      -------LVTGGGAHNHFLIEKIKQYSKS-----KIIIPS-KEIIDFKEALIFGFIGVLK
ORF             -------LFTGGGVFNSFLMERITFYSKS-----EILVPN-KELIEFKESLIFA------
BP1_E-valu      -------LLSGGGTFNSFLVERIKHYSTS-----KIIIPN-NTIINFKEAIIFGFLGVLK
E.Al.Cil_1      ------VLFTGGGVQNKYLMERIHHYVKN----VQILDQQ---ASDFKEALIFGLLGVLK
B.Pro           ------ILFTGGGVKNNFLFSLIRKRLPN-----SFCKPN-NDLIDFKEALIFGFLGVLK
E.M.Ann_1       ------MLITGGGAFNRHLMSCIKIEIQRRNLNITMVTVS-RETVEFKEALSFAFLGLLS
E.M.Mol_2       SSRMMSILVTGGGAFNVTLVEAFRNKIDK--LGMHLESPD-KYTINFKEALVFAFLGLKC
E.M.Mol_1       VS----VMITGGGAFNKFLIKILSEKLEE--HKISIKETD-EETINFKEALVFAFLGLRS
B.Th.The_1      ------IYVFGGGAFNKLLLEDLMRF------GYRVFVPN-RTFAKAREAICMALLANEF
B.C.Chr_1       ------VILAGGGSRNSYLIERLQSYLLD--THLLTSDEL-GISSEFKESIAFAILAYWH
B.P.Alp_1       ------ILVCGGGVKNKTLMALLGKKAAP--------LPD----SEMIEAQAFAFLAVRV
B.F.Bac_1       ------VFISGGGSYNPVLMQAISNGLPP-KVVVRKLDEI-GMPADAKEAMVFALLGYQY
B.Te.Mol_1      E-----LIISGGGVHNKFLVELISKGLPG--IKVLSTDDI-NFSSDFKEALAFIILGNQT
E.Am.Myc_1      ------VLVCGGGAKNSMIIKRLSELLSPFNTKVSLTDDHGGVPTQDMEAAAFAWLAYRT
B.P.Gam_1       ------LLVCGGGAHNKALMKRLAELLPD--TEVSSTEKF-GVDPDWVEAMAFAWLAHCC
B.P.Bet_1       ------LYVCGGGAYNRTLMQRLSALLPS--LRVATTATL-GIDPDWVEALAFAWLARQM
B.D.Dei_1       ------VWVAGGGAYNTTLMRRLKALLPV---TVYTFEER-GLHAKHREALCFAVLGYLR
B.P.Del_1       A-----VYVSGGGTRNPVLMERLTARLAP--LPVRPLDVL-GLPEGAKEAVCFALLANEH
B.Ac.Act_1      ------VLLSGGGAANPLLCARIGEHLRG-KTVVRTSAEA-GLPVDAKEAVLAGLLGWLT
                          ***  *  :   :                         *:          

B.B.Sph_1       WREENNVLSSVTGASRNSVGGAMW-----------MGQED----------------
E.M.Art_1       VRGEANFFSMVSGSQRDSVGGALW-----------CGKV-----------------
E.Al.Cil_2      ILKLPNCLKSVTGASQDNIGGCLY-----------LI-------------------
E.Al.Cil_3      ILKLPNCLKSVTGASQDNIGGCLY-----------LI-------------------
B.B.Fla_1       IDNQVNCLSSVTGARKNHSSGIIF-----------NP-------------------
BP2_E-valu      LRNEVNCLKEVTGADRDNIGGEIF-----------QPN------------------
ORF             --------------------------------------------------------
BP1_E-valu      VRNEVNCLRSVTGADMDNCGGIIH-----------EP-------------------
E.Al.Cil_1      LRNEINVLSSVTGASHDHSSGYIY-----------KYQEN----------------
B.Pro           IRNEVNCLKSVTGALKDHSSGIIF-----------E--------------------
E.M.Ann_1       LKGEVNVNKLTTGARCNSVSGSIH-----------MPTCA----------------
E.M.Mol_2       IFGECNIFRDVTGSESDSVSGSIH-----------LPVSTTSDYCISYFQKKKSSG
E.M.Mol_1       LLGRENVCSDVTGSTTDTVSGSIH--------------------------------
B.Th.The_1      LNGVTTGMPSVTGAKRPAVLGKIA-----------FPW------------------
B.C.Chr_1       VHNFAGNLPCVTGAKKEVVLGVSH-----------KE-------------------
B.P.Alp_1       LRGLPTSFPTTTGCRVPVCGGRLV-----------YPESFSTQR------------
B.F.Bac_1       LNKRTNNLPKATGAKQKVMMGKVA-----------WGKGRR---------------
B.Te.Mol_1      LLGLTSNLKEATGAVKNVILGTVS-----------YYT------------------
E.Am.Myc_1      INRKHGNLKEVTGASENTILGSIY-----------LKN------------------
B.P.Gam_1       LEGVPANRPTVTGAKGRRVLGAIY------------PA------------------
B.P.Bet_1       LHHAPGNLPAVTGARGERVLGAIY------------PA------------------
B.D.Dei_1       YLEQPNTLAQVTGAQKNALAGKIT-----------LPAPAGA--------------
B.P.Del_1       LSGTPANVPSATGAKRRVVLGKLT------------P-------------------
B.Ac.Act_1      WHGVAGNVPSATGADAPRVLGSITPAGTGARLGEPRPGPPEWLRVVATSEGEGTGR
                                                                        

___________________________________________________________________________________________________

GBlock 2:


Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 24
Alignment assumed to be: Protein
New number of positions: 128 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  ------------------MIYRAIG-------LMSGSSLDGLDIVFAEIHENGGR-----
Euk_Met_Art_1_E  ----------MTGGAQDMAQYRVIG-------VMSGSSLDGLDIIYAVFNVQPDNT----
Euk_Alv_Cil_2_E  ------------MTDNQIKTLNIIG-------VMSGTSLDGLDLAYFKFKYLENQKQTFN
Euk_Alv_Cil_3_E  --MKARFELAPFRNRALIYRLRPLGHFIFSESVMSGTSLDGLDLAYFKFKYLENQKQTFN
Bac_Bac_Fla_1_E  ---------------MNGDCCFIIG-------LMSGTSLDGIDLVYVKFNKKNY------
Bac_Pro_2_E-val  --------------MTKIDNYSVIG-------VMSGTSLDGLDIIKCTFQKGDE------
ORF              IYAKVHFLNYFWKLMTKKIKYTALG-------IMSGTSLDGIDLAICTFTKNQV------
Bac_Pro_1_E-val  --------------MLDNIKYNVLG-------VMSGTSLDGIDFVLCTFSKNKY------
Euk_Alv_Cil_1_E  ---------------MDQQNYTIVG-------VMSGTSLDGIDLALIQFENMNQQ-----
Bac_Pro_3_E-val  ----------------MKSIYNVLG-------VMSGTSIDGIDLCYCCFTLDRE------
Euk_Met_Ann_1_E  ------MASWQKFTDPTRKSWTGLG-------IMSGTSLDGIDLCVVSFTKEGGV-----
Euk_Met_Mol_2_E  -----------------MTSYVGIG-------CMSGSSLDGLDLCCVEFTGDRDTDV---
Euk_Met_Mol_1_E  --------------------------------VMSGTSLDGLDLCYTQFTGDVSTDV---
Bac_The_The_1_E  ------MYWADFLKLLDKKKRTIAG-------LMSGTSADGLDIAVVSFDGASRE-----
Bac_Cya_Chr_1_E  --------------------MIVVG-------LMSGTSVDGIDASVVDIQGQGLD-----
Bac_Pro_Alp_1_E  -----------------MEPIWALG-------LMSGTSLDGIDAALILTDGEQI------
Bac_Fir_Bac_1_E  ----------------MKLVNHAVG-------MMSGTSLDGIDVAIVEIVEEDGD-----
Bac_Ten_Mol_1_E  ----------------MNTSKLACG-------IMSGTSLDGIDVAIASISGSGLE-----
Euk_Amo_Myc_1_E  ------------MDLINNNKNLYIG-------IMSGTSLDGIDVVLTEINNSG-------
Bac_Pro_Gam_1_E  ------------------MDFFYIG-------VMSGSSLDGIDIALLKQDDRS-------
Bac_Pro_Bet_1_E  -----------MNSGHTYEAEHYVG-------LMSGTSLDGVDAALAEIGSAGQ------
Bac_Dei_Dei_1_E  --------------------MRVLG-------LMSGTSADGVDLVLAALEGRPPH-----
Bac_Pro_Del_1_E  ----------MDSRPPPPNSRLCVG-------LLSGTSVDAVEAVLCRVEGTGPE-----
Bac_Act_Act_1_E  --------------------MRVLG-------MQSGTSMDGVDAAVLEIEPVAEG-----
                                                  ##########                 
                                                  <===1====>

                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  ---WSYSIVAADCYPYSAEWAGR----LQSATSLNALDYQLLHAEYGAYLGAEVNRFI--
Euk_Met_Art_1_E  ---WKFSIEHTQCQPYKTYWLDK----LRHVAAMNALEYQLVHTEYGRALGDHVNNFI--
Euk_Alv_Cil_2_E  SKSFTYEIINAETIAYDENMRSN----LINTMQMSGVELSKFDREYGKFIGESIVKFIK-
Euk_Alv_Cil_3_E  SKSFTYEIINAETIAYDENMRSN----LINTMQMSGVELSKFDREYGKFIGESIVKFIK-
Bac_Bac_Fla_1_E  ---KSFKILAATTISYSNKWKNE----LKTAIHFSKDDLIILDIEYGKLLGKEINLFIK-
Bac_Pro_2_E-val  ---WSFKIEKGITKKYSKNWLEL----LKKSHEKSSKEIQINDNIYGDYIGKQVSSFI--
ORF              ---WEYRIEKSNTLKYPIYWKSK----LETLHTQNKATIEQANIQFGQYVGEIINVFL--
Bac_Pro_1_E-val  ---WQFKIKKTQTIKYTNYWKLK----LGDLHKKDINEISRTDVEYGKLIANEINKFI--
Euk_Alv_Cil_1_E  ---WHYKILSAQTYLYEQSWIDL----LKNAHTLQQGEIESFNLNYTHHLAQKINKFTS-
Bac_Pro_3_E-val  ---WTYEIIKCETISYDNYWFEK----LSTAVLLSKPEISLLNNEYTFFLASVVNQFIH-
Euk_Met_Ann_1_E  ---WNYVIKHAVTREYTTEIENV----LKSAHNLSGFDLIKAHLRYGRYLGETIRDFL--
Euk_Met_Mol_2_E  ---WGYRILKAVTLPYDANWTSR----LAGARDLSGEALIRLHVEYGHLLGKLIKKFV--
Euk_Met_Mol_1_E  ---WSFRIEKAITIPYTDTWKGR----LSGSVNLNGADLIQLHVEYGHFVGQTVRDFI--
Bac_The_The_1_E  ---TKFKLLDFRSFDYPETFKKR-IIETYDPSKSTVKDVTFMNFEIARIHAAMLKQLS--
Bac_Cya_Chr_1_E  ---LKVNLLVGQTFPYSSALRSQ-ILAVCEGKSLTMAEFAQLDHAIALEFAQAVINII--
Bac_Pro_Alp_1_E  -----YEFGESLYVPYDADFQTQ----LRSQLGQQFPD-PQIARQSTQHHGEVVKQLL--
Bac_Fir_Bac_1_E  ---IELRLKYFDMVTYHDAVKQE-LLKLCDPSKATIQMISTMNMLFGTLFAEAANQVIK-
Bac_Ten_Mol_1_E  ---TKIEFISGKTYPYPRAIYEK--VKLAIEDKLSIRDLSSLNFELGKLYADVVKDLCS-
Euk_Amo_Myc_1_E  -----IKVLKSYTHPLPETTRKE-ILSINQGQQTTLVKIGKINRDLGILYGEAVIELLKL
Bac_Pro_Gam_1_E  ------RLLATHYIPMPEDLHAE-LLGLCSSGVDELARAAIAEQKWCRLVAQGVQTLLE-
Bac_Pro_Bet_1_E  -----VRLLHSHYLPYPDALRTR-LLGLHTPQPDEIHLAAIAANELARLYADTVKSLLD-
Bac_Dei_Dei_1_E  ---LTWQVRAYREARFPPGLRLEVLQALKD--RASTRQVALLHHALGRFYAEVAAPFR--
Bac_Pro_Del_1_E  ---VRISLVAHVSRPFTPEFTRR------VLAANDARSLCELNFALGEHFAAAALEVIA-
Bac_Act_Act_1_E  ---IELRLGASRTVPY-PDWLRAELGSAVAGAALDARTLCLLDTELGKVFGSIAAEF---
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  ----GEKGLDYKVALISSHGHTTFHVPV--------KRMTAQLGDGAAIAAATKLPVVSD
Euk_Met_Art_1_E  ----REKKLTDKIDLVACHGHTVFHLPM--------QMTTTQLGDGATVAAVTGLPTVSD
Euk_Alv_Cil_2_E  ----KFNIHHKSVDYVSSHGHTVFHNPS--------EQYTVQIGHGSSIAASCKIPTICD
Euk_Alv_Cil_3_E  ----KFNIHHKSVDYVSSHGHTVFHNPS--------EQYTVQIGHGSSIAASCKIPTICD
Bac_Bac_Fla_1_E  ------KNDIVDVDFIASHGHTVLHQPG--------KGVTLQVGSGKTISEITNQKVVCD
Bac_Pro_2_E-val  ------KKNDFKIDFVASHGHTVFHQPK--------NKITLQIGNGQNIADISKSTTISD
ORF              --------DGEKIDFIASHGHTIFHQPE--------NNYTLQIGCGKTISQTTKTTTIND
Bac_Pro_1_E-val  --------VNEKIEIIACHGHTIFHQPE--------NKYTLQIGDGKTISRKTGITTVNN
Euk_Alv_Cil_1_E  ------QFQDVKIDAICSHGHTIIHKPK--------EGITIQIGNLPILSQLVKTTVVCD
Bac_Pro_3_E-val  ------NNNLTNIDFVSSHGHTVFHKPK--------SNYTFQLGNLIEFRNLISFPVVCD
Euk_Met_Ann_1_E  ------TDCQTEVDFVGCHGHTIFHQPD--------DHVTFQLGDGETMASYMYCPLVNN
Euk_Met_Mol_2_E  ------DENQLDVEFVASHGHTIFHNPT--------LNYTFQLGDGETVSRYLNCPFVCN
Euk_Met_Mol_1_E  ------KEGNLKPDFVASHGHTVFHQVD--------KGFTFQLGEGETTSIYLTCPFITN
Bac_The_The_1_E  ----------QEIDAIGYHGQTVYHLPE--------NGATLQIGEADVIAVETNLPVIHS
Bac_Cya_Chr_1_E  -------PKNTKIDLIGSHGQTVYHQPP----HKNELGYSLQLGRGDVIFQKTGIQTINN
Bac_Pro_Alp_1_E  ------SQTNKPVKLIGYHGQSTFHAPP----------ITVQMGDGEMLARTVGVPVVYD
Bac_Fir_Bac_1_E  ----EAGLRNEDIDFISSHGQTIFHQPEKVNIAGHPVTSTLQIGDISVIAEQTGITTVGD
Bac_Ten_Mol_1_E  ----LNKIQTSSLSFIASHGQTIYHQAYG---DESRAPSTLQIGHGSVISNLTQTTVVSD
Euk_Amo_Myc_1_E  VKRDNNSFSKDDIVAIGNHGTTVYHMPE--------EGFTIQLGDNNRVAAMTNINVVGD
Bac_Pro_Gam_1_E  ----DQNMVPAQIRAIGSHGQTIRHEPA--------RGYSIQIGNPALLAELTEITVVSD
Bac_Pro_Bet_1_E  ------GFTAGRVRAIGCHGQTLRHRPA--------DGYTLQIGNAALLAELTGIAVVAD
Bac_Dei_Dei_1_E  ----------GQADLAALHGQTLWHEPP---------QATLQIGEPAYLAEALGVPVVSD
Bac_Pro_Del_1_E  ----RAGLRPRDVDVIGSHGQTVAHLPA----SLSETPSTLQLGEPAVIAERTGLPVVSD
Bac_Act_Act_1_E  ----------DRVDLVASMGQTLYHLVE-----DGKTRGTLQLGQPAWIAERAGVPVVAD
                                   #########            #####################
                                   <===2===>            <===================

                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  LRAMDVALGGQGAPIVPIGEQLLL-SGYN-----YFLNLGGIANISR------HTE---G
Euk_Met_Art_1_E  FRSVDVALMGQGSPFSIAAERRLFGTEYQ-----FFLNIGGMACLTY----VGKGN---D
Euk_Alv_Cil_2_E  FRSLDVALGGQGAPLVPIGDKLLF-AEYK-----YCLNIGGIINISFDINQSDEIN---Q
Euk_Alv_Cil_3_E  FRSLDVALGGQGAPLVPIGDKLLF-AEYK-----YCLNIGGIINISFDINQSDEIN---Q
Bac_Bac_Fla_1_E  FRTQDVNLGGQGAPLVPIGDELLF-ADFD-----FCVNLGGFANVSY------KIK---E
Bac_Pro_2_E-val  FRSLDINLNGQGAPLVPIGDLMLF-PQYK-----YCLNLGGFANISI------KRK---D
ORF              FRSLDIFLNGQGAPLVPIGDLLLF-PKHK-----YCINIGGFANISI------KNN---E
Bac_Pro_1_E-val  FRNLDVALNGQGAPLVPIGDLYLF-PDYK-----YCVNLGGFANISI------KKN---N
Euk_Alv_Cil_1_E  FRVQDVKLGGNGAPLVPLGDRILF-HEYH-----YRINLGGFSNISY------ERE---N
Bac_Pro_3_E-val  FRIQDIQLGGQGAPLVPIGDLLLF-KDYK-----YCINLGGFSNLSV------KSE---N
Euk_Met_Ann_1_E  FRTKDVALGGQGAPLVPLAEQHLF-ADFD-----FCLNLGGIANISI--------R---D
Euk_Met_Mol_2_E  FRNKDVAYGGQGAPFVPCGEKYLF-QAYD-----ICINLGGIANIGI------------N
Euk_Met_Mol_1_E  FRSKDLALGGQGAPLVPSGERFLF-SQTD-----ICLNLGGIANIGL------------K
Bac_The_The_1_E  FRTKDVALGGEGAPITAYFDWVFF-KRPH----TVVLNIGGIANITY-------IN---D
Bac_Cya_Chr_1_E  FRVADIALGGQGAPLVSKIDLCLY-HHPR--HSRCLQNIGGIGNATY--LPSTHTPQWQE
Bac_Pro_Alp_1_E  FRTADCAAGGQGAPLVPIYHQVLF-RHKN--HPLVVVNIGGVANLTY------SDG---E
Bac_Fir_Bac_1_E  FRTRDMAVGGQGAPLAPYADYLLF-RDKE--KGRVLVNIGGISNMSI--LPKDCDE---N
Bac_Ten_Mol_1_E  FRVADMIAGGQGAPLVPFVDYCLF-SDPN--KNRILQNIGGISNITF--LSKSLKK---E
Euk_Amo_Myc_1_E  FRSRDIALGGQGAPLVPAFHKFIL-SDDT--EKRIVLNIGGISNITL-----LIPN---G
Bac_Pro_Gam_1_E  FRRRDIAAGGQGAPLVPAFHEALF-DDNK--DHRAVLNIGGFSNLSL-----IESD---R
Bac_Pro_Bet_1_E  FRSRDIAAGGQGAPLVPAFHAQVL-RHPD--VHRVIANIGGIANITD--LPTS------G
Bac_Dei_Dei_1_E  FRPADLALGGEAAPLVPYPDLLLY-GQSG--VARAIHNLGGISNLTY--LPADLDP---A
Bac_Pro_Del_1_E  FRTRDVAAGGQGAPLVPYLDWALF-RKPG--VARALQNIGGIGNVSV----VSERI---E
Bac_Act_Act_1_E  FRPRDVAAGGQGAPLVPVLDELLL-RGFGGSVPMACVNIGGIANITV--VAPG------G
                 #######################              #######                
                 ==3===================>              <==4==>

                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  HYAAFDVCAANRVLNMLAQTAG---HTYDAGGQLAASGAINKKLLEELDELS--YYRESA
Euk_Met_Art_1_E  DSFAADVCPANQLLNLLAQRES---KNYDNEGEMASSGSINCRLLQDLDGFD--YYKASF
Euk_Alv_Cil_2_E  IRKAFDVSPGNMILNYLCKKYLN--KEYDADGQEARLGKTHQELLNQLLNVE--FFLKAG
Euk_Alv_Cil_3_E  IRKAFDVSPGNMILNYLCKKYLN--KEYDADGQEARLGKTHQELLNQLLNVE--FFLKAG
Bac_Bac_Fla_1_E  NRIAFDICPVNIVLNHYVQKLG---FDYDDKGNIAAKGKINEDLLKELNSLE--FYKKAA
Bac_Pro_2_E-val  KIKAYDVCPANIILNYFTRRLG---KEYDKNGLIGQKGICDLKLLDQLNNLK--YYSIEK
ORF              EIIAFDICPANIVLNDICKKLG---FEYDYNGNISRKGEIVPALLHQLNQLD--FYIKKA
Bac_Pro_1_E-val  LIKAFDICPANIVLNKICKSID---TEYDDNGNNARKGKILPIFLDKLNKLE--FYKSSK
Euk_Alv_Cil_1_E  VTLAYDICPVNTVLNRLAFP-----KNYDENGDISKSGNVNPNLLDQLNNLE--YYKLSH
Bac_Pro_3_E-val  EIIAYDICPVNIVLNKYSRKIG---YEFDKNGSISKSGVINAKLLTDLNDLS--FYSLKH
Euk_Met_Ann_1_E  EAQGFDVGPCNLLLNHFASAHDSS-LKFDKNGEIAETGTVIDELLSSWNALP--FFKLVP
Euk_Met_Mol_2_E  GKKGYDISPCNYVMNKLAALFDSS-LTFDTDGRIAGQGQVLYNVLEKLDSLP--YYSTSP
Euk_Met_Mol_1_E  NGKGYDICPCNIVFNRLAGLHTAF-MDYDEDGKLASRGKIKPDLLDQLNDLD--YYKLKC
Bac_The_The_1_E  VVLAFDTGPGNCLIDLYVKESFG--ILFDKDGELARRGKVDDKILHELIRRDQEYLNKRP
Bac_Cya_Chr_1_E  KIIGWDTGPGNALIDLAVQELTDNQQTFDFNGDWSRQGKPCQPLVKQWLKQD--FFHHKP
Bac_Pro_Alp_1_E  VLIAGDTGPGNALINDVMLRDFG--QEFDKNGQTARVGRINPNLLQQWLQDP--YFSKPF
Bac_Fir_Bac_1_E  DVVAYDTGPGNMIIDYFAQQISNGKISYDVDGKLAAKGNVREEWLKRLLDNP--YYAEQP
Bac_Ten_Mol_1_E  DVLAFDTGPGNMMINRAMEICYQ--LPYDESGKIARTGKNIEALYNEVMQHP--YFLLLP
Euk_Amo_Myc_1_E  DTLGFDTGPGNIVMDSWIQQIKN--EAFDQDGQWAKSGTINVKLLDAMLNSTD-YFIKSP
Bac_Pro_Gam_1_E  PVEGFDCGPGNVLLDAWIQSQRH--ESYDKDGEWAASGEVDQALLQKLLSDQ--FFLTKG
Bac_Pro_Bet_1_E  SVRGWDTGPGNMLLDAWIKRHSG--VHYDRDGAWAASGSVHPGLLAALMRHA--YLQLPP
Bac_Dei_Dei_1_E  KVLAFDTGPGNCLLDEAAGHLG---LSQDSGGQIAASGKPHPGLLERWLTHP--YFHRRP
Bac_Pro_Del_1_E  DTIAFDTGPGNMVMDGLARRISGGQLQCDLDGSLSRQGRVIPELLAELLAHP--FLALPP
Bac_Act_Act_1_E  PTFGYDTGPGNALLDIAWEQGGDQGSPYDVDAALARTGAVHEPMLRALLEDP--YYARRP
                      ######                 ####################      ######
                      <==5=>                 <========6=========>      <====7

                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  PKSLANDFGTDTVYP---IIQ-AAGLS--VNDALRTYTEHIARQIAAALLTTGPVNENAK
Euk_Met_Art_1_E  PKSLGVDFGPEILYP---LIR-ARDLT--TCDALRTFTEHICNQVATIVELVKERVGRDN
Euk_Alv_Cil_2_E  PKSLGKEHVEKDFLP---LIEANQDLS--VQDKLNTVVEMMAQTTAEQIKVNDSKQEDDI
Euk_Alv_Cil_3_E  PKSLGKEHVEKDFLP---LIEANQDLS--VQDKLNTVVEMMAQTTAEQIKVNDSKQEDDI
Bac_Bac_Fla_1_E  PKSLGLEWVLSNILP---LID-KKEKD--VSIILRTFIEHSAIQIGKIIHNSSA------
Bac_Pro_2_E-val  PKSLSREWLENNLLN---LKA-LQNLE--IENILATLYEHIGYQIGKILNEKNV------
ORF              PKSLGREWVEEHIFP---I---LKNQK--PEDLLCTFCEHTAIQIGKFLTDESA------
Bac_Pro_1_E-val  PKSLSREWVLEHIQP---L---FTNDE--PQDLLRTFCEHIAIQISHNLRDGTA------
Euk_Alv_Cil_1_E  PKSLGVEWVYDCILP---LLD-SSNLS--QQDKLCTFCEHIAYQIGKSIEKKDEK-----
Bac_Pro_3_E-val  PKSLGLEWVDKNIFP---IID-SYNLT--IPDILRTFSEHVSIQVSKTINDKNAS-----
Euk_Met_Ann_1_E  PKSTGREWLEDEVIP---LAQ-NKGYS--THNILATACRLIAAQIGEILTSTSTSTNPRR
Euk_Met_Mol_2_E  PKSLGAEWIEENIFP---ILD-TTSYK--ITDLMRTFVEHVACKLADACASAQAPPDDQK
Euk_Met_Mol_1_E  PKSLGIEWISAKVFP---LLD-AKQYT--YEDMMRTLAEHVAQKIAQACVDSKPSTKDDE
Bac_The_The_1_E  PKTTGREWYNERFIE-------GVEKG--SFDVLRTLTYFTAFCVHENMKRYLPEVER--
Bac_Cya_Chr_1_E  PKSTGRELFGHHYLAHCRQDAQHYNLS--DADWLATITELTVASIADSYHRFLPSLPHE-
Bac_Pro_Alp_1_E  PKSLDRDHFSKF----------LREAQ--GTEGVATLTALTVHSILMGIDVLPKSPQE--
Bac_Fir_Bac_1_E  PKSTGREHFGERYAKK--LWDEAEDMSIYPYDRIATVTKLTAITITNEINRYIVKSGIRE
Bac_Ten_Mol_1_E  PKSTGRESFGVEYTDQ--LIRKYAFEK--HEDIVHTFTRITADSITSSIKDFVLKKSSVD
Euk_Amo_Myc_1_E  PKSTGRELFNIGWLNKILLQDAFKEIK--SEDVQATLLELTCKSIVEEIKKTNITFDR--
Bac_Pro_Gam_1_E  PKSTGREVFNLGWVHH--HLFQLPTLT--PEDVQATLLELTALTITESLQSAQAITKE--
Bac_Pro_Bet_1_E  PKSAGREQFNLDWLDTR-LGSLDEALA--PPDVQATLVEFTTMSLADAVNRECTGAQE--
Bac_Dei_Dei_1_E  PKSTGREVWRLE------HLEGTQTVS--PPDLLASLTELTARSIAQAYRDFILPKGLDE
Bac_Pro_Del_1_E  PRSAGREGFGDALVER--LWERHGASR--PHDLMATAVAFTVEATARAYERWLMPRFALE
Bac_Act_Act_1_E  PKSTGKEYFDAR------MIGPYRELP--LADLLATLTELTAIPIARACAEHRVAE----
                 #######                        #####                        
                 ======>                        <=8=>

                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Bac_Bac_Sph_1_E  ------LLVTGGGALNTFLIERLRVSLDA--IGIAVEVPA-DELVNYKEALIMALIGVLR
Euk_Met_Art_1_E  WPKECKMLVTGGGARNTFLVQRLSEALKA--HGILVVVPT-DELVKFKEALMTAALAVLR
Euk_Alv_Cil_2_E  K-----VLATGGGAYNKYFIERLNFYLRD--TKVQVIVPN-NLIVEFKEALLFAFLGFLR
Euk_Alv_Cil_3_E  K-----VLATGGGAYNKYFIERLNFYLRD--TKVQVIVPN-NLIVEFKEALLFAFLGFLR
Bac_Bac_Fla_1_E  ------VLITGGGVFNSFLMKRIEFYSKK-----KVEIQT-IELINYKEALIFAFLGLLR
Bac_Pro_2_E-val  -------LVTGGGAHNHFLIEKIKQYSKS-----KIIIPS-KEIIDFKEALIFGFIGVLK
ORF              -------LFTGGGVFNSFLMERITFYSKS-----EILVPN-KELIEFKESLIFA------
Bac_Pro_1_E-val  -------LLSGGGTFNSFLVERIKHYSTS-----KIIIPN-NTIINFKEAIIFGFLGVLK
Euk_Alv_Cil_1_E  ------VLFTGGGVQNKYLMERIHHYVKN----VQILDQQ---ASDFKEALIFGLLGVLK
Bac_Pro_3_E-val  ------ILFTGGGVKNNFLFSLIRKRLPN-----SFCKPN-NDLIDFKEALIFGFLGVLK
Euk_Met_Ann_1_E  ------MLITGGGAFNRHLMSCIKIEIQRRNLNITMVTVS-RETVEFKEALSFAFLGLLS
Euk_Met_Mol_2_E  SSRMMSILVTGGGAFNVTLVEAFRNKIDK--LGMHLESPD-KYTINFKEALVFAFLGLKC
Euk_Met_Mol_1_E  VS----VMITGGGAFNKFLIKILSEKLEE--HKISIKETD-EETINFKEALVFAFLGLRS
Bac_The_The_1_E  ------IYVFGGGAFNKLLLEDLMRF------GYRVFVPN-RTFAKAREAICMALLANEF
Bac_Cya_Chr_1_E  ------VILAGGGSRNSYLIERLQSYLLD--THLLTSDEL-GISSEFKESIAFAILAYWH
Bac_Pro_Alp_1_E  ------ILVCGGGVKNKTLMALLGKKAAP--------LPD----SEMIEAQAFAFLAVRV
Bac_Fir_Bac_1_E  ------VFISGGGSYNPVLMQAISNGLPP-KVVVRKLDEI-GMPADAKEAMVFALLGYQY
Bac_Ten_Mol_1_E  E-----LIISGGGVHNKFLVELISKGLPG--IKVLSTDDI-NFSSDFKEALAFIILGNQT
Euk_Amo_Myc_1_E  ------VLVCGGGAKNSMIIKRLSELLSPFNTKVSLTDDHGGVPTQDMEAAAFAWLAYRT
Bac_Pro_Gam_1_E  ------LLVCGGGAHNKALMKRLAELLPD--TEVSSTEKF-GVDPDWVEAMAFAWLAHCC
Bac_Pro_Bet_1_E  ------LYVCGGGAYNRTLMQRLSALLPS--LRVATTATL-GIDPDWVEALAFAWLARQM
Bac_Dei_Dei_1_E  ------VWVAGGGAYNTTLMRRLKALLPV---TVYTFEER-GLHAKHREALCFAVLGYLR
Bac_Pro_Del_1_E  A-----VYVSGGGTRNPVLMERLTARLAP--LPVRPLDVL-GLPEGAKEAVCFALLANEH
Bac_Act_Act_1_E  ------VLLSGGGAANPLLCARIGEHLRG-KTVVRTSAEA-GLPVDAKEAVLAGLLGWLT
                           #########                             #####       
                           <===9===>                             <=10>

                        430       440       450       460       470
                 =========+=========+=========+=========+=========+======
Bac_Bac_Sph_1_E  WREENNVLSSVTGASRNSVGGAMW-----------MGQED----------------
Euk_Met_Art_1_E  VRGEANFFSMVSGSQRDSVGGALW-----------CGKV-----------------
Euk_Alv_Cil_2_E  ILKLPNCLKSVTGASQDNIGGCLY-----------LI-------------------
Euk_Alv_Cil_3_E  ILKLPNCLKSVTGASQDNIGGCLY-----------LI-------------------
Bac_Bac_Fla_1_E  IDNQVNCLSSVTGARKNHSSGIIF-----------NP-------------------
Bac_Pro_2_E-val  LRNEVNCLKEVTGADRDNIGGEIF-----------QPN------------------
ORF              --------------------------------------------------------
Bac_Pro_1_E-val  VRNEVNCLRSVTGADMDNCGGIIH-----------EP-------------------
Euk_Alv_Cil_1_E  LRNEINVLSSVTGASHDHSSGYIY-----------KYQEN----------------
Bac_Pro_3_E-val  IRNEVNCLKSVTGALKDHSSGIIF-----------E--------------------
Euk_Met_Ann_1_E  LKGEVNVNKLTTGARCNSVSGSIH-----------MPTCA----------------
Euk_Met_Mol_2_E  IFGECNIFRDVTGSESDSVSGSIH-----------LPVSTTSDYCISYFQKKKSSG
Euk_Met_Mol_1_E  LLGRENVCSDVTGSTTDTVSGSIH--------------------------------
Bac_The_The_1_E  LNGVTTGMPSVTGAKRPAVLGKIA-----------FPW------------------
Bac_Cya_Chr_1_E  VHNFAGNLPCVTGAKKEVVLGVSH-----------KE-------------------
Bac_Pro_Alp_1_E  LRGLPTSFPTTTGCRVPVCGGRLV-----------YPESFSTQR------------
Bac_Fir_Bac_1_E  LNKRTNNLPKATGAKQKVMMGKVA-----------WGKGRR---------------
Bac_Ten_Mol_1_E  LLGLTSNLKEATGAVKNVILGTVS-----------YYT------------------
Euk_Amo_Myc_1_E  INRKHGNLKEVTGASENTILGSIY-----------LKN------------------
Bac_Pro_Gam_1_E  LEGVPANRPTVTGAKGRRVLGAIY------------PA------------------
Bac_Pro_Bet_1_E  LHHAPGNLPAVTGARGERVLGAIY------------PA------------------
Bac_Dei_Dei_1_E  YLEQPNTLAQVTGAQKNALAGKIT-----------LPAPAGA--------------
Bac_Pro_Del_1_E  LSGTPANVPSATGAKRRVVLGKLT------------P-------------------
Bac_Act_Act_1_E  WHGVAGNVPSATGADAPRVLGSITPAGTGARLGEPRPGPPEWLRVVATSEGEGTGR
                                                                         






Parameters used
Minimum Number Of Sequences For A Conserved Position: 13
Minimum Number Of Sequences For A Flanking Position: 20
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 5
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 10 selected block(s)
Flanks: [34  43]  [139  147]  [160  203]  [218  224]  [246  251]  [269  288]  [295  307]  [332  336]  [371  379]  [409  413]  

New number of positions in input.fasta-gb:  128  (26% of the original 476 positions)






Protein Domains

PROTOCOLE:


InterProScan paramètres par défaut



ANALYSE DES RÉSULTATS:


______________________________________________________________________________________________________________________________________________
|  Code Interpro  |    Banque   |  position  |  position  |  E-value  |  Intitulé banque                  | Intitulé Interpro                 |
|                 |             |            |            |           |            d'origine              |                                   |
|   (IPRxxxxxx)   |  d'origine  |  de début  |   de fin   |           |(premier sur la ligne)             |(en fin de ligne)                  |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|
|                 |             |            |            |           |    Actin-like ATPase domain       |                                   |
|    néant        | SUPERFAMILY |      9     |     109    |  3.5E-11  |        superfamily                |    Néant                          |
|                 |             |            |            |           |         (SSF53067)                |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|
|                 |             |            |            |           | Actin-like ATPase domain          |                                   |
|    néant        | SUPERFAMILY |      139   |     301    |  3.5E-11  |        superfamily                |    Néant                          |
|                 |             |            |            |           |         (SSF53067)                |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|
|    IPR005338    |     Pfam    |      10    |     292    |  4.0E-61  |Uncharacterised protein family     |Anhydro-N-acetylmuramic acid kinase|
|                 |             |            |            |           |             (UPF0075)             |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|
|    néant        |    Gene3D   |      8     |     188    |  3.1E-50  |Nucleotidyltransferase; domain 5   |   Néant                           |
|                 |             |            |            |           |          (3.30.420.40)            |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________| 
|    néant        |    PANTHER  |      1     |     315    |  3.3E-76  |ANHYDRO-N-ACETYLMURAMIC ACID KINASE|    Néant                          |
|                 |             |            |            |           |            (PTHR30605)            |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|
|    néant        |    PANTHER  |      1     |     315    |  3.3E-76  |ANHYDRO-N-ACETYLMURAMIC ACID KINASE|    Néant                          |
|                 |             |            |            |           |          (PTHR30605:SF0)          |                                   |
|_________________|_____________|____________|____________|___________|___________________________________|___________________________________|


    Le domaine protéique associé à l'intitulé PF03702 n'a pas encore caractérisé. Cependant, le même domaine a été caractérisé dans la banque de donnée d'Interpro dans laquelle il correspond à un domaine anhydro-N-acetylmuramic acid kinase. En ce qui concerne les autres domaines protéiques obtenus, aucun n'est caractérisé dans la banque de donnée Interpro. Nous allons donc nous baser sur les intitulés trouvés dans la banque d'origine pour notre analyse. Ainsi, les intitulés SSF53067 correspondent à un domaine Actin-like ATPase. Les intitulés PTHR30605:SF0 et PF03702 correspondent à un domaine ANHYDRO-N-ACETYLMURAMIC ACID KINASE. L'intitulé G3DSA:3.30.420.40 correspond dans la classification des protéines selon CATH à un domaine nucléotidyltransférase.


   En comparant les e-value, on pense que le domaine ANHYDRO-N-ACETYLMURAMIC ACID KINASE est le plus pertinent car il présente les plus faibles e-value (3.3E-76 et 4.0E-61) même si toutefois on note un petit écart entre la meilleure e-value et la suivante (3.3E-76 et 4.0E-61). Les deux dernières e-value (3.5E-11) sont associées au domaine Actin-like ATPase. Elles présentent un écart important avec la meilleure e-value obtenue (3.3E-76< 3.5E-11). C'est pourquoi nous ne validons le domaine Actin-like ATPase (3.5E-11). Enfin, le domaine nucléotidyltransférase est associé à une e-value de 3.1E-50. Cette e-value reste proche des meilleures ( 3.3E-76 et 4.0E-61). Toutefois, pour savoir si l'hypothèse que notre protéine putative présente bel et bien un domaine nucléotidyltransférase, il faut croiser nos résultats avec ceux obtenus lors du BLAST. En effet, avec cette seule analyse, on peut seulement dire que le domaine nucléotidyltransférase est potentiellement présent au niveau de la protéine putative, tout comme le domaine ANHYDRO-N-ACETYLMURAMIC ACID KINASE. On retient donc de cette analyse les domaines nucléotidyltransférase et ANHYDRO-N-ACETYLMURAMIC ACID KINASE.  


   De plus, on constate que le domaine retenu s'étend du 1er acide aminé au 315ème. C'est le domaine qui présente le plus grand recouvrement de la protéine. Les autres domaines retenus sont compris dans le domaine s'étendant du 1er acide aminé au 315ème (domaine nucléotidyltransférase: 8ème acide aminé au 188ème acide aminé/ domaine ANHYDRO-N-ACETYLMURAMIC ACID KINASE: 10ème acide aminé au 292ème acide aminé).


   Les fonctions homologues trouvées par BLAST sont la fonction d'anhydro-N-acetylmuramic acid kinase et celle de protéines chaperonnes. On peut donc, en croisant ces résultats avec ceux obtenus par Interpro en déduire que la fonction de la protéine putative est potentiellement la fonction d'anhydro-N-acetylmuramic acid kinase. En effet, cette fonction est la plus représentée par les séquences homologues.  


   Pour toutes ses raisons, nous choisissons de retenir le domaine protéique ANHYDRO-N-ACETYLMURAMIC ACID KINASE s'étendant du 1er acide aminé au 315ème acide aminé. D'après la fiche Interpro, la fonction biologique prédite est la catalyse de la phosphorylation spécifique de l'acide 1,6- anhydro -N- acétylmuramique ( anhMurNAc ) avec le clivage simultané de la bague 1,6- anhydro , générant MurNAc -6-P . Elle est également nécessaire pour l'utilisation de anhMurNAc , soit importé du milieu , soit provenant de sa propre muréine de la paroi cellulaire. Elle joue donc un rôle dans le recyclage de la paroi cellulaire.    

RÉSULTATS BRUTS:

Recherche de domaines protéiques avec InterProScan

EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	Pfam	PF03702	Uncharacterised protein family (UPF0075)	10	292	4.0E-61	T	07-10-2014	IPR005338	Anhydro-N-acetylmuramic acid kinase	GO:0005524|GO:0006040|GO:0009254|GO:0016773	UniPathway: UPA00343|UniPathway: UPA00544
EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	Gene3D	G3DSA:3.30.420.40		8	188	3.1E-50	T	07-10-2014
EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	SUPERFAMILY	SSF53067		9	109	3.5E-11	T	07-10-2014
EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	SUPERFAMILY	SSF53067		139	301	3.5E-11	T	07-10-2014
EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	PANTHER	PTHR30605:SF0		1	315	3.3E-76	T	07-10-2014
EMBOSS_001	91a181be3ac19a438380686f8b46dcc2	315	PANTHER	PTHR30605		1	315	3.3E-76	T	07-10-2014

Phylogeny

PROTOCOLE:


Phylogeny.fr / méthode PhyML / approximate likehood-ratio test / default substitution model / groupe extérieur: toutes les autres bactéries que les bacteroides


arbre supplémentaire: Phylogeny.fr / méthode PhyML / approximate likehood-ratio test / default substitution model / groupe extérieur: eukaryota



ANALYSE DES RÉSULTATS:


   L'arbre est enraciné sur le groupe extérieur à savoir toutes les bactéries excepté les bacteroidetes.


   On distingue deux groupes évolutifs : d'un coté les bacteroides, l'ORF et les 3 séquences des protéobactéries qui présentaient les meilleurs e-value et de l'autre toutes les autres bactéries. Au sein des autres bactéries, on distingue le groupe des protéobactéries des autres bactéries. On retrouve la même topologie au niveau de la taxonomie de référence (arbre de la vie), les différentes protéobactéries regroupées, les autres bactéries qui ont tous le même ancêtre commun. On note toutefois quelques différences d'embranchements; certains bactéries plus proches d'autres comme Bac_Dei_Dei_1_Evalue1e36 (Deinococci) et Bac_Aci_Aci_1_Evalue2e32 (Acidobacteria). Selon la taxonomie de référence, les Deinococci ne sont pas plus proches parents des Acidobacteria que des Firmicutes. Or, sur notre arbre Bac_Aci_Aci_1_Evalue2e32 et Bac_Dei_Dei_1_Evalue1e36 sont plus proches l'une de l'autre que de Bac_Fir_Clo_1_Evalue2e36 (Firmicutes). Cependant, on peut tout de même dire que globalement la taxonomie est respectée. Les différences sont explicables puisque nous comparons ici un arbre moléculaire avec l'arbre de référence qui reflète la phylogénie des espèces.  


   On remarque que l'ORF a un ancêtre commun plus proche avec les 2 protéobactéries présentant les meilleures e-value c'est-à-dire Bac_Pro_1_Evalue 5e131 et Bac_Pro_2_Evalue2e111. En effet, la valeur de bootstrap étant faible (0.197), la branche regroupant Bac_Pro_1_Evalue 5e131 et l'ORF n'est pas robuste donc on ne peut dire qui est le plus proche de l'ORF entre Bac_Pro_1_Evalue 5e131 et Bac_Pro_2_Evalue2e111.


On retrouve les 3 protéobactéries ayant les meilleures e-value et l'ORF plus proche parent des Bacteroidetes que des autres protéobactéries. Plusieurs explications s'offrent à nous:

- soit un transfert horizontal de gène a été fait des bacteroidetes vers les protéobactéries c'est-à-dire deux transferts indépendants : un transfert des bactéroidetes vers Pro 1 et Pro 2 et un autre transfert des bactéroidetes vers Pro 3

- soit il est possible qu'il y ait eu une duplication du gène.

- soit une mauvaise identification taxonomique de ces bactéries concernant l'absence de sous-groupe a été faite. Pour cela, il faudrait vérifier comment ces organismes ont été isolés et identifiés comme étant des protéobactéries.


   On a beaucoup de valeur de bootstrap inférieur à 0,70. Ainsi la robustesse des branches n'est pas très élevée. Cela pose un problème au niveau de la fiabilité de notre arbre, d'autant plus que certaines branches se situent en amont et mettent en doute la phylogénie de certain groupe entier. Néanmoins, ces mauvaises valeurs de bootstrap peuvent être expliquées par notre alignement multiple. En effet, une bonne partie de nos domaines conservés présente un nombre important de positions très conservées entre elles. Il est donc difficile pour le logiciel de distinguer des groupes évolutifs parmi les différentes séquences étudiées.


L'arbre réalisé en incluant les séquences eucaryotes ne met pas en avant distinctement le groupe extérieur et le groupe d'étude. c'est un exemple typique d'un arbre moléculaire qui ne correspond pas à l'arbre des espèces (l'arbre de la vie). La grande majorité des branches de l'arbre présente des valeurs de bootstraps supérieures à 0.70 ce qui indique une bonne robustesse de l'arbre ce qui le rend fiable. On peut noté que dans notre analyse, nous n'avons pas obtenu beaucoup de séquences eucaryotes homologues (10 séquences en tout) donc il n'est pas assez représentatif pour émettre une hypothèse solide sur l'origine taxonomique de l'ORF.


Nous n'avons pas pu inférer un arbre des distances car les outils BioNJ et Neighbor ne fonctionnaient pas sur le site Phylogeny.fr.



Analyse de l'arbre fait avec comme groupe d'étude les bactéries et comme groupe extérieur les eucaryotes:


   Tout d'abord, nous avons enraciné notre arbre sur le plus grand groupe ne contenant que des séquences eucaryotes (Euk_Met_Mol_1_Evalue4e67, Euk_Met_Mol_2_Evalue6e67, Euk_Met_Ann_1_Evalue5e71). On voit que cinq séquences eucaryotes se confondent dans le groupe des bactéries. Ainsi, le groupe extérieur ne se distingue pas vraiment sur cet arbre. Nous n'avons visiblement pas assez de séquences eucaryotes pour pouvoir parler du passé évolutif des eucaryotes. Autrement dit, nous ne pouvons pas déterminer s'il y a eu une duplication au niveau de l'ancêtre commun aux bactéries et aux eucaryotes (LUCA) suivi de transferts de gène multiple de bactéries vers les eucaryotes. Nous pouvons seulement parler de la position de l'ORF dans cet arbre. Il est proche parent de _Bac_Pro_1_Evalue5e131 et de Bac_Pro_2_Evalue2e11. On ne peut distinguer de laquelle il est le plus proche puisque la branche n'est pas robuste. De plus, notre ORF fait partie d'un sous groupe composé de Bac_Bac_Fla_1_Evalue6e101, Euk_Alv_Cil_1_Evalue7e87 et Bac_Pro_3_Evalue9e96. Ainsi, il possède un ancêtre commun avec des séquences bactériennes et eucaryotes. La présence de Euk_Alv_Cil_1_Evalue7e87 est peut-être dû à un transfert horizontal de gène comme nous l'avons précédemment suggéré. Nous ne pouvons donc pas savoir si notre ORF est une bactérie ou un eucaryote.



En conclusion, d'après notre premier arbre, on peut penser que notre ORF est soit une protéobactérie qui aurait subit soit un transfert horizontal de gène, soit une duplication ou bien que notre ORF est une bacteroidete. De plus, d'après l'Arbre représentant toutes les bactéries contre les Eucaryotes, on ne peut pas définir l'appartenance phylogénétique de l'ORF. En effet, on ne sait pas s'il est une bactérie ou un eucaryote. 


RÉSULTATS BRUTS:

 Arbre avec phyML :                                                                                                    ----0.2--
 S = valeur de bootstrap inférieur à 0,70

                                                                                                       -----0.2----
 
                 +--------------------------------42_Bac_Fir_Bac_1_Evalue8e44
               S++
                |+----------------------------------41_Bac_Act_Act_1_Evalue2e36
                |
                |               +-------------------------------40_Bac_Pro_Del_1_Evalue8e37
                |               |
                |         +---S-+      +-----------------------------------------------39_Bac_Cya_Chr_1_Evalue3e41
                |         |     +------+
                |    +----+            +---------------38_Bac_Cya_Glo_1_Evalue1e39
                |  S |    |
 +--------------+  +-+    +------------------------------37_Bac_Arm_Cht_1_Evalue3e31
 |              |  | |
 |              |  | +------------------------------------------36_Bac_Ten_Mol_1_Evalue2e43
 |              |  |
 |              |  |
 |              |  |                  +----------------------------35_Bac_Dei_Dei_1_Evalue1e36
 |              |  |     +------------+
 |              |  |     |            +---------------------------------34_Bac_Aci_Aci_1_Evalue2e32
 |              |  |  +--+
 |              |  |  |  |    +----------------------------------33_Bac_Pro_Zet_1_Evalue6e35
 |              +--+  |  |    |
 |                 |  |  +----+           +-----------------------------------32_Bac_The_The_1_Evalue1e42
 |                 |  |       | +---------+
 |                 |  |       +-+         +--------------------31_Bac_Fir_Clo_1_Evalue2e36
 |                 |  |        S|
 |                 |  |         +-------------------------30_Bac_Pla_Pla_1_Evalue1e33
 |                 |  |
 |                 |  |                         +----------------------------29_Bac_Pro_Eps_1_Evalue2e35
 |                 |  |                         |
 |                 +S-+                +--------+       +-----------28_Bac_Pro_Gam_4_Evalue8e35
 |                    |                |        |  +--S-+
 |                    |                |        |  |    +-------------------27_Bac_Pro_Gam_2_Evalue5e43
 |                    |                |        +S-+
 |                    |     +----------+           +----------26_Bac_Pro_Gam_3_Evalue1e39
 |                    |     |          |
 |                    |     |          |     +----------------------25_Bac_Pro_Gam_1_Evalue2e41
 |                    |     |          |     |
 |                    |     |          +-----+ +------------------24_Bac_Pro_Bet_1_Evalue2e41
 |                    |     |                | |
 |                    +-----+                +-+  +------------------------------------------23_Bac_Pro_Gam_5_Evalue1e34
 |                          |                  |  |
 |                          |                  +--+ +------------------22_Bac_Pro_Bet_3_Evalue9e34
 |                          |                     | |
 |                          |                     +-+
 |                          |                       +----------------21_Bac_Pro_Bet_2_Evalue2e40
 |                          |
 |                          +-------------------------------------------------20_Bac_Pro_Alp_1_Evalue6e38
 |
 |                                       +----------19_Bac_Bac_Sph_1_Evalue5e79
 |                   +-------------------+
 |                   |                   +-----------18_Bac_Bac_Sph_2_Evalue2e68
 |                   |
 |                   |                          +-------------------17_Bac_Bac_Cyt_6_Evalue3e76
 |                   |                          |
 |                   |        +-----------------+              +----------------16_Bac_Bac_Cyt_3_Evalue1e82
 |                   |        |                 |       +-S----+
 |                   |        |                 |       |      +------------------15_Bac_Bac_Cyt_4_Evalue2e81
 |              +----+        |                 +--S----+
 |              |    | +------+                         |     +-----------------------------14_Bac_Bac_Cyt_5_Evalue4e78
 |              |    | |      |                         +-S---+
 |              |    | |      |                               +-----------13_Bac_Bac_Cyt_2_Evalue2e83
 |              |    | |      |
 |              |    | |      +------------------------12_Bac_Bac_Cyt_1_Evalue3e87
 |              |    | |
 |              |    | |                                   +---------------------------11_Bac_Pro_3_Evalue9e96
 |              |    | |                              +--S-+
 |              |    +-+                              |    +-----------------------10_Bac_Bac_Fla_3_Evalue4e94
 |              |      |                      +-------+
 |              |      |                      |       +------------------9_Bac_Bac_Fla_4_Evalue9e84
 |              |      |         +------------+
 |              |      |         |            +-----------8_Bac_Bac_Fla_2_Evalue1e96
 +--------------+      |  +------+
                |      |  |      |
                |      |  |      +--------------------------7_Bac_Bac_Fla_1_Evalue1e100
                |      +--+
                |         |   +-------------------6_Bac_Bac_Bac_1_Evalue1e91
                |         +S--+
                |             |           +-------------------------------------5_Bac_Pro_2_Evalue2e111
                |             +-----------+
                |                         |      +--------------4_ORF
                |                         +---S--+
                |                                +---------------3_Bac_Pro_1_Evalue5e131
                |
                |    +-----------------------------------------------------------2_Bac_Bac_Fla_5_Evalue2e67
                +-S--+
                     +--------------------1_Bac_Bac_Pro_1_Evalue8e105

________________________________________________________________________________________________________________________
________________________________________________________________________________________________________________________

Arbre réalisé en incluant les séquences eucaryotes
 
                                                                                                       -----0.2----
 
         +-------------------------------24_Euk_Met_Ann_1_Evalue5e71
         |
 +-------+      +------------------------23_Euk_Met_Mol_2_Evalue6e67
 |       +------+
 |              +--------------22_Euk_Met_Mol_1_Evalue4e67
 |
 |                           +------------21_Bac_Bac_Sph_1_Evalue2e68
 |       +-------------------+
 |       |                   |
 |       |                   +------------------------------20_Euk_Met_Art_1_Evalue1e56
 |       |
 |       |                 +------------19_Bac_Bac_Fla_1_Evalue6e101
 |       |             +---+
 |       |             |   |                +-------------18_Euk_Alv_Cil_1_Evalue7e87
 |       |             |   +----------------+
 |       |  +----------+                    +-----------------------17_Bac_Pro_3_Evalue9e96
 |       |  |          |
 +-------+  |          |     +---------------16_Bac_Pro_1_Evalue5e131
         |  |          |     |
         |  |          +-----+S +----------15_ORF
         |  |                +--+
         |  |                   +-------------------------------14_Bac_Pro_2_Evalue2e111
         |  |
         |  |                     +----------------------------------------13_Bac_Pro_Alp_1_Evalue6e38
         |  |                     |
         |  |                     |
         |  |                     |             +--------------------------------------------12_Bac_Cya_Chr_1_Evalue3e41
         +--+      +--------------+      +------+
            |      |              |      |      +-------------------------------11_Bac_Ten_Mol_1_Evalue2e43
            |      |              |      |
            |      |              |      |                +--------------------------10_Euk_Amo_Myc_1_Evalue2e33
            |      |              +------+   +------------+
            |      |                     |   |            |      +------------------9_Bac_Pro_Gam_1_Evalue2e41
            |      |                     |   |            +------+
            |      |                     |   |                   +----------------8_Bac_Pro_Bet_1_Evalue2e41
            |      |                     |   |
            |      |                     +S--+      +--------------------------7_Bac_Fir_Bac_1_Evalue8e44
            |      |                         |      |
            +------+                         |  +S--+      +------------------------6_Bac_Pro_Del_1_Evalue8e37
                   |                         |  |   +------+
                   |                         |  |          +----------------------------5_Bac_Act_Act_1_Evalue2e36
                   |                         +--+
                   |                            |
                   |                            |  +-------------------------------4_Bac_Dei_Dei_1_Evalue1e36
                   |                            +--+
                   |                               +---------------------------------3_Bac_The_The_1_Evalue1e42
                   |
                   |                           +2_Euk_Alv_Cil_2_Evalue2e72
                   +---------------------------+
                                               +1_Euk_Alv_Cil_3_Evalue3e71

Taxonomy report

PROTOCOLE:


outil local "tax_report2"


sélectionner "exclure les séquences environnementales"


ANALYSE DES RÉSULTATS:


Les résultats obtenus dans le rapport taxonomique sont résumés ci-dessous:

_______________________________________________________________________________________________________________

|                       |                   |                          |                  |                     |    

| phylum                | classe            | Ordre                    | gamme de e-value | nombre de résultats |

|_______________________|___________________|__________________________|__________________|_____________________|

| [Bacteroidetes]       | [Flavobacteriia]  | [Flavobacteriales]       |   4e-102 - 8e-25 |         154         |

|                       |___________________|__________________________|__________________|_____________________|  

|                       |  [Cytophagia]     | [Cytophagales]           | 2e-91 - 2e-21    |           51        |

|                       |___________________|__________________________|__________________|_____________________|

|                       |[Sphingobacteriia] | [Sphingobacteriales]     |   5e-79 - 3e-25  |           41        |

|                       |___________________|__________________________|__________________|_____________________|

|                       | [Bacteroïdia]     | [bacteroïdale]           |   2e-92 - 8.6    |           13        |

|_______________________|___________________|__________________________|__________________|_____________________|

| [Firmicutes]          | [Bacilli]         | [Bacillales]             |  8e-44 - 7e-08   |          205        |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   | [Lactobacillales]        |    7e-39 - 7e-17 |          27         |

|                       |___________________|__________________________|__________________|_____________________|

|                       | [Clostridia]      | [Clostridiales]          |    2e-36 - 0.71  |          66         |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   | [thermoanaerobacterale]  |    8e-34 - 6e-29 |          66         |

|                       |___________________|__________________________|__________________|_____________________|

|                       | [Eryspelotrichi]  | [Eryspelotrichale]       |    1e-39 - 2e-30 |          6          |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                                              |  5e-131- 9e-96   |         3           |

|                       |______________________________________________|__________________|_____________________|

| [Proteobacteria]      |       [Gammaprotéobactériebacteria]          |  1e-49 - 5.3     |         1482        |

|                       |______________________________________________|__________________|_____________________|

|                       |        [betaprotéobacteria]                  |  2e-41- 0.12     |         418         |

|                       |______________________________________________|__________________|_____________________|

|                       |    [alphaprotéobacteria]                     |   6e-38 - 7e-07  |          573        |

|                       |______________________________________________|__________________|_____________________|

|                       |           [deltaproteobacteria]              |  8e-37 - 5.2     |         9           |

|                       |______________________________________________|__________________|_____________________|

|                       |        Epsilonprotéobacteria]                |  4e-32- 1e-29    |         3           |

|                       |______________________________________________|__________________|_____________________|

|                       |         [zetaprotéobacteria]                 |   6e-35 - 1e-24  |            3        |

|_______________________|______________________________________________|__________________|_____________________|

| Autres bactéries      |                                              |  2e-43- 2.3      |         458         |

|_______________________|______________________________________________|__________________|_____________________|

|    [Eukaryota]        |                                              |  7e-87- 8,7      |         113         |

|_______________________|______________________________________________|__________________|_____________________|

|    [Archaea]          |                                              |  3e-34- 2e-31    |           3         |

|_______________________|______________________________________________|__________________|_____________________|



   Selon le rapport taxonomique, les 3 séquences qui ont la meilleure e-value (5e-131, 2e-111, 9e-96) sont dans le phylum des protéobactéries. Cependant, leur sous-groupe taxonomique (alpha-, beta-) n'est pas défini. Les e-values des Bacteroidetes sont dans l'ensemble plus élevées que celle des protéobactéries. La meilleure e-value des Bacteroidetes est e-102. Elles est meilleure que celle de la 3eme séquence des protéobactéries. De plus, de nombreuses séquences de bacteroidetes présentent une e-value comprise entre e-102 et e-44 (meilleures e-value que celle trouvées chez les autres protéobactéries). Ainsi, nous décidons de prendre les Bacteroidetes comme groupe d'étude.


   En sachant quel est notre groupe d'étude à savoir les Bacteroidetes, on a, à partir de l'arbre de la vie, déterminé notre groupe extérieur qui est donc l'ensemble des autres bactéries.


   Toutefois, le fait de retrouver trois séquences présentant les meilleures e-values appartennant aux protéobactéries donne lieu à plusieurs hypothèses. On soupçonne qu'il y a eu, à un moment dans le passé, un transfert horizontal de gène des Bacteroidetes vers les 3 séquences des protéobactéries présentant les meilleurs e-valeurs. De plus, ce transfert serait probablement très récent au vu des scores élevés et proches des bacteroidetes. On note toutefois que ces trois séquences ne semblent pas appartenir à un sous-groupe de protéobactéries. Ces organismes auraient pu être mal identifiés en ce qui concerne leur appartenance taxonomique. On peut même imaginer que ces séquences auraient pu être mal annotées et donc qu'elles n'appartiendraient pas au phylum des protéobactéries. Enfin, si on considère qu'aucune erreur d'annotation n'ait été faite, il s'agirait donc probablement d'une nouvelle famille au sein des protéobactéries.

Pour notre inférence d'arbre phylogénétique, nous allons prendre comme groupe d'étude les bacteroidetes et comme groupe extérieur les autres bactéries. On s'attend à ce que les 3 séquences des protéobactéries présentant les meilleures e-value s'intégrent dans le groupe des bacteroidetes tout comme la séquence protéique de l'ORF.


   Au vue des scores équivalents chez les bacteroidetes et les 3 protéobactéries qui présentent les meilleures e-value, nous allons réalisé une analyse supplémentaire dans laquelle le groupe d'étude comprendra les bacteroidetes et les protéobactéries. Ainsi, le groupe d'étude serait l'ensemble des bactéries et nous prendrions les séquences eucaryotes obtenues comme groupe extérieur. Toutefois, notre rapport taxonomique ne présente pas énormément de séquences eucaryotes avec de bonnes e-value (supérieur à e-10). Nous en avons donc sélectionné une dizaine de séquences. Afin de ne pas sur-représenter les bactéries nous en avons sélectionné également une quinzaine de séquences. Nous sommes conscientes que l'alignement et l'arbre inféré ne seront pas assez représentatifs de la diversité et de la complexité du vivants. C'est pourquoi nous avons réalisé cette étude en complément à notre première étude et non à la place.  


______________________________________________________________________________________________________________________


Groupe d'étude: Bacteroidetes


>Bac_Bac_Fla_1 [Bacteria Bacteroidetes Flavobacteriia]  E-value_1e-100  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Chryseobacterium; gi|671233700|gb|KFF18685.1| anhydro-N-acetylmuramic acid kinase [Chryseobacterium sp. JM1]


>Bac_Bac_Fla_2 [Bacteria Bacteroidetes Flavobacteriia]  E-value_1e-96  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Polaribacter; gi|652380900|ref|WP_026776830.1| anhydro-N-acetylmuramic acid kinase [Polaribacter sp. Hel_I_88]


>Bac_Bac_Fla_3 [Bacteria Bacteroidetes Flavobacteriia]  E-value_4e-94  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Psychroserpens; gi|655491705|ref|WP_028873162.1| anhydro-N-acetylmuramic acid kinase [Psychroserpens burtonensis]


>Bac_Bac_Bac_1 [Bacteria Bacteroidetes Bacteroidia]  E-value_1e-91  Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Bacteroidaceae;Bacteroides; gi|496414310|ref|WP_009123157.1| anhydro-N-acetylmuramic acid kinase [Bacteroides clarus]


>Bac_Bac_Cyt_1 [Bacteria Bacteroidetes Cytophagia]  E-value_3e-87  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Flammeovirgaceae;Nafulsella; gi|516340275|ref|WP_017730308.1| hypothetical protein [Nafulsella turpanensis]


>Bac_Bac_Fla_4 [Bacteria Bacteroidetes Flavobacteriia]  E-value_9e-84  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Flavobacterium; gi|559216182|ref|WP_023579688.1| anmK protein [Flavobacterium limnosediminis]


>Bac_Bac_Cyt_2 [Bacteria Bacteroidetes Cytophagia]  E-value_2e-83  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cyclobacteriaceae;Algoriphagus; gi|652557211|ref|WP_026950754.1| anhydro-N-acetylmuramic acid kinase [Algoriphagus mannitolivorans]


>Bac_Bac_Cyt_3 [Bacteria Bacteroidetes Cytophagia]  E-value_1e-82  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cytophagaceae;Rhodonellum; gi|518425607|ref|WP_019595814.1| hypothetical protein [Rhodonellum psychrophilum]


>Bac_Bac_Cyt_4 [Bacteria Bacteroidetes Cytophagia]  E-value_2e-81  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cytophagaceae; gi|660631518|gb|KEO73162.1| anhydro-N-acetylmuramic acid kinase [Anditalea andensis]


>Bac_Bac_Sph_1 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_5e-79  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Niabella; gi|570745039|gb|AHF15551.1| hypothetical protein NIASO_11025 [Niabella soli DSM 19437]


>Bac_Bac_Cyt_5 [Bacteria Bacteroidetes Cytophagia]  E-value_4e-78  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cyclobacteriaceae;Echinicola; gi|505077595|ref|WP_015264697.1| molecular chaperone [Echinicola vietnamensis]


>Bac_Bac_Cyt_6 [Bacteria Bacteroidetes Cytophagia]  E-value_3e-76  Bacteria;Bacteroidetes;Cytophagia;Cytophagales;Cyclobacteriaceae;unclassified Cyclobacteriaceae; gi|499123449|ref|WP_010852370.1| Anhydro-N-acetylmuramic acid kinase [Cyclobacteriaceae bacterium AK24]


>Bac_Bac_Sph_2 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_2e-68  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Terrimonas; gi|655382776|ref|WP_028787396.1| hypothetical protein [Terrimonas ferruginea]


>Bac_Bac_Fla_5 [Bacteria Bacteroidetes Flavobacteriia]  E-value_2e-67  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Eudoraea; gi|518498360|ref|WP_019668567.1| hypothetical protein [Eudoraea adriatica]





______________________________________________________________________________________________________________________


Groupe extérieur: Les autres bactéries


>Bac_Pro__1 [Bacteria Proteobacteria ]  E-value_5e-131  Bacteria;Proteobacteria; gi|655442060|ref|WP_028826600.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-P07]


>Bac_Pro__2 [Bacteria Proteobacteria ]  E-value_2e-111  Bacteria;Proteobacteria; gi|655449272|ref|WP_028832826.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]


>Bac_Pro__3 [Bacteria Proteobacteria ]  E-value_9e-96  Bacteria;Proteobacteria; gi|655452963|ref|WP_028836241.1| anhydro-N-acetylmuramic acid kinase [Proteobacteria bacterium JGI 0000113-L05]


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-41  Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales;Pseudomonadaceae;Pseudomonas;Pseudomonas savastanoi; gi|490801701|ref|WP_004663838.1| anhydro-N-acetylmuramic acid kinase [Pseudomonas savastanoi]


>Bac_Pro_Gam_2 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_5e-43  Bacteria;Proteobacteria;Gammaproteobacteria;Vibrionales;Vibrionaceae;Photobacterium; gi|636572679|gb|KDM90234.1| anhydro-N-acetylmuramic acid kinase [Photobacterium halotolerans]


>Bac_Pro_Gam_3 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-39  Bacteria;Proteobacteria;Gammaproteobacteria;Enterobacteriales;Enterobacteriaceae;Pantoea; gi|545150873|ref|WP_021506203.1| anhydro-N-acetylmuramic acid kinase [Pantoea dispersa]


>Bac_Pro_Gam_4 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_8e-35  Bacteria;Proteobacteria;Gammaproteobacteria;Pasteurellales;Pasteurellaceae;Pasteurella; gi|514187704|ref|WP_016533974.1| anhydro-N-acetylmuramic acid kinase [Pasteurella multocida]


>Bac_Pro_Gam_5 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-34  Bacteria;Proteobacteria;Gammaproteobacteria;Legionellales;Legionellaceae;Legionella; gi|499534283|ref|WP_011215419.1| anhydro-


>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-41  Bacteria;Proteobacteria;Betaproteobacteria;Hydrogenophilales;Hydrogenophilaceae;Thiobacillus; gi|648548985|ref|WP_026240736.1| anhydro-N-acetylmuramic acid kinase [Thiobacillus thioparus]


>Bac_Pro_Bet_2 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-40  Bacteria;Proteobacteria;Betaproteobacteria;Methylophilales;Methylophilaceae;Methylovorus; gi|503206229|ref|WP_013440890.1| anhydro-N-acetylmuramic acid kinase [Methylovorus sp. MP688]


>Bac_Pro_Bet_3 [Bacteria Proteobacteria Betaproteobacteria]  E-value_9e-34  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderiales;Alcaligenaceae;Achromobacter; gi|493433079|ref|WP_006388645.1| anhydro-N-acetylmuramic acid kinase [Achromobacter xylosoxidans]


>Bac_Pro_Alp_1 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_6e-38  Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;Holosporaceae; gi|674212879|gb|AIK95720.1| hypothetical protein ID47_01655 [Candidatus Paracaedibacter acanthamoebae]


>Bac_Pro_Del_1 [Bacteria Proteobacteria Deltaproteobacteria]  E-value_8e-37  Bacteria;Proteobacteria;Deltaproteobacteria;Myxococcales;Cystobacterineae;Cystobacteraceae;Cystobacter; gi|667800467|gb|KFA90124.1| anhydro-N-acetylmuramic acid kinase [Cystobacter violaceus Cb vi76]


>Bac_Pro_Eps_1 [Bacteria Proteobacteria Epsilonproteobacteria]  E-value_2e-35  Bacteria;Proteobacteria;Epsilonproteobacteria;Sulfurovum; gi|500722224|ref|WP_011980928.1| anhydro-N-acetylmuramic acid kinase [Sulfurovum sp. NBC37-1]


>Bac_Pro_Zet_1 [Bacteria Proteobacteria Zetaproteobacteria]  E-value_6e-35  Bacteria;Proteobacteria;Zetaproteobacteria;Mariprofundales;Mariprofundaceae;Mariprofundus; gi|517105505|ref|WP_018294323.1| hypothetical protein [Mariprofundus ferrooxydans]


>Bac_Bac_Pro_1 [Bacteria Bacteroidetes Prolixibacter]  E-value_8e-105  Bacteria;Bacteroidetes;Prolixibacter; gi|647586775|ref|WP_025863940.1| anhydro-N-acetylmuramic acid kinase [Prolixibacter bellariivorans]


>Bac_Fir_Bac_1 [Bacteria Firmicutes Bacillales]  E-value_8e-44  Bacteria;Firmicutes;Bacillales;Bacillaceae;Ornithinibacillus; gi|497780053|ref|WP_010094237.1| anhydro-N-acetylmuramic acid kinase [Ornithinibacillus scapharcae]


>Bac_Fir_Clo_1 [Bacteria Firmicutes Clostridia]  E-value_2e-36  Bacteria;Firmicutes;Clostridia;Clostridiales;Clostridiaceae;Clostridium; gi|658502768|ref|WP_029699083.1| anhydro-N-acetylmuramic acid kinase, partial [Clostridium sp. Ade.TY]


>Bac_Ten_Mol_1 [Bacteria Tenericutes Mollicutes]  E-value_2e-43  Bacteria;Tenericutes;Mollicutes;Acholeplasmatales;Acholeplasmataceae;Acholeplasma; gi|644984776|emb|CDR31271.1| Anhydro-N-acetylmuramic acid kinase [Acholeplasma oculi]


>Bac_The_The_1 [Bacteria Thermotogae Thermotogales]  E-value_1e-42  Bacteria;Thermotogae;Thermotogales;Thermotogaceae;Thermotoga; gi|500835609|ref|WP_012003557.1| anhydro-N-acetylmuramic acid kinase [Thermotoga lettingae]


>Bac_Cya_Chr_1 [Bacteria Cyanobacteria Chroococcales]  E-value_3e-41  Bacteria;Cyanobacteria;Chroococcales;Geminocystis; gi|515865529|ref|WP_017296157.1| hypothetical protein [Geminocystis herdmanii]


>Bac_Cya_Glo_1 [Bacteria Cyanobacteria Gloeobacteria]  E-value_1e-39  Bacteria;Cyanobacteria;Gloeobacteria;Gloeobacterales;Gloeobacter; gi|554674919|ref|WP_023176122.1| anhydro-N-acetylmuramic acid kinase [Gloeobacter kilaueensis]


>Bac_Dei_Dei_1 [Bacteria Deinococcus-Thermus Deinococci]  E-value_1e-36  Bacteria;Deinococcus-Thermus;Deinococci;Thermales;Thermaceae;Meiothermus; gi|654411367|ref|WP_027882892.1| anhydro-N-acetylmuramic acid kinase [Meiothermus rufus]


>Bac_Act_Act_1 [Bacteria Actinobacteria Actinobacteridae]  E-value_2e-36  Bacteria;Actinobacteria;Actinobacteridae;Actinomycetales;Pseudonocardineae;Pseudonocardiaceae;Sciscionella; gi|648505077|ref|WP_026196828.1| hypothetical protein [Sciscionella marina]


>Bac_Pla_Pla_1 [Bacteria Planctomycetes Planctomycetacia]  E-value_1e-33  Bacteria;Planctomycetes;Planctomycetacia;Planctomycetales;Planctomycetaceae;Singulisphaera; gi|505060907|ref|WP_015248009.1| molecular chaperone [Singulisphaera acidiphila]


>Bac_Aci_Aci_1 [Bacteria Acidobacteria Acidobacteriales]  E-value_2e-32  Bacteria;Acidobacteria;Acidobacteriales;Acidobacteriaceae; gi|522202916|ref|WP_020710383.1| hypothetical protein [Acidobacteriaceae bacterium KBS 83]


>Bac_Arm_Cht_1 [Bacteria Armatimonadetes Chthonomonadetes]  E-value_3e-31  Bacteria;Armatimonadetes;Chthonomonadetes;Chthonomonadales;Chthonomonadaceae;Chthonomonas; gi|512726129|ref|WP_016484123.1| Predicted molecular chaperone distantly related to HSP70-fold metalloproteases [Chthonomonas calidirosea]


_______________________________________________________________________________________________________________________

_______________________________________________________________________________________________________________________


Arbre supplémentaire: élargissement du groupe d'étude


Groupe d'étude: les Bactéries




>Bac_Pro__1 [Bacteria Proteobacteria ]  E-value_5e-131  Bacteria;Proteobacteria; gi|655442060|ref|WP_028826600.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-P07]


>Bac_Pro__2 [Bacteria Proteobacteria ]  E-value_2e-111  Bacteria;Proteobacteria; gi|655449272|ref|WP_028832826.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]


>Bac_Pro__3 [Bacteria Proteobacteria ]  E-value_9e-96  Bacteria;Proteobacteria; gi|655452963|ref|WP_028836241.1| anhydro-N-acetylmuramic acid kinase [Proteobacteria bacterium JGI 0000113-L05]


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-41  Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales;Pseudomonadaceae;Pseudomonas;Pseudomonas savastanoi; gi|490801701|ref|WP_004663838.1| anhydro-N-acetylmuramic acid kinase [Pseudomonas savastanoi]


>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-41  Bacteria;Proteobacteria;Betaproteobacteria;Hydrogenophilales;Hydrogenophilaceae;Thiobacillus; gi|648548985|ref|WP_026240736.1| anhydro-N-acetylmuramic acid kinase [Thiobacillus thioparus]


>Bac_Pro_Alp_1 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_6e-38  Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;Holosporaceae; gi|674212879|gb|AIK95720.1| hypothetical protein ID47_01655 [Candidatus Paracaedibacter acanthamoebae]


>Bac_Pro_Del_1 [Bacteria Proteobacteria Deltaproteobacteria]  E-value_8e-37  Bacteria;Proteobacteria;Deltaproteobacteria;Myxococcales;Cystobacterineae;Cystobacteraceae;Cystobacter; gi|667800467|gb|KFA90124.1| anhydro-N-acetylmuramic acid kinase [Cystobacter violaceus Cb vi76]


>Bac_Bac_Fla_1 [Bacteria Bacteroidetes Flavobacteriia]  E-value_6e-101  Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Tenacibaculum; gi|655507495|ref|WP_028888595.1| anhydro-N-acetylmuramic acid kinase [Tenacibaculum ovolyticum]


>Bac_Bac_Sph_1 [Bacteria Bacteroidetes Sphingobacteriia]  E-value_2e-68  Bacteria;Bacteroidetes;Sphingobacteriia;Sphingobacteriales;Chitinophagaceae;Terrimonas; gi|655382776|ref|WP_028787396.1| hypothetical protein [Terrimonas ferruginea]


>Bac_Fir_Bac_1 [Bacteria Firmicutes Bacillales]  E-value_8e-44  Bacteria;Firmicutes;Bacillales;Bacillaceae;Ornithinibacillus; gi|497780053|ref|WP_010094237.1| anhydro-N-acetylmuramic acid kinase [Ornithinibacillus scapharcae]


>Bac_Ten_Mol_1 [Bacteria Tenericutes Mollicutes]  E-value_2e-43  Bacteria;Tenericutes;Mollicutes;Acholeplasmatales;Acholeplasmataceae;Acholeplasma; gi|644984776|emb|CDR31271.1| Anhydro-N-acetylmuramic acid kinase [Acholeplasma oculi]


>Bac_The_The_1 [Bacteria Thermotogae Thermotogales]  E-value_1e-42  Bacteria;Thermotogae;Thermotogales;Thermotogaceae;Thermotoga; gi|500835609|ref|WP_012003557.1| anhydro-N-acetylmuramic acid kinase [Thermotoga lettingae]


>Bac_Cya_Chr_1 [Bacteria Cyanobacteria Chroococcales]  E-value_3e-41  Bacteria;Cyanobacteria;Chroococcales;Geminocystis; gi|515865529|ref|WP_017296157.1| hypothetical protein [Geminocystis herdmanii]


>Bac_Dei_Dei_1 [Bacteria Deinococcus-Thermus Deinococci]  E-value_1e-36  Bacteria;Deinococcus-Thermus;Deinococci;Thermales;Thermaceae;Meiothermus; gi|654411367|ref|WP_027882892.1| anhydro-N-acetylmuramic acid kinase [Meiothermus rufus]


>Bac_Act_Act_1 [Bacteria Actinobacteria Actinobacteridae]  E-value_2e-36  Bacteria;Actinobacteria;Actinobacteridae;Actinomycetales;Pseudonocardineae;Pseudonocardiaceae;Sciscionella; gi|648505077|ref|WP_026196828.1| hypothetical protein [Sciscionella marina]


_______________________________________________________________________________________


Groupe extérieur: les Eucaryotes


>Euk_Alv_Cil_1 [Eukaryota Alveolata Ciliophora]  E-value_7e-87  Eukaryota;Alveolata;Ciliophora;Intramacronucleata;Oligohymenophorea;Peniculida;Parameciidae;Paramecium; gi|145490040|ref|XP_001431021.1| hypothetical protein [Paramecium tetraurelia strain d4-2]


>Euk_Alv_Cil_2 [Eukaryota Alveolata Ciliophora]  E-value_2e-72  Eukaryota;Alveolata;Ciliophora;Intramacronucleata;Oligohymenophorea;Hymenostomatida;Tetrahymenina;Tetrahymenidae;Tetrahymena; gi|586736743|gb|EAR97362.2| anhydro-N-acetylmuramic acid kinase [Tetrahymena thermophila SB210]


>Euk_Alv_Cil_3 [Eukaryota Alveolata Ciliophora]  E-value_3e-71  Eukaryota;Alveolata;Ciliophora;Intramacronucleata;Oligohymenophorea;Hymenostomatida;Tetrahymenina;Tetrahymenidae;Tetrahymena; gi|118368802|ref|XP_001017607.1| hypothetical protein TTHERM_00338440 [Tetrahymena thermophila]


>Euk_Met_Ann_1 [Eukaryota Metazoa Annelida]  E-value_5e-71  Eukaryota;Metazoa;Annelida;Polychaeta;Scolecida;Capitellida;Capitellidae;Capitella; gi|443718205|gb|ELU08950.1| hypothetical protein CAPTEDRAFT_207028 [Capitella teleta]


>Euk_Met_Mol_1 [Eukaryota Metazoa Mollusca]  E-value_4e-67  Eukaryota;Metazoa;Mollusca;Gastropoda;Patellogastropoda;Lottioidea;Lottiidae;Lottia; gi|676469616|ref|XP_009058590.1| hypothetical protein LOTGIDRAFT_73844, partial [Lottia gigantea]


>Euk_Met_Mol_2 [Eukaryota Metazoa Mollusca]  E-value_6e-67  Eukaryota;Metazoa;Mollusca;Bivalvia;Pteriomorphia;Ostreoida;Ostreoidea;Ostreidae;Crassostrea; gi|405950134|gb|EKC18138.1| Anhydro-N-acetylmuramic acid kinase [Crassostrea gigas]


>Euk_Met_Art_1 [Eukaryota Metazoa Arthropoda]  E-value_1e-56  Eukaryota;Metazoa;Arthropoda;Chelicerata;Arachnida;Acari;Parasitiformes;Ixodida;Ixodoidea;Ixodidae;Ixodinae;Ixodes; gi|240973536|ref|XP_002401492.1| anhydro-N-acetylmuramic acid kinase, putative [Ixodes scapularis]


>Euk_Amo_Myc_1 [Eukaryota Amoebozoa Mycetozoa]  E-value_2e-33  Eukaryota;Amoebozoa;Mycetozoa;Dictyosteliida;Dictyostelium; gi|330803637|ref|XP_003289810.1| hypothetical protein DICPUDRAFT_88670 [Dictyostelium purpureum]



RÉSULTATS BRUTS:

.LUCA
. Bacteria
. .Proteobacteria
. . Proteobacteria bacterium JGI 0000113-P07..... 389  5e-131 1 hit   Bacteria:Proteobacteria:                 hypothetical protein [Proteobacteria bact...   
. . Proteobacteria bacterium JGI 0000113-E04..... 339  2e-111 1 hit   Bacteria:Proteobacteria:                 hypothetical protein [Proteobacteria bact...   
. . Proteobacteria bacterium JGI 0000113-L05..... 299  9e-96  1 hit   Bacteria:Proteobacteria:                 anhydro-N-acetylmuramic acid kinase [Prot...   
. . Pseudomonas sp. BRG-100...................... 166  3e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas synxantha........................ 164  1e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas savastanoi....................... 159  2e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae......................... 158  2e-41  26 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. oryzae str. 1_6..... 158  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. aceris str. M302273PT 158  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. CHM02........................ 157  3e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae group genomosp. 2....... 157  3e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas sp. G5(2012)..................... 157  4e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: molecular chaperone [Pseudomonas sp. G5(2...   
. . Pseudomonas syringae pv. japonica str. M301072P 157  4e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. syringae SM......... 157  4e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens...................... 157  6e-41  23 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas corrugata........................ 157  7e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas chlororaphis..................... 157  7e-41  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM17......................... 157  8e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. glycinea str. race 4 156  9e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM30......................... 156  1e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM80......................... 156  1e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. avellanae str. ISPaVe0 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. M47T1........................ 155  2e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens EGD-AQ6.............. 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM102........................ 155  2e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas moraviensis...................... 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. R81.......................... 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens R124................. 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas extremorientalis FH1............. 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas putida........................... 155  3e-40  20 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. GM78......................... 155  3e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. aptata str. DSM 50252 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. H1h.......................... 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas extremaustralis.................. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae group................... 154  6e-40  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas syringae pv. morsprunorum str. M302 154  6e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas sp. URMO17WK12:I12............... 154  7e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM25......................... 154  7e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. PAMC 25886................... 154  8e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. QTF5......................... 154  9e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. CBZ-4........................ 154  9e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM67......................... 154  9e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae BRIP34881............... 154  9e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM55......................... 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens SS101................ 153  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. CFII68....................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM79......................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM50......................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM41(2012)................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM60......................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas pelagia.......................... 153  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas brassicacearum................... 152  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. PAMC 26793................... 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas bauzanensis...................... 152  3e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas.................................. 152  4e-39  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas mandelii......................... 152  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens SBW25................ 152  4e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas nitroreducens.................... 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Pseudomonas nitrore...   
. . Pseudomonas sp. 45MFCol3.1................... 152  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. actinidiae ICMP 18807 152  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas fluorescens F113................. 151  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae CC1557.................. 151  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. WCS374....................... 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas syringae pv. actinidiae ICMP 18886 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. 2-92(2010)................... 151  9e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fuscovaginae..................... 151  1e-38  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. RIT288....................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas mandelii PD30.................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas fluorescens A506................. 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae group genomosp. 3....... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM74......................... 150  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae pv. tomato str. DC3000.. 150  1e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas syringae pv. actinidiae ICMP 19103 150  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas umsongensis...................... 150  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas chlororaphis O6.................. 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas chlororaphis subsp. aurantiaca PB-S 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens BBc6R8............... 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. P482......................... 150  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. GM49......................... 150  3e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. HYS.......................... 150  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URIL14HWK12:I6............... 149  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. 12M76_air.................... 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomo...   
. . Pseudomonas syringae pv. actinidiae ICMP 19071 149  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. Lz4W......................... 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. Ag1.......................... 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas brassicacearum subsp. brassicacearu 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas viridiflava...................... 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. CFII64....................... 149  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens FH5.................. 149  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas fluorescens NCIMB 11764.......... 149  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas alcaligenes...................... 149  8e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mandelii JR-1.................... 149  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas fluorescens BRIP34879............ 149  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas veronii.......................... 149  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens Q8r1-96.............. 149  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida LF54...................... 148  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. PH1b......................... 148  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM48......................... 148  9e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas poae............................. 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri......................... 148  1e-37  16 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM16......................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas putida UW4....................... 148  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM33......................... 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas entomophila...................... 147  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens Pf0-1................ 147  2e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fragi............................ 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas agarici.......................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URHB0015..................... 146  4e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM18......................... 146  5e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens Q2-87................ 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. EGD-AK9...................... 146  6e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. TKP.......................... 146  6e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida S12....................... 146  7e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URMO17WK12:I8................ 146  8e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida BIRD-1.................... 146  8e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas monteilii........................ 145  8e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas viridiflava UASWS0038............ 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mendocina........................ 145  1e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. LAMO17WK12:I2................ 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas taeanensis....................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas protegens Cab57.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomo...   
. . Pseudomonas brenneri FH4..................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas parafulva........................ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. Chol1........................ 144  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM21......................... 144  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas psychrotolerans.................. 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida TRO1...................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas cichorii JBC1.................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas putida F1........................ 144  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens HK44................. 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mendocina ymp.................... 144  4e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. 313.......................... 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. WCS358....................... 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. CF149........................ 144  6e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. Ant30-3...................... 143  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens WH6.................. 143  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas protegens........................ 143  8e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase AnmK ...   
. . Pseudomonas mendocina AD6.................... 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. StFLB209..................... 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomo...   
. . Pseudomonas putida CSV86..................... 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas pseudoalcaligenes................ 143  1e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida KT2440.................... 143  1e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. RIT357....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. M1........................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida ND6....................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mosselii......................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas tolaasii......................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fluorescens Pf-5................. 142  2e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas plecoglossicida.................. 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas thermotolerans................... 141  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas resinovorans..................... 141  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. TJI-51....................... 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri ATCC 14405 = CCUG 16156. 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida H8234..................... 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. MOIL14HWK12:I2............... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa....................... 141  5e-35  64 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas sp. LAIL14HWK12:I7............... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida DOT-T1E................... 140  6e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWHPSA043............. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas putida group..................... 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas sp. ICMP 17674................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. FGI182....................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas knackmussii B13.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Pseudomo...   
. . Pseudomonas sp. P818......................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida LS46...................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWHPSA015............. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa B136-33............... 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa M18................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa M8A.2................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BL04.................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa X24509................ 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa C2773C................ 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa 19660................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa M9A.1................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mendocina EGD-AQ5................ 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas aeruginosa BWHPSA018............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri MF28.................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BL09.................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa 138244................ 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PAO1.................. 139  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas stutzeri B1SMN1.................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWHPSA047............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas putida GB-1...................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. GM84......................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa ATCC 700888........... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa NCGM2.S1.............. 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas aeruginosa PA1R.................. 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PAK................... 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa 3574.................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa ATCC 14886............ 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. BAY1662...................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa c7447m................ 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas taiwanensis...................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa VRFPA05............... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa RP73.................. 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. 1-7.......................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa CF614................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PAO1H2O............... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa UCBPP-PA14............ 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa C23................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa CF77.................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudomonas aeruginosa MTB-1................. 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. RL........................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. VLB120....................... 139  3e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa DK2................... 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida HB3267.................... 139  4e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa VRFPA03............... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas vranovensis...................... 138  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa 18A................... 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa DHS01................. 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri NF13.................... 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. AAC.......................... 138  7e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa UDL................... 137  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas fulva............................ 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URMO17WK12:I11............... 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWHPSA019............. 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa LESB58................ 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. HPB0071...................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Pseudomonas sp. HPB...   
. . Pseudomonas sp. CMAA1215..................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida W619...................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWHPSA013............. 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas psychrophila..................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa C48................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mendocina S5.2................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas aeruginosa C3719................. 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas luteola.......................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URMO17WK12:I4................ 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa BWH029................ 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas pseudoalcaligenes KF707.......... 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas putida NBRC 14164................ 136  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas mendocina NK-01.................. 135  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas resinovorans NBRC 106553......... 135  6e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PA21_ST175............ 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri CCUG 29243.............. 135  8e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. URMO17WK12:I3................ 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas denitrificans.................... 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas chloritidismutans................ 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PA45.................. 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri DSM 10701............... 134  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas sp. TS44......................... 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri DSM 4166................ 134  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas alkylphenolia.................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas putida S610...................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas stutzeri RCH2.................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: molecular chaperone [Pseudomonas stutzeri]     
. . Pseudomonas stutzeri A1501................... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas syringae Cit 7................... 130  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas caeni............................ 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa PA7................... 130  4e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas cremoricolorata.................. 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas chloritidismutans AW-1........... 129  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas azotifigens...................... 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudomonas aeruginosa VRFPA01............... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseudomon...   
. . Pseudomonas alcaligenes NBRC 14159........... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Azotobacter vinelandii....................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Azot...   
. . Cellvibrio sp. BR............................ 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Cell...   
. . Rhizobacter sp. JGI 0001007-A16.............. 118  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Cellvibrio japonicus......................... 110  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Cell...   
. . Acinetobacter bouvetii....................... 162  1e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter tandoii........................ 161  2e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. UNC436CL71CviS28........... 160  5e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ANC 4253................... 160  5e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter................................ 160  7e-42  22 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter radioresistens................. 159  8e-42  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1294596.............. 159  9e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1461402.............. 159  1e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter lwoffii NCTC 5866.............. 159  1e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter lwoffii NIPH 715............... 159  1e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. Ver3....................... 159  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter lwoffii SH145.................. 158  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. CIP 53.82.................. 158  3e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 713................... 158  4e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter indicus........................ 158  4e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter calcoaceticus.................. 157  5e-41  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter johnsonii...................... 157  5e-41  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter lwoffii........................ 157  6e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter ursingii....................... 157  7e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter radioresistens WC-A-157........ 157  7e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter calcoaceticus ANC 3680......... 157  8e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 899................... 157  9e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 263903-1............. 157  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii...................... 157  1e-40  43 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii CI78................. 156  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter junii.......................... 156  1e-40  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter pittii......................... 156  1e-40  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. SH024...................... 156  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1295259.............. 156  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter junii CIP 64.5................. 156  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1542444.............. 156  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter johnsonii ANC 3681............. 156  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter junii NIPH 182................. 156  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter johnsonii SH046................ 156  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter pittii ANC 4052................ 156  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ADP1....................... 155  2e-40  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii 348935............... 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. NIPH 2171.................. 155  2e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 742879............... 155  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter calcoaceticus ANC 3811......... 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter towneri DSM 14962.............. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter calcoaceticus RUH2202.......... 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter calcoaceticus NIPH 13.......... 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1294243.............. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1396970.............. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii WC-323............... 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1578804.............. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter ursingii DSM 16037............. 155  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 236................... 155  4e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter calcoaceticus/baumannii complex 155  4e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii 88816................ 155  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 573719............... 155  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii UH5107............... 155  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii OIFC021.............. 155  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii WC-136............... 155  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter venetianus RAG-1............... 155  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. NBRC 100985................ 155  5e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1245249.............. 154  6e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter schindleri CIP 107287.......... 154  6e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii 907131............... 154  7e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. A1PC16..................... 154  7e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ATCC 27244................. 154  8e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. P8-3-8..................... 154  8e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter pittii ANC 4050................ 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. HA......................... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. NIPH 1847.................. 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter parvus......................... 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 817................... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter calcoaceticus DSM 30006........ 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii WC-141............... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 758................... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter oleivorans..................... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 298................... 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1202252.............. 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter berezinae...................... 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. CIP 64.2................... 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii OIFC074.............. 153  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 25493_5.............. 153  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. CIP-A165................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 973................... 153  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii UH5207............... 153  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ETR1....................... 153  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1598530.............. 153  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii NCGM 237............. 153  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetob...   
. . Acinetobacter guillouiae..................... 152  3e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetob...   
. . Acinetobacter sp. CIP 102129................. 152  3e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. GG2........................ 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. CIP 102159................. 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii 846928............... 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Alkanindiges illinoisensis................... 152  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Alka...   
. . Acinetobacter sp. CIP 102082................. 152  4e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter gerneri........................ 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 45075_1.............. 152  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii BJAB0868............. 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: putative molecular chaperone [Acinetobact...   
. . Acinetobacter baumannii ACICU................ 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. CIP 102637................. 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii BJAB0715............. 152  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii TYTH-1............... 152  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. CIP 102529................. 152  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter parvus DSM 16617............... 152  6e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii AB0057............... 152  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii EGD-HP18............. 152  6e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter tjernbergiae................... 152  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii NIPH 60.............. 152  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii OIFC137.............. 152  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii ATCC 17978........... 152  7e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 24812_10............. 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii Naval-72............. 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 50595................ 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1461963.............. 151  8e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii AYE.................. 151  9e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 21072................ 151  9e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1499986.............. 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter gyllenbergii................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 284................... 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 809................... 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 532279............... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. ANC 3862................... 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter beijerinckii................... 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter beijerinckii ANC 3835.......... 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii NIPH 201............. 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. CIP 110321................. 150  2e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. NIPH 1859.................. 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter baumannii SDF.................. 150  3e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 214216............... 150  3e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. CIP 56.2................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter soli........................... 149  5e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter soli NIPH 2899................. 149  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ANC 3789................... 149  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. NIPH 2100.................. 148  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. ANC 4105................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii CI79................. 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter sp. ANC 3929................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Dasania marina............................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Dasania marina]          
. . Psychrobacter................................ 147  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter sp. NIPH 1867.................. 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 479375............... 144  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter baumannii 1566109.............. 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter calcoaceticus PHEA-2........... 144  4e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Moraxella macacae............................ 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Acinetobacter baumannii 916567............... 141  2e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acinetoba...   
. . Acinetobacter nectaris....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter sp. WC-743..................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Acinetobacter bereziniae NIPH 3.............. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter guillouiae CIP 63.46........... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter gerneri MTCC 9824.............. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii TCDC-AB0715.......... 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii 1656-2............... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Acinetobacter baumannii D1279779............. 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin...   
. . Moraxella caprae............................. 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Moraxella caprae]        
. . Psychrobacter sp. JCM 18902.................. 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Psychrobacter sp. JCM 18900.................. 134  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Psychrobacter sp. JCM 18903.................. 134  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Moraxella bovoculi 237....................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Moraxella...   
. . Psychrobacter sp. PAMC 21119................. 131  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Moraxella catarrhalis........................ 130  9e-31  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Moraxella catarrhalis BC1.................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Moraxella catarrhalis 103P14B1............... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Moraxella catarrhalis RH4.................... 129  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Psychrobacter cryohalolentis K5.............. 129  2e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Psychrobacter cryohalolentis................. 129  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Perlucidibaca piscinae....................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Perl...   
. . Psychrobacter sp. G.......................... 128  5e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Psychrobacter aquaticus...................... 127  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Enhydrobacter aerosaccus..................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Enhy...   
. . Moraxella catarrhalis 7169................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Moraxella boevrei............................ 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Mora...   
. . Psychrobacter arcticus....................... 124  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Psychrobacter arcticus 273-4................. 124  2e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Psychrobacter sp. 1501(2011)................. 120  2e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Psychrobacter sp. PRwf-1..................... 117  3e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Psychrobacter phenylpyruvicus................ 113  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Psychrobacter sp. JCM 18901.................. 108  2e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Psychrobacter lutiphocae..................... 100  1e-20  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Psychrobacter lutip...   
. . Acinetobacter baumannii 26016_3.............. 94.7 6e-20  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein J969_4221 [Acinetobacter ... 
. . Acinetobacter baumannii 458282............... 92.8 3e-19  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein J710_4018 [Acinetobacter ... 
. . Acinetobacter baumannii 263903-2............. 90.9 1e-18  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein J733_4066 [Acinetobacter ... 
. . Acinetobacter sp. 528........................ 39.3 1.3    1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: anhydro-N-acetylmuramic acid kinase [Acin... 
. . Acinetobacter baumannii 554515............... 36.2 5.3    2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein J571_3980 [Acinetobacter ... 
. . Photobacterium halotolerans.................. 163  5e-43  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Photobact...   
. . gamma proteobacterium IMCC2047............... 162  9e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Anhydro-N-acetylmuramic acid kinase [gamma pro...   
. . Vibrio metschnikovii......................... 160  3e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Glaciecola nitratireducens................... 160  1e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Vibrio sinaloensis........................... 159  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio proteolyticus......................... 158  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterovibrio norvegicus...................... 157  5e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Thiomicrospira pelophila..................... 157  6e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira pelo...   
. . Vibrio fluvialis............................. 157  7e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Candidatus Gilliamella apicola............... 157  7e-41  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Anhydro-N-acetylmuramic acid kinase [Gilliamel...   
. . Idiomarina loihiensis........................ 157  8e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Idio...   
. . Francisella philomiragia subsp. philomiragia AT 156  1e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N acetylmuramic acid kinase [Francisel...   
. . Vibrio halioticoli........................... 156  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Francisella philomiragia..................... 155  3e-40  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio sp. ER1A.............................. 155  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio sp...   
. . Vibrio shilonii.............................. 154  7e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio breoganii............................. 154  1e-39  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio breoganii]        
. . Enterovibrio sp. AK16........................ 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Grim...   
. . Vibrio sp. B183.............................. 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio sp...   
. . Pantoea dispersa............................. 154  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Glaciecola pallidula......................... 154  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Methylomonas sp. 11b......................... 153  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylomicrobium alcaliphilum................ 153  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylomonas sp. MK1......................... 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Hydrocarboniphaga effusa..................... 152  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Hydrocarboniphaga e...   
. . Pantoea sp. SC-1............................. 152  4e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio nigripulchritudo...................... 152  4e-39  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Methylomicrobium buryatense.................. 152  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Marinobacter daepoensis...................... 152  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Vibrio sp. EJY3.............................. 152  5e-39  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . sulfur-oxidizing symbionts................... 152  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Citrobacter koseri........................... 152  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Ferrimonas senticii.......................... 152  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Ferr...   
. . Vibrio coralliilyticus....................... 151  8e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . gamma proteobacterium L18.................... 151  9e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Vibrio ichthyoenteri......................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterovibrio calviensis...................... 151  1e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio nigripulchritudo SFn118............... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio ordalii............................... 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Methylomonas methanica....................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Francisella novicida......................... 150  2e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio scophthalmi........................... 150  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pantoea vagans............................... 150  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Providencia rustigianii...................... 150  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Francisella novicida GA99-3549............... 150  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio tasmaniensis.......................... 150  3e-38  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Colwellia psychrerythraea.................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Colw...   
. . Pasteurella pneumotropica.................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Francisella tularensis....................... 149  4e-38  17 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio parahaemolyticus...................... 149  4e-38  129 hitsBacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio sp. N418.............................. 149  5e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio nigripulchritudo AM115................ 149  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Listonella anguillarum....................... 149  6e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio nigripulchritudo ATCC 27043........... 149  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Amphritea japonica........................... 149  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Amphritea japonica]      
. . Pseudoalteromonas rubra...................... 149  7e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Francisella noatunensis...................... 149  7e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio furnissii............................. 149  8e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae......................... 149  9e-38  15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio mimicus............................... 148  1e-37  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio parahaemolyticus O1:Kuk str. FDA_R31.. 148  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Francisella novicida GA99-3548............... 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio cyclitrophicus........................ 148  1e-37  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pantoea agglomerans Eh318.................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pantoea a...   
. . Psychromonas hadalis......................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Pantoea agglomerans.......................... 148  1e-37  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Pantoea a...   
. . Vibrio cyclitrophicus FF75................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio splendidus............................ 148  1e-37  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio parahaemolyticus O1:K33 str. CDC_K4557 148  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter asburiae........................ 148  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio....................................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio mimicus CAIM 602...................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio mimicus]          
. . Vibrio parahaemolyticus 970107............... 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio nigripulchritudo MADA3021............. 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Francisella sp. TX077308..................... 148  2e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Shigella flexneri............................ 147  2e-37  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Shigella flexneri 2a str. 301................ 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Alcanivorax pacificus........................ 147  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Haemophilus paraphrohaemolyticus............. 147  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Klebsiella sp. YR343......................... 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio natriegens............................ 147  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Mannheimia varigena USDA-ARS-USMARC-1296..... 147  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Mannheimi...   
. . Vibrio cholerae.............................. 147  2e-37  40 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio furnissii NCTC 11218.................. 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Marinobacter sp. ES-1........................ 147  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Mannheimia haemolytica....................... 147  2e-37  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Vibrio brasiliensis.......................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Shigella flexneri 2747-71.................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Mannheimia haemolytica D171.................. 147  3e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Oceanimonas smirnovii........................ 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Enterobacter cloacae UCI 49.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Enterobacter sp. MGH 24...................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio parahaemolyticus VPCR-2009............ 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein D050_4014 [Vibrio parahae...   
. . Pantoea sp. 3.5.1............................ 147  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Cycloclasticus............................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Enterobacter cloacae BWH 43.................. 147  4e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Mannheimia haemolytica PHL213................ 147  4e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Enterobacter sp. SST3........................ 147  4e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Escherichia hermannii........................ 147  4e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Mannheimia haemolytica USDA-ARS-USMARC-183... 147  5e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Escherichia coli............................. 147  5e-37  179 hitsBacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Enterobacter sp. EGD-HP1..................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Pseudoalteromonas flavipulchra............... 147  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Mannheimia granulomatis...................... 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Methylovulum miyakonense..................... 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: hypothetical protein [Methylovulum miyako...   
. . Vibrio parahaemolyticus 10329................ 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio parahaemolyticus NIHCB0757............ 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio parahaemolyt...   
. . Vibrio parahaemolyticus UCM-V493............. 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter sp. DC3......................... 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Vibrio azureus............................... 146  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio parahaemolyticus 16................... 146  6e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Francisella cf. novicida Fx1................. 146  6e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Vibrio mimicus MB451......................... 146  6e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pasteurella multocida........................ 146  7e-37  14 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Plesiomonas shigelloides..................... 146  7e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ples...   
. . Enterobacter cloacae complex................. 146  7e-37  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: Predicted molecular chapero...   
. . Enterobacter sp. DC1......................... 146  8e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Mannheimia varigena USDA-ARS-USMARC-1312..... 146  8e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Mannheimi...   
. . Enterobacter sp. MR1......................... 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Enterobacter cloacae subsp. dissolvens SP1... 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Vibrio cholerae HE39......................... 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli 07798....................... 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Enterobacter asburiae L1..................... 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Enterobacter cloacae BWH 31.................. 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Glaciecola psychrophila...................... 146  2e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Enterobacter sp. MGH 16...................... 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Pantoea sp. SL1_M5........................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Pantoea agglomerans Tx10..................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio cholerae TM 11079-80.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio sp. F10............................... 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio genomosp. F10]    
. . Arenimonas metalli CF5-1..................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N787_11080 [Arenimonas me...   
. . Enterobacter cloacae UCI 39.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Enterobacter asburiae LF7a................... 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Tatumella saanichensis....................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Tatu...   
. . Pasteurella multocida 36950.................. 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Vibrio parahaemolyticus AQ3810............... 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Providencia alcalifaciens.................... 145  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Vibrio cholerae MZO-3........................ 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio cholerae O395......................... 145  1e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio mimicus VM573......................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio cholerae HE-09........................ 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter sp. 5-4......................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Ruminobacter sp. RM87........................ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: hypothetical protein [Ruminobacter sp. RM87]   
. . Vibrio metoecus.............................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio sp...   
. . Vibrio cholerae CT 5369-93................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Aliivibrio fischeri.......................... 145  2e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Alii...   
. . Vibrio ezurae................................ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae str. Hanford............ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio parahaemolyticus VPTS-2010............ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae EC_38VIM1............... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio cholerae MZO-2........................ 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae subsp. cloacae GS1...... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio fischeri ES114........................ 145  2e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Alii...   
. . Enterobacter sp. MGH 14...................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio sp. RC341............................. 145  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio vulnificus............................ 145  2e-36  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio vu...   
. . Pantoea sp. IMH.............................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio cholerae TMA 21....................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pasteurella multocida subsp. gallicida P1059. 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Enterobacter sp. BIDMC 29.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Enterobacter cloacae BWH 29.................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Serratia marcescens.......................... 145  2e-36  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Pasteurella multocida subsp. multocida str. Pm7 145  3e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Wohlfahrtiimonas chitiniclastica............. 145  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Wohlfahrtiimonas ch...   
. . Vibrio parahaemolyticus VP2007-095........... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio parahaemolyt...   
. . Vibrio crassostreae.......................... 144  3e-36  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio fortis................................ 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio fo...   
. . Pasteurella multocida RIIF................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Enterobacter hormaechei...................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Pantoea stewartii............................ 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio cholerae O1 biovar El Tor str. N16961. 144  3e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Methylophaga aminisulfidivorans.............. 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Salmonella enterica.......................... 144  3e-36  57 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salm...   
. . Pantoea...................................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio parahaemolyticus VPCR-2010............ 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio parahaemolyt...   
. . Enterobacter cloacae subsp. cloacae ENHKU01.. 144  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio cholerae 1587......................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Haemophilus parahaemolyticus................. 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Francisella cf. novicida 3523................ 144  4e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Fran...   
. . Enterobacter cloacae UCICRE 12............... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Cycloclasticus zancles....................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: putative molecular chaperone/HSP70-fold m...   
. . Providencia alcalifaciens DSM 30120.......... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Enterobacter mori............................ 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio parahaemolyticus 3259................. 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio parahaemolyt...   
. . Vibrio sp. RC586............................. 144  4e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Serratia nematodiphila....................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Legionella pneumophila....................... 144  5e-36  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Vibrio sp. OY15.............................. 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio sp...   
. . Vibrio nigripulchritudo BLFn1................ 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio parahaemolyticus 50................... 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein D028_1609 [Vibrio parahae...   
. . Edwardsiella tarda........................... 144  5e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwa...   
. . Mannheimia varigena USDA-ARS-USMARC-1388..... 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Mannheimi...   
. . Providencia alcalifaciens PAL-3.............. 144  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Providenc...   
. . Legionella pneumophila subsp. pneumophila.... 144  6e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Escherichia coli HVH 200 (4-4449924)......... 144  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Vibrio owensii JCM 18904..................... 144  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio s...   
. . Vibrio cholerae AM-19226..................... 144  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae EcWSU1.................. 144  7e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Pseudoalteromonas piscicida.................. 144  8e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Vibrio alginolyticus......................... 143  8e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Serratia marcescens EGD-HP20................. 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Vibrio cholerae BJG-01....................... 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio albensis.............................. 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio sp. Ex25.............................. 143  9e-36  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pasteurella multocida subsp. multocida str. Ana 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Vibrio rotiferianus.......................... 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter sp. 638......................... 143  1e-35  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio cholerae PS15......................... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Serratia marcescens subsp. marcescens ATCC 1388 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Vibrio sp. 624788............................ 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia.................................. 143  1e-35  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudoalteromonas sp. NJ631.................. 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Escherichia coli KTE50....................... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Erwinia mallotivora.......................... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwinia m...   
. . Escherichia coli 042......................... 143  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia albertii TW11588................. 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Bibersteinia trehalosi....................... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Bibe...   
. . Vibrio parahaemolyticus RIMD 2210633......... 143  1e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio cholerae HC-43B1...................... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Vibrio campbellii............................ 143  1e-35  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Trabulsiella guamensis ATCC 49490............ 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Trabulsie...   
. . Leclercia adecarboxylata ATCC 23216.......... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Leclercia...   
. . Serratia marcescens subsp. marcescens Db11... 143  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia...   
. . Edwardsiella piscicida....................... 143  2e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwa...   
. . Escherichia coli str. K-12 substr. MG1655.... 142  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Serratia marcescens WW4...................... 142  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Klebsiella pneumoniae IS22................... 142  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Pasteurella dagmatis......................... 142  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Enterobacter sp. GM01........................ 142  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Vibrio harveyi ATCC BAA-1116................. 142  1e-35  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Providencia alcalifaciens RIMD 1656011....... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Providenc...   
. . Providencia alcalifaciens F90-2004........... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Providenc...   
. . Legionella pneumophila str. Corby............ 142  2e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Escherichia coli KTE52....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli TA007....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 1-176-05_S3_C2.............. 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Vibrio cholerae LMA3984-4.................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli BWH 32...................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Vibrio cholerae 12129(1)..................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli KOEGE 71 (186a)............. 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Enterobacter sp. R4-368...................... 142  2e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Escherichia albertii......................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Pasteurella multocida subsp. gallicida X73... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Serratia marcescens VGH107................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Enterobacter sp. T1-1........................ 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Escherichia coli O86:H34 str. 99-3124........ 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 97.0246..................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE75....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE11....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio sp. MED222............................ 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli KTE114...................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Enterobacter cloacae subsp. cloacae ATCC 13047 142  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Vibrio mimicus VM223......................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Marinobacterium stanieri..................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Vibrio parahaemolyticus VP49................. 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio pa...   
. . Vibrio gazogenes............................. 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli P0304777.15................. 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli BCE019_MS-13................ 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Pasteurella multocida subsp. multocida str. P52 142  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Halomonas sp. GFAJ-1......................... 142  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Edwardsiella tarda EIB202.................... 142  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwa...   
. . Salmonella enterica subsp. enterica serovar Sai 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Shigella flexneri CDC 796-83................. 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Vibrio fischeri MJ11......................... 142  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Alii...   
. . Enterobacter cloacae S611.................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Escherichia coli LF82........................ 142  3e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE196...................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli M863........................ 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli H263........................ 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 113290...................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli P0301867.5.................. 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli M718........................ 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Aliagarivorans taiwanensis................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alia...   
. . Citrobacter rodentium........................ 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Escherichia coli TA124....................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Psychromonas ingrahamii...................... 142  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Escherichia coli 2-156-04_S3_C2.............. 141  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Serratia marcescens BIDMC 50................. 141  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Escherichia coli IS1......................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Escheric...   
. . Mannheimia varigena USDA-ARS-USMARC-1261..... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Mannheimi...   
. . Escherichia coli 53638....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Aliagarivorans marinus....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alia...   
. . Escherichia coli UMEA 3053-1................. 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Vibrio alginolyticus 12G01................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Enterobacter cloacae subsp. dissolvens SDM... 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Ewingella americana ATCC 33852............... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ewingella...   
. . Escherichia coli KTE44....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli DEC8E....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Neptunomonas sp. Rs2......................... 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Osed...   
. . Salmonella enterica subsp. enterica serovar Che 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli 2-460-02_S3_C1.............. 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Escherichia coli TW10509..................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli SMS-3-5..................... 141  4e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Shigella flexneri 2850-71.................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Escherichia coli MP021552.7.................. 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE78....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Kangiella aquimarina......................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Kangiella aquimarina]    
. . Shigella boydii.............................. 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Enterobacteriaceae........................... 141  4e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Escherichia coli KTE144...................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE10....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Shigella boydii 3594-74...................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Escherichia coli HVH 70 (4-2963531).......... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Pasteurella multocida subsp. gallicida str. Ana 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Serratia symbiotica.......................... 141  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Escherichia coli PCN033...................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 4_1_47FAA................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli UTI89....................... 141  4e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Edwardsiella hoshinae........................ 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwa...   
. . Escherichia coli KTE28....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli DEC5E....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Oceanimonas sp. GK1.......................... 141  5e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Legionella wadsworthii....................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Shigella flexneri K-315...................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Vibrio sp. AND4.............................. 141  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Thiomicrospira kuenenii...................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira kuen...   
. . Escherichia coli IAI1........................ 141  5e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 7-233-03_S4_C1.............. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Shigella..................................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Shigella sonnei Ss046........................ 141  5e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Salmonella enterica subsp. enterica serovar Bai 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli MP021017.9.................. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 55989....................... 141  5e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Methylococcaceae bacterium IT-4.............. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Vibrio cholerae O1 str. EM-1676A............. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Methylophaga thiooxydans..................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Escherichia coli DEC8B....................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli ATCC 35150.................. 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Shigella flexneri K-272...................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Escherichia coli B093........................ 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2362-75..................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 5.0959...................... 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Ana 141  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Neptunomonas sp. Rs1......................... 141  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Osedax symbiont Rs1]     
. . Thioalkalivibrio sp. ALJ17................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Vibrio kanaloae.............................. 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli KTE205...................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Citrobacter amalonaticus..................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citrobact...   
. . Candidatus Contendobacter odensis Run_B_J11.. 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: conserved hypothetical protein [Candidatus Co...   
. . Thiothrix flexilis........................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiothrix flexilis]      
. . Providencia sneebia.......................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Escherichia coli UMEA 3489-1................. 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Vibrio harveyi HY01.......................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli 2-011-08_S1_C1.............. 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Escherichia coli P0305260.5.................. 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli MS 115-1.................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Pan 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salmonella enterica subsp. enterica serovar Mia 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Cronobacter pulveris......................... 141  6e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Escherichia coli NA114....................... 141  6e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 536......................... 141  6e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar New 141  6e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Serratia sp. SCBI............................ 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Salmonella enterica subsp. enterica serovar Rub 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salm...   
. . Cronobacter helveticus....................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Salmonella enterica subsp. enterica serovar Mue 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salmonella enterica subsp. enterica serovar Sen 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salmonella enterica subsp. enterica serovar Typ 141  7e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli UMEA 3632-1................. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Gam 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli MS 60-1..................... 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Ken 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Serratia marcescens BIDMC 81................. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Escherichia coli P0305260.4.................. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli EC4100B..................... 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Buttiauxella agrestis ATCC 33320............. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Buttiauxe...   
. . Vibrio sp. JCM 19052......................... 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Salmonella enterica subsp. enterica serovar New 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Marinobacterium rhizophilum.................. 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Marinobacterium rhi...   
. . Salmonella enterica subsp. enterica serovar Mon 140  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli E22......................... 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Thiomicrospira sp. Milos-T2.................. 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira sp. ...   
. . Serratia sp. FS14............................ 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Vibrio ponticus.............................. 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio p...   
. . Providencia rettgeri......................... 140  8e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Salmonella enterica subsp. enterica serovar Pom 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salmonella enterica subsp. enterica serovar Giv 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Marinobacter sp. BSs20148.................... 140  8e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Teredinibacter turnerae...................... 140  8e-35  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Tere...   
. . Vibrio alginolyticus NBRC 15630.............. 140  8e-35  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pasteurella multocida 1500C.................. 140  8e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Past...   
. . Escherichia coli MS 153-1.................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Klebsiella pneumoniae MGH-74................. 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Klebsiella pneumoniae........................ 140  9e-35  24 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Escherichia coli MS 21-1..................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Cho 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salmonell...   
. . Salmonella enterica subsp. enterica serovar Soe 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salmonella enterica subsp. enterica serovar Uga 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Edwardsiella tarda 080813.................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwardsi...   
. . Escherichia coli KTE143...................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Erwinia billingiae........................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Escherichia coli F11......................... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli HVH 142 (4-5627451)......... 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar 9,1 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salmonell...   
. . Methylobacter marinus........................ 140  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Citrobacter freundii UCI 32.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citrobact...   
. . Vibrio sp. JCM 19053......................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...   
. . Escherichia coli P0299483.1.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Klebsiella pneumoniae 30684/NJST258_2........ 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Hypothetical protein KPNJ2_02448 [Klebsiella p...   
. . Glaciecola arctica........................... 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Escherichia coli HVH 118 (4-7345399)......... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Legionella pneumophila str. Lens............. 140  1e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Escherichia coli O104:H4 str. 2009EL-2071.... 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Photobacterium aphoticum..................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Photobac...   
. . Vibrio caribbenthicus........................ 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Salmonella enterica subsp. enterica serovar Typ 140  1e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Klebsiella pneumoniae IS33................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Klebsiella pneumoniae IS43................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Citrobacter freundii MGH 56.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citrobact...   
. . Klebsiella pneumoniae MGH 44................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Escherichia coli 2845650..................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Sen 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salm...   
. . Enterobacter sp. MGH 13...................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Klebsiella pneumoniae BIDMC 22............... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Escherichia coli P0299438.8.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli HVH 156 (4-3206505)......... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Endozoicomonas montiporae.................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Endozoico...   
. . Citrobacter sp. 30_2......................... 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Tolumonas sp. BRL6-1......................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Tolu...   
. . Escherichia coli ETEC H10407................. 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. enterica serovar Gal 140  1e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Rhodanobacter fulvus......................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylophaga lonarensis...................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Escherichia coli O157:H7 str. EC1212......... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Citrobacter.................................. 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio splendidus 12B01...................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Bibersteinia trehalosi USDA-ARS-USMARC-190... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Anhydro-N-acetylmuramic acid kinase [Biberstei...   
. . Citrobacter sp. KTE32........................ 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Klebsiella pneumoniae KCTC 2242.............. 140  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Klebsiella................................... 140  1e-34  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . gamma proteobacterium SCGC AAA003-E02........ 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Gammaproteobacteria...   
. . Escherichia coli O157:H7 str. EDL933......... 140  1e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2747800..................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli UMEA 3160-1................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Idiomarina sp. MCCC 1A10513.................. 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein IDAT_09385 [Idiomarina sp...   
. . Aggregatibacter actinomycetemcomitans........ 140  2e-34  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Escherichia coli CFT073...................... 140  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE220...................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Saccharophagus degradans..................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. . Salmonella enterica subsp. enterica serovar Ken 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Citrobacter sp. MGH 55....................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citrobact...   
. . Enterobacter cancerogenus.................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Haemophilus sp. CCUG 13788................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Klebsiella pneumoniae BIDMC 41............... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Citrobacter sp. A1........................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Vibrio splendidus ATCC 33789................. 140  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pseudoalteromonas spongiae................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Escherichia coli DEC14B...................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Mannheimia haemolytica serotype A1/A6 str. PKL1 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mannheimi...   
. . Salmonella enterica subsp. houtenae str. ATCC B 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Simiduia agarivorans......................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [Simi...   
. . Escherichia coli ISC11....................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Escheric...   
. . Klebsiella pneumoniae UCI 20................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Methylophaga frappieri....................... 139  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Vibrio sp. 712i1............................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli 1-250-04_S3_C1.............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Escherichia coli O103:H2 str. 12009.......... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Salmonella enterica subsp. houtenae serovar 50: 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Vibrio owensii............................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Marinobacter sp. ELB17....................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Citrobacter youngae.......................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Haemophilus parasuis ST4-1................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haemophil...   
. . Escherichia coli 1357........................ 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE210...................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Yersinia kristensenii........................ 139  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: hypothetical protein DJ57_1173 [Yersinia krist...   
. . Thioalkalivibrio sulfidiphilus............... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Escherichia coli O91:H21 str. 2009C-3740..... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Escherichia coli cloneA_i1................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Legionella cherrii........................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Klebsiella pneumoniae 700603................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Escherichia coli 2-005-03_S3_C1.............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Klebsiella pneumoniae BJ1-GA................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Escherichia coli 5-172-05_S1_C1.............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Marinobacter santoriniensis.................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Haemophilus parasuis......................... 139  2e-34  13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Escherichia coli O127:H6 str. E2348/69....... 139  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2-474-04_S4_C2.............. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Vibrio litoralis............................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli SE11........................ 139  2e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Nitrincola lacisaponensis.................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Anhydro-N-acetylmuramic acid kinase [Nitrincol...   
. . Glaciecola psychrophila 170.................. 139  3e-34  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Legionella pneumophila subsp. pneumophila str.  139  3e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Enterobacter cloacae UCICRE 3................ 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Glaciecola sp. BSs20135...................... 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Escherichia coli S88......................... 139  3e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2741950..................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli E1520....................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Haemophilus parasuis SH0165.................. 139  3e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Marinobacter sp. EN3......................... 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Escherichia coli P0304816.5.................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2866750..................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Enterobacter sp. MGH 8....................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudoalteromonas tunicata................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Pseudoalteromonas t...   
. . Salmonella enterica subsp. enterica serovar Ber 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Citrobacter freundii......................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Escherichia coli MS 185-1.................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Xanthomonas sp. 97M.......................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Kangiella koreensis.......................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Kang...   
. . Serratia marcescens BIDMC 44................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Salmonella enterica subsp. enterica serovar Cer 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Escherichia coli P0299917.7.................. 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli KTE47....................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Enterobacteriaceae bacterium 9_2_54FAA....... 139  3e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Serratia marcescens SM39..................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia...   
. . Aeromonas diversa............................ 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Xenorhabdus cabanillasii JM26................ 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Xenorhab...   
. . Beggiatoa alba............................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: molecular chaperone [Beggiatoa alba]           
. . Escherichia coli KTE154...................... 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Hafnia alvei................................. 139  4e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Hafn...   
. . Salmonella enterica subsp. enterica Serovar Cub 139  4e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Salinisphaera shabanensis.................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: anhydro-N-acetylmuramic acid kinase [Sali...   
. . Erwinia toletana............................. 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Rhodanobacter spathiphylli................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Escherichia coli HVH 39 (4-2679949).......... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Marinobacter sp. C1S70....................... 139  4e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Glaciecola polaris........................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Escherichia coli O157:H7 str. G5101.......... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Vibrio owensii JCM 18905..................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio s...   
. . Rahnella sp. Y9602........................... 139  4e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Rahn...   
. . Enterobacter lignolyticus.................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Photobacterium profundum..................... 139  4e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Pseudoalteromonas luteoviolacea.............. 139  6e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudoalteromonas lipolytica SCSIO 04301..... 139  7e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseudoalt...   
. . Aestuariibacter salexigens................... 138  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Aestuariibacter sal...   
. . Marinobacter lipolyticus..................... 138  5e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Photobacterium leiognathi.................... 138  5e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Salinimonas chungwhensis..................... 138  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Salinimonas chungwh...   
. . Haemophilus parasuis 84-15995................ 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Aliivibrio logei............................. 138  6e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Alii...   
. . Vibrionales bacterium SWAT-3................. 138  6e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Idiomarina sediminum......................... 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Idiomarina sediminum]    
. . Vibrio sp. F6................................ 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Escherichia coli UMEA 3151-1................. 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Photobacterium damselae...................... 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Marinobacter hydrocarbonoclasticus........... 138  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Haemophilus parasuis ZJ0906.................. 138  7e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Rahnella aquatilis........................... 138  7e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Rahn...   
. . Photobacterium leiognathi subsp. mandapamensis  138  7e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Neptuniibacter caesariensis.................. 138  7e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Nept...   
. . Legionella lansingensis...................... 138  7e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Klebsiella pneumoniae UCICRE 14.............. 138  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Melitea salexigens........................... 138  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Meli...   
. . Citrobacter freundii CFNIH1.................. 138  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Citrobact...   
. . Vibrio harveyi............................... 138  8e-34  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Teredinibacter turnerae T7901................ 138  8e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Tere...   
. . Klebsiella sp................................ 138  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Escherichia coli DEC5A....................... 137  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 1-392-07_S4_C2.............. 137  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich...   
. . Klebsiella pneumoniae BIDMC 69............... 137  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Rahnella aquatilis CIP 78.65 = ATCC 33071.... 137  9e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Rahn...   
. . Shigella flexneri J1713...................... 137  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shig...   
. . Escherichia coli E24377A..................... 137  9e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Avibacterium paragallinarum.................. 137  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Putative Anhydro-N-acetylmuramic acid kin...   
. . Legionella longbeachae....................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Yersinia ruckeri............................. 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Escherichia coli P0298942.1.................. 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . gamma proteobacterium HTCC5015............... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Escherichia coli 2845350..................... 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Klebsiella oxytoca........................... 137  1e-33  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Photobacterium sp. SKA34..................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Cronobacter.................................. 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Escherichia fergusonii....................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli BCE002_MS12................. 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 179100...................... 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 2867750..................... 137  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Erwinia sp. Ejp617........................... 137  1e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Proteus mirabilis............................ 137  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prot...   
. . Serratia liquefaciens........................ 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Escherichia coli P0298942.12................. 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Haemophilus parasuis gx033................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Erwinia piriflorinigrans..................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Salmonella enterica subsp. enterica serovar Ala 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salmonell...   
. . Salmonella bongori........................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Shigella flexneri 1235-66.................... 137  2e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Shigella ...   
. . Aggregatibacter actinomycetemcomitans HK1651. 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: hypothetical protein CF65_01538 [Aggregatibact...   
. . Erwinia tasmaniensis......................... 137  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Thiomicrospira arctica....................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira arct...   
. . Klebsiella sp. 10982......................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Erwinia pyrifoliae........................... 137  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Serratia liquefaciens FK01................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia...   
. . Aggregatibacter actinomycetemcomitans serotype  137  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . gamma proteobacterium IMCC3088............... 137  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Anhydro-N-acetylmuramic acid kinase [gamm...   
. . Salmonella bongori serovar 48:z41:-- str. RKS30 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salmonell...   
. . Hahella chejuensis........................... 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Hahe...   
. . Aggregatibacter actinomycetemcomitans D11S-1. 136  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Neptunomonas japonica........................ 136  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Nept...   
. . Klebsiella pneumoniae JM45................... 136  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Cronobacter sp. FGI57........................ 136  3e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: molecular chaperone [Enterobacteriaceae b...   
. . Klebsiella pneumoniae UCI 26................. 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Photobacterium profundum 3TCK................ 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Providencia stuartii......................... 136  3e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Salmonella enterica subsp. enterica serovar Typ 136  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: hypothetical protein [Salmonella enterica]     
. . Proteus penneri.............................. 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prot...   
. . Vibrio vulnificus BAA87...................... 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio vu...   
. . Succinivibrio dextrinosolvens................ 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: hypothetical protein [Succinivibrio dextr...   
. . Enterobacteriaceae bacterium LSJC7........... 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Legionella longbeachae D-4968................ 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Aggregatibacter actinomycetemcomitans serotype  136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Escherichia coli PA9......................... 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Klebsiella sp. 07A044........................ 136  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiel...   
. . Serratia fonticola........................... 136  3e-33  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Erwinia pyrifoliae Ep1/96.................... 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Photobacterium angustum...................... 136  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Endozoicomonas numazuensis................... 136  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Endozoico...   
. . Erwinia amylovora............................ 136  4e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Erwinia amylovora CFBP1430................... 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Lonsdalea quercina........................... 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Lons...   
. . gamma proteobacterium NOR5-3................. 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Serratia sp. DD3............................. 136  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Actinobacillus succinogenes.................. 136  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Yersinia kristensenii ATCC 33638............. 136  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Aggregatibacter actinomycetemcomitans ANH9381 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Pseudoalteromonas atlantica.................. 136  4e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Xylella fastidiosa subsp. sandyi Ann-1....... 136  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xylella f...   
. . Vibrio vulnificus CMCP6...................... 136  5e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pseudoalteromonas luteoviolacea 2ta16........ 136  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: putative molecular chaperone distantly re...   
. . Wohlfahrtiimonas chitiniclastica SH04........ 136  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Anhydro-N-acetylmuramic acid kinase [Wohl...   
. . Halomonas sp. HAL1........................... 135  5e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Marinobacter sp. EVN1........................ 135  5e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Thioalkalivibrio thiocyanodenitrificans...... 135  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio th...   
. . Mannheimia succiniciproducens................ 135  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Mann...   
. . Salinisphaera hydrothermalis C41B8........... 135  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: anhydro-N-acetylmuramic acid kinase [Salinisph...   
. . Yokenella regensburgei ATCC 49455............ 135  6e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yokenella...   
. . Hydrogenovibrio marinus...................... 135  6e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein EI16_05400 [Hydrogenovibr...   
. . Haemophilus pittmaniae....................... 135  6e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Xylella fastidiosa........................... 135  6e-33  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xyle...   
. . Succinivibrionaceae bacterium WG-1........... 135  6e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Succ...   
. . Actinobacillus suis.......................... 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Providencia rettgeri Dmel1................... 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Legionella geestiana......................... 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: hypothetical protein [Legionella geestiana]    
. . Pectobacterium carotovorum subsp. brasiliense 135  7e-33  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pectobact...   
. . Serratia fonticola AU-AP2C................... 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Serr...   
. . Vibrio vulnificus MO6-24/O................... 135  7e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Hafnia alvei ATCC 51873...................... 135  7e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Hafn...   
. . Shewanella oneidensis........................ 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Psychromonas aquimarina...................... 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Aggregatibacter actinomycetemcomitans RhAA1.. 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Sodalis glossinidius......................... 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Soda...   
. . Klebsiella oxytoca 10-5242................... 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Erwinia chrysanthemi......................... 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Shewanella putrefaciens...................... 135  8e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Erwinia amylovora ATCC BAA-2158.............. 135  8e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Erwinia ...   
. . Haemophilus influenzae....................... 135  9e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Yokenella regensburgei....................... 135  9e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yoke...   
. . Yersinia enterocolitica...................... 135  9e-33  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Pseudoalteromonas sp. BSi20311............... 135  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Escherichia coli H120........................ 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Aggregatibacter actinomycetemcomitans D7S-1.. 135  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Mangrovibacter sp. MFB070.................... 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Mangrovib...   
. . Actinobacillus minor......................... 135  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Escherichia coli 96.154...................... 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Pectobacterium carotovorum subsp. carotovorum 135  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pectobact...   
. . Escherichia coli P0302308.1.................. 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Serratia grimesii............................ 135  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Methylobacter tundripaludum.................. 134  1e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Vibrio vulnificus YJ016...................... 134  1e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Escherichia coli P0302308.3.................. 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Escherichia coli 10.0869..................... 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Serratia..................................... 134  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Arhodomonas aquaeolei........................ 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Arhodomonas aquaeolei]   
. . Xylella fastidiosa Mul-MD.................... 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xylella f...   
. . Escherichia coli 2875150..................... 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Rhodanobacter denitrificans.................. 134  1e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Pseudomonas flectens......................... 134  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Phas...   
. . Marinobacter sp. R9SW1....................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Marinobac...   
. . Aggregatibacter actinomycetemcomitans serotype  134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Klebsiella oxytoca KONIH1.................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Yersinia enterocolitica LC20................. 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: AnhMurNAc kinase [Yersinia enterocolitica LC20]     
. . Klebsiella oxytoca 10-5245................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Xylella fastidiosa Temecula1................. 134  2e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xyle...   
. . Vibrio splendidus LGP32...................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pectobacterium carotovorum................... 134  2e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pect...   
. . Raoultella ornithinolytica................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Raou...   
. . Shewanella pealeana.......................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Proteus mirabilis HI4320..................... 134  2e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prot...   
. . Dickeya zeae................................. 134  2e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Dick...   
. . Photorhabdus asymbiotica..................... 134  2e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Legionella drancourtii....................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Salmonella enterica subsp. arizonae serovar 62: 134  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm...   
. . Budvicia aquatica............................ 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Budv...   
. . Yersinia bercovieri.......................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Shewanella sp. HN-41......................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Serratia fonticola RB-25..................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Psychromonas ossibalaenae.................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Psychromonas ossiba...   
. . Klebsiella oxytoca 10-5250................... 134  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Aeromonas veronii............................ 134  3e-32  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Dyella ginsengisoli.......................... 134  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Dyella ginsengisoli]     
. . Escherichia fergusonii ECD227................ 134  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Esch...   
. . Haemophilus haemolyticus..................... 134  3e-32  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Pectobacterium carotovorum subsp. carotovorum P 134  3e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pect...   
. . Pectobacterium carotovorum subsp. carotovorum P 134  3e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pect...   
. . Klebsiella oxytoca MGH 42.................... 134  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Aggregatibacter sp. oral taxon 458........... 134  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Pseudoalteromonas............................ 134  3e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pseudoalteromonas sp. SM9913................. 134  3e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Xanthomonas vesicatoria...................... 134  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Marinobacter adhaerens....................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Aeromonas hydrophila AD9..................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aeromonas...   
. . Klebsiella oxytoca MGH 28.................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Haemophilus parasuis D74..................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Aggregatibacter aphrophilus.................. 133  3e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Haemophilus parasuis SW114................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Vibrio rumoiensis............................ 133  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio rumoiensis]       
. . Simiduia agarivorans SA1..................... 133  4e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [Simi...   
. . Methylobacter luteus......................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Tatumella.................................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Klebsiella oxytoca KCTC 1686................. 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Raoultella planticola ATCC 33531............. 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Raoultell...   
. . Haemophilus parasuis MN-H.................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Francisella sp. W12-1067..................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Francisel...   
. . Aeromonas veronii B565....................... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Klebsiella oxytoca E718...................... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Aeromonas.................................... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Aeromonas salmonicida........................ 133  4e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Yersinia enterocolitica (type O:5) str. YE53/03 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Yersinia ente...   
. . Aeromonas sp. 159............................ 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Candidatus Schmidhempelia bombi.............. 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Orbales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Serratia sp. ATCC 39006...................... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Serr...   
. . Aggregatibacter aphrophilus NJ8700........... 133  4e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Aggregatibacter actinomycetemcomitans Y4..... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Klebsiella sp. AS10.......................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Haemophilus parasuis SW140................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Actinobacillus minor NM305................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Hahella ganghwensis.......................... 133  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Hahella ganghwensis]     
. . Proteus hauseri.............................. 133  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prot...   
. . Haemophilus influenzae Rd KW20............... 133  5e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Methylobacter tundripaludum SV96............. 133  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Serratia sp. Ag2............................. 133  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serratia ...   
. . Pseudoalteromonas sp. BSi20439............... 133  7e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Aeromonas media WS........................... 132  6e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aeromonas...   
. . Serratia marcescens FGI94.................... 132  6e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: molecular chaperone [Serratia marcescens]      
. . Yersinia aldovae............................. 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Pectobacterium wasabiae...................... 132  7e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pect...   
. . Shewanella baltica........................... 132  7e-32  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Erwinia amylovora NBRC 12687................. 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwinia ...   
. . Ferrimonas balearica......................... 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Ferr...   
. . Klebsiella oxytoca MGH 41.................... 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Aeromonas veronii AMC34...................... 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Haemophilus parainfluenzae................... 132  7e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Yersinia intermedia.......................... 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Pantoea ananatis............................. 132  7e-32  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Aeromonas hydrophila......................... 132  7e-32  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Salmonella enterica subsp. enterica serovar Urb 132  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Salmonell...   
. . Aeromonas veronii AER397..................... 132  8e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Aeromonas veronii AMC35...................... 132  8e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Yersinia enterocolitica subsp. enterocolitica 8 132  8e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Xylella fastidiosa XfPE...................... 132  8e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xylella f...   
. . Shewanella baltica OS185..................... 132  9e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Aeromonas salmonicida subsp. pectinolytica 34me 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Haemophilus parainfluenzae T3T1.............. 132  9e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Legionella sainthelensi...................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Cronobacter dublinensis...................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Cron...   
. . Xylella fastidiosa M12....................... 132  9e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xyle...   
. . Thiomicrospira chilensis..................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira chil...   
. . Catenovulum agarivorans DS-2................. 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Catenovul...   
. . Dickeya solani............................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Dick...   
. . Legionella shakespearei...................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Cronobacter condimenti....................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase (EC 2...   
. . Haemophilus parainfluenzae HK2019............ 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Shewanella sp. YQH10......................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shewanell...   
. . Pantoea sp. A4............................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Ignatzschineria larvae....................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Ignatzschineria lar...   
. . Enterobacter radicincitans................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kosa...   
. . gamma proteobacterium WG36................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Providencia burhodogranariea................. 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Prov...   
. . Marinobacterium sp. AK27..................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Anhydro-N-acetylmuramic acid kinase [Marinobac...   
. . Halomonas boliviensis........................ 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Thioalkalimicrobium aerophilum AL3........... 131  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Thioalkal...   
. . Serratia odorifera........................... 131  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Pantoea sp. At-9b............................ 131  1e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Xenorhabdus nematophila...................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Xeno...   
. . Marinobacter sp. AK21........................ 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Anhydro-N-acetylmuramic acid kinase [Marinobac...   
. . Serratia sp. S4.............................. 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Aggregatibacter actinomycetemcomitans serotype  131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Serratia proteamaculans...................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Serratia sp. M24T3........................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Microbulbifer variabilis..................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Micr...   
. . Shewanella baltica BA175..................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Shewanella baltica OS223..................... 131  2e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Arenimonas composti.......................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Aren...   
. . Rheinheimera baltica......................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Rhei...   
. . Klebsiella pneumoniae subsp. pneumoniae KP5-1 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Actinobacillus pleuropneumoniae.............. 131  2e-31  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Shewanella putrefaciens 200.................. 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Pantoea ananatis PA13........................ 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Piscirickettsia salmonis..................... 131  2e-31  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Piscirickettsia sal...   
. . Haemophilus influenzae 22.4-21............... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Spongiibacter tropicus....................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [Spon...   
. . Pantoea ananatis AJ13355..................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Pseudoalteromonas sp. SCSIO_11900............ 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseudoalt...   
. . Enterobacteriaceae bacterium HS.............. 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Sodalis s...   
. . Xanthomonas vasicola......................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Klebsiella pneumoniae 342.................... 131  2e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Beggiatoa sp. SS............................. 131  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Protein of unknown function UPF0075 [Beggiatoa...   
. . Pantoea ananatis LMG 5342.................... 131  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Pantoea ananatis LMG 20103................... 131  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pant...   
. . Klebsiella variicola......................... 131  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Cronobacter sakazakii........................ 131  3e-31  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Halomonas titanicae.......................... 131  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Anhydro-N-acetylmuramic acid kinase [Halo...   
. . Pseudoalteromonas undina..................... 131  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Glaciecola lipolytica........................ 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Pectobacterium betavasculorum................ 130  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pectobact...   
. . Oleispira antarctica RB-8.................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Anhydro-N-acetylmuramic acid kinase [Oleispir...   
. . Klebsiella variicola At-22................... 130  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Halomonas sp. A3H3........................... 130  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Shewanella putrefaciens CN-32................ 130  3e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Actinobacillus pleuropneumoniae serovar 10 str. 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Aeromonas hydrophila 4AK4.................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anmK product [Aeromonas hydrophila 4AK4]            
. . Xanthomonas perforans........................ 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Nevskia ramosa............................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Nevs...   
. . Haemophilus haemolyticus M21621.............. 130  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Pseudoalteromonas haloplanktis............... 130  4e-31  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Halomonas sp. KO116.......................... 130  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Anhydro-N-acetylmuramic acid kinase [Halomonas...   
. . Xanthomonas campestris....................... 130  4e-31  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Glaciecola................................... 130  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Shewanella waksmanii......................... 130  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Xanthomonas campestris pv. musacearum NCPPB 438 130  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Klebsiella pneumoniae MGH-80................. 130  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Klebsiell...   
. . Serratia plymuthica.......................... 130  5e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . Serratia odorifera 4Rx13..................... 130  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Serr...   
. . gamma proteobacterium HTCC2207............... 130  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Solimonas soli............................... 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Solimonas soli]          
. . Haemophilus haemolyticus HK386............... 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Catenovulum agarivorans...................... 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Catenovulum agarivo...   
. . Cronobacter turicensis....................... 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Haemophilus haemolyticus M21639.............. 130  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Serratia sp. AS12............................ 130  6e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Actinobacillus pleuropneumoniae serovar 1 str.  130  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Actinobacillus pleuropneumoniae serovar 6 str.  130  6e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Pantoea sp. AS-PWVM4......................... 130  6e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Pant...   
. . Halomonas.................................... 130  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . gamma proteobacterium BDW918................. 130  7e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Edwardsiella ictaluri........................ 130  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Edwa...   
. . Cronobacter sakazakii ATCC BAA-894........... 130  7e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Algicola sagamiensis......................... 129  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Algicola sagamiensis]    
. . Pectobacterium wasabiae CFBP 3304............ 129  7e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Pect...   
. . Marinobacter manganoxydans................... 129  8e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Haemophilus sp. oral taxon 851............... 129  8e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Legionella fairfieldensis.................... 129  8e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Legi...   
. . Actinobacillus pleuropneumoniae serovar 5b str. 129  9e-31  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Cronobacter sakazakii ES15................... 129  9e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Xanthomonas euvesicatoria.................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Aeromonas veronii Hm21....................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Aeromonas hydrophila subsp. hydrophila ATCC 796 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Xenorhabdus bovienii str. feltiae Moldova.... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Xenorhabdus b...   
. . Nevskia soli................................. 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Nevskia soli]            
. . Yersinia enterocolitica (type O:2) str. YE3094/ 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Yersinia ente...   
. . Xanthomonas vasicola pv. vasculorum NCPPB 1326 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Thalassolituus oleivorans.................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Thal...   
. . Xenorhabdus bovienii str. puntauvense........ 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Xenorhabdus b...   
. . Enterobacter aerogenes....................... 129  1e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Pseudoxanthomonas sp. J35.................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Xenorhabdus bovienii str. kraussei Quebec.... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Xenorhabdus b...   
. . Aeromonas hydrophila ML09-119................ 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Xanthomonas alfalfae......................... 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Enterobacter aerogenes UCI 45................ 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Enterobac...   
. . Colwellia piezophila......................... 129  1e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Colw...   
. . Shewanella decolorationis.................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-n-acetylmuramic acid kinase [Shew...   
. . Actinobacillus pleuropneumoniae serovar 3 str.  129  1e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Xanthomonas axonopodis pv. citrumelo F1...... 129  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Arenimonas donghaensis DSM 18148............. 129  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N788_06090 [Arenimonas do...   
. . Actinobacillus pleuropneumoniae serovar 12 str. 129  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Nitrosococcus halophilus..................... 129  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Xanthomonas campestris pv. campestris str. B100 129  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Cronobacter sp. 1383......................... 129  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cron...   
. . Sinobacter flavus............................ 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Sinobacter flavus]       
. . Xenorhabdus doucetiae........................ 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Xenorhab...   
. . Actinobacillus pleuropneumoniae serovar 4 str.  128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Aeromonas caviae............................. 128  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Shewanella oneidensis MR-1................... 128  2e-30  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Chain A, Crystal Structure Of A Functionally Unkno...   
. . Haemophilus haemolyticus M21127.............. 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Ferrimonas kyonanensis....................... 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Ferr...   
. . Leucothrix mucor............................. 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Leuc...   
. . Vibrio cholerae HENC-03...................... 128  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Dickeya dianthicola.......................... 128  2e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Dick...   
. . Halomonas anticariensis...................... 128  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Aeromonas molluscorum........................ 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Psychromonas sp. SP041....................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. . Thalassolituus oleivorans R6-15.............. 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Thalassol...   
. . Oceanobacter kriegii......................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Oceanobacter kriegii]    
. . Shewanella sp. ANA-3......................... 128  3e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Dickeya dadantii............................. 128  3e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Dick...   
. . Thioalkalivibrio sp. ALJ16................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Actinobacillus pleuropneumoniae serovar 2 str.  128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Aeromonas hydrophila SSU..................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Yersinia pestis.............................. 128  3e-30  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Yersinia pestis Z176003...................... 128  3e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Yersinia..................................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Rhodanobacter sp. 115........................ 128  3e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Halomonas sp. HL-48.......................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Brenneria sp. EniD312........................ 127  3e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Bren...   
. . Shewanella algae............................. 127  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Xanthomonadaceae bacterium JGI 0001020-F16... 127  4e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Shewanella xiamenensis....................... 127  4e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shewanell...   
. . Agarivorans albus............................ 127  4e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Agar...   
. . Alcanivorax hongdengensis.................... 127  4e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Thiomicrospira crunogena XCL-2............... 127  4e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Luteimonas sp. J29........................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Lute...   
. . Pseudoalteromonas marina..................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Shewanella frigidimarina..................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Aggregatibacter segnis....................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Aggr...   
. . Shewanella marina............................ 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Yersinia similis............................. 127  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yersinia ...   
. . Xanthomonas campestris pv. campestris str. ATCC 127  5e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Xanthomonas axonopodis....................... 127  5e-30  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Actinobacillus capsulatus.................... 127  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Shewanella sp. MR-7.......................... 127  6e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Xenorhabdus bovienii str. oregonense......... 127  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: conserved hypothetical protein [Xenorhabdus b...   
. . Lysobacter sp. URHA0019...................... 127  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Lyso...   
. . marine gamma proteobacterium HTCC2143........ 127  6e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [mari...   
. . Arenimonas malthae CC-JY-1................... 127  7e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N790_13840 [Arenimonas ma...   
. . Photorhabdus temperata subsp. khanii NC19.... 127  7e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: molecular chaperone [Photorhabdus temperata su...   
. . Xanthomonas hortorum......................... 127  7e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Idiomarina salinarum......................... 127  7e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein IDSA_09860 [Idiomarina sa...   
. . Halomonas sp. KM-1........................... 127  7e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Aeromonas hydrophila HZM..................... 127  9e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aeromonas...   
. . Yersinia pestis PY-03........................ 126  8e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Thioalkalimicrobium cyclicum................. 126  8e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Piscirickettsia salmonis LF-89............... 126  8e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Pisc...   
. . Actinobacillus ureae......................... 126  9e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Acti...   
. . Legionella pneumophila subsp. pneumophila LPE50 126  9e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Anhydro-N-acetylmuramic acid kinase [Legi...   
. . Shewanella sp. MR-4.......................... 126  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Xanthomonas cassavae......................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Shewanella sp. 38A_GOM-205m.................. 126  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Stenotrophomonas maltophilia SKK35........... 126  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Stenotro...   
. . Xenorhabdus szentirmaii DSM 16338............ 126  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Xenorhab...   
. . Gallibacterium anatis........................ 126  1e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Gall...   
. . Coxiella burnetii............................ 126  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Coxi...   
. . Halothiobacillus neapolitanus................ 126  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Halothiobacillus ne...   
. . Pseudoalteromonas sp. BSi20495............... 126  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Arenimonas oryziterrae....................... 126  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Aren...   
. . Pseudoalteromonas citrea..................... 126  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Spiribacter salinus.......................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Spir...   
. . Halomonas campaniensis....................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halomonas...   
. . Rickettsiella grylli......................... 125  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Rick...   
. . Vibrio cholerae HENC-02...................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio sp...   
. . Stenotrophomonas maltophilia................. 125  2e-29  13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Photorhabdus temperata J3.................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Photorhab...   
. . Endozoicomonas elysicola..................... 125  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Endozoicomonas elys...   
. . Shewanella woodyi............................ 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Gallibacterium anatis UMN179................. 125  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Gall...   
. . Pseudomonas geniculata....................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [ [Ps...   
. . Alteromonadales bacterium TW-7............... 125  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Glaciecola mesophila......................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Enterobacter sp. Ag1......................... 125  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Ente...   
. . Nitrincola sp. AK23.......................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Anhydro-N-acetylmuramic acid kinase [Nitrincol...   
. . Photorhabdus temperata....................... 125  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Xanthomonas oryzae........................... 125  3e-29  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Methylohalobius crimeensis................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rudaea cellulosilytica....................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Rudaea cellulosilyt...   
. . gamma proteobacterium IMCC1989............... 125  4e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Anhydro-N-acetylmuramic acid kinase [gamm...   
. . Shewanella benthica.......................... 125  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Pseudoalteromonas sp. BSi20429............... 125  4e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Photobacterium phosphoreum ANT220............ 125  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Photobac...   
. . gamma proteobacterium SCGC AAA076-P13........ 124  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Xanthomonas fragariae........................ 124  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Idiomarina sp. A28L.......................... 124  5e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Idiomarina sp. A28L]     
. . Pseudoxanthomonas spadix..................... 124  5e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Gallaecimonas xiamenensis.................... 124  5e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [Gall...   
. . Morganella morganii.......................... 124  5e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Morg...   
. . Xenorhabdus bovienii......................... 124  5e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Xeno...   
. . Shewanella violacea.......................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Morganella morganii IS15..................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Morganel...   
. . Yersinia pseudotuberculosis.................. 124  6e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Thiomicrospira crunogena..................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Cedecea davisae.............................. 124  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Cede...   
. . Xanthomonas albilineans...................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Alishewanella agri........................... 124  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alis...   
. . Tolumonas auensis............................ 124  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Tolu...   
. . gamma proteobacterium Hiromi1................ 124  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamma pr...   
. . Bermanella marisrubri........................ 124  8e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Berm...   
. . Cronobacter sakazakii 696.................... 124  8e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Cron...   
. . Alcanivorax sp. 97CO-5....................... 124  8e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alcanivor...   
. . Thiomicrospira halophila..................... 124  8e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira halo...   
. . Shewanella denitrificans..................... 124  8e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Gammaproteobacteria bacterium MOLA455........ 124  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Anhydro-N-acetylmuramic acid kinase [Gammaprot...   
. . Dyella jiangningensis........................ 124  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Dyella ji...   
. . Xanthomonas oryzae pv. oryzicola BLS256...... 124  9e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Pseudoalteromonas sp. TB51................... 124  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Vibrio harveyi CAIM 1792..................... 124  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Pseudoalteromonas sp. BSi20652............... 124  9e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Aeromonas enteropelogenes.................... 124  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aero...   
. . Xenorhabdus poinarii G6...................... 124  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Xenorhab...   
. . Pseudoalteromonas sp. NW 4327................ 124  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Stenotrophomonas maltophilia D457............ 123  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Fangia hongkongensis......................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Fangia hongkongensis]    
. . Congregibacter litoralis..................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Congregibacter lito...   
. . Luminiphilus syltensis....................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [Lumi...   
. . Marinobacter sp. HL-58....................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . SAR86 cluster bacterium SAR86C............... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [SAR8...   
. . Idiomarina baltica........................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Predicted molecular chaperone [Idiomarina...   
. . Stenotrophomonas maltophilia 5BA-I-2......... 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Stenotrop...   
. . Stenotrophomonas maltophilia M30............. 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Stenotrop...   
. . Cronobacter sakazakii CMCC 45402............. 123  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Cron...   
. . Stenotrophomonas maltophilia MF89............ 123  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Stenotrop...   
. . Stenotrophomonas maltophilia EPM1............ 123  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Anhydro-N-acetylmuramic acid kinase [Sten...   
. . Rhodanobacter sp. OR444...................... 123  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Pseudoalteromonas arctica.................... 123  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudoalteromonas sp. S3431.................. 123  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseudoalt...   
. . Stenotrophomonas maltophilia K279a........... 123  2e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Halomonas sp. BJGMM-B45...................... 123  2e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Halomonas sp. BJGMM...   
. . Photorhabdus luminescens subsp. laumondii TTO1 122  2e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Alcanivorax sp. P2S70........................ 122  2e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Alcanivorax sp. P2S70]   
. . Thioalkalivibrio sp. ALR17-21................ 122  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Stenotrophomonas maltophilia R551-3.......... 122  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Photorhabdus luminescens..................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Phot...   
. . Rhodanobacter thiooxydans.................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Erwinia tracheiphila......................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Erwi...   
. . Halomonas sp. S18214......................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Stenotrophomonas sp. SKA14................... 122  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Dyella japonica.............................. 122  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Dyel...   
. . Thioalkalivibrio sp. AKL17................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Morganella morganii SC01..................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Morg...   
. . Cardiobacterium hominis...................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Cardiobacteriales: anhydro-N-acetylmuramic acid kinase [Card...   
. . Halomonas alkaliantarctica................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Frateuria aurantia........................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Frat...   
. . Xanthomonas fuscans.......................... 122  4e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: putative Anhydro-N-acetylmuramic acid kin...   
. . Halomonas smyrnensis......................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Halomonas smyrnensis]    
. . Dyella sp. A8................................ 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Dyel...   
. . gamma proteobacterium SCGC AAA168-I18........ 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Stenotrophomonas maltophilia Ab55555......... 122  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Pseudoalteromonas sp. Bsw20308............... 122  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Photobacterium sp. AK15...................... 121  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Anhydro-N-acetylmuramic acid kinase [Phot...   
. . Xanthomonas.................................. 121  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Shewanella fidelis........................... 121  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Xanthomonas axonopodis pv. malvacearum str. GSP 121  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Pseudoalteromonas agarivorans................ 121  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Alteromonas sp. H17.......................... 121  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alteromon...   
. . Xanthomonas axonopodis pv. citri str. 306.... 121  7e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Xanthomonas citri............................ 121  7e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Arsenophonus nasoniae........................ 121  7e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Arse...   
. . Xanthomonas fuscans subsp. aurantifolii str. IC 121  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Dichelobacter nodosus........................ 121  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Cardiobacteriales: anhydro-N-acetylmuramic acid kinase [Dich...   
. . Xanthomonas citri pv. mangiferaeindicae LMG 941 121  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Halomonas zhanjiangensis..................... 121  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Alcanivorax.................................. 121  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Rheinheimera sp. A13L........................ 121  8e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Rhei...   
. . Xanthomonas axonopodis pv. glycines str. 8ra. 121  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xanthomon...   
. . Ectothiorhodospira sp. PHS-1................. 121  8e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Ecto...   
. . Thioalkalivibrio sp. AKL19................... 121  9e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Thioalkalivibrio sp. ALJ24................... 120  9e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Xanthomonas oryzae pv. oryzae PXO99A......... 120  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Halomonas sp. TD01........................... 120  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Shewanella halifaxensis...................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Thioalkalivibrio sp. ALE19................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Idiomarina xiamenensis....................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Idio...   
. . Acidithiobacillus caldus..................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Histophilus somni............................ 120  2e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Hist...   
. . Pseudoalteromonas atlantica T6c.............. 120  2e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudoalteromonas haloplanktis ANT/505....... 120  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Xanthomonas gardneri......................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Rheinheimera nanhaiensis..................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Rhei...   
. . Marinobacter nanhaiticus..................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Thioalkalivibrio sp. HK1..................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Xanthomonas fuscans subsp. aurantifolii str. IC 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Microbulbifer agarilyticus................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Micr...   
. . Xanthomonas axonopodis pv. vasculorum........ 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xanthomon...   
. . Shewanella piezotolerans..................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Shewanella piezotol...   
. . Thioalkalivibrio............................. 119  3e-27  15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: hypothetical protein [Thioa...   
. . Dickeya...................................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Shewanella amazonensis....................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Moritella dasanensis......................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mori...   
. . Halomonas jeotgali........................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Halomonas jeotgali]      
. . gamma proteobacterium HIMB55................. 119  4e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: molecular chaperone [gamma proteobacteriu...   
. . Marinimicrobium agarilyticum................. 119  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Salinivibrio costicola....................... 119  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Sali...   
. . Pseudoalteromonas sp. BSi20480............... 119  5e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Halotalea alkalilenta........................ 119  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Thioalkalivibrio sp. ALE9.................... 119  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Lysobacter antibioticus...................... 118  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Lyso...   
. . Xanthomonas arboricola pv. celebensis........ 118  7e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xanthomon...   
. . Thiobacillus prosperus....................... 118  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: AnmK, anhydro-N-acetylmuramic acid kinase [Thi...   
. . Thioalkalivibrio sp. ALMg11.................. 118  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Oceanospirillum beijerinckii................. 118  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Oceanospirillum bei...   
. . Thioalkalivibrio sp. ALJT.................... 118  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALE30................... 118  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALE11................... 118  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALE17................... 118  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Acidithiobacillus ferrooxidans............... 118  9e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Thioalkalivibrio sp. ALM2T................... 118  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. AKL8.................... 118  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALMg2................... 118  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. AKL10................... 118  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALMg13-2................ 117  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . gamma proteobacterium SCGC AAA076-P09........ 117  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [gamm...   
. . Zooshikella ganghwensis...................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Zooshikella ganghwe...   
. . Leminorella grimontii........................ 117  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Lemi...   
. . Alcanivorax sp. DG881........................ 117  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Xanthomonas arboricola pv. pruni MAFF 301420. 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xanthomo...   
. . Thioalkalivibrio sp. AKL12................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Acidithiobacillus thiooxidans................ 117  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Stenotrophomonas rhizophila.................. 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Stenotrop...   
. . Thioalkalivibrio sp. AKL6.................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio sp. ALMg9................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Rheinheimera perlucida....................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Rheinheimera perluc...   
. . Thioalkalivibrio sp. ALE28................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Polycyclovorans algicola..................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Polycyclovorans alg...   
. . Moritella sp. PE36........................... 117  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mori...   
. . Thiorhodospira sibirica...................... 117  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Thioalkalivibrio sp. ALE16................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Nitrosococcus watsonii....................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Xanthomonas arboricola....................... 116  3e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Aeromonas hydrophila YL17.................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Aeromonas...   
. . Shewanella sediminis......................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Shew...   
. . Halomonas halocynthiae....................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Spiribacter sp. UAH-SP71..................... 116  4e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Spiribacter sp. UAH...   
. . Thioalkalivibrio sp. ARh3.................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . marine gamma proteobacterium HTCC2148........ 116  4e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: anhydro-N-acetylmuramic acid kinase [mari...   
. . Methylophaga nitratireducenticrescens........ 116  4e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Pseudoxanthomonas sp. J31.................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Pseudoxanthomonas sp. GW2.................... 116  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Halomonas halodenitrificans.................. 116  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Anaerobiospirillum succiniciproducens........ 116  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: hypothetical protein [Anaerobiospirillum ...   
. . Haemophilus somnus 129PT..................... 115  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Hist...   
. . Klebsiella pneumoniae subsp. pneumoniae JC2877 115  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb...   
. . Halomonas lutea.............................. 115  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Halomonas lutea]         
. . Halomonas elongata........................... 115  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Halomonas sp. B6............................. 115  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Fluoribacter dumoffii........................ 115  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: anhydro-N-acetylmuramic acid kinase [Fluo...   
. . Legionella massiliensis...................... 114  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Anhydro-N-acetylmuramic acid kinase [Legionel...   
. . Pseudoxanthomonas suwonensis................. 114  1e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Succinatimonas hippei........................ 114  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: anhydro-N-acetylmuramic acid kinase [Succ...   
. . Chromohalobacter salexigens.................. 114  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Chro...   
. . gamma proteobacterium SCGC AAA300-D14........ 114  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Nitrosococcus oceani......................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Nitrosoco...   
. . Nitrosococcus oceani ATCC 19707.............. 114  3e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Acidithiobacillus ferrooxidans ATCC 53993.... 114  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Acidithiobacillus sp. GGI-221................ 114  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acidithio...   
. . Oceanospirillum maris........................ 113  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Oceanospirillum maris]   
. . Ectothiorhodospiraceae....................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Xanthomonas translucens...................... 112  6e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: putative anhydro-N-acetylmuramic acid kin...   
. . Nitrococcus mobilis.......................... 112  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Nitrococcus mobilis]     
. . Alishewanella aestuarii...................... 112  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alis...   
. . Acidithiobacillus ferrivorans................ 112  8e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Alteromonas sp. ALT199....................... 112  8e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Alteromonas sp. SN2.......................... 112  9e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Marinospirillum insulare..................... 112  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Marinospirillum ins...   
. . Marinospirillum minutulum.................... 112  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Marinospirillum min...   
. . Moritella marina............................. 112  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mori...   
. . Cobetia marina............................... 112  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Cobetia m...   
. . Thioalkalivibrio sp. ALSr1................... 111  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Thioalkalivibrio thiocyanoxidans ARh 4....... 111  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Thioalkal...   
. . Alishewanella jeotgali....................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alis...   
. . Marinimicrobium sp. LS-A18................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Mari...   
. . Carnimonas nigrificans....................... 110  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Carn...   
. . Vibrio cholerae HENC-01...................... 110  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibr...   
. . Xanthomonas translucens DAR61454............. 110  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Alteromonas macleodii........................ 110  3e-24  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Thioalkalivibrio nitratireducens............. 110  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Anhydro-N-acetylmuramic acid kinase [Thio...   
. . Alteromonas macleodii AltDE1................. 110  4e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Haemophilus haemolyticus M19107.............. 109  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: anhydro-N-acetylmuramic acid kinase [Haem...   
. . Yersinia pestis 113.......................... 109  6e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Yers...   
. . Lysobacter defluvii.......................... 109  1e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Lyso...   
. . Xanthomonas translucens pv. translucens DSM 189 108  2e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Halomonas sp. PBN3........................... 107  3e-23  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Halomonas sp. PBN3]      
. . Alcanivorax dieselolei....................... 107  4e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Legionella sp. LegM.......................... 106  6e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: hypothetical protein [Legionella sp. LegM]     
. . Thioalkalivibrio sp. AKL11................... 106  7e-23  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Polaromonas sp. CF318........................ 106  8e-23  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pola...   
. . Cardiobacterium valvarum..................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Cardiobacteriales: anhydro-N-acetylmuramic acid kinase [Card...   
. . Alkalilimnicola ehrlichii.................... 103  1e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Alka...   
. . Legionella oakridgensis ATCC 33761 = DSM 21215 102  1e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: putative molecular chaperone distantly related...   
. . Xanthomonas vasicola pv. vasculorum NCPPB 890 101  2e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xanthomon...   
. . Luteimonas mephitis.......................... 101  5e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Lute...   
. . Xanthomonas sacchari......................... 100  6e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Xanthomonas sp. SHU199....................... 100  6e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Legionella oakridgensis RV-2-2007............ 100  6e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: putative molecular chaperone [Legionella oakri...   
. . Rheinheimera texasensis...................... 100  7e-21  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Rhei...   
. . Alteromonas macleodii str. 'Black Sea 11'.... 100  1e-20  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte...   
. . Gilvimarinus chinensis....................... 100  1e-20  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Gilvimarinus chinen...   
. . Halorhodospira halophila..................... 100  1e-20  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: anhydro-N-acetylmuramic acid kinase [Halo...   
. . Glaciecola punicea........................... 100  2e-20  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Glac...   
. . Alteromonas macleodii ATCC 27126............. 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte... 
. . Thioalkalivibrio sp. K90mix.................. 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: hypothetical protein [Thioa... 
. . Alteromonas macleodii str. 'Balearic Sea AD45' 99.0 4e-20  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte... 
. . Alteromonas macleodii str. 'Aegean Sea MED64' 97.8 1e-19  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte... 
. . Alteromonas macleodii str. 'Ionian Sea U4'... 97.8 1e-19  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: anhydro-N-acetylmuramic acid kinase [Alte... 
. . Brucella abortus LMN2........................ 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Oceanospirillales bacterium SCGC AAA298-N10.. 95.5 3e-19  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Oceanospirillales b... 
. . Pseudoxanthomonas suwonensis 11-1............ 95.5 4e-19  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Pseu... 
. . Xanthomonas sp. SHU308....................... 94.0 2e-18  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: anhydro-N-acetylmuramic acid kinase [Xant... 
. . Alcanivorax sp. NBRC 101098.................. 80.5 2e-14  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: anhydro-N-acetylmuramic acid kinase [Alcanivo... 
. . Escherichia coli TA143....................... 79.0 2e-14  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: hypothetical protein [Escherichia coli]      
. . Vibrio variabilis............................ 69.3 9e-11  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio v... 
. . Beggiatoa sp. PS............................. 67.8 3e-10  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Protein of unknown function UPF0075 [Beggiatoa... 
. . Escherichia coli DORA_B_14................... 66.2 5e-10  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Escherich... 
. . Escherichia coli O55:H7 str. 06-3555......... 66.2 1e-09  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Escherich... 
. . Cronobacter sakazakii 701.................... 64.7 7e-09  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Cron... 
. . Escherichia coli DORA_A_5_14_21.............. 64.3 6e-09  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Escherich... 
. . Klebsiella pneumoniae BIDMC 25............... 63.2 2e-08  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Kleb... 
. . Cronobacter malonaticus...................... 61.2 9e-08  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Cron... 
. . Cobetia crustatorum.......................... 58.9 4e-07  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Cobetia crustatorum]   
. . Halomonas sp. BC04........................... 57.8 5e-07  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein Q427_33120 [Halomonas sp.... 
. . Francisella tularensis subsp. tularensis str. S 53.5 1e-05  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: anhydro-N-acetylmuramic acid kinase [Francisel... 
. . Vibrio sp. C7................................ 43.9 0.021  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: anhydro-N-acetylmuramic acid kinase [Vibrio s... 
. . Pseudoalteromonas ruthenica.................. 41.2 0.22   1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Pseudoalteromonas r... 
. . Salmonella enterica subsp. enterica serovar Ent 41.2 0.28   2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm... 
. . Klebsiella pneumoniae IS10................... 38.9 0.54   1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Anhydro-N-acetylmuramic acid kinase [Klebsiel... 
. . Salmonella enterica subsp. enterica serovar Ent 38.5 1.9    2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: anhydro-N-acetylmuramic acid kinase [Salm... 
. . Thiobacillus thioparus....................... 159  2e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Thiobacillus denitrificans................... 154  5e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Thiobacillus denitrificans ATCC 25259........ 144  3e-36  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Sulfuricella denitrificans................... 135  6e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Methylovorus sp. MP688....................... 155  2e-40  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Vitreoscilla stercoraria..................... 155  3e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Vitreoscilla sterco...   
. . Deefgea rivuli............................... 153  2e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Deef...   
. . Nitrosomonas cryotolerans.................... 152  2e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Aquaspirillum serpens........................ 152  3e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Aqua...   
. . Methylotenera................................ 151  1e-38  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Methylobacillus flagellatus.................. 150  1e-38  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Nitrosomonas sp. Is79A3...................... 150  1e-38  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Methyloversatilis universalis................ 150  2e-38  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . beta proteobacterium KB13.................... 150  2e-38  2 hits  Bacteria:Proteobacteria:Betaproteobacteria: anhydro-N-acetylmuramic acid kinase [beta...   
. . Methylophilus methylotrophus................. 149  7e-38  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methyloversatilis universalis FAM5........... 147  2e-37  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylotenera versatilis..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylovorus glucosotrophus.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Janthinobacterium agaricidamnosum NBRC 102515 = 145  1e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Janthino...   
. . Duganella violaceinigra...................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Duga...   
. . Sulfuritalea hydrogenivorans sk43H........... 143  8e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: hypothetical protein SUTH_03117 [Sulfuritalea...   
. . Oxalobacteraceae bacterium AB_14............. 143  1e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oxalobacteraceae ba...   
. . Lutiella nitroferrum......................... 142  2e-35  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Duganella zoogloeoides....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Duganella zoogloeoi...   
. . Pseudogulbenkiania sp. NH8B.................. 141  4e-35  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Snodgrassella alvi SCGC AB-598-J21........... 141  4e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: putative molecular chaperone distantly related...   
. . Nitrosospira briensis........................ 140  7e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Microvirgula aerodenitrificans............... 140  7e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Micr...   
. . Methylotenera sp. 1P/1....................... 140  7e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: hypothetical protein [Methylotenera sp. 1...   
. . Candidatus Snodgrassella alvi................ 140  7e-35  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Anhydro-N-acetylmuramic acid kinase [Snodgrass...   
. . Candidatus Snodgrassella alvi wkB2........... 139  2e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Anhydro-N-acetylmuramic acid kinase [Snodgrass...   
. . Herminiimonas arsenicoxydans................. 139  2e-34  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herm...   
. . Comamonas badia.............................. 139  2e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Methylobacillus glycogenes................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Nitrosospira sp. APG3........................ 139  2e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: Anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Acidovorax radicis........................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Gallionella capsiferriformans................ 139  3e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: anhydro-N-acetylmuramic acid kinase [Gall...   
. . Achromobacter xylosoxidans................... 139  3e-34  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Achr...   
. . Achromobacter xylosoxidans NBRC 15126........ 139  3e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Achr...   
. . Methylophilaceae bacterium 11................ 139  4e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Verminephrobacter aporrectodeae.............. 138  4e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Verm...   
. . Methylophilales bacterium HTCC2181........... 138  6e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Snodgrassella alvi SCGC AB-598-P14........... 138  7e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: putative molecular chaperone distantly related...   
. . Alcaligenes.................................. 138  7e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Achromobacter xylosoxidans C54............... 137  9e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Alcaligenes sp. DH1f......................... 137  1e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Alcaligenes faecalis......................... 137  1e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Alca...   
. . Rhodocyclaceae............................... 136  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: hypothetical protein [Rhodo...   
. . Acidovorax citrulli.......................... 136  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Neisseria weaveri............................ 136  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Pseudogulbenkiania sp. MAI-1................. 136  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Janthinobacterium sp. Marseille.............. 136  4e-33  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Jant...   
. . Achromobacter piechaudii..................... 136  4e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Methylophilus sp. 5.......................... 135  1e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Acidovorax sp. JS42.......................... 135  1e-32  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Acidovorax ebreus............................ 134  1e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Janthinobacterium sp. HH01................... 134  1e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase AnmK ...   
. . Variovorax paradoxus......................... 134  2e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Vari...   
. . Bordetella avium............................. 134  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Advenella kashmirensis....................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Adve...   
. . Variovorax sp. URHB0020...................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Vari...   
. . Alicycliphilus denitrificans................. 134  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Alic...   
. . Polaromonas naphthalenivorans................ 134  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pola...   
. . Sideroxydans lithotrophicus.................. 133  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: anhydro-N-acetylmuramic acid kinase [Side...   
. . Achromobacter xylosoxidans A8................ 133  5e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Achromobacter arsenitoxydans................. 132  6e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Variovorax................................... 132  7e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Leeia oryzae................................. 132  7e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Leeia oryzae]            
. . Acidovorax delafieldii....................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Janthinobacterium lividum.................... 132  9e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Janthinob...   
. . Herbaspirillum seropedicae................... 132  9e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herb...   
. . Pusillimonas noertemannii.................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Pusillimonas noerte...   
. . Massilia timonae............................. 132  1e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Massilia timonae]        
. . Chitinilyticum aquatile...................... 131  1e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. . Nitrosospira multiformis..................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Acidovorax sp. CF316......................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Nitrosomonas sp. AL212....................... 131  2e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Neisseria sp. GT4A_CT1....................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Variovorax paradoxus B4...................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase AnmK ...   
. . Chitinibacter tainanensis.................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. . Chitinilyticum litopenaei.................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. . Sutterella wadsworthensis.................... 130  3e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Sutt...   
. . Chromobacterium violaceum ATCC 12472......... 130  4e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Kingella oralis.............................. 130  5e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [King...   
. . Kingella kingae.............................. 129  9e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [King...   
. . Burkholderiales bacterium 1_1_47............. 129  1e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Ferrovum myxofaciens......................... 129  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: hypothetical protein [Ferrovum myxofaciens]    
. . Acidovorax sp. KKS102........................ 129  1e-30  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Sphaerotilus natans subsp. natans DSM 6575... 129  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: molecular chaperone [Sphaerotilus natans subsp...   
. . Herbaspirillum sp. YR522..................... 129  2e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herb...   
. . Neisseria meningitidis....................... 128  2e-30  44 hits Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria flavescens......................... 128  2e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Paludibacterium yongneupense................. 128  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Palu...   
. . Comamonas composti........................... 128  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Lautropia mirabilis.......................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Laut...   
. . Neisseria macacae............................ 128  3e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Bordetella trematum.......................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Bordetella petrii............................ 128  3e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Neisseria meningitidis NM3001................ 127  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Chromobacterium violaceum.................... 127  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Chro...   
. . Achromobacter piechaudii HLE................. 127  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Neisseria flavescens NRL30031/H210........... 127  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Achromobacter xylosoxidans AXX-A............. 127  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Achr...   
. . Oligella ureolytica.......................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oligella ureolytica]     
. . Acidovorax oryzae............................ 127  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Acidovorax sp. MR-S7......................... 127  5e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Acidovorax sp. MR-S7]    
. . Neisseria mucosa............................. 127  7e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Advenella mimigardefordensis DPN7............ 127  7e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Advenella...   
. . Bordetella holmesii.......................... 127  8e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Collimonas fungivorans....................... 127  8e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coll...   
. . Herminiimonas sp. CN......................... 127  9e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herm...   
. . Alcaligenaceae bacterium DSM 24701........... 126  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein IX83_02715 [Alcaligenacea...   
. . Acidovorax sp. JHL-9......................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Neisseria meningitidis 053442................ 126  1e-29  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Herbaspirillum sp. GW103..................... 126  1e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herb...   
. . Parasutterella excrementihominis............. 126  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Para...   
. . Sutterella wadsworthensis HGA0223............ 126  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Sutterella wadswort...   
. . Pelistega sp. HM-7........................... 126  1e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Peli...   
. . Simonsiella muelleri......................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Simo...   
. . Pseudogulbenkiania ferrooxidans EGD-HP2...... 125  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. . Methyloversatilis sp. NVD.................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: hypothetical protein [Methyloversatilis s...   
. . Acidovorax avenae............................ 125  2e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Massilia consociata.......................... 125  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Massilia ...   
. . Neisseria subflava........................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Herbaspirillum massiliense................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Herbaspirillum mass...   
. . Burkholderia ferrariae....................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Leptothrix ochracea.......................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Lept...   
. . Oxalobacter formigenes....................... 125  4e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Oxal...   
. . Leptothrix cholodnii......................... 124  4e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Lept...   
. . Burkholderia sp. JV3......................... 124  5e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Sten...   
. . Taylorella equigenitalis..................... 124  5e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Tayl...   
. . Oligella urethralis.......................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oligella urethralis]     
. . Verminephrobacter eiseniae................... 124  6e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Verm...   
. . Rhodoferax saidenbachensis................... 124  7e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Kingella denitrificans....................... 124  8e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [King...   
. . Chitiniphilus shinanonensis.................. 124  8e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. . Neisseria meningitidis alpha710.............. 124  9e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Eikenella corrodens.......................... 124  1e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Eikenella corrodens]     
. . Ralstonia solanacearum....................... 124  1e-28  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Neisseria meningitidis 8013.................. 123  1e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Thiomonas sp. FB-Cd.......................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Ralstonia solanacearum GMI1000............... 123  1e-28  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Kingella kingae ATCC 23330................... 123  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [King...   
. . Comamonas sp. B-9............................ 123  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Neisseria lactamica.......................... 123  1e-28  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Oxalobacter formigenes OXCC13................ 123  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Oxal...   
. . Neisseria polysaccharea...................... 123  2e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis NZ-05/33.............. 123  2e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Massilia niastensis.......................... 123  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Massilia niastensis]     
. . Ralstonia solanacearum FQY_4................. 123  2e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Rals...   
. . Neisseria meningitidis M01-240013............ 122  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis 2004032............... 122  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis NM2657................ 122  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Ralstonia solanacearum CMR15................. 122  3e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Castellaniella defragrans 65Phen............. 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Castella...   
. . Hylemonella gracilis str. Niagara R.......... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Hylemonel...   
. . Neisseria meningitidis NM220................. 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Bordetella bronchiseptica 99-R-0433.......... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Neisseria meningitidis 2001001............... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Ralstonia solanacearum K60................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Bordetella hinzii 8-296-03................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Massilia alkalitolerans...................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Mass...   
. . Neisseria lactamica 020-06................... 122  3e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria lactamica Y92-1009................. 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Delftia acidovorans.......................... 122  4e-28  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein DR66_5562 [Delftia acidov...   
. . Neisseria meningitidis 80179................. 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis 81858................. 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis G2136................. 122  4e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . beta proteobacterium L13..................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: anhydro-N-acetylmuramic acid kinase [beta...   
. . Neisseria meningitidis 961-5945.............. 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neisseria...   
. . Kingella kingae PYKK081...................... 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [King...   
. . Neisseria meningitidis N1568................. 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis 2003051............... 122  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Ralstonia solanacearum UW551................. 122  5e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Ralstonia solanacearum CFBP2957.............. 122  5e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Neisseria meningitidis alpha522.............. 121  5e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis 77221................. 121  5e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis 63049................. 121  5e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Methylophilus sp. OH31....................... 121  5e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: hypothetical protein [Methylophilus sp. O...   
. . Methylophilus................................ 121  6e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Ideonella sp. B508-1......................... 121  6e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Ideo...   
. . Neisseria meningitidis WUE 2594.............. 121  6e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis NM3081................ 121  6e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis NM255................. 121  6e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis M01-240149............ 121  6e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis M01-240355............ 121  6e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis M04-240196............ 121  6e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Advenella kashmirensis WT001................. 121  7e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Adve...   
. . Laribacter hongkongensis..................... 121  7e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Lari...   
. . Neisseria meningitidis 63041................. 121  7e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis Z2491................. 121  8e-28  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Azohydromonas australica..................... 121  9e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Azoh...   
. . Comamonas testosteroni....................... 121  9e-28  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Laribacter hongkongensis HLHK9............... 120  9e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Lari...   
. . Comamonadaceae bacterium URHA0028............ 120  9e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Neisseria sicca.............................. 120  1e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Delftia acidovorans SPH-1.................... 120  1e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Delf...   
. . Ralstonia syzygii R24........................ 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Ralstoni...   
. . Neisseria meningitidis NM518................. 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis OX99.30304............ 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria polysaccharea ATCC 43768........... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Acidovorax sp. JHL-3......................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Burkholderia sp. URHA0054.................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Delftia sp. RIT313........................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Delftia s...   
. . Polaromonas naphthalenivorans CJ2............ 120  1e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Polaromo...   
. . Neisseria meningitidis 98008................. 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Burkholderia glathei......................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Bordetella sp. FB-8.......................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Betaproteobacteria........................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Neisseria sp. oral taxon 014................. 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Neisseria meningitidis MC58.................. 120  2e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Ralstonia pickettii.......................... 120  2e-27  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: molecular chaperone [Ralstonia pickettii]      
. . Neisseria meningitidis H44/76................ 120  2e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Ralstonia solanacearum PSI07................. 120  2e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Neisseria wadsworthii........................ 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Thiomonas sp. CB2............................ 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Thiomona...   
. . Ralstonia sp. UNC404CL21Col.................. 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Comamonas testosteroni S44................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Burkholderia sp. H160........................ 120  2e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Thiomonas intermedia......................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Thio...   
. . Oxalobacteraceae bacterium JGI 0001004-K23... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oxalobacteraceae ba...   
. . Eikenella corrodens ATCC 23834............... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Eike...   
. . Burkholderia caledonica...................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Variovorax sp. JGI 0001016-M12............... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Vari...   
. . Bordetella bronchiseptica.................... 119  3e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetel...   
. . Bordetella................................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Ralstonia solanacearum Po82.................. 119  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Burkholderia sp. JPY366...................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Bordetella parapertussis..................... 119  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Bordetella parapert...   
. . Neisseria lactamica ATCC 23970............... 119  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein DR91_816 [Neisseria lacta...   
. . Thiomonas arsenitoxydans..................... 119  4e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase (AnhM...   
. . Neisseria gonorrhoeae........................ 119  4e-27  9 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Bordetella pertussis......................... 119  4e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Delftia sp. Cs1-4............................ 119  4e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Delf...   
. . Neisseria gonorrhoeae FA 1090................ 119  4e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Neisseria gonorrhoeae NCCP11945.............. 119  4e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Bordetella pertussis Tohama I................ 119  4e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Neisseria gonorrhoeae SK-93-1035............. 119  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neisseria...   
. . Neisseria meningitidis NM3139................ 119  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Neisseria meningitidis 2002007............... 119  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Neisseria meningiti...   
. . Burkholderia sp. Ch1-1....................... 119  4e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Simplicispira psychrophila................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Simp...   
. . Neisseria gonorrhoeae 35/02.................. 119  5e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neisseria...   
. . Delftia acidovorans CCUG 15835............... 119  5e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Delf...   
. . Comamonas testosteroni CNB-2................. 119  5e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Burkholderia sp. JPY251...................... 119  6e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia phenoliruptrix.................. 119  6e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria sicca ATCC 29256................... 118  6e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Burkholderiales bacterium JOSHI_001.......... 118  6e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Limnohabitans sp. Rim28...................... 118  6e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Limnohabitans sp. R...   
. . Bordetella bronchiseptica MO149.............. 118  6e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Bordetella bronchis...   
. . Burkholderia sp. CCGE1002.................... 118  7e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria gonorrhoeae 1291................... 118  7e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neisseria...   
. . Bordetella bronchiseptica OSU-O54............ 118  7e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Delftia acidovorans CCUG 274B................ 118  7e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Delf...   
. . Neisseria meningitidis ATCC 13091............ 118  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neisseria...   
. . Burkholderia sp. WSM4176..................... 118  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Bordetella pertussis CHOC0017................ 118  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Bordetella bronchiseptica MBORD731........... 117  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Burkholderia sp. WSM3617..................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sp. CCGE1001.................... 117  1e-26  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia dilworthii...................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Bordetella petrii DSM 12804.................. 117  1e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Burkholderia bryophila....................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . beta proteobacterium SCGC AAA027-I06......... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: anhydro-N-acetylmuramic acid kinase [beta...   
. . Burkholderia vietnamiensis AU4i.............. 117  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Burk...   
. . Polaromonas sp. Cr4-12....................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pola...   
. . Burkholderia sp. lig30....................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Comamonas aquatica DA1877.................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Comamonas...   
. . Neisseria meningitidis alpha14............... 117  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Burkholderia sp. MSh2........................ 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Caldimonas manganoxidans..................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Caldimonas manganox...   
. . Burkholderia sp. WSM2230..................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Taylorella asinigenitalis.................... 116  3e-26  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Tayl...   
. . Neisseria meningitidis M0579................. 116  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Massilia sp. LC238........................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Massilia ...   
. . Burkholderia andropogonis.................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sp. WSM2232..................... 116  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria elongata........................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Methylotenera mobilis........................ 116  4e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Burkholderia acidipaludis.................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia bannensis....................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria mucosa ATCC 25996.................. 116  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Curvibacter lanceolatus...................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Curvibacter lanceol...   
. . Burkholderia sp. MSh1........................ 116  5e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Comamonas testosteroni KF-1.................. 116  5e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Burkholderia phytofirmans.................... 115  5e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sp. CCGE1003.................... 115  5e-26  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Bordetella hinzii............................ 115  6e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Bordetella hinzii CA90 BAL1384............... 115  7e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Ralstonia solanacearum IPO1609............... 115  8e-26  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: protein of unknown function upf0075 [Rals...   
. . Burkholderia lata............................ 115  8e-26  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Candidatus Symbiobacter mobilis.............. 115  8e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Bordetella hinzii 4161....................... 115  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bordetell...   
. . Burkholderia sp. MP-1........................ 115  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Curvibacter gracilis......................... 115  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Curv...   
. . Janthinobacterium sp. CG3.................... 115  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Janthinobacterium s...   
. . Neisseria shayeganii......................... 115  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Taylorella asinigenitalis MCE3............... 115  1e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Tayl...   
. . Polaromonas sp. JS666........................ 115  1e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pola...   
. . Burkholderia fungorum........................ 115  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Rubrivivax benzoatilyticus................... 114  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rubr...   
. . Sutterella parvirubra........................ 114  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Sutt...   
. . Burkholderia cepacia......................... 114  1e-25  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Pusillimonas sp. T7-7........................ 114  1e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pusi...   
. . Burkholderia sp. K24......................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sordidicola..................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Herbaspirillum frisingense................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herb...   
. . Burkholderia cenocepacia..................... 114  2e-25  9 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia ambifaria....................... 114  2e-25  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia ambifaria MEX-5................. 114  2e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Ralstonia pickettii 12D...................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Burkholderia oxyphila........................ 114  2e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia mimosarum....................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia cenocepacia MC0-3............... 114  2e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia ambifaria AMMD.................. 113  3e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria sp. oral taxon 020................. 113  4e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Glomeribacter sp. 1016415.................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Glom...   
. . Burkholderia cenocepacia AU 1054............. 113  4e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia multivorans..................... 113  5e-25  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia multivorans CF2................. 113  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia nodosa.......................... 113  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Neisseria bacilliformis...................... 113  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: anhydro-N-acetylmuramic acid kinase [Neis...   
. . Burkholderia multivorans CGD1................ 113  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia cepacia GG4..................... 113  6e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sp. RPE67....................... 113  6e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkhold...   
. . Burkholderia xenovorans...................... 112  6e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Herbaspirillum............................... 112  7e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Burkholderia sp. YI23........................ 112  7e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia sp. RPE64....................... 112  8e-25  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Nitrosomonas europaea........................ 112  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Cupriavidus taiwanensis...................... 112  1e-24  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Burkholderia cenocepacia PC184............... 112  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Thiomonas sp. FB-6........................... 111  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Thiomonas sp. FB-6]      
. . Burkholderia multivorans CGD2................ 111  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia ambifaria MC40-6................ 111  1e-24  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia dolosa.......................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia pyrrocinia...................... 111  2e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Polynucleobacter necessarius................. 111  2e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Poly...   
. . Limnohabitans sp. Rim47...................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Limn...   
. . Burkholderia................................. 111  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Burkholderia multivorans ATCC BAA-247........ 111  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Cupriavidus necator HPC(L)................... 110  3e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Burkholderia multivorans ATCC 17616.......... 110  4e-24  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Methylibium petroleiphilum................... 110  4e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Burkholderia ubonensis....................... 110  5e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Ralstonia sp. PBA............................ 110  5e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Polaromonas sp. EUR3 1.2.1................... 109  6e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pola...   
. . Comamonadaceae bacterium B1.................. 109  7e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: predicted molecular chaperone distantly relat...   
. . Cupriavidus basilensis....................... 109  8e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Burkholderia caribensis MBA4................. 109  9e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Burkholderia sp. TJI49....................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Burkholderia sp. OP-1........................ 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Burkholderia sp. JPY347...................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Hylemonella gracilis......................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Hyle...   
. . Burkholderia terrae.......................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Rubrivivax gelatinosus....................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rubr...   
. . Nitrosomonas eutropha........................ 108  2e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Burkholderia phymatum........................ 107  3e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Cupriavidus pinatubonensis................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Burkholderia sp. UYPR1.413................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Herbaspirillum sp. CF444..................... 107  4e-23  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Herb...   
. . Burkholderia sp. BT03........................ 107  6e-23  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Polynucleobacter necessarius subsp. asymbioticu 106  7e-23  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Poly...   
. . Bordetella pertussis CHOC0018................ 106  9e-23  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Bord...   
. . Derxia gummosa............................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Derxia gummosa]          
. . Pandoraea.................................... 105  1e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Pandoraea sp. B-6............................ 105  1e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pand...   
. . Brachymonas chironomi........................ 105  2e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Brac...   
. . Pandoraea sp. RB-44.......................... 105  2e-22  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Burkholderia kururiensis..................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia thailandensis................... 105  2e-22  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Pandoraea pnomenusa.......................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pandoraea...   
. . Burkholderia thailandensis MSMB43............ 104  3e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia cenocepacia J2315............... 104  4e-22  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia thailandensis MSMB121........... 104  5e-22  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Comamonadaceae bacterium H1.................. 103  6e-22  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Coma...   
. . Ralstonia pickettii DTP0602.................. 103  6e-22  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Burkholderia thailandensis E264.............. 103  7e-22  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Burkholderia oklahomensis.................... 103  1e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Cupriavidus taiwanensis LMG 19424............ 103  1e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Burkholderia cenocepacia H111................ 103  1e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Cupriavidus sp. BIS7......................... 102  1e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Limnobacter sp. MED105....................... 102  1e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Limn...   
. . Cupriavidus necator.......................... 102  2e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Ralstonia sp. GA3-3.......................... 102  2e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . Cupriavidus sp. SK-4......................... 102  3e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupriavid...   
. . Pandoraea sp. SD6-2.......................... 102  3e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Pand...   
. . Burkholderia thailandensis H0587............. 101  4e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde...   
. . Comamonadaceae bacterium A1.................. 101  4e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: predicted molecular chaperone distantly relat...   
. . Cupriavidus sp. amp6......................... 101  4e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Cupriavidus sp. UYPR2.512.................... 101  5e-21  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Cupriavidus metallidurans.................... 100  6e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Ralstonia sp. AU12-08........................ 100  9e-21  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Rals...   
. . beta proteobacterium CB...................... 100  1e-20  3 hits  Bacteria:Proteobacteria:Betaproteobacteria: Anhydro-N-acetylmuramic acid kinase [beta...   
. . Burkholderia sp. SJ98........................ 100  1e-20  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk...   
. . Cupriavidus necator N-1...................... 100  1e-20  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr...   
. . Brackiella oedipodis......................... 100  1e-20  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Brac...   
. . Albidiferax ferrireducens.................... 97.8 7e-20  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Albi... 
. . Betaproteobacteria bacterium MOLA814......... 97.1 2e-19  2 hits  Bacteria:Proteobacteria:Betaproteobacteria: Anhydro-N-acetylmuramic acid kinase [Beta... 
. . Burkholderia pseudomallei.................... 95.9 2e-19  40 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Acidovorax sp. NO-1.......................... 94.4 5e-19  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Acid... 
. . Cupriavidus sp. HMR-1........................ 94.4 1e-18  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr... 
. . Burkholderia pseudomallei 668................ 94.0 2e-18  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Cupriavidus sp. WS........................... 94.0 2e-18  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Cupr... 
. . Burkholderia pseudomallei MSHR346............ 94.0 2e-18  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 406e............... 93.6 3e-18  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 1710b.............. 92.8 4e-18  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei K96243............. 92.8 4e-18  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 1655............... 92.8 5e-18  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 1106a.............. 92.8 5e-18  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei BPC006............. 92.8 6e-18  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia mallei.......................... 92.0 8e-18  10 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei NAU20B-16.......... 92.0 9e-18  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burkholde... 
. . Burkholderia pseudomallei Pakistan 9......... 92.0 1e-17  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia mallei NCTC 10229............... 91.7 1e-17  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia gladioli........................ 90.1 4e-17  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 576................ 90.1 5e-17  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia sp. A1.......................... 89.7 5e-17  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia pseudomallei 1026b.............. 89.4 8e-17  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Burkholderia glumae.......................... 86.7 6e-16  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: anhydro-N-acetylmuramic acid kinase [Burk... 
. . Curvibacter putative symbiont of Hydra magnipap 75.1 6e-13  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein Csp_D28670 [Curvibacter ... 
. . Burkholderia rhizoxinica..................... 71.2 2e-11  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Burkholderia rhizox... 
. . Neisseria meningitidis alpha153.............. 44.3 0.029  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: conserved hypothetical protein [Neisseria men... 
. . Neisseria meningitidis alpha275.............. 42.7 0.12   1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: conserved hypothetical protein [Neisseria men... 
. . Candidatus Paracaedibacter acanthamoebae..... 148  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: hypothetical protein ID47_01655 [endosymbiont ...   
. . endosymbiont of Acanthamoeba sp. UWC8........ 123  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [endosymbi...   
. . alpha proteobacterium HIMB59................. 118  8e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: hypothetical protein [alpha proteobacteri...   
. . Candidatus Midichloria mitochondrii.......... 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Candidatus Odyssella thessalonicensis........ 115  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . alpha proteobacterium HIMB5.................. 113  5e-25  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [alph...   
. . Candidatus Pelagibacter ubique............... 112  9e-25  9 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Candidatus Pelagibacter ubique HTCC1062...... 111  2e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Candidatus Pelagibacter ubique HTCC1002...... 110  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Candidatus Pelagibacter ubique HIMB083....... 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: molecular chaperone [Candidatus Pelagibac...   
. . Candidatus Pelagibacter sp. HTCC7211......... 101  4e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand...   
. . Candidatus Xenolissoclinum pacificiensis L6.. 101  4e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: hypothetical protein P857_347 [Candidatus Xeno...   
. . Candidatus Pelagibacter sp. IMCC9063......... 94.0 2e-18  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: anhydro-N-acetylmuramic acid kinase [Cand... 
. . Rickettsiales bacterium Ac37b................ 90.9 2e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: Anhydro-N-acetylmuramic acid kinase [Rickettsi... 
. . alpha proteobacterium HIMB114................ 82.4 1e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: molecular chaperone [alpha proteobacteriu... 
. . Magnetospira sp. QH-2........................ 144  4e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Magnetos...   
. . alpha proteobacterium Q-1.................... 137  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alpha pr...   
. . Zymomonas mobilis............................ 134  1e-32  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Zymo...   
. . Inquilinus limosus........................... 134  1e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Inqu...   
. . alpha proteobacterium JLT2015................ 133  4e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Anhydro-N-acetylmuramic acid kinase [alph...   
. . Fulvimarina pelagi........................... 133  6e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Fulv...   
. . alpha proteobacterium IMCC14465.............. 132  8e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Acetobacter pomorum.......................... 132  1e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Acetobacter tropicalis....................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Rhodospirillum centenum...................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Hyphomicrobium denitrificans................. 130  4e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Hyph...   
. . Microvirga aerilata.......................... 130  5e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Microvirg...   
. . alpha proteobacterium RS24................... 130  8e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: 30S ribosomal protein S6 [alpha proteobac...   
. . Kozakia baliensis............................ 129  9e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Koza...   
. . Bradyrhizobium sp. BTAi1..................... 129  1e-30  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Bosea sp. LC85............................... 128  2e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Bosea sp....   
. . Hyphomicrobium denitrificans 1NES1........... 128  3e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Hyph...   
. . Methylobacterium sp. MB200................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Nisaea denitrificans......................... 127  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Nisa...   
. . Terasakiella pusilla......................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Tera...   
. . Methylobacterium sp. 88A..................... 127  5e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Aurantimonas manganoxydans................... 127  7e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Aura...   
. . Rhodospirillum rubrum........................ 127  8e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylobacterium sp. 10...................... 127  9e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rhodospirillum photometricum................. 127  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylobacterium sp. 77...................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Aurantimonas coralicida...................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Aura...   
. . alpha proteobacterium SCGC AAA076-C03........ 125  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Rhodobacterales bacterium HTCC2255........... 125  2e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Ruegeria conchae............................. 125  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rueg...   
. . Geminicoccus roseus.......................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [Geminicoccus roseus]     
. . Rhodopseudomonas palustris................... 125  3e-29  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylobacterium extorquens.................. 125  3e-29  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylopila sp. 73B.......................... 125  3e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Methylopila sp. 73B]     
. . Rhodopseudomonas palustris BisA53............ 125  4e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Rhodopseudomonas palustris CGA009............ 124  5e-29  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Bradyrhizobium sp. DOA9...................... 124  5e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Acetobacter aceti 1023....................... 124  7e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acetobact...   
. . Roseobacter sp. MED193....................... 124  7e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Roseobacter sp. AzwK-3b...................... 124  7e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Methylobacterium extorquens DM4.............. 124  7e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rhodopseudomonas palustris DX-1.............. 124  8e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Zymomonas mobilis subsp. mobilis CP4......... 124  9e-29  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: molecular chaperone [Zymomonas mobilis]        
. . Acetobacter pasteurianus..................... 123  1e-28  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Rhodospirillales bacterium URHD0088.......... 123  2e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylobacterium sp. GXF4.................... 123  2e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Microvirga lotononidis....................... 122  2e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Micr...   
. . Methylobacterium nodulans.................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylobacterium populi...................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rhodopseudomonas palustris BisB5............. 122  3e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Dinoroseobacter shibae....................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Dino...   
. . Aliihoeflea sp. 2WW.......................... 122  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Alii...   
. . Methylobacterium extorquens PA1.............. 122  4e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Zymomonas mobilis subsp. mobilis NCIMB 11163. 122  4e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Zymo...   
. . Acetobacter pasteurianus 386B................ 122  5e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Gluconobacter thailandicus................... 121  5e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Gluconacetobacter rhaeticus AF1.............. 121  6e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluconace...   
. . Bradyrhizobium elkanii....................... 121  6e-28  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Acidocella sp. MX-AZ02....................... 121  7e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Azorhizobium caulinodans..................... 121  7e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Azor...   
. . Gluconobacter oxydans........................ 121  7e-28  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Afipia felis................................. 121  7e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia felis]            
. . Lutibaculum baratangense..................... 121  8e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Luti...   
. . Bradyrhizobium sp. URHA0002.................. 120  9e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Nitratireductor basaltis..................... 120  9e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Nitratire...   
. . Methylobacterium extorquens AM1.............. 120  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Gluconobacter oxydans H24.................... 120  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: AnmK [Gluconobacter oxydans]                   
. . Oligotropha carboxidovorans.................. 120  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Olig...   
. . Gluconacetobacter sp. SXCC-1................. 120  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Leisingera aquimarina........................ 120  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Leis...   
. . Sphingomonas sp. S17......................... 120  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Rhodopseudomonas palustris BisB18............ 120  1e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Acidocella facilis........................... 120  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Zymomonas mobilis subsp. mobilis ATCC 29191.. 120  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Zymo...   
. . Methylopila sp. M107......................... 120  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Bradyrhizobium sp. ORS 375................... 120  2e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Azospirillum irakense........................ 120  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Azos...   
. . Rhizobium leguminosarum...................... 120  2e-27  19 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Phaeobacter caeruleus........................ 120  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Azospirillum brasilense...................... 119  3e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Azos...   
. . Asaia astilbes............................... 119  3e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Asai...   
. . Micavibrio aeruginosavorus................... 119  3e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Anhydro-N-acetylmuramic acid kinase [Mica...   
. . Leisingera methylohalidivorans............... 119  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Leis...   
. . Xanthobacteraceae............................ 119  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: hypothetical protein [Xanth...   
. . Rhizobium etli bv. mimosae str. IE4771....... 119  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobium...   
. . Afipia clevelandensis........................ 119  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia clevelandensis]   
. . Afifella pfennigii........................... 119  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afifella pfennigii]      
. . Bradyrhizobium sp. ORS 285................... 119  5e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Afipia broomeae.............................. 118  6e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia broomeae]         
. . Bradyrhizobium sp. ORS 278................... 118  6e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Gluconacetobacter europaeus.................. 118  7e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Bradyrhizobium japonicum..................... 118  8e-27  9 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Pleomorphomonas koreensis.................... 118  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Pleo...   
. . Methylobacterium sp. 285MFTsu5.1............. 118  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rhodovulum sp. PH10.......................... 118  9e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Sphingomonas wittichii....................... 118  9e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Asaia platycodi SF2.1........................ 118  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Asaia pl...   
. . Bradyrhizobium sp. Tv2a-2.................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Acetobacter aceti............................ 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Magnetospirillum magneticum.................. 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Magn...   
. . Gluconobacter frateurii...................... 117  1e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Rhizobium leguminosarum bv. viciae 3841...... 117  1e-26  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Skermanella stibiiresistens SB22............. 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Skermanel...   
. . Bradyrhizobium............................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Rhodovibrio salinarum........................ 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylocella silvestris...................... 117  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Bradyrhizobium sp. YR681..................... 117  1e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Methylobacterium mesophilicum................ 117  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Gluconobacter frateurii NBRC 103465.......... 117  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-n-acetylmuramic acid kinase [Gluc...   
. . Leisingera daeponensis....................... 117  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Methylobacterium radiotolerans............... 117  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Methylobacterium............................. 117  2e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Hyphomicrobium nitrativorans................. 117  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Hyph...   
. . alpha proteobacterium BAL199................. 117  2e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Sphingobium chlorophenolicum................. 117  3e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Rhizobium leguminosarum bv. trifolii WSM1689. 116  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobium...   
. . Bradyrhizobium sp. WSM471.................... 116  3e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Afipia sp. 1NLS2............................. 116  3e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Afip...   
. . Rhizobium etli............................... 116  3e-26  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Oceanibaculum indicum........................ 116  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Micavibrio aeruginosavorus ARL-13............ 116  4e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [Mica...   
. . Bradyrhizobium sp. WSM1253................... 116  4e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Rhodopseudomonas palustris HaA2.............. 116  4e-26  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Magnetospirillum sp. SO-1.................... 116  4e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Magn...   
. . Bradyrhizobium sp. WSM3983................... 116  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Bradyrhizobium sp. WSM4349................... 115  5e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Magnetospirillum gryphiswaldense............. 115  6e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Magn...   
. . Magnetospirillum gryphiswaldense MSR-1....... 115  6e-26  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: putative chaperone [Magnetospirillum gryphiswa...   
. . Bradyrhizobiaceae bacterium SG-6C............ 115  6e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Sphingomonas sp. FUKUSWIS1................... 115  7e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . SAR 116 cluster alpha proteobacterium HIMB100 115  7e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: molecular chaperone [SAR116 cluster alpha...   
. . Azospirillum lipoferum....................... 115  7e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Azos...   
. . Sphingomonas sp. DC-6........................ 115  7e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Sphingomonas sp. STIS6.2..................... 115  7e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Roseomonas................................... 115  7e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Afipia....................................... 115  7e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Sulfitobacter sp. 20_GPM-1509m............... 115  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Aminobacter sp. J41.......................... 115  9e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Amin...   
. . Ruegeria sp. TM1040.......................... 115  9e-26  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rueg...   
. . Shinella zoogloeoides DD12................... 115  1e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase AnmK ...   
. . Rhizobium leguminosarum bv. trifolii WSM2304. 115  1e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhizobium sp. CCGE 510....................... 115  1e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Parvibaculum lavamentivorans................. 115  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Parv...   
. . Phyllobacterium sp. UNC302MFCol5.2........... 115  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Phyl...   
. . Roseobacter litoralis........................ 115  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Rhodomicrobium sp. JA643..................... 114  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhodomicr...   
. . Oceanicola nanhaiensis....................... 114  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Phaeobacter arcticus......................... 114  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Gluconacetobacter xylinus E25................ 114  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: hypothetical protein H845_1409 [Gluconacetobac...   
. . Rhodobacteraceae bacterium HIMB11............ 114  1e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: molecular chaperone [Rhodobacteraceae bac...   
. . Sulfitobacter guttiformis.................... 114  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Rhizobium etli CIAT 652...................... 114  1e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Bradyrhizobium sp. WSM1417................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Phaeospirillum fulvum........................ 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Ensifer sp. BR816............................ 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ensi...   
. . Agromonas oligotrophica...................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Bradyrhizobium olig...   
. . Phaeobacter gallaeciensis.................... 114  2e-25  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Rhizobium leguminosarum bv. trifolii CB782... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobium...   
. . Rhodobacterales bacterium Y4I................ 114  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Rhizobium etli CFN 42........................ 114  2e-25  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Ruegeria lacuscaerulensis.................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rueg...   
. . Rhizobium sp. Pop5........................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Sulfitobacter donghicola..................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Rhizobium phaseoli........................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . alpha proteobacterium SCGC AAA027-L15........ 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Bradyrhizobium diazoefficiens................ 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Xanthobacter autotrophicus................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Kordiimonas gwangyangensis................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Kordiimonadales: anhydro-N-acetylmuramic acid kinase [Kord...   
. . Afipia sp. Bat1.............................. 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Afipia sp...   
. . Bradyrhizobium diazoefficiens SEMIA 5080..... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Silicibacter sp. TrichCH4B................... 114  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sili...   
. . Gluconacetobacter hansenii................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Phaeobacter gallaeciensis DSM 26640.......... 114  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: putative molecular chaperone distantly [P...   
. . Pleomorphomonas oryzae....................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Pleo...   
. . Rhizobium.................................... 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Gluconacetobacter oboediens.................. 114  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Sulfitobacter sp. H3......................... 114  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulfitoba...   
. . Phaeobacter gallaeciensis DSM 17395.......... 114  3e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . Sphingomonas sp. KC8......................... 113  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Acetobacter nitrogenifigens.................. 113  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Phaeobacter inhibens......................... 113  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Phae...   
. . alpha proteobacterium SCGC AB-629-G21........ 113  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Gluconobacter oxydans DSM 3504............... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: UPF0075 family protein [Gluconobacter oxydans ...   
. . Rhizobium sp. MGL06.......................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rubellimicrobium sp. MSL 20.................. 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Anhydro-N-acetylmuramic acid kinase [Rubellimi...   
. . Fodinicurvata sediminis...................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Fodi...   
. . Rhizobium leguminosarum bv. trifolii WSM1325. 113  4e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Leisingera nanhaiensis....................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Leis...   
. . Bradyrhizobium sp. ARR65..................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Roseovarius sp. 217.......................... 113  4e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Caenispirillum salinarum..................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Caen...   
. . Beijerinckia indica.......................... 113  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Beij...   
. . Bradyrhizobium sp. Ec3.3..................... 113  5e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Rhizobium sp. R1-200B2....................... 113  5e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobium...   
. . Beijerinckiaceae bacterium SOP9.............. 113  5e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Methyloferula stell...   
. . Bradyrhizobium japonicum USDA 6.............. 112  6e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Oceaniovalibus guishaninsula................. 112  6e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . alpha proteobacterium SCGC AAA023-L09........ 112  7e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Sulfitobacter sp. MM-124..................... 112  7e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Bradyrhizobium sp. JGI 0001002-A22........... 112  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Sulfitobacter sp. NAS-14.1................... 112  8e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Acetobacter malorum.......................... 112  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Acetobact...   
. . Rhizobium etli CNPAF512...................... 112  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase protein [R...   
. . Rhizobium leguminosarum bv. viciae WSM1455... 112  9e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Bradyrhizobium japonicum WSM2793............. 112  9e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Sulfitobacter pontiacus 3SOLIMAR09........... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulfitoba...   
. . alpha proteobacterium SCGC AAA028-D10........ 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Acetobacter pasteurianus NBRC 101655......... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: hypothetical protein [Acetobacter pasteur...   
. . Asaia prunellae.............................. 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Asai...   
. . Rhizobium leguminosarum bv. phaseoli CCGM1... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobium...   
. . Acidomonas methanolica NBRC 104435........... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acidomon...   
. . Acetobacter papayae.......................... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Methylosinus sp. LW3......................... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Ahrensia sp. R2A130.......................... 112  1e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ahre...   
. . Sinorhizobium americanum CCGM7............... 112  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sinorhizo...   
. . Roseomonas cervicalis........................ 111  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Methylocapsa acidiphila...................... 111  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Rhodobacteraceae bacterium KLH11............. 111  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Asaia platycodi.............................. 111  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Asai...   
. . Bradyrhizobium sp. Cp5.3..................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Hyphomicrobium............................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Bradyrhizobium sp. STM 3843.................. 111  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Sulfitobacter sp. EE-36...................... 111  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Roseobacter denitrificans.................... 111  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Rhizobium sp. 2MFCol3.1...................... 110  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Zymomonas mobilis subsp. mobilis ZM4......... 110  2e-24  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: unknown [Zymomonas mobilis subsp. mo...   
. . Acetobacter pasteurianus subsp. pasteurianus LM 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Methylocystis parvus......................... 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Bradyrhizobium japonicum SEMIA 5079.......... 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bradyrhiz...   
. . Hoeflea phototrophica........................ 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Hoef...   
. . Sinorhizobium meliloti....................... 110  3e-24  6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Roseobacter sp. SK209-2-6.................... 110  3e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Sulfitobacter sp. NB-77...................... 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Sulfitobacter sp. CB2047..................... 110  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulfitoba...   
. . Fodinicurvata fenggangensis.................. 110  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Fodi...   
. . Bradyrhizobium sp. OHSU_III.................. 110  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Oceanicola batsensis......................... 110  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Novospirillum itersonii...................... 110  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Novi...   
. . Bradyrhizobium sp. S23321.................... 110  5e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Hyphomicrobium zavarzinii.................... 110  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Hyphomicrobium zava...   
. . Kaistia granuli.............................. 110  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Kais...   
. . alpha proteobacterium Mf 1.05b.01............ 110  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Bradyrhizobium sp. WSM2254................... 110  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Nitrobacter hamburgensis..................... 110  6e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Oceanicola granulosus........................ 109  6e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Oceanicaulis alexandrii...................... 109  6e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Sulfitobacter mediterraneus.................. 109  6e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulfitoba...   
. . Ruegeria pomeroyi............................ 109  8e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rueg...   
. . Dongia sp. URHE0060.......................... 109  8e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Dong...   
. . alpha proteobacterium MA2.................... 109  8e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alpha pr...   
. . Ruegeria sp. R11............................. 109  1e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rueg...   
. . Azospirillum sp. B510........................ 109  1e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Azos...   
. . Tistrella mobilis............................ 109  7e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Tist...   
. . Rhizobium leguminosarum bv. trifolii WSM2012. 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhodobacter sphaeroides...................... 108  1e-23  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Labrenzia alexandrii......................... 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Labr...   
. . Rhizobium sp. 42MFCr.1....................... 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhodomicrobium vannielii..................... 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Rhodomicrobium vann...   
. . alpha proteobacterium JGI 0001002-I18........ 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Rhizobium mongolense......................... 108  1e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhizobium sp. CF142.......................... 108  2e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Gluconacetobacter diazotrophicus............. 108  2e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Methylobacterium sp. 4-46.................... 108  2e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Agrobacterium larrymoorei.................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Xanthobacter sp. 126......................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Xant...   
. . Gluconobacter oxydans 621H................... 108  2e-23  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Amorphus coralli............................. 108  2e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Amorphus coralli]        
. . Rhizobium sullae............................. 108  2e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Donghicola xiamenensis....................... 108  2e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Dong...   
. . Polymorphum gilvum........................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [Poly...   
. . Sphingobium indicum.......................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Rhizobium sp. IBUN........................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhodobacter sphaeroides KD131................ 107  3e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Octadecabacter arcticus...................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Octa...   
. . Oceanicola sp. HL-35......................... 107  3e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Bradyrhizobium sp. th.b2..................... 107  4e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Robiginitomaculum antarcticum................ 107  4e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Robiginitomaculum a...   
. . Azorhizobium doebereinerae................... 107  4e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Azor...   
. . Citreicella sp. SE45......................... 107  4e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Gluconacetobacter diazotrophicus PAl 5....... 107  4e-23  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Acidiphilium multivorum...................... 107  4e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Rhizobium grahamii........................... 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Chelativorans sp. J32........................ 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Chel...   
. . Rhizobium sp. JGI 001013-F22................. 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Salipiger mucosus............................ 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sali...   
. . Loktanella cinnabarina....................... 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Lokt...   
. . Sagittula stellata........................... 107  5e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sagi...   
. . Bradyrhizobium sp. DFCI-1.................... 107  5e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Thalassospira profundimaris.................. 107  6e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Thal...   
. . Roseomonas gilardii.......................... 107  6e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rose...   
. . Agrobacterium albertimagni................... 107  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Bradyrhizobium sp. URHD0069.................. 106  7e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad...   
. . Ochrobactrum sp. EGD-AQ16.................... 106  7e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr...   
. . alpha proteobacterium SCGC AAA536-K22........ 106  7e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Ensifer adhaerens............................ 106  7e-23  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ensifer a...   
. . Labrenzia.................................... 106  8e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Sphingomonas-like bacterium B12.............. 106  8e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Candidatus Planktomarina temperata RCA23..... 106  9e-23  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase AnmK [Cand...   
. . Thalassobacter arenae........................ 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Anhydro-N-acetylmuramic acid kinase [Thal...   
. . Sphingobium japonicum........................ 106  1e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Acidiphilium cryptum......................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Sphingomonas phyllosphaerae.................. 106  1e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Mesorhizobium sp. L2C084A000................. 106  1e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Rhizobium leguminosarum bv. trifolii WSM2297. 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Ensifer sp. TW10............................. 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ensi...   
. . Oceanibulbus indolifex....................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Roseivivax sp. 22II-s10s..................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Roseiviva...   
. . Methylosinus trichosporium................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Sinorhizobium fredii......................... 106  1e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Granulibacter bethesdensis................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gran...   
. . Octadecabacter antarcticus................... 106  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase AnmK ...   
. . Citreicella sp. 357.......................... 105  1e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Citr...   
. . Methylosinus sp. LW4......................... 105  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Methylosinus sp. LW4]    
. . Sulfitobacter sp. NB-68...................... 105  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Aquamicrobium defluvii....................... 105  1e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Aquamicro...   
. . Agrobacterium tumefaciens.................... 105  2e-22  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Mesorhizobium ciceri......................... 105  2e-22  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Nitrobacter winogradskyi..................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Thalassospira lucentensis.................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Thal...   
. . Gluconobacter morbifer....................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Gluc...   
. . Sediminimonas qiaohouensis................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. . Acetobacter okinawensis...................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Granulibacter bethesdensis CGDNIH3........... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Granuliba...   
. . Rhizobium sp. PDO-076........................ 105  2e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Thioclava pacifica DSM 10166................. 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein TP2_02245 [Thioclava paci...   
. . Mesorhizobium alhagi......................... 105  2e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Rhodobacter sphaeroides 2.4.1................ 105  3e-22  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Candidatus Puniceispirillum marinum.......... 105  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [Candidatus Puniceis...   
. . Sinorhizobium arboris........................ 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Rhodobacter sphaeroides WS8N................. 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . alpha proteobacterium SCGC AAA027-C06........ 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Thalassospira permensis NBRC 106175.......... 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Thalassos...   
. . Agrobacterium sp. Cherry 2E-2-2.............. 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Sphingomonas sp. PR090111-T3T-6A............. 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Granulibacter bethesdensis CGDNIH4........... 104  3e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Anhydro-N-acetylmuramic acid kinase [Granuliba...   
. . Nitrobacter sp. Nb-311A...................... 104  4e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr...   
. . Sphingobium ummariense RL-3.................. 104  4e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphingobi...   
. . Roseivivax halodurans JCM 10272.............. 104  4e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Roseiviva...   
. . Rhodobacteraceae bacterium HTCC2150.......... 104  4e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Jannaschia sp. CCS1.......................... 104  4e-22  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: RecName: Full=Anhydro-N-acetylmuramic...   
. . Kaistia adipata.............................. 104  4e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Kais...   
. . Catellibacterium nectariphilum............... 104  4e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Cate...   
. . Sphingobium.................................. 104  4e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Agrobacterium vitis.......................... 104  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Thalassiobium sp. R2A62...................... 103  5e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Thal...   
. . Mesorhizobium loti WSM1293................... 103  6e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Thioclava sp. DT23-4......................... 103  7e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein DT23_03690 [Thioclava sp....   
. . Methylocystis sp. SC2........................ 103  7e-22  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Elioraea tepidiphila......................... 103  7e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Elio...   
. . Agrobacterium fabrum str. C58................ 103  7e-22  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: RecName: Full=Anhydro-N-acetylmuramic ...   
. . Phyllobacterium sp. YR531.................... 103  7e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Phyl...   
. . Rhizobium mesoamericanum..................... 103  7e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Sphingobium ummariense....................... 103  8e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Thalassospira xiamenensis.................... 103  8e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Thal...   
. . Acidiphilium angustum........................ 103  9e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acid...   
. . Pelagibaca bermudensis....................... 103  9e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Pela...   
. . Agrobacterium sp. ATCC 31749................. 103  9e-22  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Hirschia maritima............................ 103  9e-22  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hirs...   
. . Sinorhizobium sp. USDA 6670.................. 103  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ensi...   
. . Ahrensia kielensis........................... 103  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Ahrensia kielensis]      
. . Rhizobium sp. CF122.......................... 103  1e-21  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Ensifer adhaerens OV14....................... 103  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ensifer a...   
. . Starkeya novella............................. 103  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Star...   
. . Rhodobacteraceae bacterium HTCC2083.......... 102  1e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Acetobacteraceae bacterium AT-5844........... 102  1e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Acet...   
. . Loktanella hongkongensis..................... 102  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Loktanella hongkong...   
. . Actibacterium sp. 22II-S11-z10............... 102  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Actibacte...   
. . Ensifer sp. WSM1721.......................... 102  1e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Rhodobacteraceae bacterium PD-2.............. 102  1e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Rhodobacter sp. AKP1......................... 102  1e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Mesorhizobium loti........................... 102  2e-21  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso...   
. . Ochrobactrum intermedium..................... 102  2e-21  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr...   
. . Sinorhizobium fredii USDA 257................ 102  2e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Roseivivax isoporae LMG 25204................ 102  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Roseiviva...   
. . Agrobacterium tumefaciens 5A................. 102  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Rhizobium sp. IRBG74......................... 102  2e-21  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Rhizobium sp. IRBG74]    
. . Agrobacterium sp. 10MFCol1.1................. 102  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Sinorhizobium meliloti 1021.................. 102  2e-21  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Agrobacterium tumefaciens LBA4213 (Ach5)..... 102  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agrobacte...   
. . Sphingomonas paucimobilis.................... 102  2e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Anhydro-N-acetylmuramic acid kinase [Sphingomo...   
. . Sinorhizobium medicae........................ 102  2e-21  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sino...   
. . Loktanella vestfoldensis..................... 102  3e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Lokt...   
. . Rhizobium sp. OR191.......................... 102  3e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhizobium lupini............................. 102  3e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Agrobacterium sp. H13-3...................... 102  3e-21  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Sinorhizobium................................ 102  3e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. . Rhizobium sp................................. 101  3e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Rhizobiu...   
. . Sphingobium yanoikuyae....................... 101  4e-21  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sphingobium yanoiku...   
. . Oceanicaulis sp. HTCC2633.................... 101  4e-21  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea...   
. . Agrobacterium tumefaciens F2................. 101  4e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro...   
. . Wenxinia marina.............................. 101  4e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Wenxinia marina]         
. . Ahrensia sp. 13_GOM-1096m.................... 101  4e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ahre...   
. . Methylocystis sp. SB2........................ 101  4e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Aurantimonas ureilytica...................... 101  5e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Aureimonas ureilytica]   
. . Rhizobium freirei............................ 101  5e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Rhizobium tropici............................ 100  7e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz...   
. . Ochrobactrum anthropi........................ 100  7e-21  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr...   
. . alpha proteobacterium SCGC AAA240-E13........ 100  8e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Sphingobium sp. DC-2......................... 100  8e-21  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. . Ochrobactrum anthropi ATCC 49188............. 100  9e-21  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr...   
. . Rhodobacter sphaeroides ATCC 17029........... 100  1e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod...   
. . Methylocystis rosea.......................... 100  1e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meth...   
. . Ochrobactrum sp. UNC390CL2Tsu3S39............ 100  1e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr...   
. . alpha proteobacterium SCGC AAA288-N07........ 100  1e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph...   
. . Sphingomonas sp. MM-1........................ 99.8 1e-20  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Sphingomonas melonis......................... 99.8 2e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Roseobacter sp. CCS2......................... 99.8 2e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose... 
. . Parvularcula bermudensis..................... 99.8 2e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Parvularculales: molecular chaperone [Parvularcula bermude... 
. . Sphingobium quisquiliarum.................... 99.4 2e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Novosphingobium sp. AP12..................... 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Novo... 
. . Asticcacaulis sp. AC460...................... 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Asti... 
. . Rhodobacter sp. SW2.......................... 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. . Mesorhizobium sp. LNHC209A00................. 99.0 3e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Agrobacterium................................ 99.0 3e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Rhizobium leucaenae.......................... 98.6 4e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Cucumibacter marinus......................... 98.6 4e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Cucu... 
. . Paracoccus aminophilus....................... 98.6 5e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Agrobacterium radiobacter DSM 30147.......... 98.2 5e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro... 
. . Rhodobacter sp. CACIA14H1.................... 98.2 5e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Rhodobacter sp. CAC... 
. . Rhodobacter sp. DW2-9........................ 98.2 5e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhodobact... 
. . Sphingobium japonicum BiD32.................. 98.2 5e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Mesorhizobium sp. LNHC229A00................. 98.2 6e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Rhizobium selenitireducens................... 98.2 6e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Thioclava sp. 13D2W-2........................ 97.8 7e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Thioclava... 
. . Sphingomonas sp. SKA58....................... 97.8 7e-20  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Sphingomonas sp. PAMC 26605.................. 97.8 7e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Brucella..................................... 97.8 8e-20  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . alpha proteobacterium LLX12A................. 97.4 8e-20  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: anhydro-N-acetylmuramic acid kinase [alph... 
. . Mesorhizobium loti MAFF303099................ 97.4 1e-19  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Brucella inopinata........................... 97.4 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Maricaulis sp. JL2009........................ 97.4 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Mari... 
. . Sphingobium xenophagum....................... 97.4 1e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Brucella suis................................ 97.4 1e-19  7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Mesorhizobium loti R7A....................... 97.4 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: molecular chaperone [Mesorhizobium loti R7A]      
. . Roseovarius nubinhibens...................... 97.4 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose... 
. . Brucella sp. 04-5288......................... 97.4 1e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Stappia stellulata........................... 97.4 1e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Stap... 
. . Ochrobactrum intermedium 229E................ 97.4 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr... 
. . Brucella abortus............................. 97.4 1e-19  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Paracoccus yeei.............................. 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Brucella ovis................................ 97.1 1e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Agrobacterium fabrum......................... 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro... 
. . Brucella ovis 80/125......................... 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Brucella abortus 65/157...................... 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Bosea sp. 117................................ 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bose... 
. . Parvularcula oceani.......................... 97.1 1e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Parvularculales: hypothetical protein [Parvularcula sp. JL... 
. . Brucella neotomae............................ 96.7 2e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Oceanicola sp. S124.......................... 96.7 2e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Ocea... 
. . Brucella sp. BO2............................. 96.7 2e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Woodsholea maritima.......................... 96.7 2e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Woodsholea maritima]   
. . Mesorhizobium huakuii 7653R.................. 96.3 3e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative family protein [Mesorhizobium huakuii... 
. . Mesorhizobium australicum.................... 95.9 3e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. WSM3626.................... 95.9 3e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Roseibium sp. TrichSKD4...................... 95.9 4e-19  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose... 
. . Hyphomonas sp. L-53-1-40..................... 95.5 4e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein L53_10285 [Hyphomonas sp.... 
. . Thioclava dalianensis........................ 95.5 5e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Thioclava... 
. . Roseibacterium elongatum DSM 19469........... 95.5 7e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Anhydro-N-acetylmuramic acid kinase [Roseibact... 
. . Asticcacaulis biprosthecium.................. 95.1 7e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Asti... 
. . Sphingobium sp. ba1.......................... 94.7 7e-19  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphingobi... 
. . Chelativorans sp. BNC1....................... 94.7 1e-18  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Chel... 
. . Salinarimonas rosea.......................... 94.4 1e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Sali... 
. . Sphingobium sp. KK22......................... 94.4 1e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Rubritepida flocculans....................... 94.0 2e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Rubr... 
. . Xanthobacter sp. 91.......................... 94.0 2e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Xant... 
. . Sphingobium herbicidovorans NBRC 16415....... 93.6 2e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Anhydro-N-acetylmuramic acid kinase [Sphingobi... 
. . Roseobacter sp. GAI101....................... 93.6 2e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rose... 
. . Meganema perideroedes........................ 93.6 2e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Meganema perideroedes] 
. . Maricaulis maris............................. 93.6 2e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Mari... 
. . Brucella melitensis ATCC 23457............... 93.6 2e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Asticcacaulis sp. AC402...................... 93.6 3e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Asti... 
. . Pseudaminobacter salicylatoxidans............ 93.2 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Pseu... 
. . Sphingobium sp. YL23......................... 93.2 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Caulobacter sp. UNC358MFTsu5.1............... 93.2 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Agrobacterium radiobacter K84................ 93.2 3e-18  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Agro... 
. . Hyphomonas adhaerens MHS-3................... 93.2 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Caulobacter segnis........................... 93.2 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Celeribacter baekdonensis.................... 92.8 3e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Cele... 
. . Sphingobium baderi........................... 92.8 4e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Mesorhizobium ciceri biovar biserrulae WSM1271 92.8 4e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. URHC0008................... 92.4 5e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Devosia riboflavina.......................... 92.4 6e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Devosia r... 
. . Rhizobium rhizogenes NBRC 13257.............. 92.4 6e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhizobiu... 
. . Rhizobium sp. AP16........................... 92.4 6e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Ochrobactrum rhizosphaerae................... 92.4 6e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr... 
. . Brucella melitensis.......................... 92.0 6e-18  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Brucella melitensis bv. 1 str. 16M........... 92.0 7e-18  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Caulobacter sp. URHA0033..................... 92.0 8e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Bradyrhizobium sp. Ai1a-2.................... 92.0 8e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Brad... 
. . Asticcacaulis sp. AC466...................... 92.0 9e-18  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Asticcacaulis sp. A... 
. . alpha proteobacterium SCGC AAA015-O19........ 91.7 9e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri... 
. . Defluviimonas sp. 20V17...................... 91.7 9e-18  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Defluviim... 
. . Mesorhizobium sp. URHA0056................... 91.7 1e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. LNHC252B00................. 91.7 1e-17  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Hyphomonas sp. CY54-11-8..................... 91.7 1e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY17_13805 [Hyphomonas sp... 
. . Mesorhizobium opportunistum.................. 91.3 1e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Bartonella tamiae............................ 91.3 1e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Bartonella tamiae]     
. . Paracoccus denitrificans..................... 91.3 1e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Ponticaulis koreensis........................ 90.9 2e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Pont... 
. . Caulobacter vibrioides....................... 90.9 2e-17  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: molecular chaperone [Caulobacter vibrioides] 
. . Mesorhizobium sp. LNHC221B00................. 90.9 2e-17  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Haematobacter massiliensis................... 90.5 3e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Haematoba... 
. . Mesorhizobium sp. LNHC232B00................. 90.5 3e-17  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Rhizobium undicola........................... 90.5 3e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Hellea balneolensis.......................... 90.1 3e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Hellea balneolensis]   
. . Devosia sp. LC5.............................. 90.1 3e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Devosia s... 
. . Asticcacaulis excentricus.................... 90.1 4e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Asti... 
. . Hirschia baltica............................. 90.1 4e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hirs... 
. . Neorhizobium galegae bv. orientalis str. HAMBI  89.4 6e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: AnhMurNAc kinase [Rhizobium galegae bv. orien... 
. . Rhizobium sp. CF080.......................... 89.4 7e-17  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Asticcacaulis benevestitus................... 89.4 7e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Asti... 
. . Asticcacaulis benevestitus DSM 16100......... 89.4 7e-17  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein ABENE_02145 [Asticcacauli... 
. . Brucella melitensis NI....................... 88.6 1e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Bruc... 
. . Paracoccus sp. J39........................... 88.6 1e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Paracoccus sp. TRP........................... 88.2 1e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Sphingobium sp. C100......................... 88.2 2e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: anhydro-N-acetylmuramic acid kinase [Sphi... 
. . Hyphomonas jannaschiana VP2.................. 88.2 2e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Hyphomonas sp. T16B2......................... 87.8 2e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY2_10445 [Hyphomonas sp.... 
. . Mesorhizobium sp. LSJC280B00................. 87.8 2e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium metallidurans STM 4661......... 87.8 2e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Meso... 
. . Hyphomonas sp. 25B14_1....................... 87.8 3e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY29_12130 [Hyphomonas sp... 
. . Paracoccus sp. J55........................... 87.4 3e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Mesorhizobium metallidurans.................. 87.0 4e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. L48C026A00................. 87.0 5e-16  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium amorphae....................... 86.7 5e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Pseudochrobactrum sp. AO18b.................. 86.3 6e-16  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Pseu... 
. . Mesorhizobium................................ 86.3 9e-16  7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Ochrobactrum sp. CDB2........................ 86.3 1e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr... 
. . Caulobacteraceae bacterium PMMR1............. 85.9 1e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Phenylobacterium zucineum.................... 85.9 1e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Phen... 
. . Caulobacter crescentus CB15.................. 85.9 1e-15  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Rhodobacter capsulatus....................... 85.9 1e-15  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. . Mesorhizobium sp. WSM2561.................... 85.5 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Ketogulonicigenium vulgare................... 85.5 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Keto... 
. . Rhodobacter capsulatus YW2................... 85.5 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. . Maritimibacter alkaliphilus.................. 85.5 2e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Mari... 
. . Rhodobacter capsulatus SB 1003............... 84.7 3e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. . Nitratireductor pacificus.................... 84.7 3e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr... 
. . Rhodobacter capsulatus B6.................... 84.7 3e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. . Neorhizobium galegae bv. officinalis bv. offici 84.7 3e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: AnhMurNAc kinase [Rhizobium galegae bv. offic... 
. . Nesiotobacter exalbescens.................... 84.3 4e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Nesi... 
. . Paracoccus pantotrophus...................... 84.0 5e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Brevundimonas naejangsanensis................ 84.0 5e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Brev... 
. . alpha proteobacterium SCGC AAA300-J04........ 84.0 6e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri... 
. . Nitratireductor aquibiodomus................. 84.0 6e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr... 
. . Haematobacter missouriensis.................. 83.6 6e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Haematoba... 
. . Brevundimonas diminuta....................... 83.6 7e-15  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Brev... 
. . Hyphomonas sp. 22II1-22F38................... 83.2 9e-15  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY36_07735 [Hyphomonas sp... 
. . Asticcacaulis sp. YBE204..................... 83.2 1e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Asticcacaulis sp. Y... 
. . Pseudovibrio sp. FO-BEG1..................... 82.4 2e-14  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Pseu... 
. . Paracoccus sp. N5............................ 82.4 2e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Para... 
. . Caulobacter sp. AP07......................... 82.4 2e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Caulobacter sp. K31.......................... 82.0 2e-14  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Caulobacter crescentus NA1000................ 82.0 3e-14  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Caul... 
. . Nitratireductor indicus...................... 82.0 3e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Nitr... 
. . Chelatococcus sp. GW1........................ 81.6 4e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Chelatococcus sp. GW1] 
. . Mesorhizobium sp. WSM3224.................... 81.3 5e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Azospirillum amazonense...................... 80.5 9e-14  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: anhydro-N-acetylmuramic acid kinase [Azos... 
. . Brevundimonas diminuta ATCC 11568............ 80.1 1e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: anhydro-N-acetylmuramic acid kinase [Brev... 
. . Pseudovibrio sp. JE062....................... 80.1 1e-13  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Pseu... 
. . Hyphomonas sp. BH-BN04-4..................... 79.3 2e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein HY30_07090 [Hyphomonas sp... 
. . Mesorhizobium sp. URHB0007................... 79.0 3e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Martelella sp. AD-3.......................... 77.4 9e-13  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mart... 
. . Hyphomonas polymorpha PS728.................. 77.4 1e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Mesorhizobium sp. LNJC386A00................. 77.0 2e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Mesorhizobium sp. LSHC432A00................. 76.6 2e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Hyphomonas hirschiana VP5.................... 76.6 2e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Mesorhizobium sp. LSJC264A00................. 76.6 2e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Mesorhizobium sp. LSHC426A00................. 76.3 3e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Mesorhizobium sp. LNJC380A00................. 76.3 3e-12  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Hyphomonas neptunium......................... 76.3 3e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyph... 
. . Martelella mediterranea...................... 75.1 7e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mart... 
. . Hyphomonas oceanitis SCH89................... 75.1 7e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Mesorhizobium sp. LNJC394B00................. 74.7 8e-12  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Devosia sp. DBB001........................... 73.6 2e-11  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Anhydro-N-acetylmuramic acid kinase [Devosia ... 
. . Devosia sp. 17-2-E-8......................... 73.2 3e-11  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Devosia s... 
. . Mesorhizobium sp. LSJC268A00................. 72.0 9e-11  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. LSJC255A00................. 71.6 1e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: anhydro-N-acetylmuramic aci... 
. . Mesorhizobium sp. LNJC398B00................. 71.6 1e-10  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. LNJC395A00................. 70.9 1e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Mesorhizobium sp. LSHC412B00................. 70.1 2e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Mesorhizobium sp. LSJC269B00................. 70.1 3e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Meso... 
. . Mesorhizobium sp. LSHC440B00................. 69.7 3e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Hoeflea sp. 108.............................. 69.7 5e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Hoef... 
. . Mesorhizobium sp. LSJC285A00................. 69.7 5e-10  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Mesorhizobium sp. LSJC265A00................. 68.9 6e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Mesorhizobium sp. LSJC277A00................. 68.2 8e-10  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Mesorhizo... 
. . Henriciella marina........................... 67.4 2e-09  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Henriciella marina]    
. . Hyphomonas johnsonii MHS-2................... 65.1 1e-08  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: anhydro-N-acetylmuramic acid kinase [Hyphomona... 
. . Rhizobium sp. JGI 0001003-A11................ 63.9 1e-08  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Rhiz... 
. . Ochrobactrum intermedium M86................. 58.9 7e-07  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: anhydro-N-acetylmuramic acid kinase [Ochr... 
. . Cystobacter violaceus Cb vi76................ 146  8e-37  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: anhydro-N-acetylmuramic acid kinase [Cystobact...   
. . Cystobacter fuscus........................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Anhydro-N-acetylmuramic acid kinase [Cyst...   
. . Stigmatella aurantiaca....................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: hypothetical protein [Stigmatella auranti...   
. . Hyalangium minutum........................... 139  4e-34  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Anhydro-N-acetylmuramic acid kinase [Hyalangiu...   
. . Corallococcus coralloides.................... 143  2e-35  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: anhydro-N-acetylmuramic acid kinase [Cora...   
. . Myxococcus stipitatus........................ 141  5e-35  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: anhydro-N-acetylmuramic acid kinase [Myxo...   
. . Plesiocystis pacifica........................ 111  2e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: anhydro-N-acetylmuramic acid kinase [Ples...   
. . Sandaracinus amylolyticus.................... 100  6e-21  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Anhydro-N-acetylmuramic acid kinase [Sandaraci...   
. . SAR324 cluster bacterium JCVI-SC AAA005...... 124  7e-29  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein [SAR324 cluster bact...   
. . Bdellovibrio exovorus........................ 117  1e-26  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: hypothetical protein [Bdellovibrio exovorus]   
. . Candidatus Entotheonella sp. TSY2............ 115  1e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein ETSY2_43725 [Candidatus E...   
. . Candidatus Entotheonella sp. TSY1............ 109  9e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein ETSY1_33355 [Candidatus E...   
. . Desulfomicrobium baculatum................... 38.9 5.2    1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: UDP-N-acetylmuramate--alanine ligase [Des... 
. . Sulfurovum sp. NBC37-1....................... 142  2e-35  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Sulfurovum sp. AR............................ 136  3e-33  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Sulfurimonas gotlandica...................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Sulfurimonas denitrificans................... 128  3e-30  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Sulfurimonas autotrophica.................... 126  1e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. . Mariprofundus ferrooxydans................... 141  6e-35  2 hits  Bacteria:Proteobacteria:Zetaproteobacteria:Mariprofundales: hypothetical protein [Mariprofundus ferro...   
. . Mariprofundus ferrooxydans PV-1.............. 140  1e-34  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria:Mariprofundales: predicted molecular chaperone [Mariprofun...   
. . zeta proteobacterium SCGC AB-604-O16......... 127  7e-30  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: hypothetical protein [zeta proteobacteriu...   
. . zeta proteobacterium SCGC AB-137-C09......... 125  4e-29  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: hypothetical protein [zeta proteobacteriu...   
. . Magnetococcus marinus........................ 108  1e-23  1 hit   Bacteria:Proteobacteria:                 anhydro-N-acetylmuramic acid kinase [Magn...   
. . Proteobacteria bacterium JGI 0000113-D06..... 105  2e-22  1 hit   Bacteria:Proteobacteria:                 anhydro-N-acetylmuramic acid kinase [Prot...   
. .Prolixibacter bellariivorans.................. 322  8e-105 1 hit   Bacteria:Bacteroidetes:                  anhydro-N-acetylmuramic acid kinase [Prol...   
. .Epilithonimonas sp. FH1....................... 316  4e-102 1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Epilithon...   
. .Tenacibaculum ovolyticum...................... 313  6e-101 1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Tena...   
. .Chryseobacterium sp. JM1...................... 311  1e-100 1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Epilithonimonas tenax......................... 309  1e-99  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Epil...   
. .Tenacibaculum maritimum....................... 308  4e-99  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Tena...   
. .Chryseobacterium caeni........................ 305  4e-98  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Epilithonimonas lactis........................ 304  7e-98  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Epilithon...   
. .Tenacibaculum sp. 47A_GOM-205m................ 303  4e-97  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Tena...   
. .Polaribacter sp. Hel_I_88..................... 301  1e-96  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Pola...   
. .Polaribacter sp. MED152....................... 301  1e-96  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Pola...   
. .Bizionia argentinensis........................ 301  1e-96  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Bizi...   
. .Mesoflavibacter zeaxanthinifaciens............ 301  3e-96  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Meso...   
. .Elizabethkingia............................... 300  3e-96  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Gillisia sp. ck-I2-15......................... 300  4e-96  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Galb...   
. .Chryseobacterium sp. P1-3..................... 300  4e-96  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Elizabethkingia anophelis..................... 300  4e-96  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Eliz...   
. .Flavobacteriales bacterium ALC-1.............. 298  2e-95  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Lacinutrix sp. 5H-3-7-4....................... 298  3e-95  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Laci...   
. .Bacteroidetes bacterium FH5................... 298  5e-95  1 hit   Bacteria:Bacteroidetes:                  anhydro-N-acetylmuramic acid kinase [Bacteroid...   
. .Elizabethkingia meningoseptica................ 297  4e-95  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Elizabeth...   
. .Chryseobacterium sp. UNC8MFCol................ 297  7e-95  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Olleya sp. VCSA23............................. 297  9e-95  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Olle...   
. .Chryseobacterium piperi....................... 296  9e-95  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Chryseobacterium luteum....................... 296  2e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Chryseobacterium gleum........................ 296  3e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Psychroserpens burtonensis.................... 295  4e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. .Chryseobacterium gregarium.................... 295  4e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Olleya marilimosa............................. 295  6e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Olle...   
. .Flavobacterium sp. SCGC AAA160-P02............ 295  7e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Flavobacterium sp. ...   
. .Gillisia marina............................... 294  8e-94  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gill...   
. .Olleya sp. VCSM12............................. 294  2e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Olle...   
. .Bergeyella zoohelcum.......................... 293  2e-93  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Berg...   
. .Chryseobacterium antarcticum.................. 293  3e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Leeuwenhoekiella sp. MAR_2009_132............. 293  3e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Leeu...   
. .Winogradskyella psychrotolerans............... 293  4e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: Anhydro-N-acetylmuramic acid kinase [Wino...   
. .Chryseobacterium formosense................... 292  6e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Aequorivita capsosiphonis..................... 291  9e-93  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aequ...   
. .Flavobacteriaceae bacterium 3A10.............. 291  1e-92  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Bergeyella zoohelcum CCUG 30536............... 291  2e-92  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Berg...   
. .Winogradskyella sp. PG-2...................... 291  2e-92  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Winograd...   
. .Bacteroides oleiciplenus...................... 291  2e-92  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides oleicip...   
. .Bacteroides sp. D20........................... 291  2e-92  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: anhydro-N-acetylmuramic acid kinase [Bact...   
. .Flavobacteriaceae bacterium 3519-10........... 289  6e-92  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Bacteroides clarus............................ 289  1e-91  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: anhydro-N-acetylmuramic acid kinase [Bact...   
. .Bacteroides uniformis str. 3978 T3 ii......... 289  1e-91  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein M094_2115 [Bacteroides un...   
. .Bacteroides uniformis......................... 288  2e-91  3 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides uniformis]   
. .Bacteroides uniformis ATCC 8492............... 288  2e-91  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides uniformis]   
. .Bacteroides uniformis dnLKV2.................. 288  2e-91  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: hypothetical protein [Bacteroides uniformis]   
. .Cytophaga fermentans.......................... 288  2e-91  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Cytophaga fermentans]    
. .Arenitalea lutea.............................. 288  4e-91  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Flavobacteriaceae b...   
. .Polaribacter irgensii......................... 287  5e-91  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Pola...   
. .Salinimicrobium xinjiangense.................. 287  6e-91  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Sali...   
. .Aequorivita sublithincola..................... 286  2e-90  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aequ...   
. .Croceibacter atlanticus....................... 285  5e-90  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Croc...   
. .Bacteroides graminisolvens.................... 284  8e-90  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: anhydro-N-acetylmuramic acid kinase [Bact...   
. .Leeuwenhoekiella blandensis................... 283  2e-89  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Leeu...   
. .Mesonia mobilis............................... 283  2e-89  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Meso...   
. .Leeuwenhoekiella sp. Hel_I_48................. 283  4e-89  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Leeu...   
. .Flavobacteria bacterium BBFL7................. 281  1e-88  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   anhydro-N-acetylmuramic acid kinase [Flav...   
. .Elizabethkingia meningoseptica NBRC 12535..... 281  1e-88  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Eliz...   
. .Flavobacterium gelidilacus.................... 280  4e-88  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Bacteroides sp. CF50.......................... 280  4e-88  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: Anhydro-N-acetylmuramic acid kinase [Bacteroid...   
. .Nonlabens sediminis........................... 279  5e-88  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Nonlaben...   
. .Nonlabens ulvanivorans........................ 279  6e-88  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Nonlabens...   
. .Bacteroides graminisolvens JCM 15093.......... 279  8e-88  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: anhydro-N-acetylmuramic acid kinase [Bacteroi...   
. .Persicivirga dokdonensis...................... 279  8e-88  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Nonl...   
. .Kordia algicida............................... 278  1e-87  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Kord...   
. .Nafulsella turpanensis........................ 278  3e-87  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Nafulsella turpanen...   
. .Chryseobacterium hispalense................... 277  4e-87  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Cyclobacterium marinum........................ 277  5e-87  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Cycl...   
. .Flavobacterium sp. EM1321..................... 277  4e-86  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium sp. EM1321]            
. .Chryseobacterium vrystaatense................. 276  1e-86  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chryseoba...   
. .Mangrovimonas yunxiaonensis................... 276  2e-86  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Mangrovim...   
. .Myroides...................................... 275  3e-86  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Dokdonia donghaensis MED134................... 274  1e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein MED134_00920 [Dokdonia do...   
. .Formosa agariphila KMM 3901................... 273  1e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Formosa ...   
. .Chryseobacterium sp. CF314.................... 273  1e-85  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Formosa sp. AK20.............................. 273  2e-85  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: Anhydro-N-acetylmuramic acid kinase [Form...   
. .Zunongwangia profunda......................... 273  2e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Zuno...   
. .Flavobacterium filum.......................... 273  2e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flavobacterium sasangense..................... 273  3e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Chryseobacterium daeguense.................... 272  3e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Algoriphagus sp. PR1.......................... 272  3e-85  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Algo...   
. .Psychroflexus tropicus........................ 272  3e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Psychroflexus tropi...   
. .Gillisia sp. JM1.............................. 271  6e-85  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gill...   
. .Gillisia limnaea.............................. 271  1e-84  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gill...   
. .Echinicola pacifica........................... 271  1e-84  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Echinicola pacifica]     
. .Flavobacteria bacterium BAL38................. 271  1e-84  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Cytophaga hutchinsonii........................ 271  2e-84  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Cyto...   
. .Flavobacteriaceae bacterium S85............... 270  2e-84  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Fulvivirga imtechensis........................ 270  3e-84  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Anhydro-N-acetylmuramic acid kinase [Fulv...   
. .Aquimarina agarilytica........................ 270  4e-84  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Flavobacterium indicum........................ 269  8e-84  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flavobacterium limnosediminis................. 269  9e-84  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium limnosediminis]   
. .Crocinitomix catalasitica..................... 268  1e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Crocinitomix catala...   
. .Flavobacteriaceae bacterium HQM9.............. 268  2e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Cytophaga aurantiaca.......................... 268  2e-83  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Cytophaga aurantiaca]    
. .Algoriphagus mannitolivorans.................. 268  2e-83  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Algo...   
. .Gramella echinicola........................... 267  3e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gram...   
. .Capnocytophaga canimorsus..................... 267  3e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Capn...   
. .Flavobacterium enshiense...................... 267  3e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium enshiense]        
. .Adhaeribacter aquaticus....................... 267  4e-83  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Adha...   
. .Flavobacterium soli........................... 266  6e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flavobacterium suncheonense................... 266  8e-83  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Rhodonellum psychrophilum..................... 266  1e-82  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Rhodonellum psychro...   
. .Empedobacter brevis........................... 266  1e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Empe...   
. .Owenweeksia hongkongensis..................... 265  1e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Owen...   
. .Flavobacterium psychrophilum FPG3............. 265  2e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flavobact...   
. .Flavobacterium psychrophilum.................. 265  2e-82  8 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: Anhydro-N-acetylmuramic acid kinase [Flavobact...   
. .Dokdonia sp. 4H-3-7-5......................... 265  2e-82  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Krok...   
. .Flavobacterium psychrophilum JIP02/86......... 265  2e-82  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flavobacterium sp. EM1308..................... 265  2e-82  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium sp. EM1308]            
. .Flavobacterium daejeonense.................... 265  3e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Riemerella anatipestifer...................... 265  3e-82  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Riem...   
. .Flavobacterium sp. ACAM 123................... 264  7e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Riemerella anatipestifer DSM 15868............ 263  8e-82  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Riem...   
. .Psychroflexus torquis......................... 263  8e-82  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Psyc...   
. .Bacteroidetes bacterium SCGC AAA027-N21....... 263  9e-82  1 hit   Bacteria:Bacteroidetes:                  anhydro-N-acetylmuramic acid kinase [Bact...   
. .Flavobacterium subsaxonicum................... 263  1e-81  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Anditalea andensis............................ 262  2e-81  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Cytophaga...   
. .Flavobacterium frigoris....................... 262  2e-81  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Effluviibacter roseus......................... 262  4e-81  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Pontibacter roseus]      
. .Flavobacterium saliperosum.................... 261  4e-81  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium saliperosum]      
. .Gaetbulibacter saemankumensis................. 261  5e-81  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gaet...   
. .Gramella portivictoriae....................... 261  6e-81  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gram...   
. .Flavobacterium cauense........................ 261  1e-80  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anmK protein [Flavobacterium cauense]          
. .Flavobacterium tegetincola.................... 260  2e-80  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flexithrix dorotheae.......................... 260  2e-80  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Flexithrix dorotheae]    
. .Riemerella columbina.......................... 259  5e-80  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Riem...   
. .Flavobacteria bacterium MS024-2A.............. 258  8e-80  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   anhydro-N-acetylmuramic acid kinase [Flav...   
. .Sporocytophaga myxococcoides.................. 258  1e-79  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Sporocytophaga myxo...   
. .Flavobacterium antarcticum.................... 257  2e-79  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Imtechella halotolerans....................... 257  3e-79  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Imte...   
. .Algoriphagus terrigena........................ 256  4e-79  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Algo...   
. .Niabella soli DSM 19437....................... 256  5e-79  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein NIASO_11025 [Niabella sol...   
. .Algoriphagus vanfongensis..................... 256  6e-79  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Algo...   
. .Sediminibacter sp. Hel_I_10................... 256  6e-79  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. .Joostella marina.............................. 256  9e-79  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Joos...   
. .Marivirga tractuosa........................... 255  2e-78  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Marivirga tractuosa]     
. .Gramella forsetii............................. 255  2e-78  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Gram...   
. .Flexibacter sp. AMV16......................... 255  2e-78  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Anhydro-N-acetylmuramic acid kinase [Cesi...   
. .Aquimarina megaterium......................... 254  4e-78  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Echinicola vietnamensis....................... 254  4e-78  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: molecular chaperone [Echinicola vietnamen...   
. .Niabella aurantiaca........................... 254  5e-78  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Niabella aurantiaca]     
. .Zhouia amylolytica AD3........................ 254  6e-78  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein P278_05110 [Zhouia amylol...   
. .Aquimarina macrocephali....................... 253  9e-78  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Myroides odoratimimus......................... 253  1e-77  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Myroides odoratimimus CCUG 10230.............. 253  1e-77  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Flexibacter litoralis......................... 253  4e-77  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: molecular chaperone [Flexibacter litoralis]    
. .Myroides odoratimimus CCUG 12700.............. 252  2e-77  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Pontibacter actiniarum........................ 252  3e-77  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Pont...   
. .Aquimarina muelleri........................... 252  3e-77  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Salinimicrobium terrae........................ 252  4e-77  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Sali...   
. .Flavobacterium columnare...................... 250  1e-76  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Myroides odoratimimus CIP 101113.............. 250  1e-76  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Aquimarina sp. SW150.......................... 250  2e-76  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Flavobacterium rivuli......................... 250  2e-76  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Flavobacterium rivuli]   
. .Cyclobacteriaceae bacterium AK24.............. 249  3e-76  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Anhydro-N-acetylmuramic acid kinase [Cycl...   
. .Myroides odoratimimus CCUG 12901.............. 249  3e-76  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Flavobacterium frigidarium.................... 247  2e-75  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Zobellia galactanivorans...................... 246  4e-75  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Zobe...   
. .Aquimarina sp. 22II-S11-z7.................... 246  7e-75  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aquimarin...   
. .Flexibacter roseolus.......................... 246  1e-74  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Flexibacter roseolus]    
. .Algoriphagus marincola........................ 245  1e-74  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Algo...   
. .Mariniradius saccharolyticus.................. 245  1e-74  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Anhydro-N-acetylmuramic acid kinase [Mari...   
. .Myroides injenensis........................... 245  1e-74  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Myro...   
. .Muricauda ruestringensis...................... 243  6e-74  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Muri...   
. .Maribacter antarcticus........................ 243  1e-73  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Mari...   
. .Aquimarina latercula.......................... 242  2e-73  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aqui...   
. .Arenibacter algicola.......................... 241  5e-73  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aren...   
. .Arenibacter latericius........................ 240  1e-72  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aren...   
. .Niastella koreensis........................... 239  8e-72  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Niastella koreensis]     
. .Cellulophaga lytica........................... 237  2e-71  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Cell...   
. .Maribacter sp. Hel_I_7........................ 237  2e-71  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Mari...   
. .Robiginitalea biformata....................... 237  2e-71  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Robi...   
. .Arenibacter certesii.......................... 234  3e-70  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Aren...   
. .Cellulophaga geojensis KL-A................... 232  1e-69  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Celluloph...   
. .Terrimonas ferruginea......................... 229  2e-68  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Terrimonas ferruginea]   
. .Lewinella cohaerens........................... 229  3e-68  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Lewinella cohaerens]     
. .Eudoraea adriatica............................ 226  2e-67  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Eudoraea adriatica]      
. .Maribacter sp. HTCC2170....................... 226  2e-67  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Mari...   
. .Cellulophaga algicola......................... 225  9e-67  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Cell...   
. .Schleiferia thermophila str. Yellowstone...... 224  7e-67  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Schleifer...   
. .Riemerella anatipestifer RA-CH-2.............. 222  2e-66  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Riem...   
. .Cellulophaga baltica.......................... 221  2e-65  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Cell...   
. .Saprospira grandis............................ 221  4e-65  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sapr...   
. .Saprospira grandis DSM 2844................... 215  8e-63  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sapr...   
. .Segetibacter koreensis........................ 213  5e-62  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Segetibacter koreen...   
. .Chitinophaga pinensis......................... 192  2e-54  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. .Lewinella persica............................. 178  1e-48  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Lewinella persica]       
. .Pedobacter glucosidilyticus................... 152  5e-39  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Pedobacter saltans............................ 151  1e-38  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Cytophagales bacterium B6..................... 146  1e-36  1 hit   Bacteria:Bacteroidetes:                  anhydro-N-acetylmuramic acid kinase [Cyto...   
. .Solitalea canadensis.......................... 140  3e-34  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Soli...   
. .Balneola vulgaris............................. 138  5e-34  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Balneola vulgaris]       
. .Pontibacter sp. BAB1700....................... 138  9e-34  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Pont...   
. .Flavobacterium sp. CF313...................... 135  1e-32  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Vari...   
. .Sphingobacterium sp. PM2-P1-29................ 134  3e-32  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: Anhydro-N-acetylmuramic acid kinase [Sphingob...   
. .Pedobacter heparinus.......................... 133  7e-32  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Pedobacter borealis........................... 131  3e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Pedobacter agri............................... 130  4e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Dyadobacter beijingensis...................... 130  6e-31  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Dyad...   
. .Sediminibacterium sp. OR43.................... 130  7e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. .Dyadobacter crusticola........................ 130  8e-31  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Dyad...   
. .Olivibacter sitiensis......................... 129  1e-30  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Oliv...   
. .Sediminibacterium sp. OR53.................... 129  1e-30  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. .Emticicia oligotrophica....................... 129  2e-30  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Emti...   
. .Pedobacter sp. V48............................ 128  3e-30  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedobacte...   
. .Sphingobacterium sp. ML3W..................... 128  4e-30  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphingoba...   
. .Dyadobacter fermentans........................ 128  4e-30  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Dyad...   
. .Rhodothermus marinus.......................... 127  7e-30  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: anhydro-N-acetylmuramic acid kinase [Rhod...   
. .Pedobacter sp. BAL39.......................... 127  1e-29  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Flavobacterium hydatis........................ 126  1e-29  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flavobact...   
. .Mucilaginibacter paludis...................... 126  2e-29  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Muci...   
. .Sphingobacterium spiritivorum................. 126  2e-29  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. .Sphingobacterium thalpophilum................. 125  2e-29  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. .Flavobacterium sp. WG21....................... 125  3e-29  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Spirosoma panaciterrae........................ 125  3e-29  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Spir...   
. .Arcticibacter svalbardensis................... 125  4e-29  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: Anhydro-N-acetylmuramic acid kinase [Arct...   
. .Dyadobacter alkalitolerans.................... 125  5e-29  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Dyad...   
. .Sphingobacterium spiritivorum ATCC 33861...... 124  9e-29  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. .Flavobacterium denitrificans.................. 124  1e-28  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Rhodothermus marinus DSM 4252................. 124  1e-28  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: anhydro-N-acetylmuramic acid kinase [Rhod...   
. .Cytophagaceae bacterium JGI 0001001-B3........ 124  1e-28  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Cyto...   
. .Haliscomenobacter hydrossis................... 123  2e-28  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Hali...   
. .Sphingobacterium paucimobilis................. 123  2e-28  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Sphingobacterium pa...   
. .Runella slithyformis.......................... 123  2e-28  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Rune...   
. .Runella zeae.................................. 122  3e-28  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Rune...   
. .Flavobacterium johnsoniae..................... 122  3e-28  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Sphingobacterium sp. H1ai..................... 122  4e-28  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. .Flavobacterium sp. KJJ........................ 122  5e-28  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Pedobacter sp. R20-19......................... 122  6e-28  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Sphingobacterium sp. 21....................... 121  7e-28  3 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphi...   
. .Flavobacterium sp. F52........................ 121  9e-28  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Rudanella lutea............................... 120  1e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Rudanella lutea]         
. .Gracilimonas tropica.......................... 120  2e-27  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Gracilimonas tropica]    
. .Dyadobacter sp. Y620-1........................ 120  3e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Dyad...   
. .Microscilla marina............................ 119  3e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Spirosoma linguale............................ 119  4e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Spir...   
. .Chryseobacterium taeanense.................... 119  4e-27  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Chry...   
. .Flexibacter elegans........................... 119  6e-27  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Flexibacter elegans]     
. .Chitinophaga pinensis DSM 2588................ 118  7e-27  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Chit...   
. .Runella limosa................................ 118  1e-26  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Rune...   
. .Fibrisoma limi................................ 118  1e-26  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Fibr...   
. .Flavobacterium sp. URHB0058................... 117  2e-26  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Sediminibacterium salmoneum................... 117  2e-26  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. .Flavobacterium succinicans.................... 117  3e-26  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Pedobacter oryzae............................. 116  3e-26  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Pedo...   
. .Salinibacter ruber............................ 116  3e-26  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: anhydro-N-acetylmuramic acid kinase [Sali...   
. .Salinibacter ruber M8......................... 116  3e-26  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: anhydro-N-acetylmuramic acid kinase [Sali...   
. .Fibrella aestuarina........................... 116  4e-26  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: protein of unknown function UPF0075 [Fibr...   
. .Pedobacter sp. A12............................ 116  5e-26  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Pedobacter arcticus]     
. .Hymenobacter aerophilus....................... 115  8e-26  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Hymenobacter aeroph...   
. .Hymenobacter sp. APR13........................ 115  8e-26  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein N008_11525 [Hymenobacter ...   
. .Sphingobacterium antarcticus 4BY.............. 115  9e-26  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sphingoba...   
. .Flavobacterium chungangense................... 115  1e-25  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Flavobacterium branchiophilum................. 114  1e-25  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Leadbetterella byssophila..................... 114  2e-25  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Lead...   
. .Sediminibacterium sp. C3...................... 114  3e-25  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: anhydro-N-acetylmuramic acid kinase [Sedi...   
. .Flavobacterium reichenbachii.................. 114  3e-25  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flavobact...   
. .Flavobacterium sp. CF136...................... 112  8e-25  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: anhydro-N-acetylmuramic acid kinase [Flav...   
. .Hymenobacter sp. DY53......................... 112  1e-24  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein Hsw_3570 [Hymenobacter sp...   
. .Hymenobacter norwichensis..................... 108  2e-23  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Hyme...   
. .Spirosoma luteum.............................. 105  3e-22  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Spir...   
. .Spirosoma spitsbergense....................... 102  2e-21  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: anhydro-N-acetylmuramic acid kinase [Spir...   
. .Bacteroides pyogenes.......................... 38.5 8.0    1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: peptidase M16 [Bacteroides pyogenes]         
. .Bacteroides pyogenes JCM 6294................. 38.5 8.3    1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: probable zinc protease pqqL [Bacteroides pyog... 
. .Bacteroides pyogenes JCM 6292................. 38.1 8.6    1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: probable zinc protease pqqL [Bacteroides pyog... 
. .Ornithinibacillus scapharcae.................. 165  8e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Orni...   
. .Bacillus cereus............................... 154  7e-40  90 hits Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. 10403023......................... 154  9e-40  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus gaemokensis.......................... 153  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus ...   
. .Bacillus cereus VD102......................... 153  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Rock3-28...................... 153  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus str. Schrouff................. 152  5e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH603......................... 152  5e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus HuA3-9........................ 152  7e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus E33L.......................... 152  7e-39  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD022......................... 152  7e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis........................ 152  7e-39  20 hits Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus group......................... 152  8e-39  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus thuringiensis serovar tochigiensis BGS 152  8e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus aurantiacus.......................... 152  9e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis IBL 200................ 151  1e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus G9241......................... 151  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG1X1-3...................... 151  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD078......................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AND1407....................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Rock3-42...................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Geobacillus sp. G1w1.......................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Geobacill...   
. .Bacillus cereus Rock1-3....................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Rock3-29...................... 150  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD148......................... 150  3e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar finitimus YBT-02 150  3e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG5O-1....................... 150  3e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus HuB5-5........................ 150  3e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus ATCC 4342..................... 150  3e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Q1............................ 150  3e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus ATCC 10987.................... 150  4e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar sotto str. T0400 150  4e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD146......................... 150  4e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis HD-771................. 150  4e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD115......................... 150  4e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus...................................... 149  5e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus weihenstephanensis KBAB4............. 149  5e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus thuringiensis MC28................... 149  5e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG1X1-1...................... 149  6e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG2O-3....................... 149  6e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar pulsiensis BGSC  149  6e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus HuA2-1........................ 149  6e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus 03BB102....................... 149  7e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis str. Al Hakam.......... 149  7e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus cereus BAG3X2-1...................... 149  8e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VDM053........................ 149  8e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH1272........................ 149  8e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus anthracis............................ 149  8e-38  14 hits Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus IS075......................... 149  9e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH820......................... 149  9e-38  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus 95/8201....................... 149  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH187......................... 149  1e-37  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Paucisalibacillus globulus.................... 149  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Pauc...   
. .Bacillus anthracis str. H9401................. 149  1e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus MSX-D12....................... 149  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus anthracis str. Ames.................. 149  1e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH621......................... 148  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BDRD-ST196.................... 148  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus m1293......................... 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus MSX-A1........................ 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus MM3........................... 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD048......................... 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar konkukian str. 9 148  2e-37  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VDM062........................ 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VDM034........................ 147  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus weihenstephanensis NBRC 101238....... 147  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus...   
. .Bacillus cereus W............................. 147  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus FRI-35........................ 147  3e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar monterrey BGSC 4 147  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar andalousiensis B 147  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus alcalophilus......................... 147  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD156......................... 147  5e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus HuA4-10....................... 147  5e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD142......................... 146  7e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus R309803....................... 146  8e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD131......................... 146  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH676......................... 146  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG4X12-1..................... 145  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Rock4-2....................... 145  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus mycoides............................. 145  2e-36  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein DJ93_4954 [Bacillus mycoi...   
. .Bacillus cereus VD133......................... 145  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG1O-3....................... 145  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus Rock1-15...................... 145  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis BMB171................. 145  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus weihenstephanensis FSL R5-860........ 145  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus ...   
. .Bacillus mycoides DSM 2048.................... 144  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar pondicheriensis  144  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG1X1-2...................... 144  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus sp. WBUNB009......................... 144  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD200......................... 144  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus F65185........................ 144  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar pakistani str. T 144  6e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus cereus ATCC 14579.................... 144  6e-36  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  RecName: Full=Anhydro-N-acetylmuramic ...   
. .Bacillus cereus CER057........................ 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD184......................... 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BDRD-ST24..................... 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BDRD-Cer4..................... 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar huazhongensis BG 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD014......................... 144  8e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD045......................... 144  9e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis YBT-1518............... 143  9e-36  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH1271........................ 143  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus AH1134........................ 143  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus m1550......................... 143  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus thuringiensis serovar chinensis CT-43 142  2e-35  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD166......................... 142  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. WBUNB004......................... 142  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG3O-2....................... 142  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus cereus BAG5X1-1...................... 142  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus B4264......................... 142  3e-35  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus bombysepticus str. Wang.............. 142  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus ...   
. .Bacillus cereus BAG6O-2....................... 142  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG2X1-2...................... 142  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VDM019........................ 141  4e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus subtilis............................. 141  6e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD169......................... 141  6e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus BAG2X1-1...................... 141  8e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus 172560W....................... 140  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus ATCC 10876.................... 140  2e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus selenitireducens..................... 140  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [ [Bacillus seleniti...   
. .Bacillus megaterium........................... 139  2e-34  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. RP1137........................... 139  2e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. 171095_106....................... 138  7e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Thalassobacillus devorans..................... 138  8e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Thal...   
. .Bacillus cereus BAG5X2-1...................... 137  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VD136......................... 137  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. m3-13............................ 137  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus flexus............................... 137  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus cereus VDM006........................ 137  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. TS-2............................. 137  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative anhydro-N-acetylmuramic acid kinase ...   
. .Bacillus sp. JCM 19045........................ 136  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus...   
. .Bacillus pseudomycoides DSM 12442............. 135  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Bacillus sp. 278922_107....................... 135  6e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus megaterium WSH-002................... 135  6e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus megaterium QM B1551.................. 135  8e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Tumebacillus flagellatus...................... 135  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein EL26_09635 [Tumebacillus ...   
. .Bacillus cereus Rock3-44...................... 133  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. MB2021........................... 133  6e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus sp. UNC437CL72CviS29................. 131  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Virgibacillus halodenitrificans............... 127  5e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Anhydro-N-acetylmuramic acid kinase [Virgibac...   
. .Bacillus cereus VDM022........................ 124  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci...   
. .Bacillus subtilis BEST7613.................... 117  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  RecName: Full=Anhydro-N-acetylmuramic ...   
. .Bacillus mycoides Rock1-4..................... 98.2 1e-20  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Baci... 
. .Bacillus sp. GeD10............................ 87.0 6e-17  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Anhydro-N-acetylmuramic acid kinase [Baci... 
. .Bacillus anthracis 9080-G..................... 85.1 5e-16  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Bacillus ... 
. .Bacillus thuringiensis serovar israelensis ATCC 68.2 3e-10  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus thuringien... 
. .Cohnella panacarvi............................ 152  1e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Cohn...   
. .Cohnella laeviribosi.......................... 146  9e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Cohnella laeviribosi]    
. .Brevibacillus laterosporus.................... 145  2e-36  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Paenibacillus sanguinis....................... 145  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus sangu...   
. .Paenibacillus sp. oral taxon 786.............. 145  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. J14......................... 144  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus harenae......................... 144  8e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Brevibacillus laterosporus GI-9............... 142  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Paenibacillus sp. FSL R7-269.................. 142  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Brevibacillus laterosporus PE36............... 141  4e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Brevibacillus laterosporus LMG 15441.......... 140  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brevibaci...   
. .Paenibacillus barengoltzii.................... 139  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus baren...   
. .Listeria weihenstephanensis FSL R9-0317....... 136  3e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Listeria ...   
. .Listeria riparia FSL S10-1204................. 136  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Listeriac...   
. .Sporolactobacillus laevolacticus.............. 135  9e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Spor...   
. .Cohnella thermotolerans....................... 134  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Cohn...   
. .Paenibacillus sp. FSL H8-237.................. 134  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Paenibacillus pini JCM 16418.................. 131  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibac...   
. .Paenibacillus alvei........................... 129  1e-30  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Listeria cornellensis FSL F6-969.............. 129  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Listeriac...   
. .Paenibacillus sp. Y412MC10.................... 128  3e-30  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. UNC217MF.................... 128  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. JCM 10914................... 127  1e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus daejeonensis.................... 126  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus daeje...   
. .Paenibacillus alvei DSM 29.................... 125  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus terrigena....................... 125  4e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus terri...   
. .Paenibacillus dendritiformis.................. 125  4e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Tuberibacillus calidus........................ 125  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Tube...   
. .Listeria grandensis FSL F6-971................ 124  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Listeriac...   
. .Paenibacillus sabinae T27..................... 124  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Paenibacillus alvei TS-15..................... 124  9e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Bacillales.................................... 122  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Paenibacillus sp. MSt1........................ 120  1e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Paenibacillus larvae.......................... 120  1e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase AnmK ...   
. .Paenibacillus................................. 120  2e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Paenibacillus ehimensis....................... 119  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus senegalensis.................... 119  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus forsythiae...................... 119  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. HGF5........................ 119  4e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. URHA0014.................... 119  6e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus pasadenensis.................... 118  7e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. FSL H8-457.................. 118  8e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Brevibacillus thermoruber..................... 118  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Brevibacillus panacihumi...................... 117  3e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Paenibacillus assamensis...................... 115  6e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus alginolyticus................... 113  5e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus sp. OSY-SE...................... 111  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus sp. O...   
. .Paenibacillus sp. FSL R5-808.................. 110  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Paenibacillus vortex.......................... 110  4e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen...   
. .Brevibacillus sp. phR......................... 110  5e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Brevibacillus sp. phR]   
. .Paenibacillus sp. FSL R5-192.................. 109  9e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Brevibacillus borstelensis.................... 109  9e-24  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Paenibacillus sp. FSL H7-689.................. 109  1e-23  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibaci...   
. .Brevibacillus brevis.......................... 108  2e-23  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Brevibacillus sp. BC25........................ 108  2e-23  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Brev...   
. .Paenibacillus sp. PAMC 26794.................. 108  3e-23  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus sp. P...   
. .Paenibacillus sp. TCA20....................... 103  6e-22  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paenibac...   
. .Paenibacillus sp. P22......................... 100  3e-21  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Anhydro-N-acetylmuramic acid kinase [Paen...   
. .Paenibacillus elgii........................... 60.5 7e-08  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  anhydro-N-acetylmuramic acid kinase [Paen... 
. .Candidatus Stoquefichus massiliensis.......... 154  1e-39  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: anhydro-N-acetylmuramic acid kinase [Cand...   
. .Enterococcus casseliflavus.................... 152  7e-39  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus faecalis......................... 152  8e-39  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus sp. C1........................... 152  8e-39  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus faecium.......................... 151  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus flavescens ATCC 49996............ 150  3e-38  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus cassel...   
. .Enterococcus casseliflavus EC20............... 150  3e-38  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus casseliflavus 14-MB-W-14......... 150  4e-38  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus gallinarum EG2................... 150  5e-38  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Enterococ...   
. .Enterococcus casseliflavus EC30............... 149  6e-38  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus saccharolyticus.................. 149  7e-38  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus gallinarum....................... 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Enterococcus sulfureus........................ 148  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus sulfur...   
. .Granulicatella adiacens....................... 147  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Gran...   
. .Clostridium sp. Ade.TY........................ 145  2e-36  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Coprobacillus................................. 144  3e-36  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Enterococcus phoeniculicola................... 143  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus phoeni...   
. .Carnobacterium sp. 17-4....................... 143  1e-35  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Carn...   
. .Clostridium butyricum......................... 143  1e-35  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Enterococcus sp. TR........................... 142  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Ente...   
. .Clostridium butyricum 60E.3................... 142  3e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium butyricum]   
. .Clostridium butyricum DKU-01.................. 142  3e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Caloramator sp. ALD01......................... 142  3e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Calo...   
. .Carnobacterium jeotgali....................... 141  5e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Carn...   
. .Carnobacterium sp. AT7........................ 140  2e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Carn...   
. .Clostridium tunisiense........................ 139  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium tunisie...   
. .Thermoanaerobacter indiensis.................. 138  8e-34  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Caldicoprobacter oshimai...................... 138  1e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Cald...   
. .Carnobacterium maltaromaticum................. 137  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Carn...   
. .Enterococcus moraviensis...................... 137  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus moravi...   
. .Thermoanaerobacter ethanolicus................ 137  2e-33  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Carnobacterium maltaromaticum LMA28........... 136  3e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: uncharacterised family protein [Carnobact...   
. .Eremococcus coleocola......................... 136  4e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Erem...   
. .Enterococcus haemoperoxidus................... 134  3e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus haemop...   
. .Eremococcus coleocola ACS-139-V-Col8.......... 133  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: anhydro-N-acetylmuramic acid kinase [Erem...   
. .Clostridium lundense.......................... 133  5e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Alkalibacterium sp. AK22...................... 133  5e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Anhydro-N-acetylmuramic acid kinase [Alkalibac...   
. .Allobaculum stercoricanis..................... 131  2e-31  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [Allobaculum stercor...   
. .Enterococcus caccae........................... 130  4e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus caccae]     
. .Clostridium celatum........................... 130  5e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Erysipelothrix tonsillarum.................... 130  8e-31  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [Erysipelothrix tons...   
. .Thermosediminibacter oceani................... 129  2e-30  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Erysipelothrix rhusiopathiae.................. 129  2e-30  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: anhydro-N-acetylmuramic acid kinase [Erys...   
. .Erysipelothrix rhusiopathiae ATCC 19414....... 129  2e-30  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: anhydro-N-acetylmuramic acid kinase [Erys...   
. .Caldanaerobacter subterraneus................. 125  2e-29  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Cald...   
. .Thermoanaerobacter tengcongensis MB4.......... 125  3e-29  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Cald...   
. .Thermoanaerobacter mathranii.................. 125  3e-29  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Caldanaerobacter subterraneus subsp. yonseiensi 124  6e-29  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: anhydro-N-acetylmuramic acid kinase [Caldanaer...   
. .Clostridium difficile......................... 123  2e-28  44 hits Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridiales bacterium oral taxon 876........ 123  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Clostridium difficile DA00065................. 123  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD175................... 122  3e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Sulfobacillus thermosulfidooxidans............ 120  1e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Sulfobacillus therm...   
. .Clostridium cellobioparum..................... 120  1e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [ [Cl...   
. .Clostridium phytofermentans................... 119  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Clostridium difficile P71..................... 119  4e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium paraputrificum.................... 119  5e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos...   
. .Clostridium termitidis........................ 119  6e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [ [Cl...   
. .Clostridiaceae bacterium L21-TH-D2............ 119  6e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase [Clos...   
. .Sulfobacillus acidophilus..................... 116  5e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Sulf...   
. .Clostridium difficile E10..................... 115  7e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase (AnhM...   
. .Alkaliphilus metalliredigens.................. 115  7e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Alka...   
. .Clostridium difficile NAP08................... 115  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile T5...................... 115  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase (AnhM...   
. .Butyrivibrio sp. AE2015....................... 114  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Buty...   
. .Butyrivibrio proteoclasticus.................. 113  3e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Butyrivibrio proteo...   
. .Halonatronum saccharophilum................... 112  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: anhydro-N-acetylmuramic acid kinase [Halo...   
. .Clostridium difficile P42..................... 111  2e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD44.................... 111  2e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD196................... 110  3e-24  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile 050-P50-2011............ 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile P45..................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P53..................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile 70-100-2010............. 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile CD34.................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile T22..................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase (AnhMurNA...   
. .Clostridium difficile CD18.................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile DA00211................. 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P13..................... 110  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD3..................... 110  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P49..................... 110  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P6...................... 110  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile CD169................... 110  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P29..................... 110  5e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD165................... 107  1e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile 630..................... 107  4e-23  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile E19..................... 107  4e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase (AnhMurNA...   
. .Clostridium difficile CD42.................... 107  4e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [[Clo...   
. .Clostridium difficile P7...................... 107  5e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile CD8..................... 107  6e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile T23..................... 106  8e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Anhydro-N-acetylmuramic acid kinase (AnhMurNA...   
. .Clostridium difficile DA00238................. 106  8e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile 6042.................... 106  8e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile Y381.................... 106  9e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile F314.................... 106  9e-23  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Clostridium difficile P59..................... 106  1e-22  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi...   
. .Subdoligranulum sp. 4_3_54A2FAA............... 105  2e-22  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Subd...   
. .Clostridium sp. D5............................ 95.5 8e-19  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: anhydro-N-acetylmuramic acid kinase [Clos... 
. .Clostridiales bacterium VE202-21.............. 94.4 2e-18  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiales bacte... 
. .Enterococcus gallinarum EGD-AAK12............. 86.3 7e-17  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein N036_71705 [Enterococcus ... 
. .Clostridium difficile DA00313................. 82.0 4e-15  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Clostridium difficile Y165.................... 80.5 9e-15  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Clostridium difficile Y266.................... 78.2 8e-14  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Clostridium difficile CD206................... 71.2 2e-11  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Clostridium difficile DA00145................. 58.5 1e-07  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Clostridium difficile CD69.................... 58.2 1e-07  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [[Clostridium] diffi... 
. .Desulfosporosinus orientis.................... 40.8 0.71   1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: CoA activase [Desulfosporosinus orientis]    
. .Acholeplasma oculi............................ 164  2e-43  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: Anhydro-N-acetylmuramic acid kinase [Acholepl...   
. .Acholeplasma brassicae........................ 163  4e-43  3 hits  Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: Anhydro-N-acetylmuramic acid kinase [Acho...   
. .Acholeplasma modicum.......................... 149  1e-37  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: hypothetical protein [Acholeplasma modicum]    
. .Acholeplasma laidlawii........................ 144  7e-36  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: anhydro-N-acetylmuramic acid kinase [Acho...   
. .Acholeplasma equifetale....................... 140  1e-34  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: anhydro-N-acetylmuramic acid kinase [Acho...   
. .Mycoplasma lipofaciens........................ 147  2e-37  1 hit   Bacteria:Tenericutes:Mollicutes:Mycoplasmatales: hypothetical protein [Mycoplasma lipofaci...   
. .Mycoplasma elephantis......................... 136  4e-33  1 hit   Bacteria:Tenericutes:Mollicutes:Mycoplasmatales: hypothetical protein [Mycoplasma elephantis]   
. .Mycoplasma anatis............................. 127  3e-30  1 hit   Bacteria:Tenericutes:Mollicutes:Mycoplasmatales: anhydro-N-acetylmuramic acid kinase [Myco...   
. .Thermotoga lettingae.......................... 161  1e-42  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Thermotoga elfii.............................. 160  3e-42  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Thermotoga thermarum.......................... 149  5e-38  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Thermotoga hypogea............................ 146  5e-37  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: hypothetical protein [Thermotoga hypogea]      
. .Mesotoga...................................... 154  5e-40  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Kosmotoga olearia............................. 149  4e-38  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: anhydro-N-acetylmuramic acid kinase [Kosm...   
. .Petrotoga mobilis............................. 135  1e-32  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: anhydro-N-acetylmuramic acid kinase [Petr...   
. .Geminocystis herdmanii........................ 158  3e-41  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Geminocystis herdma...   
. .Cyanobacterium stanieri....................... 154  1e-39  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Cyanobacterium stan...   
. .Cyanobacterium aponinum....................... 147  6e-37  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Synechococcus sp. PCC 7502.................... 145  1e-36  3 hits  Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Synechococcus sp. PC...   
. .Microcystis aeruginosa........................ 135  5e-33  13 hits Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microcystis aeruginosa PCC 9807............... 135  8e-33  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Cyanothece sp. CCY0110........................ 134  2e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Cyanothece.................................... 134  3e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Microcystis aeruginosa NIES-843............... 133  4e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Cyanothece sp. PCC 7822....................... 133  6e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Microcystis aeruginosa PCC 9806............... 132  7e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microcystis aeruginosa PCC 7941............... 132  7e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microcystis aeruginosa PCC 9432............... 132  8e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Thermosynechococcus sp. NK55.................. 132  8e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase AnmK ...   
. .Microcystis aeruginosa TAIHU98................ 132  1e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    putative family protein [Microcystis aeru...   
. .Microcystis sp. T1-4.......................... 132  1e-31  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microcystis aeruginosa PCC 9808............... 131  2e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microcystis aeruginosa PCC 7806............... 131  2e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    putative family protein [Microcystis aeru...   
. .Synechococcus sp. PCC 7336.................... 131  3e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Synechococcus sp. P...   
. .Chamaesiphon minutus.......................... 131  3e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Chamaesiphon minutus]     
. .Microcystis aeruginosa PCC 9717............... 130  6e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Candidatus Atelocyanobacterium thalassa isolate 130  7e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Candidatus Atelocyanobact...   
. .Microcystis aeruginosa PCC 9809............... 129  7e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Micr...   
. .Halothece sp. PCC 7418........................ 129  2e-30  3 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Halothece sp. PCC 7...   
. .Thermosynechococcus elongatus................. 127  6e-30  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Ther...   
. .Cyanothece sp. PCC 7424....................... 126  2e-29  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Synechococcus sp. PCC 7335.................... 125  3e-29  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Cyanothece sp. PCC 8801....................... 124  8e-29  3 hits  Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Synechococcus sp. PCC 6312.................... 123  1e-28  3 hits  Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Synechococcus sp. PC...   
. .cyanobacterium UCYN-A......................... 123  1e-28  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [cyan...   
. .Synechococcus sp. JA-2-3B'a(2-13)............. 121  6e-28  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Crocosphaera watsonii......................... 121  8e-28  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Croc...   
. .Synechocystis sp. PCC 6714.................... 121  8e-28  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Synechocy...   
. .Cyanothece sp. PCC 7425....................... 121  9e-28  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Crocosphaera watsonii WH 8501................. 121  9e-28  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Croc...   
. .Crocosphaera watsonii WH 0401................. 119  4e-27  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Croc...   
. .Crocosphaera watsonii WH 8502................. 119  4e-27  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Croc...   
. .Synechococcus sp. PCC 7002.................... 117  2e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Acaryochloris sp. CCMEE 5410.................. 116  4e-26  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Acar...   
. .Synechococcus sp. WH 7805..................... 115  6e-26  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Dactylococcopsis salina....................... 115  6e-26  1 hit   Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Dactylococcopsis sal...   
. .Cyanobium gracile............................. 115  1e-25  1 hit   Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Cyanobium gracile]        
. .Gloeocapsa sp. PCC 73106...................... 113  4e-25  2 hits  Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Gloeocapsa sp. PCC 7...   
. .Synechococcus sp. WH 7803..................... 112  9e-25  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Synechocystis sp. PCC 7509.................... 112  1e-24  1 hit   Bacteria:Cyanobacteria:Chroococcales:    molecular chaperone [Synechocystis sp. PC...   
. .Synechococcus sp. NKBG 042902................. 111  2e-24  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Synechocystis sp. PCC 6803.................... 110  3e-24  7 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Acaryochloris marina.......................... 110  4e-24  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Acar...   
. .Synechococcus sp. NKBG15041c.................. 109  9e-24  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Synechococcus elongatus....................... 108  2e-23  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Cyanobium sp. CACIA14......................... 107  4e-23  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyanobium...   
. .Gloeocapsa sp. PCC 7428....................... 107  7e-23  3 hits  Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Gloe...   
. .Synechococcus sp. RCC307...................... 103  6e-22  3 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Synechococcus elongatus PCC 6301.............. 102  2e-21  3 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Cyanobium sp. PCC 7001........................ 102  2e-21  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Cyan...   
. .Synechococcus sp. RS9916...................... 101  3e-21  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne...   
. .Synechococcus sp. KORDI-49.................... 100  9e-21  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein KR49_07095 [Synechococcus...   
. .Synechococcus sp. WH 5701..................... 95.5 5e-19  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Rubidibacter lacunae.......................... 95.1 8e-19  1 hit   Bacteria:Cyanobacteria:Chroococcales:    putative molecular chaperone distantly [R... 
. .Synechococcus sp. WH 8109..................... 93.2 3e-18  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Synechoco... 
. .Synechococcus sp. CC9616...................... 92.4 6e-18  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. KORDI-100................... 92.0 8e-18  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein KR100_14285 [Synechococcu... 
. .Synechococcus sp. WH 8102..................... 89.7 6e-17  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. RS9917...................... 88.6 2e-16  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. WH 8016..................... 87.8 2e-16  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. CC9605...................... 87.8 2e-16  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. CC9902...................... 87.0 5e-16  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. BL107....................... 82.0 3e-14  2 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. CB0101...................... 80.9 5e-14  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. CC9311...................... 80.9 8e-14  4 hits  Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Synechococcus sp. KORDI-52.................... 80.5 8e-14  1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Synechoco... 
. .Crocosphaera watsonii WH 0402................. 46.6 0.006  2 hits  Bacteria:Cyanobacteria:Chroococcales:    Anhydro-N-acetylmuramic acid kinase [Crocosph... 
. .Synechococcus sp. CB0205...................... 39.7 0.52   1 hit   Bacteria:Cyanobacteria:Chroococcales:    anhydro-N-acetylmuramic acid kinase [Syne... 
. .Gloeobacter kilaueensis....................... 154  1e-39  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: anhydro-N-acetylmuramic acid kinase [Gloe...   
. .Planktothrix.................................. 143  1e-35  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Planktothrix agardhii......................... 143  1e-35  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Plan...   
. .Planktothrix agardhii NIVA-CYA 126/8.......... 143  1e-35  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein A19Y_2051 [Planktothrix a...   
. .Planktothrix rubescens........................ 143  2e-35  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Plan...   
. .Pseudanabaena biceps.......................... 139  4e-34  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  Anhydro-N-acetylmuramic acid kinase [Pseu...   
. .Spirulina subsalsa............................ 139  5e-34  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Spirulina subsalsa]      
. .Leptolyngbya boryana.......................... 135  6e-33  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Lept...   
. .Geitlerinema sp. PCC 7407..................... 134  1e-32  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Geitlerinema sp. PC...   
. .Oscillatoria sp. PCC 10802.................... 133  6e-32  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Oscillatoria sp. PC...   
. .Pseudanabaena sp. PCC 6802.................... 130  5e-31  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Pseudanabaena sp. P...   
. .Gloeobacter violaceus......................... 129  8e-31  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: anhydro-N-acetylmuramic acid kinase [Gloe...   
. .Oscillatoriales cyanobacterium JSC-12......... 129  9e-31  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  molecular chaperone [Oscillatoriales cyan...   
. .Chroococcidiopsis thermalis................... 127  6e-30  2 hits  Bacteria:Cyanobacteria:Pleurocapsales:   hypothetical protein [Chroococcidiopsis t...   
. .Calothrix parietina........................... 125  3e-29  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Calo...   
. .Calothrix sp. 336/3........................... 125  3e-29  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Calothrix...   
. .Chlorogloeopsis sp. PCC 7702.................. 124  6e-29  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [cyan...   
. .Microcoleus sp. PCC 7113...................... 124  6e-29  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  molecular chaperone [Microcoleus sp. PCC ...   
. .Calothrix sp. PCC 7103........................ 123  1e-28  1 hit   Bacteria:Cyanobacteria:Nostocales:       hypothetical protein [Calothrix sp. PCC 7...   
. .Fischerella muscicola......................... 123  1e-28  2 hits  Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc...   
. .Mastigocladopsis repens....................... 123  2e-28  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Mast...   
. .Xenococcus sp. PCC 7305....................... 123  2e-28  2 hits  Bacteria:Cyanobacteria:Pleurocapsales:   molecular chaperone [Xenococcus sp. PCC 7...   
. .Oscillatoria acuminata........................ 123  2e-28  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  molecular chaperone [Oscillatoria acuminata]   
. .Mastigocoleus testarum........................ 122  2e-28  3 hits  Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Mast...   
. .Arthrospira sp. PCC 8005...................... 122  4e-28  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Arth...   
. .Nostoc sp. PCC 7107........................... 122  4e-28  3 hits  Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Nost...   
. .Fischerella sp. PCC 9339...................... 121  5e-28  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc...   
. .Arthrospira platensis......................... 120  1e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Arth...   
. .Leptolyngbya nodulosa......................... 120  2e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Nodosilinea nodulosa]    
. .Lyngbya sp. PCC 8106.......................... 119  3e-27  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Lyng...   
. .Nodularia spumigena........................... 119  3e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Nodu...   
. .Microchaete sp. PCC 7126...................... 119  3e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Micr...   
. .[Scytonema hofmanni] UTEX 2349................ 119  3e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [ [[S...   
. .Trichodesmium erythraeum...................... 119  3e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Tric...   
. .Stanieria cyanosphaera........................ 119  4e-27  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   Anhydro-N-acetylmuramic acid kinase [Stan...   
. .Fischerella sp. PCC 9431...................... 119  5e-27  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc...   
. .Chlorogloeopsis fritschii..................... 119  6e-27  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Chlo...   
. .Rivularia sp. PCC 7116........................ 118  7e-27  3 hits  Bacteria:Cyanobacteria:Nostocales:       molecular chaperone [Rivularia sp. PCC 7116]   
. .Fischerella sp. JSC-11........................ 118  7e-27  2 hits  Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc...   
. .filamentous cyanobacterium ESFC-1............. 118  7e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [filamentous cyanoba...   
. .Fischerella thermalis......................... 118  8e-27  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc...   
. .Pleurocapsa sp. PCC 7319...................... 118  8e-27  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   hypothetical protein [Pleurocapsa sp. PCC...   
. .Trichormus azollae............................ 118  9e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Tric...   
. .Cylindrospermum stagnale...................... 118  1e-26  1 hit   Bacteria:Cyanobacteria:Nostocales:       molecular chaperone [Cylindrospermum stag...   
. .Pseudanabaena sp. PCC 7367.................... 118  1e-26  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Pseu...   
. .Crinalium epipsammum.......................... 117  2e-26  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Crin...   
. .Leptolyngbya sp. Heron Island J............... 117  2e-26  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-n-acetylmuramic acid kinase [Lept...   
. .Leptolyngbya sp. PCC 7376..................... 117  3e-26  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Lept...   
. .Microcoleus vaginatus......................... 117  3e-26  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Micr...   
. .Nostoc punctiforme............................ 115  1e-25  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Nost...   
. .Leptolyngbya sp. PCC 7375..................... 114  2e-25  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  molecular chaperone [Leptolyngbya sp. PCC...   
. .Raphidiopsis brookii.......................... 114  2e-25  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Raph...   
. .Anabaena cylindrica........................... 114  2e-25  1 hit   Bacteria:Cyanobacteria:Nostocales:       Anhydro-N-acetylmuramic acid kinase [Anab...   
. .Pleurocapsa minor............................. 114  2e-25  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   molecular chaperone [Pleurocapsa minor]        
. .Oscillatoria nigroviridis..................... 114  3e-25  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  Anhydro-N-acetylmuramic acid kinase [Osci...   
. .Dolichospermum circinale...................... 113  3e-25  2 hits  Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Doli...   
. .Geitlerinema sp. PCC 7105..................... 113  5e-25  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Geit...   
. .Calothrix sp. PCC 7507........................ 112  7e-25  3 hits  Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Calo...   
. .Cylindrospermopsis raciborskii................ 112  1e-24  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Cyli...   
. .Anabaena sp. PCC 7108......................... 112  1e-24  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Anab...   
. .Anabaena sp. 90............................... 110  3e-24  3 hits  Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Anab...   
. .Scytonema hofmanni............................ 110  4e-24  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Scyt...   
. .Nostoc sp. PCC 7524........................... 110  4e-24  3 hits  Bacteria:Cyanobacteria:Nostocales:       molecular chaperone [Nostoc sp. PCC 7524]      
. .Aphanizomenon flos-aquae...................... 110  5e-24  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Apha...   
. .Anabaena variabilis........................... 110  6e-24  1 hit   Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Anab...   
. .Nostoc sp. PCC 7120........................... 109  7e-24  4 hits  Bacteria:Cyanobacteria:Nostocales:       anhydro-N-acetylmuramic acid kinase [Nost...   
. .Lyngbya aestuarii............................. 108  1e-23  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Lyngbya aestuarii]       
. .Leptolyngbya sp. PCC 6406..................... 107  7e-23  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  molecular chaperone [Leptolyngbya sp. PCC...   
. .Prochlorothrix hollandica..................... 107  8e-23  1 hit   Bacteria:Cyanobacteria:Prochlorales:     hypothetical protein [Prochlorothrix holl...   
. .Coleofasciculus chthonoplastes................ 103  1e-21  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Cole...   
. .Prochlorococcus marinus....................... 100  1e-20  6 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc...   
. .Fischerella sp. PCC 9605...................... 97.8 1e-19  1 hit   Bacteria:Cyanobacteria:Stigonematales:   anhydro-N-acetylmuramic acid kinase [Fisc... 
. .Prochlorococcus sp. scB245a_518D8............. 95.9 3e-19  1 hit   Bacteria:Cyanobacteria:Prochlorales:     hypothetical protein [Prochlorococcus sp.... 
. .Prochlorococcus marinus str. MIT 9303......... 95.1 8e-19  3 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc... 
. .Moorea producta............................... 93.6 6e-18  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  anhydro-N-acetylmuramic acid kinase [Moor... 
. .Prochlorococcus marinus subsp. marinus str. CCM 90.5 3e-17  3 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc... 
. .Prochlorococcus marinus str. MIT 9313......... 89.7 5e-17  3 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc... 
. .Prochlorococcus marinus str. NATL1A........... 87.8 2e-16  3 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc... 
. .Prochlorococcus marinus str. NATL2A........... 87.8 3e-16  3 hits  Bacteria:Cyanobacteria:Prochlorales:     anhydro-N-acetylmuramic acid kinase [Proc... 
. .Oscillatoria sp. PCC 6506..................... 46.6 0.006  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  Anhydro-N-acetylmuramic acid kinase (frag... 
. .Richelia intracellularis...................... 46.2 0.007  1 hit   Bacteria:Cyanobacteria:Nostocales:       Anhydro-N-acetylmuramic acid kinase [Richelia... 
. .Chroococcidiopsis thermalis PCC 7203.......... 39.3 1.9    4 hits  Bacteria:Cyanobacteria:Pleurocapsales:   hypothetical protein [Chroococcidiopsis t... 
. .endosymbiont of unidentified scaly snail isolat 156  2e-40  1 hit   Bacteria::                               anhydro-N-acetylmuramic acid kinase [endosymb...   
. .Meiothermus sp. CAL-12........................ 145  1e-36  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Meio...   
. .Meiothermus ruber............................. 144  2e-36  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: hypothetical protein [Meiothermus ruber]       
. .Meiothermus silvanus.......................... 127  5e-30  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: hypothetical protein [Meiothermus silvanus]    
. .Meiothermus timidus........................... 124  7e-29  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Meio...   
. .Meiothermus taiwanensis....................... 124  7e-29  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Meio...   
. .Meiothermus chliarophilus..................... 122  3e-28  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Meio...   
. .Oceanithermus profundus....................... 112  7e-25  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: hypothetical protein [Oceanithermus profu...   
. .Thermus scotoductus........................... 104  2e-22  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Thermus islandicus............................ 92.8 3e-18  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: anhydro-N-acetylmuramic acid kinase [Ther... 
. .Deinococcus aquatilis......................... 117  2e-26  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein...   
. .Deinococcus marmoris.......................... 111  2e-24  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein...   
. .Deinococcus peraridilitoris................... 104  5e-22  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: molecular chaperone [Deinococcus peraridi...   
. .Deinococcus radiodurans....................... 103  7e-22  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein...   
. .Deinococcus deserti........................... 99.4 2e-20  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein... 
. .Deinococcus xibeiensis........................ 98.6 5e-20  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein... 
. .Deinococcus wulumuqiensis..................... 98.6 6e-20  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: hypothetical protein [Deinococcus wulumuq... 
. .Deinococcus frigens........................... 96.7 2e-19  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein... 
. .Deinococcus gobiensis......................... 95.1 8e-19  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein... 
. .Deinococcus geothermalis...................... 94.4 1e-18  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Dein... 
. .Deinococcus phoenicis......................... 93.2 4e-18  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: anhydro-N-acetylmuramic acid kinase [Deinococc... 
. .Deinococcus radiodurans R1.................... 62.8 1e-07  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: hypothetical protein [Deinococcus radiodu... 
. .Haloplasma contractile........................ 145  2e-36  1 hit   Bacteria::Haloplasmatales:               anhydro-N-acetylmuramic acid kinase [Halo...   
. .Sciscionella marina........................... 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Sciscionella marina]     
. .Sciscionella sp. SE31......................... 144  4e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Sciscionella sp. SE31]   
. .Saccharopolyspora spinosa..................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Saccharopolyspora erythraea................... 123  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Amycolatopsis thermoflava..................... 123  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Amycolatopsis sp. ATCC 39116.................. 120  2e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Saccharopolyspora rectivirgula................ 119  4e-27  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Allokutzneria albata.......................... 117  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Allo...   
. .Pseudonocardia sp. P1......................... 117  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. .Amycolatopsis methanolica..................... 116  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Amycolatopsis azurea.......................... 112  9e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Amycolatopsis nigrescens...................... 111  3e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Amycolatopsis nigre...   
. .Saccharomonospora viridis..................... 109  1e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Amycolatopsis sp. MJM2582..................... 109  1e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amycolato...   
. .Pseudonocardia spinosispora................... 108  1e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Pseu...   
. .Kutzneria albida DSM 43870.................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein KALB_7327 [Kutzneria albi...   
. .Amycolatopsis japonica........................ 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Amycolato...   
. .Amycolatopsis balhimycina..................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Amycolatopsis alba............................ 108  3e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Kutzneria sp. 744............................. 108  2e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Kutzneria...   
. .Saccharomonospora azurea...................... 105  2e-22  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Saccharomonospora cyanea...................... 105  2e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Amycolatopsis orientalis...................... 104  4e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Amycolatopsis decaplanina..................... 103  7e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Saccharomonospora marina...................... 103  7e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Saccharomonospora glauca...................... 103  1e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Amycolatopsis vancoresmycina.................. 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Saccharomonospora azurea SZMC 14600........... 101  8e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Amycolatopsis mediterranei.................... 101  8e-21  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc...   
. .Actinomycetospora chiangmaiensis.............. 100  1e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomycetospora c...   
. .Saccharomonospora sp. CNQ490.................. 98.6 5e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc... 
. .Amycolatopsis rifamycinica.................... 97.8 1e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amycolato... 
. .Saccharomonospora xinjiangensis............... 96.3 3e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Sacc... 
. .Actinoalloteichus cyanogriseus................ 94.7 1e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Acti... 
. .Amycolatopsis benzoatilytica.................. 88.2 3e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Amyc... 
. .Kutzneria albida.............................. 85.1 6e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Kutz... 
. .Lentzea albidocapillata....................... 113  4e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Lent...   
. .Lechevalieria aerocolonigenes................. 113  5e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Lech...   
. .Saccharothrix espanaensis..................... 108  1e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Sacc...   
. .Actinokineospora sp. EG49..................... 101  4e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Actinokin...   
. .Actinosynnema mirum........................... 90.9 2e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Acti... 
. .Streptomyces sp. SPB74........................ 138  7e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Nocardiopsis alba............................. 138  1e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Streptomyces sp. NRRL F-5630.................. 136  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. SA3_actG..................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. SPB78........................ 133  4e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. Tu6071....................... 133  5e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Brachybacterium faecium....................... 133  7e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brac...   
. .Nonomuraea coxensis........................... 132  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Nono...   
. .Streptomyces sp. SA3_actF..................... 130  4e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Catellatospora koreensis...................... 129  1e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Cate...   
. .Streptomyces violaceorubidus.................. 129  1e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Micromonospora sp. M42........................ 129  1e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micromono...   
. .Streptomyces sp. NRRL F-2890.................. 128  4e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Micromonospora purpureochromogenes............ 127  4e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Propionibacteriaceae bacterium P6A17.......... 126  1e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Propionibacteriacea...   
. .Streptomyces coelicoflavus ZG0656............. 126  1e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Streptomy...   
. .Streptomyces natalensis....................... 125  2e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Catenulispora acidiphila...................... 125  2e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Cate...   
. .Micromonospora sp. CNB394..................... 125  3e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Promicromonospora sukumoe..................... 124  6e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Prom...   
. .Aestuariimicrobium kwangyangense.............. 123  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Aestuariimicrobium ...   
. .Streptomyces sp. PCS3-D2...................... 123  2e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Streptomy...   
. .Streptomyces sp. CNT371....................... 122  3e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Brachybacterium phenoliresistens.............. 122  3e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brachybac...   
. .Janibacter sp. HTCC2649....................... 122  3e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Jani...   
. .Nocardia brasiliensis......................... 122  3e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Nocardiopsis lucentensis...................... 122  3e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Streptomyces.................................. 122  4e-28  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: hypothetical protein [Strep...   
. .Micromonospora sp. L5......................... 122  4e-28  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Micromonospora aurantiaca..................... 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Streptomyces sp. CNS335....................... 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN...   
. .Streptomyces lavenduligriseus................. 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Micromonospora globosa........................ 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Microbispora sp. ATCC PTA-5024................ 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Microbisp...   
. .Streptomyces sp. CNQ329....................... 122  5e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Nocardiopsis ganjiahuensis.................... 121  6e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Nocardiopsis sp. 20028........................ 121  7e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis vallif...   
. .Microbacterium oxydans UCD-TDU................ 121  7e-28  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium sp. ...   
. .Micromonospora chokoriensis................... 121  8e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Nocardiopsis synnemataformans................. 121  8e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Micromonospora parva.......................... 121  8e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Nocardiopsis xinjiangensis.................... 121  9e-28  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Streptomyces sp. AA0539....................... 120  1e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. AA...   
. .Streptomyces sp. MspMP-M5..................... 120  2e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL S-813................... 119  4e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. CNQ766....................... 119  4e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN...   
. .Streptomyces sp. BoleA5....................... 119  6e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL F-4474.................. 118  7e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces olivaceus........................ 118  9e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces violaceoruber.................... 118  9e-27  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces virginiae........................ 118  1e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Nesterenkonia sp. F........................... 117  1e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Nest...   
. .Streptomyces sp. NRRL S-98.................... 117  2e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Microbacterium sp. URHA0036................... 117  2e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Nocardiopsis kunsanensis...................... 117  3e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Microbacterium................................ 117  3e-26  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: anhydro-N-acetylmuramic aci...   
. .Streptomyces lividans......................... 116  4e-26  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL F-5650.................. 116  5e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces albulus.......................... 116  5e-26  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces albulus]    
. .Streptomyces lividans TK24.................... 115  6e-26  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces albulus PD-1..................... 115  6e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Streptomy...   
. .Nocardiopsis sp. CNS639....................... 115  7e-26  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Streptomyces sp. NRRL F-2664.................. 115  1e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL S-31.................... 115  1e-25  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Cellulosimicrobium cellulans.................. 115  1e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Cellulosimicrobium ...   
. .Streptosporangium roseum...................... 114  2e-25  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Mycobacterium smegmatis....................... 114  2e-25  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Myco...   
. .Nocardia brasiliensis NBRC 14402.............. 114  2e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Nocardia...   
. .Nocardiopsis salina........................... 114  3e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis salina]     
. .Kribbella flavida............................. 114  3e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Krib...   
. .Streptomyces sp. NRRL S-1022.................. 114  3e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces vitaminophilus................... 114  3e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces vitami...   
. .Serinicoccus marinus.......................... 113  4e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Seri...   
. .Streptomyces coelicolor....................... 113  4e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Oerskovia turbata............................. 113  5e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Oerskovia turbata]       
. .Nocardiopsis dassonvillei..................... 113  5e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Stackebrandtia nassauensis.................... 113  6e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stac...   
. .Mycobacterium smegmatis str. MC2 155.......... 112  7e-25  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Myco...   
. .Phycicoccus jejuensis......................... 112  9e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Phyc...   
. .Actinopolyspora mortivallis................... 112  9e-25  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolyspora mor...   
. .Microbacterium barkeri........................ 112  1e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium bark...   
. .Ornithinimicrobium pekingense................. 112  1e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Orni...   
. .Nocardiopsis halophila........................ 112  1e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis haloph...   
. .Streptomyces hygroscopicus.................... 112  1e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. C............................ 112  2e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL F-2799.................. 111  2e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL B-24720................. 111  2e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces achromogenes..................... 111  2e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Brachybacterium paraconglomeratum............. 110  4e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brac...   
. .Streptomyces aurantiacus...................... 110  4e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Anhydro-N-acetylmuramic acid kin...   
. .Nocardiopsis prasina.......................... 110  4e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis prasina]    
. .Austwickia chelonae........................... 110  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Aust...   
. .Streptomyces ruber............................ 110  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Microbacterium paraoxydans.................... 110  5e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Streptomyces sp. NRRL F-2580.................. 110  6e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sulphureus....................... 109  8e-24  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL S-378................... 108  1e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces flavotricini..................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Brachybacterium squillarum.................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brac...   
. .Arthrobacter sp. 35W.......................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Arth...   
. .Kribbella catacumbae.......................... 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Krib...   
. .Streptomyces aureocirculatus.................. 108  2e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces fulvoviolaceus................... 108  3e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Microbacterium maritypicum.................... 107  3e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium mari...   
. .Streptomycetaceae bacterium MP113-05.......... 107  4e-23  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomycetaceae b...   
. .Streptomyces sp. NRRL S-1824.................. 107  5e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL WC-3744................. 107  5e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces seoulensis....................... 106  8e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL S-237................... 106  9e-23  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Paraoerskovia marina.......................... 105  1e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Para...   
. .Nocardiopsis potens........................... 105  2e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis potens]     
. .Actinopolymorpha alba......................... 104  4e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolymorpha alba]   
. .Streptomyces sp. CNH099....................... 104  4e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces megasporus....................... 104  4e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. NRRL S-241................... 104  5e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Arthrobacter castelli......................... 103  9e-22  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Arthrobacter castelli]   
. .Streptomyces flavovariabilis.................. 103  1e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Nocardiopsis chromatogenes.................... 103  1e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis chroma...   
. .Streptomyces xanthophaeus..................... 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Nocardiopsis alkaliphila...................... 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Noca...   
. .Brevibacterium casei.......................... 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brev...   
. .Microbacterium sp. 292MF...................... 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Microbacterium sp. ...   
. .Streptomyces sp. PRh5......................... 102  2e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Streptomy...   
. .Streptomyces sp. NRRL S-475................... 102  3e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Agromyces subbeticus.......................... 101  6e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Agro...   
. .Streptomyces sp. NRRL S-920................... 101  6e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces lavendulae....................... 101  6e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces sp. PsTaAH-124................... 100  8e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces katrae........................... 100  9e-21  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Streptomyces violaceusniger................... 100  1e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre...   
. .Microbispora rosea............................ 100  1e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Micr...   
. .Streptomyces sp. Tu 6176...................... 99.8 2e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Streptomy... 
. .Streptomyces iranensis........................ 99.8 2e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Anhydro-N-acetylmuramic acid kinase [Streptom... 
. .Streptomyces avermitilis...................... 99.4 3e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. Ame12xE9..................... 99.4 3e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Serinicoccus profundi......................... 99.0 3e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Seri... 
. .Streptomyces sp. NRRL B-1347.................. 98.6 5e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. NRRL S-646................... 98.2 6e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces prunicolor....................... 97.8 8e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. e14.......................... 97.8 9e-20  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sclerotialus..................... 97.8 9e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces bingchenggensis.................. 97.8 9e-20  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Brevibacterium linens......................... 97.8 1e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brev... 
. .Streptomyces rapamycinicus.................... 97.4 1e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Brevibacterium sp. VCM10...................... 97.4 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Brev... 
. .Streptomyces sp. 142MFCol3.1.................. 97.1 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Rhodococcus erythropolis...................... 97.1 2e-19  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. .Rhodococcus erythropolis DN1.................. 97.1 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Rhod... 
. .Streptomyces sp. NRRL F-2747.................. 97.1 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Actinopolyspora halophila..................... 97.1 2e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolyspora hal... 
. .Actinocatenispora sera........................ 96.7 3e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Acti... 
. .Streptomyces sp. NRRL S-118................... 96.3 3e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. HGB0020...................... 96.3 3e-19  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Arthrobacter sp. H5........................... 96.3 4e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Arthrobacter sp. H5]   
. .Streptomyces sp. R1-NS-10..................... 95.9 4e-19  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces viridochromogenes................ 95.5 6e-19  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Anhydro-N-acetylmuramic acid kin... 
. .Leifsonia aquatica............................ 95.1 7e-19  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Leifsonia aquatica]    
. .Dermabacter sp. HFH0086....................... 94.7 1e-18  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Dermabacter sp. HFH... 
. .Rhodococcus................................... 94.4 2e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: hypothetical protein [Rhodo... 
. .Streptomyces sp. AA4.......................... 94.0 2e-18  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Dermabacter hominis 1368...................... 93.6 3e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Dermabact... 
. .Streptomyces collinus......................... 93.2 3e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces durhamensis...................... 92.0 8e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. C34(2013).................... 91.3 1e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. C3... 
. .Streptomyces sp. CNT302....................... 90.5 4e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN... 
. .Streptomyces sp. CNS615....................... 90.5 4e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. CN... 
. .Streptomyces sp. NRRL S-87.................... 90.1 5e-17  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. CNR698....................... 89.4 1e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces sp. CNS606....................... 88.6 2e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Beutenbergia cavernae......................... 88.2 2e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Beut... 
. .Agromyces italicus............................ 87.0 8e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Agro... 
. .Streptomyces sp. NRRL S-244................... 83.6 1e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces peruviensis...................... 78.6 7e-14  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces griseoflavus..................... 75.9 1e-12  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Nocardiopsis halotolerans..................... 68.9 2e-10  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardiopsis haloto... 
. .Leifsonia xyli................................ 64.7 2e-08  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: aspartyl/glutamyl-tRNA amidotransferase s... 
. .Streptomyces sp. NRRL F-5140.................. 50.8 1e-04  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Streptomyces himastatinicus................... 43.9 0.064  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: anhydro-N-acetylmuramic acid kinase [Stre... 
. .Leifsonia xyli subsp. xyli str. CTCB07........ 37.7 6.0    2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: HIT family hydrolase [Leifsonia xyli]        
. .Leifsonia xyli subsp. cynodontis DSM 46306.... 37.7 6.8    4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Leifsonia xyli]        
. .Bifidobacterium kashiwanohense JCM 15439...... 92.8 5e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: anhydro-N-acetylmuramic acid kinase [Bifidobac... 
. .Bifidobacterium dentium....................... 92.0 9e-18  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: hypothetical protein [Bifidobacterium den... 
. .Bifidobacterium scardovii..................... 87.4 4e-16  1 hit   Bacteria:Actinobacteria:Actinobacteria:Bifidobacteriales: anhydro-N-acetylmuramic acid kinase [Bifidobac... 
. .Atopobium vaginae............................. 139  5e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: anhydro-N-acetylmuramic acid kinase [Atop...   
. .Atopobium vaginae DSM 15829................... 136  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: anhydro-N-acetylmuramic acid kinase [Atop...   
. .Atopobium..................................... 135  1e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: MULTISPECIES: hypothetical protein [Atopo...   
. .Collinsella stercoris......................... 129  2e-30  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: hypothetical protein [Collinsella stercoris]   
. .Solirubrobacter soli.......................... 126  1e-29  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: anhydro-N-acetylmuramic acid kinase [Soli...   
. .Olsenella profusa............................. 38.9 2.3    1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: anhydro-N-acetylmuramic acid kinase-like ... 
. .BRC1 bacterium SCGC AAA257-C11................ 144  4e-36  1 hit   Bacteria::                               hypothetical protein [candidate division ...   
. .Singulisphaera acidiphila..................... 138  1e-33  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: molecular chaperone [Singulisphaera acidi...   
. .planctomycete KSU-1........................... 107  8e-23  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: anhydro-N-acetylmuramic acid kinase [plan...   
. .Rhodopirellula baltica........................ 39.3 4.5    1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutathione-regulated potassium-efflux sy... 
. .Candidatus Kuenenia stuttgartiensis........... 119  3e-27  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: conserved hypothetical protein [Candidatus Ku...   
. .Phycisphaera mikrensis........................ 85.5 5e-15  1 hit   Bacteria:Planctomycetes:Phycisphaerae:Phycisphaerales: anhydro-N-acetylmuramic acid kinase/N-ace... 
. .Gemmatimonas aurantiaca....................... 137  1e-33  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: anhydro-N-acetylmuramic acid kinase [Gemm...   
. .Gemmatimonas sp. AP64......................... 123  1e-28  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: hypothetical protein [Gemmatimonas sp. AP64]   
. .Gemmatimonadetes bacterium KBS708............. 110  6e-24  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes: Anhydro-N-acetylmuramic acid kinase [Gemmatimo...   
. .Acidobacteriaceae bacterium KBS 83............ 134  2e-32  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Acidobacteria bacterium KBS 146............... 127  4e-30  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Acid...   
. .Acidobacteriaceae bacterium TAA166............ 126  1e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Acid...   
. .Granulicella mallensis........................ 125  2e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Gran...   
. .Terriglobus saanensis......................... 119  3e-27  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Terr...   
. .Terriglobus roseus............................ 116  5e-26  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Terr...   
. .Acidobacteriaceae bacterium KBS 89............ 115  9e-26  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Granulicella sp. MP5ACTX9..................... 113  5e-25  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Gran...   
. .Acidobacterium capsulatum..................... 113  5e-25  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Acid...   
. .Acidobacteriaceae bacterium URHE0068.......... 110  3e-24  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Acid...   
. .Acidobacterium sp. PMMR2...................... 107  3e-23  1 hit   Bacteria:Acidobacteria:Acidobacteriales: anhydro-N-acetylmuramic acid kinase [Acid...   
. .Candidatus Solibacter usitatus................ 131  1e-31  1 hit   Bacteria:Acidobacteria:Solibacteres:Solibacterales: anhydro-N-acetylmuramic acid kinase [Cand...   
. .Bryobacter aggregatus......................... 110  2e-24  1 hit   Bacteria:Acidobacteria:                  hypothetical protein [Bryobacter aggregatus]   
. .Candidatus Koribacter versatilis.............. 110  5e-24  1 hit   Bacteria:Acidobacteria:                  anhydro-N-acetylmuramic acid kinase [Cand...   
. .Holophaga foetida............................. 90.1 4e-17  1 hit   Bacteria:Acidobacteria:Holophagae:Holophagales: hypothetical protein [Holophaga foetida]     
. .Geothrix fermentans........................... 82.4 2e-14  1 hit   Bacteria:Acidobacteria:Holophagae:Holophagales: hypothetical protein [Geothrix fermentans]   
. .candidate division ZIXI....................... 133  6e-32  1 hit   Bacteria::                               Anhydro-N-acetylmuramic acid kinase [cand...   
. .Treponema medium.............................. 132  2e-31  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema medium]        
. .Treponema maltophilum......................... 130  1e-30  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema maltophilum]   
. .Treponema vincentii........................... 120  3e-27  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: anhydro-N-acetylmuramic acid kinase [Trep...   
. .Treponema vincentii F0403..................... 119  3e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Treponema vincentii]     
. .Spirochaeta bajacaliforniensis................ 125  2e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Spirochaeta bajacal...   
. .Spirochaeta smaragdinae....................... 123  1e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: hypothetical protein [Spirochaeta smaragd...   
. .Sphaerochaeta pleomorpha str. Grapes.......... 122  4e-28  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: anhydro-N-acetylmuramic acid kinase [Spha...   
. .Sphaerochaeta globosa str. Buddy.............. 121  8e-28  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: anhydro-N-acetylmuramic acid kinase [Spha...   
. .Chthonomonas calidirosea...................... 131  3e-31  1 hit   Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: Predicted molecular chaperone distantly r...   
. .Chloroherpeton thalassium..................... 130  4e-31  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: anhydro-N-acetylmuramic acid kinase [Chlo...   
. .Chlorobium sp. GBChlB......................... 125  4e-29  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: hypothetical protein HY22_07425 [Chlorobium sp...   
. .bacterium UASB14.............................. 126  1e-29  1 hit   Bacteria::                               anhydro-N-acetylmuramic acid kinase [bacteriu...   
. .Thermobaculum terrenum........................ 125  3e-29  1 hit   Bacteria::                               hypothetical protein [Thermobaculum terre...   
. .bacterium Ec32................................ 120  1e-27  1 hit   Bacteria::                               Anhydro-N-acetylmuramic acid kinase [bacteriu...   
. .Candidatus Nitrospira defluvii................ 120  1e-27  3 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: anhydro-N-acetylmuramic acid kinase [Cand...   
. .Leptospirillum ferrooxidans................... 108  2e-23  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: hypothetical protein [Leptospirillum ferr...   
. .Leptospirillum ferrodiazotrophum.............. 103  1e-21  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: protein of unknown function UPF0075 [Leptospir...   
. .Leptospirillum ferriphilum YSK................ 77.0 2e-12  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: anhydro-N-acetylmuramic acid kinase [Leptospir... 
. .Leptospirillum sp. Group II '5-way CG'........ 73.9 2e-11  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: Protein of unknown function [Leptospirillum sp... 
. .Leptospirillum rubarum........................ 71.2 1e-10  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: protein of unknown function [Leptospirillum ru... 
. .Poribacteria bacterium JGI 0000000-Pori2...... 117  2e-26  1 hit   Bacteria:Poribacteria:                   anhydro-N-acetylmuramic acid kinase [Pori...   
. .Candidatus Poribacteria sp. WGA-4E............ 111  2e-24  1 hit   Bacteria:Poribacteria:                   hypothetical protein [Candidatus Poribact...   
. .Caldilinea aerophila.......................... 117  2e-26  1 hit   Bacteria:Chloroflexi:Caldilineae:Caldilineales: anhydro-N-acetylmuramic acid kinase [Cald...   
. .Thermomicrobium roseum........................ 110  3e-24  1 hit   Bacteria:Chloroflexi:Thermomicrobia:Thermomicrobiales: anhydro-N-acetylmuramic acid kinase [Ther...   
. .Ktedonobacter racemifer....................... 105  4e-22  1 hit   Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: protein of unknown function UPF0075 [Kted...   
. .Caldisericum exile............................ 116  3e-26  1 hit   Bacteria:Caldiserica:Caldisericia:Caldisericales: anhydro-N-acetylmuramic acid kinase [Cald...   
. .Pedosphaera parvula........................... 112  1e-24  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: protein of unknown function UPF0075 [Pedo...   
. .Elusimicrobium minutum........................ 111  2e-24  1 hit   Bacteria:Elusimicrobia:Elusimicrobiales: anhydro-N-acetylmuramic acid kinase [Elus...   
. .bacterium JKG1................................ 110  3e-24  1 hit   Bacteria::                               hypothetical protein [bacterium JKG1]          
. .Marinimicrobia bacterium SCGC AAA003-L08...... 109  9e-24  1 hit   Bacteria::                               hypothetical protein [SAR406 cluster bact...   
. .Calescamantes................................. 104  4e-22  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Cales...   
. .Gammaproteobacteria bacterium MFB021.......... 85.1 2e-15  1 hit   Bacteria::                               anhydro-N-acetylmuramic acid kinase [Gammaprot... 
. .Plautia stali symbiont........................ 71.6 4e-12  6 hits  Bacteria::                               hypothetical protein [Plautia stali symbi... 
. Paramecium tetraurelia strain d4-2............. 276  7e-87  2 hits  Eukaryota::Oligohymenophorea:Peniculida: hypothetical protein [Paramecium tetraure...   
. Paramecium tetraurelia......................... 48.5 0.003  2 hits  Eukaryota::Oligohymenophorea:Peniculida: hypothetical protein [Paramecium tetraure... 
. Tetrahymena thermophila SB210.................. 240  2e-72  1 hit   Eukaryota::Oligohymenophorea:Hymenostomatida: anhydro-N-acetylmuramic acid kinase [Tetrahyme...   
. Tetrahymena thermophila........................ 238  3e-71  1 hit   Eukaryota::Oligohymenophorea:Hymenostomatida: hypothetical protein TTHERM_00338440 [Tet...   
. Capitella teleta............................... 236  5e-71  1 hit   Eukaryota:Annelida:Polychaeta:Capitellida: hypothetical protein CAPTEDRAFT_207028 [Capite...   
. Lottia gigantea................................ 226  4e-67  2 hits  Eukaryota:Mollusca:Gastropoda:           hypothetical protein LOTGIDRAFT_73844 [Lo...   
. Crassostrea gigas.............................. 226  6e-67  1 hit   Eukaryota:Mollusca:Bivalvia:Ostreoida:   Anhydro-N-acetylmuramic acid kinase [Crassostr...   
. Ixodes scapularis.............................. 199  1e-56  2 hits  Eukaryota:Arthropoda:Arachnida:Ixodida:  anhydro-N-acetylmuramic acid kinase, puta...   
. Monosiga brevicollis MX1....................... 147  1e-35  2 hits  Eukaryota::Choanoflagellida:             hypothetical protein [Monosiga brevicolli...   
. Dictyostelium purpureum........................ 137  2e-33  2 hits  Eukaryota::Dictyosteliida:               hypothetical protein DICPUDRAFT_88670 [Di...   
. Bombus impatiens............................... 134  2e-31  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: anhydro-N-acetylmuramic acid k...   
. Morganella sp. EGD-HP17........................ 122  2e-28  1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: anhydro-N-acetylmuramic acid kinase [Morganell...   
. Dictyostelium fasciculatum..................... 121  1e-27  2 hits  Eukaryota::Dictyosteliida:               hypothetical protein DFA_10616 [Dictyoste...   
. Salpingoeca rosetta............................ 120  2e-27  2 hits  Eukaryota::Choanoflagellida:             anhydro-N-acetylmuramic acid kinase [Salp...   
. Polysphondylium pallidum PN500................. 117  2e-26  1 hit   Eukaryota::Dictyosteliida:               hypothetical protein PPL_12402 [Polysphondyliu...   
. Neosartorya fischeri NRRL 181.................. 115  9e-26  8 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: UPF0075 domain protein [Neosartorya fisch...   
. Lipomyces starkeyi............................. 113  7e-25  1 hit   Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: levoglucosan kinase [Lipomyces starkeyi]            
. Neofusicoccum parvum UCRNP2.................... 112  9e-25  4 hits  Eukaryota:Ascomycota:Dothideomycetes:Botryosphaeriales: putative upf0075 domain protein [Neofusic...   
. Dictyostelium discoideum AX4................... 112  1e-24  2 hits  Eukaryota::Dictyosteliida:               hypothetical protein DDB_G0285145 [Dictyoste...   
. Aspergillus kawachii IFO 4308.................. 112  1e-24  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: UPF0075 domain protein [Aspergillus kawachii ...   
. Aspergillus niger ATCC 1015.................... 111  3e-24  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein ASPNIDRAFT_189398 [Asperg...   
. Coniosporium apollinis CBS 352.97.............. 111  3e-24  6 hits  Eukaryota:Ascomycota:                    anhydro-N-acetylmuramic acid kinase [Coni...   
. Colletotrichum gloeosporioides Nara gc5........ 111  1e-23  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: transaldolase [Colletotrichum gloeosporio...   
. Colletotrichum gloeosporioides Cg-14........... 110  4e-24  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: hypothetical protein CGLO_06162 [Colletotrichu...   
. Aspergillus oryzae RIB40....................... 110  5e-24  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein AOR_1_438034 [Asperg...   
. Cladophialophora psammophila CBS 110553........ 110  5e-24  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: anhydro-N-acetylmuramic acid kinase [Clad...   
. Trichoderma reesei QM6a........................ 108  3e-23  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: predicted protein [Trichoderma reesei QM6a]    
. Trichoderma reesei RUT C-30.................... 108  3e-23  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: UPF0075 domain protein [Trichoderma reesei RUT...   
. Rhodosporidium toruloides NP11................. 108  4e-23  1 hit   Eukaryota:Basidiomycota:Sporidiobolales: anhydro-N-acetylmuramic acid kinase [Rhodospor...   
. Aspergillus terreus NIH2624.................... 107  6e-23  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: conserved hypothetical protein [Aspergill...   
. Fusarium oxysporum f. sp. vasinfectum 25433.... 106  1e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Fusarium oxysporum f. sp. cubense tropical race 106  2e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Fusarium oxysporum Fo47........................ 106  2e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Fusarium oxysporum f. sp. pisi HDV247.......... 106  2e-22  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Fusarium oxysporum Fo5176...................... 106  2e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOXB_17483 [Fusarium oxys...   
. Stachybotrys chlorohalonata IBT 40285.......... 106  2e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S40285_03345 [Stachybotry...   
. Fusarium oxysporum FOSC 3-a.................... 106  2e-22  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Trichoderma virens Gv29-8...................... 105  2e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein TRIVIDRAFT_37900 [Trichod...   
. Verticillium albo-atrum VaMs.102............... 105  3e-22  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: anhydro-N-acetylmuramic acid kinase [Vert...   
. Penicillium roqueforti FM164................... 105  4e-22  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: Anhydro-N-acetylmuramic acid kinase [Penicill...   
. Aspergillus fumigatus A1163.................... 105  4e-22  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: UPF0075 domain protein [Aspergillus fumigatus ...   
. Ophiocordyceps sinensis CO18................... 104  6e-22  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: UPF0075 domain protein [Ophiocordyceps sinensi...   
. Togninia minima UCRPA7......................... 104  6e-22  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Calosphaeriales: putative anhydro-n-acetylmuramic acid kin...   
. Aureobasidium melanogenum CBS 110374........... 104  7e-22  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: UPF0075 domain protein [Aureobasidium melanoge...   
. Stachybotrys chartarum IBT 40293............... 103  1e-21  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S40293_09052 [Stachybotry...   
. Byssochlamys spectabilis No. 5................. 103  1e-21  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein NCU06383 [Byssochlamys s...   
. Mycosphaerella populorum SO2202................ 103  1e-21  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: UPF0075-domain-containing protein [Sphaerulina...   
. Cladophialophora carrionii CBS 160.54.......... 103  1e-21  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: hypothetical protein G647_03305 [Cladophi...   
. Pseudogymnoascus pannorum VKM F-4515 (FW-2607). 103  2e-21  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V496_06356 [Pseudogymnoas...   
. Penicillium chrysogenum Wisconsin 54-1255...... 103  2e-21  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: Pc12g08720 [Penicillium chrysogenum Wisco...   
. Pseudogymnoascus pannorum VKM F-4517 (FW-2822). 103  2e-21  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V498_01292 [Pseudogymnoas...   
. Phialophora europaea CBS 101466................ 103  2e-21  6 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: hypothetical protein HMPREF1541_01955 [Cy...   
. Acremonium chrysogenum ATCC 11550.............. 103  2e-21  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: Anhydro-N-acetylmuramic acid kinase-like prote...   
. Aspergillus nidulans FGSC A4................... 102  2e-21  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein AN3499.2 [Aspergillus n...   
. Naegleria gruberi strain NEG-M................. 102  3e-21  1 hit   Eukaryota::Heterolobosea:Schizopyrenida: predicted protein [Naegleria gruberi stra...   
. Pseudogymnoascus pannorum VKM F-4518 (FW-2643). 102  4e-21  2 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V500_03106 [Pseudogymnoas...   
. Pseudozyma hubeiensis SY62..................... 101  1e-20  1 hit   Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: hypothetical protein PHSY_001591 [Pseudozyma ...   
. Rhodotorula glutinis ATCC 204091............... 101  1e-20  1 hit   Eukaryota:Basidiomycota:Sporidiobolales: UPF0075 domain protein [Rhodotorula glutinis A...   
. Aspergillus fumigatus var. RP-2014............. 101  3e-20  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: transcription factor C6 [Aspergillus fumigatus...   
. Chaetomium globosum CBS 148.51................. 101  6e-20  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein CHGG_02135 [Chaetomi...   
. Pseudogymnoascus pannorum VKM F-3557........... 100  1e-20  3 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V490_06235 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4514 (FW-929).. 100  1e-20  3 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V495_05895 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4246........... 100  1e-20  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V492_05463 [Pseudogymnoas...   
. Meyerozyma guilliermondii ATCC 6260............ 100  2e-20  2 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein PGUG_04600 [Meyerozyma gu...   
. Fusarium oxysporum f. sp. cubense race 4....... 100  2e-20  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: Anhydro-N-acetylmuramic acid kinase [Fusarium ...   
. Pseudozyma aphidis DSM70725.................... 100  2e-20  1 hit   Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: hypothetical protein PaG_04239 [Pseudozyma aph...   
. Pseudogymnoascus pannorum VKM F-4519 (FW-2642). 100  3e-20  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V501_02107 [Pseudogymnoas...   
. Geomyces pannorum var. pannorum F-3808......... 100  3e-20  2 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein O988_04296 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-3775........... 100  1e-19  2 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V491_08081 [Pseudogymnoas...   
. Fusarium fujikuroi IMI 58289................... 99.4 4e-20  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: probable molecular chaperone distantly relate... 
. Nectria haematococca mpVI 77-13-4.............. 99.4 4e-20  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein NECHADRAFT_36824 [Ne... 
. Pseudozyma antarctica T-34..................... 99.4 4e-20  1 hit   Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: hypothetical protein PANT_1d00001 [Pseudozyma... 
. Aspergillus fumigatus Af293.................... 99.4 4e-20  6 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: UPF0075 family protein [Aspergillus fumigatu... 
. Beauveria bassiana ARSEF 2860.................. 99.4 5e-20  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: UPF0075 domain protein [Beauveria bassian... 
. Pseudogymnoascus pannorum VKM F-4513 (FW-928).. 99.4 2e-19  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V494_02563 [Pseudogymnoas... 
. Pseudozyma antarctica.......................... 99.0 9e-20  1 hit   Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: UPF0075 domain protein [Pseudozyma antarctica]   
. Pseudogymnoascus pannorum VKM F-103............ 98.6 4e-19  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V499_04816 [Pseudogymnoas... 
. Eutypa lata UCREL1............................. 97.8 1e-19  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Xylariales: putative upf0075 domain protein [Eutypa l... 
. Neurospora crassa OR74A........................ 97.8 2e-19  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: UPF0075 domain-containing protein [Neurospora ... 
. Exophiala aquamarina CBS 119918................ 97.4 2e-19  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: anhydro-N-acetylmuramic acid kinase [Exophiala... 
. Pyronema omphalodes CBS 100304................. 96.7 3e-19  1 hit   Eukaryota:Ascomycota:Pezizomycetes:Pezizales: Similar to Anhydro-N-acetylmuramic acid kinas... 
. Aureobasidium pullulans var. subglaciale EXF-24 96.7 3e-19  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: hypothetical protein AUEXF2481DRAFT_215477 [Au... 
. Scheffersomyces stipitis CBS 6054.............. 96.3 4e-19  2 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein PICST_36132 [Scheffe... 
. Neurospora tetrasperma FGSC 2508............... 96.3 4e-19  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein NEUTE1DRAFT_130165 [Neuro... 
. Talaromyces stipitatus ATCC 10500.............. 94.0 3e-18  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: UPF0075 domain protein [Talaromyces stipi... 
. Grosmannia clavigera kw1407.................... 94.0 3e-18  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Ophiostomatales: upf0075 domain containing protein [Grosmannia ... 
. Neurospora tetrasperma FGSC 2509............... 94.0 4e-18  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein NEUTE1DRAFT_108710 [Neuro... 
. Metarhizium anisopliae......................... 93.6 4e-18  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: UPF0075 domain protein [Metarhizium anisopliae]   
. Pseudallescheria apiosperma.................... 92.4 1e-17  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Microascales: Upf0075 domain protein [Pseudallescheria apios... 
. Mycosphaerella graminicola IPO323.............. 91.7 1e-17  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: hypothetical protein MYCGRDRAFT_84209 [Zy... 
. Kuraishia capsulata CBS 1993................... 91.3 2e-17  2 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: unnamed protein product [Kuraishia capsulata ... 
. Sporothrix schenckii ATCC 58251................ 91.3 3e-17  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Ophiostomatales: hypothetical protein HMPREF1624_03672 [Sporoth... 
. Pseudogymnoascus pannorum VKM F-4516 (FW-969).. 90.1 6e-17  3 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V495_00599 [Pseudogymnoas... 
. Candida tenuis ATCC 10573...................... 89.7 9e-17  2 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: UPF0075-domain-containing protein [Candid... 
. Ophiostoma piceae UAMH 11346................... 88.2 4e-16  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Ophiostomatales: hypothetical protein F503_00922 [Ophiostoma pi... 
. Verticillium dahliae VdLs.17................... 85.5 2e-15  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: anhydro-N-acetylmuramic acid kinase [Verticill... 
. Reticulomyxa filosa............................ 85.5 3e-15  1 hit   Eukaryota::Foraminifera:                 hypothetical protein RFI_02801 [Reticulomyxa f... 
. Macrophomina phaseolina MS6.................... 84.7 4e-15  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Botryosphaeriales: Anhydro-N-acetylmuramic acid kinase [Macrophom... 
. Metarhizium robertsii.......................... 83.6 1e-14  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: anhydro-N-acetylmuramic acid kinase domain pro... 
. Penicillium digitatum Pd1...................... 80.9 9e-14  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein PDIP_36080 [Penicillium d... 
. Trichosporon asahii var. asahii CBS 2479....... 77.4 2e-12  1 hit   Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: hypothetical protein A1Q1_06539 [Trichosporon ... 
. Pseudogymnoascus pannorum VKM F-4520 (FW-2644). 76.6 3e-12  2 hits  Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V502_02892 [Pseudogymnoas... 
. Trichoderma atroviride IMI 206040.............. 75.9 4e-12  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein TRIATDRAFT_32538 [Trichod... 
. Botryotinia fuckeliana T4...................... 75.1 1e-11  1 hit   Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein BofuT4_P030260.1 [Botryo... 
. Sclerotinia borealis F-4157.................... 73.6 3e-11  1 hit   Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein SBOR_4790 [Sclerotinia bo... 
. Capsaspora owczarzaki ATCC 30864............... 73.2 4e-11  2 hits  Eukaryota::Ichthyosporea:                anhydro-N-acetylmuramic acid kinase [Capsaspor... 
. Glarea lozoyensis ATCC 20868................... 72.4 1e-10  2 hits  Eukaryota:Ascomycota:                    Acetyl-CoA synthetase-like protein [Glare... 
. Metarhizium anisopliae ARSEF 23................ 70.5 3e-10  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: UPF0075 domain protein [Metarhizium aniso... 
. Sclerotinia sclerotiorum 1980 UF-70............ 59.7 1e-06  2 hits  Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein SS1G_02630 [Scleroti... 
. Fusarium pseudograminearum CS3096.............. 54.7 7e-05  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FPSE_06755 [Fusarium pseu... 
. Botryotinia fuckeliana B05.10.................. 53.5 8e-05  1 hit   Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein BC1G_01143 [Botryoti... 
. Pleurotus ostreatus PC15....................... 38.1 8.7    1 hit   Eukaryota:Basidiomycota:Agaricomycetes:Agaricales: hypothetical protein PLEOSDRAFT_1059064 [Pleur... 
. Haladaptatus paucihalophilus................... 140  3e-34  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: anhydro-N-acetylmuramic acid kinase [Hala...   
. euryarchaeote SCGC AAA261-G15.................. 119  5e-27  1 hit   Archaea:Euryarchaeota:                   hypothetical protein [euryarchaeote SCGC ...   
. Caldivirga maquilingensis...................... 131  2e-31  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: anhydro-N-acetylmuramic acid kinase [Cald...   

Erreurs:

Sequence retrieval failure : ref|WP_023168629.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   5e-35 

Sequence retrieval failure : ref|WP_005385936.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   5e-35 

Sequence retrieval failure : gb|AHO16929.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   6e-35 

Sequence retrieval failure : gb|KFR77513.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    139   6e-35 

Sequence retrieval failure : gb|AHR06138.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   8e-35 

Sequence retrieval failure : gb|AHO12014.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   8e-35 

Sequence retrieval failure : gb|AHU40605.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   9e-35 

Sequence retrieval failure : ref|WP_023629313.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 

Sequence retrieval failure : gb|AHU10814.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    135   6e-33 

Sequence retrieval failure : ref|WP_003147208.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   7e-33 

Sequence retrieval failure : gb|AHO21798.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    134   9e-33 

Sequence retrieval failure : gb|AHQ40724.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    134   1e-32 

Sequence retrieval failure : gb|AHO06779.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    133   2e-32 

Sequence retrieval failure : gb|AHS21702.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    133   5e-32 

Sequence retrieval failure : gb|AHP48948.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    130   6e-31 

Sequence retrieval failure : ref|WP_015649703.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    125   1e-29 

Sequence retrieval failure : dbj|BAP17442.1|  anhydro-N-acetylmuramic acid kinase [cyanobac...    117   1e-26 

Sequence retrieval failure : gb|AHR86434.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...  97.8    9e-21 

Sequence retrieval failure : gb|AHT06927.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...  95.5    5e-20 

Sequence retrieval failure : gb|AHQ99928.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...  94.7    7e-20 

Sequence retrieval failure : ref|WP_001729643.1|  anhydro-N-acetylmuramic acid kinase [Salm...  84.3    3e-16 

Sequence retrieval failure : gb|AHR65404.1|  hypothetical protein AU66_11610 [Salmonella en...  79.7    8e-15 

 

BLAST

PROTOCOLE:


a)  NCBI --> Blast p contre nr/ max target sequences_ 5000/ autres paramètres par défaut

b)  NCBI --> Blast p contre swissprot/ max target sequences_ 5000/ paramètres par défaut



ANALYSE DES RÉSULTATS:


Les résultats des BLASTp pour notre ORF d'intérêt sont les suivants:

__________________________________________________

      |  nombre de  | e-value | e-value | e-value |

      |  résultats  |   min   |   max   |  seuil  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  NR  |    4779     |  5e-131 |    9.9  |  e-10   |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  SP  |     219     |  2e-43  |    9    |  7e-16  |

______|_____________|_________|_________|_________|


   Comme indiqué dans le tableau ci-dessus, le nombre de hits obtenus lors du BLASTp contre NR est de 4779. La gamme de evalue s'étend de 5e-131 à 9,9. En ce qui concerne la distribution des HSP, ils recouvrent en moyenne la séquence requête de son 20 ème acide aminé à son 329ème acide aminé. Sachant que la séquence requête a une longueur de 334 acides aminés, on peut dire que le recouvrement est excellent ((329-20)/ 334)* 100_ 92,5 %. Le nombre de hits obtenus lors du BLASTp contre SP est de 219. La gamme de e-value s'étend de 2e-43 à 9.  En ce qui concerne la distribution des HSP, ils recouvrent en moyenne la séquence requête de son 25 ème acide aminé à son 310 ème acide aminé. Sachant que la séquence requête a une longueur de 334 acides aminés, on peut dire que le recouvrement est excellent ((310-25)/ 334)* 100_ 85,3 %.


   On cherche maintenant à déterminer le seuil de e-value pour lequel les séquences protéiques sont homologues avec la séquence de notre protéine putative. Au niveau du BLASTp contre NR, la plupart de nos séquences ont une fonction d'anhydro-N-acetylmuramic acid kinase, on ne voit pas un changement net de fonction. En ce qui concerne les e-value, la meilleure est de 5e-131. Ensuite, les e-value croissent de manière linéaire. Au vue de ces résultats, on peut choisir notre seuil à e-10 ce qui nous parait être la valeur la plus raisonnable pour s'assurer d'avoir uniquement des séquences homologues au-dessus de ce seuil.

   Au niveau du BLASTp contre Swissprot, la meilleure e-value est de 2e-43. Ensuite, les e-value croissent de manière linéaire jusqu'à 7e-16. On passe après directement à une e-value de 3e-04. Ce shift est indicatif pour le choix de notre seuil. De plus, on observe également un changement au niveau des fonctions (Formamidopyrimidine-DNA, Phosphoglucosamine mutase). On choisit donc notre valeur seuil à 7e-16.


BLASTp contre NR

_____________________________________

               |  e-value  | e-value |

catalogue des  |           |         |

fonctions      |    min    |   max   |  

_______________|___________|_________|

               |           |         |      

anhydro-N-     |           |         |

acetylmuramic  |           |         |

acid kinase    |  5e-131   |  3.9    |    

_______________|___________|_________|

               |           |         |    

protéine      |           |         |

chaperonne     |   4e-78   |  0.042  |

_______________|___________|_________|


   On trouve dans nos résultats des protéines ayant des fonctions soit de anhydro-N-acetylmuramic acid kinase soit de protéines chaperonnes. D'après les résultats de InterPro, on s'attendait à obtenir des protéines ayant la fonction d'anhydro-N-acetylmuramic acide kinase. Les résultats du BLAST sont donc cohérents avec ceux d'Interpro. Cependant, on ne s'attendait pas à obtenir des homologies très fortes avec des protéines chaperonnes. Toutefois, on remarque que la meilleure e-value que l'on obtient (5e-131) est assimilée à une protéine ayant la fonction d'anhydro-N-acetylmuramic acid kinase. La meilleure e-value assimilée à une protéine ayant une fonction de molécule chaperonne est de 4e-78. Elle est clairement homologue mais on peut noter la différence importante entre ces deux valeurs. On peut quand même rechercher si les fonctions d'anhydro-N-acetylmuramic acid kinase et de protéine chaperonne peuvent être retrouvées toutes deux chez la même protéine. En faisant de plus amples recherches, on peut supposer que ces deux fonctions ne sont pas incompatibles.


En effet, il serait possible qu'une molécule chaperonne ayant donc la fonction d'aider au bon repliement d'une protéine, peut aussi avoir une fonction de kinase.


"Il existe aussi de très nombreuses protéines ayant une fonction de chaperon plus spécialisée – qui s’ajoute souvent à une autre fonction. [...] La recherche de l’activité «intégrative» de certains chaperons. HSP90a, en association avec un ensemble complexe d’autres chaperons et co-chaperons (m/s 1990, n°10, p. 1022)[19], une action de chaperon mi-spécialisé pour un certain nombre de facteurs de transcription, de protéine kinases appartenant aux voies de signalisation, mais aussi pour la télomérase [20] ou l’enzyme qui synthétise le monoxyde d’azote." (cf article http://www.ipubli.inserm.fr/bitstream/handle/10608/1706/2000_5_630.pdf?sequence_3).


Ainsi, d'après cet article, les chercheurs mettent en lumière le fait que la fonction de protéine chaperonne peut être couplée à une autre fonction comme une fonction de kinase.  


Un autre article nous renseigne sur l'action de l'anhydro-N-acetylmuramic acid kinase:


"Les sucres aminés de la muréine sont recyclés efficacement. L'acide 1,6-anhydro-N-acétylmuramique (anhMurNAc) est renvoyé à la voie de biosynthèse de transformation de la N-acétylglucosamine-phosphate (P-GlcNAc). Le sucre est d'abord phosphorylée par anhydro-acide N-acétylmuramique kinase (AnmK), ce qui donne MurNAc-P, et il est suivi par l'action d'un estherase qui coupe la liaison entre D-lactique et le fragment N-acétylglucosamine de MurNAc-P , ce qui donne GlcNAc-P." ( cf Recycling of the anhydro-N-acetylmuramic acid derived from cell wall murein involves a two-step conversion to N-acetylglucosamine-phosphate de Uehara T1, Suefuji K, Valbuena N, Meehan B, Donegan M, Park JT)


D'après la fiche Interpro, la fonction biologique prédite est la catalyse de la phosphorylation spécifique de l'acide 1,6- anhydro -N- acétylmuramique ( anhMurNAc ) avec le clivage simultané de la bague 1,6- anhydro , générant MurNAc -6-P . Elle est également nécessaire pour l'utilisation de anhMurNAc , soit importé du milieu , soit provenant de sa propre muréine de la paroi cellulaire. Elle joue donc un rôle dans le recyclage de la paroi cellulaire.


Cette fonction est donc importante pour le recyclage de la paroi cellulaire notamment pour son implication dans la voie de biosynthèse de la N-acétylglucosamine-phosphate.


Ainsi, les deux fonctions d'anhydro-N-acetylmuramic acid kinase et de protéine chaperonne pourraient être retrouvées toutes deux chez la même protéine. Par ailleurs, des recherches sur plusieurs fonctions biologiques retrouvées chez la même protéine sont encore en cours.


En outre, les fonctions que nous venons d'énumérer sont les fonctions identifiées dans NR. Ces fonctions ne sont pas forcément fiables à 100% car la majorité des séquences répertoriées dans NR sont annotées automatiquement par des analyses in silico. Donc, les annotations sont variables en fonction des annotateurs. Pour compléter notre analyse, nous avons réalisé un BLAST contre swissprot. Les fiches d'annotations sont dans cette banque de données faites à la main par des annotateurs. Les résultats obtenus sont donc plus fiables que ceux obtenus lors du BLAST contre NR.


BLASTp contre Swissprot

_____________________________________________

                       |  e-value  | e-value |

catalogue des          |           |         |

fonctions              |    min    |   max   |  

_______________________|___________|_________|

                       |           |         |      

anhydro-N-             |           |         |

acetylmuramic          |           |         |

acid kinase            |  2e-43    |  3e-04  |    

_______________________|___________|_________|


La seule fonction biologique associée à des séquences homologues est la fonction d'anhydro-N-acetylmuramic acid kinase. Ainsi, en croisant ce résultat avec ceux obtenus par BLASTp contre NR et ceux obtenus lors de notre recherche de domaines protéiques, on peut dire que la fonction biologique de notre protéine putative semble être vraisemblablement la fonction d'anhydro-N-acetylmuramic acid kinase.




   Enfin, à partir de ce BLAST, on émet l'hypothèse que notre ORF est codant pour une protéine ayant la fonction d'anhydro-N-acetylmuramic acide kinase.


RÉSULTATS BRUTS:

a) analyse par BLAST contre nr

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           49,370,157 sequences; 17,711,572,573 total letters
Query= Translation of ORF number 1 in reading frame 2 on the direct strand.

Length=329


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|WP_028826600.1|  hypothetical protein [Proteobacteria bact...    389   5e-131
ref|WP_028832826.1|  hypothetical protein [Proteobacteria bact...    339   2e-111
ref|WP_025863940.1|  anhydro-N-acetylmuramic acid kinase [Prol...    322   8e-105
gb|KFC18451.1|  anhydro-N-acetylmuramic acid kinase [Epilithon...    316   4e-102
ref|WP_028888595.1|  anhydro-N-acetylmuramic acid kinase [Tena...    313   6e-101
gb|KFF18685.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    311   1e-100
ref|WP_028122749.1|  anhydro-N-acetylmuramic acid kinase [Epil...    309   1e-99 
ref|WP_024740445.1|  anhydro-N-acetylmuramic acid kinase [Tena...    308   4e-99 
ref|WP_027384547.1|  anhydro-N-acetylmuramic acid kinase [Chry...    305   4e-98 
gb|KFC22162.1|  anhydro-N-acetylmuramic acid kinase [Epilithon...    304   7e-98 
ref|WP_028892743.1|  anhydro-N-acetylmuramic acid kinase [Tena...    303   4e-97 
ref|WP_026776830.1|  anhydro-N-acetylmuramic acid kinase [Pola...    301   1e-96 
ref|WP_015480920.1|  anhydro-N-acetylmuramic acid kinase [Pola...    301   1e-96 
ref|WP_008639114.1|  anhydro-N-acetylmuramic acid kinase [Bizi...    301   1e-96 
ref|WP_027880326.1|  anhydro-N-acetylmuramic acid kinase [Meso...    301   3e-96 
ref|WP_024564404.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    300   3e-96 
ref|WP_008992432.1|  anhydro-N-acetylmuramic acid kinase [Galb...    300   4e-96 
gb|KFF75547.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    300   4e-96 
ref|WP_009084425.1|  anhydro-N-acetylmuramic acid kinase [Eliz...    300   4e-96 
ref|WP_028836241.1|  anhydro-N-acetylmuramic acid kinase [Prot...    299   9e-96 
ref|WP_008269300.1|  anhydro-N-acetylmuramic acid kinase [Flav...    298   2e-95 
ref|WP_013870299.1|  anhydro-N-acetylmuramic acid kinase [Laci...    298   3e-95 
ref|WP_024567067.1|  anhydro-N-acetylmuramic acid kinase [Eliz...    298   4e-95 
dbj|BAP32743.1|  anhydro-N-acetylmuramic acid kinase [Chryseob...    297   4e-95 
gb|KFC38616.1|  anhydro-N-acetylmuramic acid kinase [Elizabeth...    297   4e-95 
gb|AHW61173.1|  anhydro-N-acetylmuramic acid kinase [Bacteroid...    298   5e-95 
ref|WP_027374351.1|  anhydro-N-acetylmuramic acid kinase [Chry...    297   7e-95 
ref|WP_028289168.1|  anhydro-N-acetylmuramic acid kinase [Olle...    297   9e-95 
gb|KFF29434.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    296   9e-95 
gb|EQB93934.1|  anhydro-N-acetylmuramic acid kinase [Elizabeth...    295   2e-94 
gb|KFF02293.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    296   2e-94 
ref|WP_002977624.1|  anhydro-N-acetylmuramic acid kinase [Chry...    296   3e-94 
ref|WP_028873162.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    295   4e-94 
ref|WP_027385922.1|  anhydro-N-acetylmuramic acid kinase [Chry...    295   4e-94 
ref|WP_028283791.1|  anhydro-N-acetylmuramic acid kinase [Olle...    295   6e-94 
ref|WP_020080383.1|  hypothetical protein [Flavobacterium sp. ...    295   7e-94 
ref|WP_029331977.1|  anhydro-N-acetylmuramic acid kinase [Gill...    294   8e-94 
ref|WP_028606902.1|  anhydro-N-acetylmuramic acid kinase [Olle...    294   2e-93 
ref|WP_002663632.1|  anhydro-N-acetylmuramic acid kinase [Berg...    293   2e-93 
gb|KEY19550.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    293   3e-93 
ref|WP_031427297.1|  anhydro-N-acetylmuramic acid kinase [Leeu...    293   3e-93 
ref|WP_020895287.1|  Anhydro-N-acetylmuramic acid kinase [Wino...    293   4e-93 
gb|KFF00266.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    292   6e-93 
ref|WP_026450290.1|  anhydro-N-acetylmuramic acid kinase [Aequ...    291   9e-93 
ref|WP_027377256.1|  anhydro-N-acetylmuramic acid kinase [Chry...    291   1e-92 
ref|WP_002665158.1|  anhydro-N-acetylmuramic acid kinase [Berg...    291   2e-92 
dbj|BAO74858.1|  anhydro-N-acetylmuramic acid kinase [Winograd...    291   2e-92 
ref|WP_009130681.1|  hypothetical protein [Bacteroides oleicip...    291   2e-92 
ref|WP_009037952.1|  anhydro-N-acetylmuramic acid kinase [Bact...    291   2e-92 
ref|WP_015806039.1|  anhydro-N-acetylmuramic acid kinase [Flav...    289   6e-92 
ref|WP_022219530.1|  anhydro-N-acetylmuramic acid kinase [Bact...    289   1e-91 
ref|WP_009123157.1|  anhydro-N-acetylmuramic acid kinase [Bact...    289   1e-91 
gb|KDS49131.1|  hypothetical protein M094_2115 [Bacteroides un...    289   1e-91 
ref|WP_005833148.1|  hypothetical protein [Bacteroides uniformis]    288   2e-91 
ref|WP_005827191.1|  hypothetical protein [Bacteroides uniformis]    288   2e-91 
ref|WP_016273002.1|  hypothetical protein [Bacteroides uniformis]    288   2e-91 
ref|WP_027470299.1|  hypothetical protein [Cytophaga fermentans]     288   2e-91 
ref|WP_019386203.1|  hypothetical protein [Flavobacteriaceae b...    288   4e-91 
emb|CDN79994.1|  Anhydro-N-acetylmuramic acid kinase [Elizabet...    287   4e-91 
ref|WP_004569902.1|  anhydro-N-acetylmuramic acid kinase [Pola...    287   5e-91 
ref|WP_029038891.1|  anhydro-N-acetylmuramic acid kinase [Sali...    287   6e-91 
ref|WP_022401431.1|  uncharacterized protein [Bacteroides unif...    286   1e-90 
ref|WP_014782437.1|  anhydro-N-acetylmuramic acid kinase [Aequ...    286   2e-90 
gb|EDM45072.1|  anhydro-N-acetylmuramic acid kinase [unidentif...    285   4e-90 
ref|WP_013187082.1|  anhydro-N-acetylmuramic acid kinase [Croc...    285   5e-90 
ref|WP_024997480.1|  anhydro-N-acetylmuramic acid kinase [Bact...    284   8e-90 
ref|WP_009781541.1|  anhydro-N-acetylmuramic acid kinase [Leeu...    283   2e-89 
ref|WP_027885637.1|  anhydro-N-acetylmuramic acid kinase [Meso...    283   2e-89 
ref|WP_028377520.1|  anhydro-N-acetylmuramic acid kinase [Leeu...    283   4e-89 
ref|WP_008664055.1|  hypothetical protein [Bacteroides sp. 4_1...    280   8e-89 
emb|CBL87582.1|  anhydro-N-acetylmuramic acid kinase [uncultur...    282   9e-89 
ref|WP_006795992.1|  anhydro-N-acetylmuramic acid kinase [Flav...    281   1e-88 
ref|WP_016198776.1|  anhydro-N-acetylmuramic acid kinase [Eliz...    281   1e-88 
ref|WP_026717786.1|  anhydro-N-acetylmuramic acid kinase [Flav...    280   4e-88 
gb|AGY53458.1|  Anhydro-N-acetylmuramic acid kinase [Bacteroid...    280   4e-88 
dbj|GAK98073.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    279   5e-88 
gb|KEZ94003.1|  anhydro-N-acetylmuramic acid kinase [Nonlabens...    279   6e-88 
dbj|GAK37921.1|  anhydro-N-acetylmuramic acid kinase [Bacteroi...    279   8e-88 
ref|WP_015362562.1|  anhydro-N-acetylmuramic acid kinase [Nonl...    279   8e-88 
ref|WP_007096719.1|  anhydro-N-acetylmuramic acid kinase [Kord...    278   1e-87 
ref|WP_017730308.1|  hypothetical protein [Nafulsella turpanen...    278   3e-87 
ref|WP_029296882.1|  anhydro-N-acetylmuramic acid kinase [Chry...    277   4e-87 
ref|WP_014019187.1|  anhydro-N-acetylmuramic acid kinase [Cycl...    277   5e-87 
ref|XP_001431021.1|  hypothetical protein [Paramecium tetraure...    276   7e-87 
ref|WP_027127028.1|  anhydro-N-acetylmuramic acid kinase [Geli...    276   8e-87 
gb|KFF25540.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    276   1e-86 
gb|KFF11132.1|  anhydro-N-acetylmuramic acid kinase [Chryseoba...    275   1e-86 
gb|KFB00592.1|  anhydro-N-acetylmuramic acid kinase [Mangrovim...    276   2e-86 
ref|WP_002990918.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    275   3e-86 
gb|KDN55421.1|  anmK protein [Flavobacterium sp. EM1321]             277   4e-86 
dbj|GAL01017.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    275   4e-86 
gb|EAQ39137.1|  hypothetical protein MED134_00920 [Dokdonia do...    274   1e-85 
emb|CDF80498.1|  anhydro-N-acetylmuramic acid kinase [Formosa ...    273   1e-85 
ref|WP_007845823.1|  anhydro-N-acetylmuramic acid kinase [Chry...    273   1e-85 
ref|WP_007649702.1|  Anhydro-N-acetylmuramic acid kinase [Form...    273   2e-85 
ref|WP_013073324.1|  anhydro-N-acetylmuramic acid kinase [Zuno...    273   2e-85 
ref|WP_026710369.1|  anhydro-N-acetylmuramic acid kinase [Flav...    273   2e-85 
ref|WP_026726424.1|  anhydro-N-acetylmuramic acid kinase [Flav...    273   3e-85 
ref|WP_027380606.1|  anhydro-N-acetylmuramic acid kinase [Chry...    272   3e-85 
ref|WP_008197639.1|  anhydro-N-acetylmuramic acid kinase [Algo...    272   3e-85 
ref|WP_019037618.1|  hypothetical protein [Psychroflexus tropi...    272   3e-85 
ref|WP_026839698.1|  anhydro-N-acetylmuramic acid kinase [Gill...    271   6e-85 
ref|WP_006988605.1|  anhydro-N-acetylmuramic acid kinase [Gill...    271   1e-84 
ref|WP_018472590.1|  hypothetical protein [Echinicola pacifica]      271   1e-84 
ref|WP_008254613.1|  anhydro-N-acetylmuramic acid kinase [Flav...    271   1e-84 
ref|WP_011586622.1|  anhydro-N-acetylmuramic acid kinase [Cyto...    271   2e-84 
ref|WP_010136891.1|  anhydro-N-acetylmuramic acid kinase [Flav...    270   2e-84 
ref|WP_009579160.1|  Anhydro-N-acetylmuramic acid kinase [Fulv...    270   3e-84 
ref|WP_010177267.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    270   4e-84 
dbj|GAK90051.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    268   6e-84 
ref|WP_014387759.1|  anhydro-N-acetylmuramic acid kinase [Flav...    269   8e-84 
ref|WP_023579688.1|  anmK protein [Flavobacterium limnosediminis]    269   9e-84 
ref|WP_027421010.1|  hypothetical protein [Crocinitomix catala...    268   1e-83 
ref|WP_010521724.1|  anhydro-N-acetylmuramic acid kinase [Flav...    268   2e-83 
ref|WP_018343500.1|  hypothetical protein [Cytophaga aurantiaca]     268   2e-83 
ref|WP_026950754.1|  anhydro-N-acetylmuramic acid kinase [Algo...    268   2e-83 
ref|WP_026933489.1|  anhydro-N-acetylmuramic acid kinase [Gram...    267   3e-83 
ref|WP_013996950.1|  anhydro-N-acetylmuramic acid kinase [Capn...    267   3e-83 
ref|WP_023574482.1|  anmK protein [Flavobacterium enshiense]         267   3e-83 
gb|EKD30930.1|  hypothetical protein ACD_77C00447G0005 [uncult...    267   3e-83 
ref|WP_026462244.1|  anhydro-N-acetylmuramic acid kinase [Adha...    267   4e-83 
ref|WP_022436827.1|  uncharacterized protein [Prevotella sp. C...    267   5e-83 
ref|WP_026703959.1|  anhydro-N-acetylmuramic acid kinase [Flav...    266   6e-83 
ref|WP_026981449.1|  anhydro-N-acetylmuramic acid kinase [Flav...    266   8e-83 
ref|WP_019595814.1|  hypothetical protein [Rhodonellum psychro...    266   1e-82 
ref|WP_026357425.1|  anhydro-N-acetylmuramic acid kinase [Empe...    266   1e-82 
ref|WP_014202110.1|  anhydro-N-acetylmuramic acid kinase [Owen...    265   1e-82 
gb|AIN74314.1|  anhydro-N-acetylmuramic acid kinase [Flavobact...    265   2e-82 
gb|AIJ37367.1|  Anhydro-N-acetylmuramic acid kinase [Flavobact...    265   2e-82 
ref|WP_013750092.1|  anhydro-N-acetylmuramic acid kinase [Krok...    265   2e-82 
ref|WP_011964031.1|  anhydro-N-acetylmuramic acid kinase [Flav...    265   2e-82 
gb|KFC59247.1|  anmK protein [Flavobacterium sp. EM1308]             265   2e-82 
ref|WP_026714685.1|  anhydro-N-acetylmuramic acid kinase [Flav...    265   3e-82 
ref|WP_014938684.1|  anhydro-N-acetylmuramic acid kinase [Riem...    265   3e-82 
ref|WP_016988848.1|  anhydro-N-acetylmuramic acid kinase [Flav...    264   7e-82 
ref|WP_013446748.1|  anhydro-N-acetylmuramic acid kinase [Riem...    263   8e-82 
ref|WP_015023806.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    263   8e-82 
ref|WP_027310486.1|  anhydro-N-acetylmuramic acid kinase [Bact...    263   9e-82 
ref|WP_026990713.1|  anhydro-N-acetylmuramic acid kinase [Flav...    263   1e-81 
gb|KEO73162.1|  anhydro-N-acetylmuramic acid kinase [Cytophaga...    262   2e-81 
ref|WP_007136622.1|  anhydro-N-acetylmuramic acid kinase [Flav...    262   2e-81 
ref|WP_018476477.1|  hypothetical protein [Pontibacter roseus]       262   4e-81 
ref|WP_023577373.1|  anmK protein [Flavobacterium saliperosum]       261   4e-81 
ref|WP_027138424.1|  anhydro-N-acetylmuramic acid kinase [Gaet...    261   5e-81 
ref|WP_026915094.1|  anhydro-N-acetylmuramic acid kinase [Gram...    261   6e-81 
dbj|GAK93603.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    260   1e-80 
ref|WP_023570408.1|  anmK protein [Flavobacterium cauense]           261   1e-80 
dbj|BAO55359.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    259   2e-80 
ref|WP_026976603.1|  anhydro-N-acetylmuramic acid kinase [Flav...    260   2e-80 
ref|WP_020530837.1|  hypothetical protein [Flexithrix dorotheae]     260   2e-80 
ref|WP_026315520.1|  anhydro-N-acetylmuramic acid kinase [Riem...    259   5e-80 
ref|WP_008865229.1|  anhydro-N-acetylmuramic acid kinase [Flav...    258   8e-80 
ref|WP_028980788.1|  hypothetical protein [Sporocytophaga myxo...    258   1e-79 
ref|WP_022828251.1|  anhydro-N-acetylmuramic acid kinase [Flav...    257   2e-79 
ref|WP_008238550.1|  anhydro-N-acetylmuramic acid kinase [Imte...    257   3e-79 
ref|WP_026967394.1|  anhydro-N-acetylmuramic acid kinase [Algo...    256   4e-79 
gb|AHF15551.1|  hypothetical protein NIASO_11025 [Niabella sol...    256   5e-79 
ref|WP_026956097.1|  anhydro-N-acetylmuramic acid kinase [Algo...    256   6e-79 
ref|WP_026753880.1|  anhydro-N-acetylmuramic acid kinase [Sedi...    256   6e-79 
ref|WP_008613474.1|  anhydro-N-acetylmuramic acid kinase [Joos...    256   9e-79 
ref|WP_013454140.1|  hypothetical protein [Marivirga tractuosa]      255   2e-78 
ref|WP_011710757.1|  anhydro-N-acetylmuramic acid kinase [Gram...    255   2e-78 
ref|WP_020894033.1|  Anhydro-N-acetylmuramic acid kinase [Cycl...    254   2e-78 
ref|WP_009194475.1|  Anhydro-N-acetylmuramic acid kinase [Cesi...    255   2e-78 
ref|WP_025666310.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    254   4e-78 
ref|WP_015264697.1|  molecular chaperone [Echinicola vietnamen...    254   4e-78 
ref|WP_018627827.1|  hypothetical protein [Niabella aurantiaca]      254   5e-78 
gb|ETN97085.1|  hypothetical protein P278_05110 [Zhouia amylol...    254   6e-78 
ref|WP_010520166.1|  anhydro-N-acetylmuramic acid kinase [Meso...    253   7e-78 
ref|WP_024768653.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    253   9e-78 
ref|WP_006265901.1|  anhydro-N-acetylmuramic acid kinase [Myro...    253   1e-77 
ref|WP_006258676.1|  anhydro-N-acetylmuramic acid kinase [Myro...    253   1e-77 
ref|WP_009032997.1|  anhydro-N-acetylmuramic acid kinase [Indi...    252   2e-77 
ref|WP_016648877.1|  anhydro-N-acetylmuramic acid kinase [Myro...    252   2e-77 
ref|WP_025608762.1|  anhydro-N-acetylmuramic acid kinase [Pont...    252   3e-77 
ref|WP_027412423.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    252   3e-77 
ref|WP_013687300.1|  hypothetical protein [Fluviicola taffensis]     251   4e-77 
ref|WP_029035415.1|  anhydro-N-acetylmuramic acid kinase [Sali...    252   4e-77 
ref|WP_014798875.1|  molecular chaperone [Flexibacter litoralis]     253   4e-77 
ref|WP_014165392.1|  anhydro-N-acetylmuramic acid kinase [Flav...    250   1e-76 
ref|WP_006264331.1|  anhydro-N-acetylmuramic acid kinase [Myro...    250   1e-76 
ref|WP_003440041.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    249   2e-76 
ref|WP_025743191.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    250   2e-76 
ref|WP_020214743.1|  hypothetical protein [Flavobacterium rivuli]    250   2e-76 
ref|WP_025124724.1|  anhydro-N-acetylmuramic acid kinase [Myro...    250   2e-76 
ref|WP_010852370.1|  Anhydro-N-acetylmuramic acid kinase [Cycl...    249   3e-76 
ref|WP_006261802.1|  anhydro-N-acetylmuramic acid kinase [Myro...    249   3e-76 
ref|WP_026707056.1|  anhydro-N-acetylmuramic acid kinase [Flav...    247   2e-75 
emb|CBL87520.1|  anhydro-N-acetylmuramic acid kinase [uncultur...    246   3e-75 
ref|WP_013995047.1|  anhydro-N-acetylmuramic acid kinase [Zobe...    246   4e-75 
gb|EZH73326.1|  anhydro-N-acetylmuramic acid kinase [Aquimarin...    246   7e-75 
ref|WP_014771801.1|  anhydro-N-acetylmuramic acid kinase [Bell...    245   1e-74 
ref|WP_024284283.1|  anhydro-N-acetylmuramic acid kinase [Algo...    245   1e-74 
ref|WP_027002871.1|  hypothetical protein [Flexibacter roseolus]     246   1e-74 
ref|WP_008627971.1|  Anhydro-N-acetylmuramic acid kinase [Mari...    245   1e-74 
ref|WP_026038696.1|  anhydro-N-acetylmuramic acid kinase [Myro...    245   1e-74 
ref|WP_014031580.1|  anhydro-N-acetylmuramic acid kinase [Muri...    243   6e-74 
ref|WP_027077858.1|  anhydro-N-acetylmuramic acid kinase [Mari...    243   1e-73 
ref|WP_027395670.1|  anhydro-N-acetylmuramic acid kinase [Aqui...    242   2e-73 
ref|WP_026946262.1|  anhydro-N-acetylmuramic acid kinase [Algo...    241   4e-73 
ref|WP_031443490.1|  anhydro-N-acetylmuramic acid kinase [Aren...    241   5e-73 
ref|WP_026808994.1|  anhydro-N-acetylmuramic acid kinase [Aren...    240   1e-72 
gb|EAR97362.2|  anhydro-N-acetylmuramic acid kinase [Tetrahyme...    240   2e-72 
ref|WP_013598398.1|  anhydro-N-acetylmuramic acid kinase [Week...    238   4e-72 
ref|WP_014223141.1|  hypothetical protein [Niastella koreensis]      239   8e-72 
gb|ADI20291.1|  hypothetical protein [uncultured Sphingobacter...    239   9e-72 
ref|WP_013619824.1|  anhydro-N-acetylmuramic acid kinase [Cell...    237   2e-71 
ref|WP_027066446.1|  anhydro-N-acetylmuramic acid kinase [Mari...    237   2e-71 
ref|WP_015755510.1|  anhydro-N-acetylmuramic acid kinase [Robi...    237   2e-71 
ref|XP_001017607.1|  hypothetical protein TTHERM_00338440 [Tet...    238   3e-71 
gb|ELU08950.1|  hypothetical protein CAPTEDRAFT_207028 [Capite...    236   5e-71 
ref|WP_026812773.1|  anhydro-N-acetylmuramic acid kinase [Aren...    234   3e-70 
gb|EWH14232.1|  anhydro-N-acetylmuramic acid kinase [Celluloph...    232   1e-69 
ref|WP_028787396.1|  hypothetical protein [Terrimonas ferruginea]    229   2e-68 
ref|WP_020536591.1|  hypothetical protein [Lewinella cohaerens]      229   3e-68 
gb|KFC57563.1|  anmK protein [Flavobacterium sp. EM1308]             225   8e-68 
ref|WP_019668567.1|  hypothetical protein [Eudoraea adriatica]       226   2e-67 
ref|WP_013306598.1|  anhydro-N-acetylmuramic acid kinase [Mari...    226   2e-67 
ref|XP_009058590.1|  hypothetical protein LOTGIDRAFT_73844 [Lo...    226   4e-67 
ref|WP_009186852.1|  anhydro-N-acetylmuramic acid kinase [Cece...    224   5e-67 
gb|EKC18138.1|  Anhydro-N-acetylmuramic acid kinase [Crassostr...    226   6e-67 
gb|KFD39617.1|  anhydro-N-acetylmuramic acid kinase [Schleifer...    224   7e-67 
ref|WP_013551541.1|  anhydro-N-acetylmuramic acid kinase [Cell...    225   9e-67 
ref|WP_004918944.1|  anhydro-N-acetylmuramic acid kinase [Riem...    222   2e-66 
ref|WP_024480450.1|  anhydro-N-acetylmuramic acid kinase [Cell...    221   2e-65 
emb|CBL80567.1|  anhydro-N-acetylmuramic acid kinase [uncultur...    221   2e-65 
ref|WP_029448904.1|  anhydro-N-acetylmuramic acid kinase [Cell...    221   2e-65 
ref|WP_029446201.1|  anhydro-N-acetylmuramic acid kinase [Cell...    221   3e-65 
ref|WP_025614879.1|  anhydro-N-acetylmuramic acid kinase [Cell...    221   3e-65 
ref|WP_015693681.1|  anhydro-N-acetylmuramic acid kinase [Sapr...    221   4e-65 
ref|WP_002656777.1|  anhydro-N-acetylmuramic acid kinase [Sapr...    215   8e-63 
ref|WP_026259921.1|  hypothetical protein [Segetibacter koreen...    213   5e-62 
ref|XP_002401492.1|  anhydro-N-acetylmuramic acid kinase, puta...    199   1e-56 
ref|WP_012788871.1|  anhydro-N-acetylmuramic acid kinase [Chit...    192   2e-54 
ref|WP_026231838.1|  hypothetical protein [Lewinella persica]        178   1e-48 
gb|KFF45545.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    166   3e-44 
ref|WP_010094237.1|  anhydro-N-acetylmuramic acid kinase [Orni...    165   8e-44 
ref|WP_005792002.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    164   1e-43 
emb|CDR31271.1|  Anhydro-N-acetylmuramic acid kinase [Acholepl...    164   2e-43 
ref|WP_030004260.1|  Anhydro-N-acetylmuramic acid kinase [Acho...    163   4e-43 
gb|KDM90234.1|  anhydro-N-acetylmuramic acid kinase [Photobact...    163   5e-43 
gb|EGG99079.1|  Anhydro-N-acetylmuramic acid kinase [gamma pro...    162   9e-43 
ref|WP_005006528.1|  anhydro-N-acetylmuramic acid kinase [Acin...    162   1e-42 
ref|WP_012003557.1|  anhydro-N-acetylmuramic acid kinase [Ther...    161   1e-42 
ref|WP_016168940.1|  anhydro-N-acetylmuramic acid kinase [Acin...    161   2e-42 
ref|WP_028843859.1|  anhydro-N-acetylmuramic acid kinase [Ther...    160   3e-42 
ref|WP_004394119.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    160   3e-42 
ref|WP_027254157.1|  anhydro-N-acetylmuramic acid kinase [Phot...    160   5e-42 
ref|WP_026444123.1|  anhydro-N-acetylmuramic acid kinase [Acin...    160   5e-42 
ref|WP_004650355.1|  anhydro-N-acetylmuramic acid kinase [Acin...    160   5e-42 
ref|WP_004647150.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    160   7e-42 
ref|WP_005017492.1|  anhydro-N-acetylmuramic acid kinase [Acin...    159   8e-42 
gb|EXF57433.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    159   9e-42 
gb|EXB32935.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    159   1e-41 
ref|WP_014109162.1|  anhydro-N-acetylmuramic acid kinase [Glac...    160   1e-41 
ref|WP_005094877.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    159   1e-41 
ref|WP_022247541.1|  anhydro-N-acetylmuramic acid kinase [Clos...    159   1e-41 
ref|WP_004729019.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    159   1e-41 
ref|WP_026240736.1|  anhydro-N-acetylmuramic acid kinase [Thio...    159   2e-41 
ref|WP_004663838.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    159   2e-41 
gb|EZQ01441.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    159   2e-41 
ref|WP_008077183.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    159   2e-41 
ref|WP_011269098.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    158   2e-41 
ref|WP_021705621.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    158   2e-41 
ref|WP_005896872.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    158   2e-41 
ref|WP_003401948.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    158   2e-41 
ref|WP_004281899.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    158   2e-41 
ref|WP_017296157.1|  hypothetical protein [Geminocystis herdma...    158   3e-41 
ref|WP_005181147.1|  anhydro-N-acetylmuramic acid kinase [Acin...    158   3e-41 
ref|WP_025857069.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   3e-41 
ref|WP_002551954.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    157   3e-41 
ref|WP_005173456.1|  anhydro-N-acetylmuramic acid kinase [Acin...    158   4e-41 
ref|WP_016659759.1|  anhydro-N-acetylmuramic acid kinase [Acin...    158   4e-41 
ref|WP_020798782.1|  molecular chaperone [Pseudomonas sp. G5(2...    157   4e-41 
ref|WP_003316311.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   4e-41 
ref|WP_016569114.1|  Anhydro-N-acetylmuramic acid kinase [Pseu...    157   4e-41 
ref|WP_017006239.1|  anhydro-N-acetylmuramic acid kinase [Ente...    157   5e-41 
ref|WP_017481202.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   5e-41 
ref|WP_004697501.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   5e-41 
ref|WP_016983464.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   6e-41 
ref|WP_029935788.1|  hypothetical protein [Thiomicrospira pelo...    157   6e-41 
ref|WP_016960327.1|  anhydro-N-acetylmuramic acid kinase [Ente...    157   6e-41 
ref|WP_005108217.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   6e-41 
ref|WP_020332098.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    157   7e-41 
ref|WP_004994609.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   7e-41 
ref|WP_024777445.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   7e-41 
gb|KFA58516.1|  Anhydro-N-acetylmuramic acid kinase [Gilliamel...    157   7e-41 
ref|WP_009045859.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   7e-41 
ref|WP_005405934.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   7e-41 
ref|WP_011235465.1|  anhydro-N-acetylmuramic acid kinase [Idio...    157   8e-41 
ref|WP_007930195.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    157   8e-41 
ref|WP_005037777.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   8e-41 
ref|WP_024649705.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    156   9e-41 
ref|WP_004780315.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   9e-41 
ref|WP_004660767.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    156   9e-41 
gb|KCX37577.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    157   1e-40 
ref|WP_017279833.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    156   1e-40 
ref|WP_024438168.1|  anhydro-N-acetylmuramic acid kinase [Acin...    157   1e-40 
ref|WP_007966418.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    156   1e-40 
gb|ETR93482.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    156   1e-40 
ref|WP_004914607.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   1e-40 
ref|WP_019767325.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   1e-40 
ref|WP_005804870.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   1e-40 
gb|EXA97158.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    156   1e-40 
ref|WP_008078001.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    156   1e-40 
ref|WP_004965193.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   1e-40 
ref|WP_017386211.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    156   1e-40 
gb|ACA66107.1|  anhydro-N acetylmuramic acid kinase [Francisel...    156   1e-40 
ref|WP_004977768.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   2e-40 
dbj|BAN69895.1|  anhydro-N-acetylmuramic acid kinase [endosymb...    156   2e-40 
ref|WP_003411692.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_023404530.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    156   2e-40 
ref|WP_008365278.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_021491385.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_004950027.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   2e-40 
ref|WP_007906862.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_005401791.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   2e-40 
ref|WP_016772929.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_010206934.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_016143901.1|  anhydro-N-acetylmuramic acid kinase [Acin...    156   2e-40 
ref|WP_017708605.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_004930042.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    155   2e-40 
ref|WP_030139196.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
ref|WP_003228774.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   2e-40 
gb|EXA60645.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   2e-40 
ref|WP_005233064.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   2e-40 
gb|ETK23520.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    155   2e-40 
ref|WP_013440890.1|  anhydro-N-acetylmuramic acid kinase [Meth...    155   2e-40 
gb|EXS25874.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   2e-40 
gb|KEX95376.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    155   3e-40 
ref|WP_008061609.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   3e-40 
gb|EGH79010.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    155   3e-40 
ref|WP_016139744.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
ref|WP_004969740.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    155   3e-40 
ref|WP_003656053.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
ref|WP_012280718.1|  anhydro-N-acetylmuramic acid kinase [Fran...    155   3e-40 
ref|WP_017387716.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
ref|WP_004640222.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
gb|EKD77317.1|  hypothetical protein ACD_42C00381G0002 [uncult...    155   3e-40 
gb|EXR37893.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   3e-40 
gb|EXB11298.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   3e-40 
ref|WP_009506221.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
ref|WP_019957870.1|  hypothetical protein [Vitreoscilla sterco...    155   3e-40 
gb|EXE90458.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   3e-40 
ref|WP_004986183.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   3e-40 
ref|WP_025113542.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   3e-40 
ref|WP_010568022.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   3e-40 
ref|WP_004660583.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   4e-40 
ref|WP_004711281.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    155   4e-40 
gb|EXS43972.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   4e-40 
ref|WP_017683447.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   4e-40 
gb|EXS20343.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    155   4e-40 
ref|WP_010439068.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    155   4e-40 
ref|WP_001274583.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   4e-40 
ref|WP_002051863.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   5e-40 
ref|WP_002115501.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    155   5e-40 
gb|KFA99885.1|  anhydro-N-acetylmuramic acid kinase [Vibrio sp...    155   5e-40 
ref|WP_004882266.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    155   5e-40 
ref|WP_007482104.1|  anhydro-N-acetylmuramic acid kinase [Acin...    155   5e-40 
ref|WP_018079612.1|  anhydro-N-acetylmuramic acid kinase [Thio...    154   5e-40 
ref|WP_006489419.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   5e-40 
ref|WP_005614195.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   6e-40 
gb|EXH33350.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    154   6e-40 
ref|WP_003377461.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   6e-40 
ref|WP_004897500.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   6e-40 
ref|WP_004287384.1|  anhydro-N-acetylmuramic acid kinase [Fran...    154   6e-40 
ref|WP_017399679.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   7e-40 
gb|EXE24865.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    154   7e-40 
ref|WP_000275001.1|  anhydro-N-acetylmuramic acid kinase [Baci...    154   7e-40 
ref|WP_006072913.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    154   7e-40 
ref|WP_027926759.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   7e-40 
ref|WP_007956330.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   7e-40 
ref|WP_016654489.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   7e-40 
ref|WP_010167203.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   8e-40 
ref|WP_004637302.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   8e-40 
ref|WP_010116386.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   8e-40 
ref|WP_030130032.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   9e-40 
ref|WP_026137166.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   9e-40 
ref|WP_010677289.1|  anhydro-N-acetylmuramic acid kinase [Baci...    154   9e-40 
ref|WP_008035995.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   9e-40 
ref|WP_003422783.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   9e-40 
ref|WP_017026903.1|  hypothetical protein [Vibrio breoganii]         154   1e-39 
ref|WP_016142642.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_004813956.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   1e-39 
ref|WP_005228146.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   1e-39 
ref|WP_004675455.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_003433176.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   1e-39 
ref|WP_015221466.1|  hypothetical protein [Cyanobacterium stan...    154   1e-39 
ref|WP_002538356.1|  Anhydro-N-acetylmuramic acid kinase [Grim...    154   1e-39 
ref|WP_028044212.1|  anhydro-N-acetylmuramic acid kinase [Cand...    154   1e-39 
ref|WP_008017446.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    154   1e-39 
ref|WP_004795587.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   1e-39 
ref|WP_005045355.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_009392836.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
gb|KFI09310.1|  anhydro-N-acetylmuramic acid kinase [Vibrio sp...    154   1e-39 
ref|WP_021506203.1|  anhydro-N-acetylmuramic acid kinase [Pant...    154   1e-39 
ref|WP_005758052.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   1e-39 
ref|WP_004776518.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   1e-39 
ref|WP_013196510.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_003194670.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   1e-39 
ref|WP_023176122.1|  anhydro-N-acetylmuramic acid kinase [Gloe...    154   1e-39 
ref|WP_005194336.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_024616715.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   1e-39 
ref|WP_020430569.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    153   1e-39 
ref|WP_001274592.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_010591402.1|  anhydro-N-acetylmuramic acid kinase [Acin...    154   1e-39 
ref|WP_005122207.1|  anhydro-N-acetylmuramic acid kinase [Acin...    153   1e-39 
ref|WP_005244818.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    154   1e-39 
ref|WP_001274578.1|  anhydro-N-acetylmuramic acid kinase [Acin...    153   1e-39 
ref|WP_018607146.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
ref|WP_008067466.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
ref|WP_024658137.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
gb|EYD43253.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    153   2e-39 
ref|WP_008008354.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
ref|WP_006010502.1|  anhydro-N-acetylmuramic acid kinase [Glac...    154   2e-39 
ref|WP_008147253.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
gb|KFJ42207.1|  hypothetical protein DR78_319 [Francisella phi...    153   2e-39 
ref|WP_004672279.1|  anhydro-N-acetylmuramic acid kinase [Acin...    153   2e-39 
ref|WP_026603458.1|  anhydro-N-acetylmuramic acid kinase [Meth...    153   2e-39 
ref|WP_004698186.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    153   2e-39 
ref|WP_001274584.1|  anhydro-N-acetylmuramic acid kinase [Acin...    153   2e-39 
gb|KEK23537.1|  anhydro-N-acetylmuramic acid kinase [Bacillus ...    153   2e-39 
ref|WP_000275000.1|  anhydro-N-acetylmuramic acid kinase [Baci...    153   2e-39 
ref|WP_027467443.1|  anhydro-N-acetylmuramic acid kinase [Deef...    153   2e-39 
ref|WP_008027120.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
ref|WP_022962962.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    153   2e-39 
gb|AHL36254.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    152   2e-39 
ref|WP_000274951.1|  anhydro-N-acetylmuramic acid kinase [Baci...    153   2e-39 
ref|WP_028462156.1|  anhydro-N-acetylmuramic acid kinase [Nitr...    152   2e-39 
ref|WP_016977903.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   2e-39 
gb|KEC84848.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    153   3e-39 
gb|KCY09468.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    153   3e-39 
ref|WP_004744844.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    152   3e-39 
ref|WP_014147058.1|  anhydro-N-acetylmuramic acid kinase [Meth...    153   3e-39 
ref|WP_026077828.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   3e-39 
ref|WP_001274590.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   3e-39 
dbj|BAP34949.1|  anhydro-N-acetylmuramic acid kinase [Acinetob...    152   3e-39 
gb|EZQ13886.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    152   3e-39 
dbj|BAN86000.1|  anhydro-N-acetylmuramic acid kinase [Acinetob...    153   3e-39 
ref|WP_026146968.1|  anhydro-N-acetylmuramic acid kinase [Meth...    152   3e-39 
ref|WP_004760232.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   3e-39 
ref|WP_007184518.1|  hypothetical protein [Hydrocarboniphaga e...    152   3e-39 
ref|WP_022653220.1|  anhydro-N-acetylmuramic acid kinase [Aqua...    152   3e-39 
ref|WP_019456687.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   3e-39 
ref|WP_004756812.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    152   3e-39 
gb|EXI35929.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    152   3e-39 
ref|WP_009090451.1|  anhydro-N-acetylmuramic acid kinase [Pant...    152   4e-39 
ref|WP_022610281.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    152   4e-39 
ref|WP_026286625.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    152   4e-39 
ref|WP_019580755.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   4e-39 
ref|WP_015886145.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   4e-39 
ref|WP_026472130.1|  anhydro-N-acetylmuramic acid kinase [Alka...    152   4e-39 
ref|WP_004777625.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   4e-39 
ref|WP_017840968.1|  anhydro-N-acetylmuramic acid kinase [Meth...    152   4e-39 
ref|WP_024697882.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   4e-39 
ref|WP_004871599.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   5e-39 
gb|KCW00280.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    152   5e-39 
ref|WP_017517351.1|  hypothetical protein [Pseudomonas nitrore...    152   5e-39 
ref|WP_029654508.1|  anhydro-N-acetylmuramic acid kinase [Mari...    152   5e-39 
ref|WP_016077736.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   5e-39 
ref|WP_026905304.1|  anhydro-N-acetylmuramic acid kinase [Pedo...    152   5e-39 
ref|WP_014230877.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    152   5e-39 
ref|WP_020752489.1|  putative molecular chaperone [Acinetobact...    152   5e-39 
ref|WP_026345948.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    152   5e-39 
ref|WP_001274581.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   5e-39 
gb|EPN63010.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    152   5e-39 
ref|WP_002069286.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   5e-39 
ref|WP_005961667.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    152   5e-39 
ref|WP_004797983.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   5e-39 
ref|WP_001274580.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   5e-39 
ref|WP_001274589.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_017031270.1|  hypothetical protein [Vibrio breoganii]         152   6e-39 
ref|WP_024434843.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_016098500.1|  anhydro-N-acetylmuramic acid kinase [Baci...    151   6e-39 
ref|WP_001274591.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_004770025.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_004683907.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_014340482.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   6e-39 
ref|WP_012132524.1|  anhydro-N-acetylmuramic acid kinase [Citr...    152   6e-39 
ref|WP_001274588.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    152   6e-39 
ref|WP_021510904.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   6e-39 
ref|WP_018679881.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   7e-39 
ref|WP_027855380.1|  anhydro-N-acetylmuramic acid kinase [Mari...    151   7e-39 
ref|WP_028115852.1|  anhydro-N-acetylmuramic acid kinase [Ferr...    152   7e-39 
ref|WP_004837146.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   7e-39 
ref|WP_000104635.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   7e-39 
emb|CDZ83528.1|  anhydro-N-acetylmuramic acid kinase [Citrobac...    152   7e-39 
ref|WP_024645933.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   7e-39 
ref|WP_005236765.1|  anhydro-N-acetylmuramic acid kinase [Ente...    152   7e-39 
ref|WP_016095318.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   7e-39 
ref|WP_000274999.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   7e-39 
ref|WP_000274968.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   7e-39 
ref|WP_001274576.1|  anhydro-N-acetylmuramic acid kinase [Acin...    152   7e-39 
gb|KFE49135.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    151   7e-39 
ref|WP_003309483.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   7e-39 
gb|EXG70554.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   8e-39 
ref|WP_000274969.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    152   8e-39 
ref|WP_016621309.1|  anhydro-N-acetylmuramic acid kinase [Ente...    152   8e-39 
ref|WP_001274587.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   8e-39 
ref|WP_008379719.1|  anhydro-N-acetylmuramic acid kinase [Ente...    152   8e-39 
gb|EXE21613.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   8e-39 
gb|EXB40129.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   8e-39 
gb|AIB44244.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    151   8e-39 
ref|WP_006957698.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    151   8e-39 
ref|WP_020313639.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   8e-39 
ref|WP_000274986.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   8e-39 
ref|WP_028618139.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   9e-39 
ref|WP_001274579.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   9e-39 
gb|KCY12352.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   9e-39 
ref|WP_027980380.1|  anhydro-N-acetylmuramic acid kinase [gamm...    151   9e-39 
ref|WP_025989035.1|  anhydro-N-acetylmuramic acid kinase [Baci...    151   9e-39 
ref|WP_026691310.1|  anhydro-N-acetylmuramic acid kinase [Baci...    152   9e-39 
ref|WP_019360710.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   1e-38 
ref|WP_010444156.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   1e-38 
gb|KCY00863.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   1e-38 
ref|WP_016543201.1|  Anhydro-N-acetylmuramic acid kinase [Acin...    151   1e-38 
ref|WP_013633942.1|  anhydro-N-acetylmuramic acid kinase [Pedo...    151   1e-38 
gb|EZP33826.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    151   1e-38 
ref|WP_027086315.1|  anhydro-N-acetylmuramic acid kinase [Cohn...    152   1e-38 
gb|KDD69259.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    151   1e-38 
ref|WP_014720160.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   1e-38 
ref|WP_006711481.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    151   1e-38 
ref|WP_020167078.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    151   1e-38 
ref|WP_028025956.1|  anhydro-N-acetylmuramic acid kinase [Ente...    151   1e-38 
ref|WP_005158953.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   1e-38 
ref|WP_004656880.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   1e-38 
gb|EXE84084.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    151   1e-38 
ref|WP_007251891.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    151   1e-38 
ref|WP_003307029.1|  anhydro-N-acetylmuramic acid kinase [Baci...    151   1e-38 
ref|WP_008051662.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   1e-38 
ref|WP_022604828.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    151   1e-38 
ref|WP_007244408.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    150   1e-38 
ref|WP_005219074.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   1e-38 
ref|WP_026027450.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    151   1e-38 
ref|WP_011478430.1|  anhydro-N-acetylmuramic acid kinase [Meth...    150   1e-38 
ref|WP_020304361.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   1e-38 
ref|WP_013964862.1|  anhydro-N-acetylmuramic acid kinase [Nitr...    150   1e-38 
ref|WP_028940285.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   1e-38 
ref|WP_005060429.1|  anhydro-N-acetylmuramic acid kinase [Acin...    151   1e-38 
ref|WP_013817500.1|  anhydro-N-acetylmuramic acid kinase [Meth...    151   1e-38 
ref|WP_005055362.1|  anhydro-N-acetylmuramic acid kinase [Acin...    150   2e-38 
ref|WP_017243553.1|  hypothetical protein [Vibrio breoganii]         150   2e-38 
ref|WP_001980078.1|  anhydro-N-acetylmuramic acid kinase [Baci...    151   2e-38 
ref|WP_018230692.1|  anhydro-N-acetylmuramic acid kinase [Meth...    150   2e-38 
ref|WP_005109117.1|  anhydro-N-acetylmuramic acid kinase [Acin...    150   2e-38 
ref|WP_016613242.1|  anhydro-N-acetylmuramic acid kinase [Ente...    151   2e-38 
ref|WP_000274955.1|  anhydro-N-acetylmuramic acid kinase [Baci...    151   2e-38 
ref|WP_009051132.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   2e-38 
ref|WP_023969105.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   2e-38 
ref|WP_002168379.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   2e-38 
ref|WP_016162094.1|  anhydro-N-acetylmuramic acid kinase [Acin...    150   2e-38 
ref|WP_000274989.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   2e-38 
ref|WP_003210933.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   2e-38 
ref|WP_005277634.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    150   2e-38 
ref|WP_011733699.1|  anhydro-N-acetylmuramic acid kinase [Fran...    150   2e-38 
ref|WP_002052795.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   2e-38 
gb|KFX33692.1|  anhydro-N-acetylmuramic acid kinase [Geobacill...    150   2e-38 
ref|WP_002038669.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   2e-38 
ref|WP_002050270.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   2e-38 
ref|WP_005596153.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    150   2e-38 
ref|WP_009852638.1|  anhydro-N-acetylmuramic acid kinase [beta...    150   2e-38 
ref|WP_000274949.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
ref|WP_013357723.1|  anhydro-N-acetylmuramic acid kinase [Pant...    150   3e-38 
ref|WP_000274988.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
ref|WP_000274948.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
ref|WP_006813242.1|  anhydro-N-acetylmuramic acid kinase [Prov...    150   3e-38 
ref|WP_000274946.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
ref|WP_000274982.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
gb|KDO00400.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    150   3e-38 
ref|WP_003034536.1|  anhydro-N-acetylmuramic acid kinase [Fran...    150   3e-38 
ref|WP_017110504.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    150   3e-38 
ref|WP_007994921.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   3e-38 
ref|WP_001274585.1|  anhydro-N-acetylmuramic acid kinase [Acin...    150   3e-38 
ref|WP_010221480.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   3e-38 
gb|EXR79738.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    150   3e-38 
ref|WP_016702776.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    150   3e-38 
ref|WP_019276859.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    150   3e-38 
ref|WP_010749417.1|  hypothetical protein [Enterococcus cassel...    150   3e-38 
ref|WP_015509985.1|  anhydro-N-acetylmuramic acid kinase [Ente...    150   3e-38 
ref|WP_000274987.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   3e-38 
ref|WP_027610743.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   3e-38 
emb|CEA06691.1|  anhydro-N-acetylmuramic acid kinase [Pseudomo...    149   4e-38 
ref|WP_000289013.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
ref|WP_011045450.1|  anhydro-N-acetylmuramic acid kinase [Colw...    150   4e-38 
ref|WP_020312072.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   4e-38 
ref|WP_016717503.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
gb|KFE25904.1|  hypothetical protein DN30_3416 [Vibrio cholerae]     149   4e-38 
ref|WP_015868251.1|  anhydro-N-acetylmuramic acid kinase [Kosm...    149   4e-38 
ref|WP_026215426.1|  anhydro-N-acetylmuramic acid kinase [Past...    150   4e-38 
ref|WP_003444453.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   4e-38 
ref|WP_016610824.1|  anhydro-N-acetylmuramic acid kinase [Ente...    150   4e-38 
ref|WP_003278246.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
ref|WP_004803368.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    150   4e-38 
ref|WP_016120200.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
ref|WP_011886497.1|  anhydro-N-acetylmuramic acid kinase [Fran...    149   4e-38 
ref|WP_008434463.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   4e-38 
ref|WP_013694343.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    149   4e-38 
ref|WP_000274967.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
ref|WP_025995994.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   4e-38 
ref|WP_029828433.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    149   4e-38 
ref|WP_020292767.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   4e-38 
ref|WP_000274959.1|  anhydro-N-acetylmuramic acid kinase [Baci...    150   4e-38 
ref|WP_009385658.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    149   5e-38 
ref|WP_004933530.1|  anhydro-N-acetylmuramic acid kinase [Acin...    149   5e-38 
gb|EEV32704.1|  anhydro-N-acetylmuramic acid kinase [Enterococ...    150   5e-38 
gb|ETK39006.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    149   5e-38 
ref|WP_000274993.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    149   5e-38 
ref|WP_002141765.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    149   5e-38 
ref|WP_004944554.1|  anhydro-N-acetylmuramic acid kinase [Acin...    149   5e-38 
ref|WP_013931360.1|  anhydro-N-acetylmuramic acid kinase [Ther...    149   5e-38 
ref|WP_017530834.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   5e-38 
ref|WP_022600134.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    149   5e-38 
ref|WP_000274947.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   5e-38 
ref|WP_017341085.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   6e-38 
ref|WP_016081643.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   6e-38 
ref|WP_016087869.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   6e-38 
ref|WP_003304977.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   6e-38 
ref|WP_013857548.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    149   6e-38 
ref|WP_002136309.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   6e-38 
ref|WP_004749219.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    149   6e-38 
ref|WP_004397931.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    149   6e-38 
ref|WP_005229685.1|  anhydro-N-acetylmuramic acid kinase [Ente...    149   6e-38 
ref|WP_019623170.1|  hypothetical protein [Amphritea japonica]       149   6e-38 
gb|AIK95720.1|  hypothetical protein ID47_01655 [endosymbiont ...    148   6e-38 
gb|KDN10362.1|  Anhydro-N-acetylmuramic acid kinase [Gilliamel...    149   6e-38 
ref|WP_024674779.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   6e-38 
ref|WP_010381267.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   7e-38 
ref|WP_000274994.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   7e-38 
ref|WP_005472332.1|  anhydro-N-acetylmuramic acid kinase [Ente...    149   7e-38 
ref|WP_026295581.1|  anhydro-N-acetylmuramic acid kinase [Meth...    149   7e-38 
ref|WP_014714928.1|  anhydro-N-acetylmuramic acid kinase [Fran...    149   7e-38 
ref|WP_002002771.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    149   7e-38 
ref|WP_000274954.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   8e-38 
ref|WP_021221628.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   8e-38 
gb|AHZ71155.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    149   8e-38 
ref|WP_003232542.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   8e-38 
ref|WP_026140132.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   8e-38 
ref|WP_000274956.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   8e-38 
ref|WP_004728861.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    149   8e-38 
ref|WP_002078213.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   8e-38 
ref|WP_003206113.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    149   8e-38 
ref|WP_009879065.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   8e-38 
ref|WP_021782736.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   8e-38 
ref|WP_025132433.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   9e-38 
ref|WP_023299957.1|  anhydro-N-acetylmuramic acid kinase [Ente...    149   9e-38 
ref|WP_007985995.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   9e-38 
ref|WP_000274983.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   9e-38 
ref|WP_017014872.1|  anhydro-N-acetylmuramic acid kinase [Ente...    148   9e-38 
ref|WP_000274996.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   9e-38 
gb|AIC23477.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    148   9e-38 
ref|WP_002036405.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   1e-37 
ref|WP_000274984.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   1e-37 
ref|WP_026908842.1|  anhydro-N-acetylmuramic acid kinase [Pauc...    149   1e-37 
ref|WP_015373078.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   1e-37 
ref|WP_014654559.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   1e-37 
ref|WP_003296688.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   1e-37 
ref|WP_000274985.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   1e-37 
ref|WP_025635146.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_000274995.1|  anhydro-N-acetylmuramic acid kinase [Baci...    149   1e-37 
ref|WP_026391563.1|  hypothetical protein [Acholeplasma modicum]     149   1e-37 
ref|WP_000840714.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_020840111.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_007918907.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    148   1e-37 
ref|WP_015097040.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    148   1e-37 
ref|WP_003037143.1|  anhydro-N-acetylmuramic acid kinase [Fran...    148   1e-37 
ref|WP_016789764.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_005290569.1|  anhydro-N-acetylmuramic acid kinase [Acin...    148   1e-37 
gb|KDA95731.1|  anhydro-N-acetylmuramic acid kinase [Pantoea a...    148   1e-37 
ref|WP_022942553.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    148   1e-37 
gb|EZI34621.1|  Anhydro-N-acetylmuramic acid kinase [Pantoea a...    148   1e-37 
gb|KFL59216.1|  anhydro-N-acetylmuramic acid kinase [Pantoea a...    148   1e-37 
ref|WP_022570874.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_017077731.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_002012895.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   1e-37 
ref|WP_020904202.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   1e-37 
ref|WP_002035113.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   1e-37 
ref|WP_024909357.1|  anhydro-N-acetylmuramic acid kinase [Ente...    148   1e-37 
ref|WP_029486945.1|  anhydro-N-acetylmuramic acid kinase [Ente...    148   2e-37 
ref|WP_001997479.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
ref|WP_000274975.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
ref|WP_005186232.1|  anhydro-N-acetylmuramic acid kinase [Acin...    148   2e-37 
ref|WP_026028077.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    148   2e-37 
ref|WP_005523091.1|  hypothetical protein [Vibrio mimicus]           148   2e-37 
ref|WP_025623550.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   2e-37 
ref|WP_025532834.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   2e-37 
ref|WP_002007680.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
gb|ETR83829.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    148   2e-37 
ref|WP_002165806.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
ref|WP_025510488.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   2e-37 
ref|WP_000276045.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
ref|WP_025576245.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    148   2e-37 
ref|WP_031591518.1|  anhydro-N-acetylmuramic acid kinase [Pant...    148   2e-37 
ref|WP_022589851.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    148   2e-37 
ref|WP_007980172.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   2e-37 
ref|WP_015296263.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
ref|WP_000835080.1|  anhydro-N-acetylmuramic acid kinase [Shig...    147   2e-37 
ref|WP_011531873.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   2e-37 
ref|WP_000835055.1|  anhydro-N-acetylmuramic acid kinase [Shig...    147   2e-37 
ref|WP_011336182.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   2e-37 
ref|WP_016184810.1|  hypothetical protein [Enterococcus sulfur...    148   2e-37 
ref|WP_008739718.1|  anhydro-N-acetylmuramic acid kinase [Alca...    147   2e-37 
ref|WP_005708052.1|  anhydro-N-acetylmuramic acid kinase [Haem...    147   2e-37 
ref|WP_008110280.1|  anhydro-N-acetylmuramic acid kinase [Pant...    147   2e-37 
ref|WP_010670045.1|  anhydro-N-acetylmuramic acid kinase [Pant...    147   2e-37 
ref|WP_013922763.1|  anhydro-N-acetylmuramic acid kinase [Fran...    148   2e-37 
ref|WP_020335934.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
ref|WP_002192911.1|  anhydro-N-acetylmuramic acid kinase [Baci...    148   2e-37 
ref|WP_008062900.1|  anhydro-N-acetylmuramic acid kinase [Meth...    147   2e-37 
ref|WP_029851136.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
gb|AHG75881.1|  Anhydro-N-acetylmuramic acid kinase [Mannheimi...    147   2e-37 
ref|WP_027120577.1|  hypothetical protein [Mycoplasma lipofaci...    147   2e-37 
ref|WP_000840725.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
ref|WP_002189606.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   2e-37 
ref|WP_010656634.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   2e-37 
ref|WP_014204516.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
ref|WP_010319153.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   2e-37 
ref|WP_022990256.1|  anhydro-N-acetylmuramic acid kinase [Mari...    147   2e-37 
dbj|GAE38400.1|  anhydro-N-acetylmuramic acid kinase [Bacillus...    147   2e-37 
ref|WP_021280553.1|  anhydro-N-acetylmuramic acid kinase [Mann...    147   2e-37 
ref|WP_006878831.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   3e-37 
ref|WP_000835056.1|  anhydro-N-acetylmuramic acid kinase [Shig...    147   3e-37 
ref|WP_000274998.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   3e-37 
ref|WP_006251060.1|  anhydro-N-acetylmuramic acid kinase [Mann...    147   3e-37 
ref|WP_029803139.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    147   3e-37 
ref|WP_005146326.1|  anhydro-N-acetylmuramic acid kinase [Acin...    147   3e-37 
ref|WP_019529818.1|  hypothetical protein [Dasania marina]           147   3e-37 
ref|WP_000289014.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   3e-37 
ref|WP_017129855.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   3e-37 
gb|KFD98193.1|  hypothetical protein DN34_2233 [Vibrio cholerae]     147   3e-37 
ref|WP_013146808.1|  anhydro-N-acetylmuramic acid kinase [Meth...    147   3e-37 
ref|WP_003288118.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   3e-37 
ref|WP_003294156.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   3e-37 
ref|WP_029438334.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   3e-37 
ref|WP_019934523.1|  anhydro-N-acetylmuramic acid kinase [Ocea...    147   3e-37 
gb|EUL39975.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    147   3e-37 
ref|WP_023335446.1|  anhydro-N-acetylmuramic acid kinase [Ente...    147   3e-37 
ref|WP_016782395.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   3e-37 
gb|EXJ29273.1|  hypothetical protein D050_4014 [Vibrio parahae...    147   3e-37 
ref|WP_031375727.1|  anhydro-N-acetylmuramic acid kinase [Pant...    147   3e-37 
ref|WP_015005069.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    147   4e-37 
ref|WP_029414547.1|  anhydro-N-acetylmuramic acid kinase [Acin...    147   4e-37 
gb|KDF49787.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    147   4e-37 
ref|WP_003324178.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   4e-37 
ref|WP_006248301.1|  anhydro-N-acetylmuramic acid kinase [Mann...    147   4e-37 
ref|WP_005607768.1|  anhydro-N-acetylmuramic acid kinase [Gran...    147   4e-37 
gb|EYT24577.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    145   4e-37 
ref|WP_028017301.1|  anhydro-N-acetylmuramic acid kinase [Ente...    147   4e-37 
ref|WP_008500577.1|  anhydro-N-acetylmuramic acid kinase [Ente...    147   4e-37 
ref|WP_002433528.1|  anhydro-N-acetylmuramic acid kinase [Esch...    147   4e-37 
ref|WP_027617201.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   4e-37 
ref|WP_006253692.1|  anhydro-N-acetylmuramic acid kinase [Mann...    147   5e-37 
ref|WP_027662370.1|  anhydro-N-acetylmuramic acid kinase [Esch...    147   5e-37 
ref|WP_031504757.1|  hypothetical protein [Thermotoga hypogea]       146   5e-37 
gb|KFA86092.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    147   5e-37 
gb|AIG03322.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    146   5e-37 
ref|WP_007941666.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   5e-37 
ref|WP_000274976.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   5e-37 
ref|WP_024225366.1|  anhydro-N-acetylmuramic acid kinase [Esch...    146   5e-37 
gb|KFE53390.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    146   5e-37 
ref|WP_027074385.1|  anhydro-N-acetylmuramic acid kinase [Mann...    146   5e-37 
ref|WP_019866581.1|  hypothetical protein [Methylovulum miyako...    146   5e-37 
ref|WP_003177728.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   5e-37 
ref|WP_005497200.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   5e-37 
ref|WP_010605516.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    147   5e-37 
ref|WP_025499415.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   5e-37 
ref|WP_021823376.1|  hypothetical protein [Vibrio parahaemolyt...    146   5e-37 
ref|WP_025441316.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   5e-37 
ref|WP_002146350.1|  anhydro-N-acetylmuramic acid kinase [Baci...    147   5e-37 
gb|EWG65335.1|  Anhydro-N-acetylmuramic acid kinase [Enterobac...    146   5e-37 
ref|WP_025611860.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   5e-37 
ref|WP_021710263.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   5e-37 
ref|WP_015219948.1|  anhydro-N-acetylmuramic acid kinase [Cyan...    147   6e-37 
ref|WP_025552589.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_025505047.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_005475872.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_021443724.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   6e-37 
ref|WP_024077688.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   6e-37 
ref|WP_003040151.1|  anhydro-N-acetylmuramic acid kinase [Fran...    146   6e-37 
ref|WP_029388329.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_025505724.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_000840713.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   6e-37 
ref|WP_019436723.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   7e-37 
ref|WP_014668332.1|  anhydro-N-acetylmuramic acid kinase [Past...    146   7e-37 
ref|WP_002085556.1|  anhydro-N-acetylmuramic acid kinase [Baci...    146   7e-37 
ref|WP_010863903.1|  anhydro-N-acetylmuramic acid kinase [Ples...    146   7e-37 
ref|WP_015570673.1|  MULTISPECIES: Predicted molecular chapero...    146   7e-37 
ref|WP_025604947.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   7e-37 
gb|EKD74770.1|  hypothetical protein ACD_44C00336G0005 [uncult...    146   7e-37 
gb|ACA58081.1|  AnmK [Francisella noatunensis]                       146   7e-37 
ref|WP_017138094.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   7e-37 
gb|KED33198.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    146   7e-37 
gb|EWG72029.1|  Anhydro-N-acetylmuramic acid kinase [Enterobac...    146   8e-37 
ref|WP_027917432.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   8e-37 
gb|AHG77894.1|  Anhydro-N-acetylmuramic acid kinase [Mannheimi...    146   8e-37 
ref|WP_014589467.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    146   8e-37 
gb|KFA90124.1|  anhydro-N-acetylmuramic acid kinase [Cystobact...    146   8e-37 
ref|WP_025522111.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   8e-37 
ref|WP_028696963.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   8e-37 
ref|WP_002018421.1|  anhydro-N-acetylmuramic acid kinase [Baci...    146   8e-37 
ref|WP_024702559.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   8e-37 
gb|KEE98195.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    146   8e-37 
ref|WP_023617343.1|  anhydro-N-acetylmuramic acid kinase [Ente...    146   9e-37 
gb|AIA25079.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    146   9e-37 
ref|WP_000840724.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   9e-37 
ref|WP_029296735.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   9e-37 
ref|WP_000835045.1|  anhydro-N-acetylmuramic acid kinase [Esch...    146   9e-37 
ref|WP_019003853.1|  hypothetical protein [Cohnella laeviribosi]     146   9e-37 
ref|WP_029740321.1|  anhydro-N-acetylmuramic acid kinase [Ente...    146   9e-37 
ref|WP_023311368.1|  anhydro-N-acetylmuramic acid kinase [Ente...    146   9e-37 
ref|WP_016786107.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   9e-37 
ref|WP_016767723.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    146   9e-37 
ref|WP_016799147.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_002051274.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_023566210.1|  anhydro-N-acetylmuramic acid kinase [Esch...    144   1e-36 
ref|WP_019097612.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   1e-36 
ref|WP_025524980.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_023343975.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   1e-36 
ref|WP_016108398.1|  anhydro-N-acetylmuramic acid kinase [Baci...    146   1e-36 
ref|WP_010245545.1|  anhydro-N-acetylmuramic acid kinase [Pant...    145   1e-36 
ref|WP_031415038.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_005209674.1|  anhydro-N-acetylmuramic acid kinase [Acin...    145   1e-36 
ref|WP_025645996.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    147   1e-36 
ref|WP_002197767.1|  anhydro-N-acetylmuramic acid kinase [Baci...    146   1e-36 
ref|WP_022625736.1|  anhydro-N-acetylmuramic acid kinase [Pant...    145   1e-36 
ref|WP_015167050.1|  molecular chaperone [Synechococcus sp. PC...    145   1e-36 
ref|WP_031266045.1|  anhydro-N-acetylmuramic acid kinase [Cyto...    146   1e-36 
ref|WP_004885456.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   1e-36 
ref|WP_027882892.1|  anhydro-N-acetylmuramic acid kinase [Meio...    145   1e-36 
ref|WP_004373464.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   1e-36 
ref|WP_025754019.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   1e-36 
ref|WP_000840723.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_027605885.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   1e-36 
ref|WP_015829103.1|  anhydro-N-acetylmuramic acid kinase [Meth...    145   1e-36 
ref|WP_017036897.1|  hypothetical protein [Vibrio genomosp. F10]     145   1e-36 
gb|KFN46398.1|  hypothetical protein N787_11080 [Arenimonas me...    145   1e-36 
gb|EUL65230.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    145   1e-36 
ref|WP_014069978.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   1e-36 
ref|WP_029685848.1|  anhydro-N-acetylmuramic acid kinase [Tatu...    145   1e-36 
emb|CDG85206.1|  anhydro-N-acetylmuramic acid kinase [Janthino...    145   1e-36 
ref|WP_014326420.1|  anhydro-N-acetylmuramic acid kinase [Past...    145   1e-36 
ref|WP_000289012.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   1e-36 
ref|WP_005460274.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
gb|KFD82022.1|  hypothetical protein DA89_640 [Vibrio cholerae]      145   1e-36 
ref|WP_029866018.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   1e-36 
ref|WP_002196490.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   1e-36 
ref|WP_006661930.1|  anhydro-N-acetylmuramic acid kinase [Prov...    145   1e-36 
dbj|BAO64902.1|  anhydro-N-acetylmuramic acid kinase [Pseudomo...    145   1e-36 
ref|WP_001897496.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_012429592.1|  anhydro-N-acetylmuramic acid kinase [Fran...    144   1e-36 
ref|WP_000840721.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_027601384.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   1e-36 
ref|WP_000840716.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_000840722.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   1e-36 
ref|WP_029442298.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   1e-36 
ref|WP_024687679.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   1e-36 
ref|WP_029793075.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   1e-36 
ref|WP_017011625.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   1e-36 
ref|WP_025911573.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   1e-36 
gb|ETK19396.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    145   1e-36 
ref|WP_017449484.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
gb|KFM98520.1|  hypothetical protein DJ93_4954 [Bacillus mycoi...    145   2e-36 
ref|WP_031578614.1|  hypothetical protein [Ruminobacter sp. RM87]    145   2e-36 
ref|WP_007639334.1|  anhydro-N-acetylmuramic acid kinase [Glac...    146   2e-36 
ref|WP_016109965.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   2e-36 
gb|KDO15322.1|  anhydro-N-acetylmuramic acid kinase [Vibrio sp...    145   2e-36 
ref|WP_017686254.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_001914896.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_005422656.1|  anhydro-N-acetylmuramic acid kinase [Alii...    145   2e-36 
ref|WP_021714439.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_018673177.1|  anhydro-N-acetylmuramic acid kinase [Brev...    145   2e-36 
ref|WP_025541197.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_010434847.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_020884330.1|  Anhydro-N-acetylmuramic acid kinase [Ente...    145   2e-36 
ref|WP_028633510.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   2e-36 
ref|WP_025610877.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_018753237.1|  hypothetical protein [Paenibacillus sangu...    145   2e-36 
ref|WP_021241136.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   2e-36 
gb|KEY43075.1|  anhydro-N-acetylmuramic acid kinase [Pantoea a...    145   2e-36 
ref|WP_000840720.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_003857603.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   2e-36 
ref|WP_011263351.1|  anhydro-N-acetylmuramic acid kinase [Alii...    145   2e-36 
gb|KFE13841.1|  hypothetical protein DN37_667 [Vibrio cholerae]      145   2e-36 
ref|WP_025626716.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_029835150.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_028102301.1|  anhydro-N-acetylmuramic acid kinase [Duga...    145   2e-36 
ref|WP_016512851.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   2e-36 
ref|WP_024700214.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_017035455.1|  hypothetical protein [Vibrio genomosp. F10]     145   2e-36 
ref|WP_025570610.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_022650944.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   2e-36 
ref|WP_029559489.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_020192673.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    145   2e-36 
ref|WP_029699083.1|  anhydro-N-acetylmuramic acid kinase [Clos...    145   2e-36 
ref|WP_008824386.1|  anhydro-N-acetylmuramic acid kinase [Halo...    145   2e-36 
ref|WP_000840712.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
gb|KFZ85299.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    145   2e-36 
ref|WP_024967957.1|  anhydro-N-acetylmuramic acid kinase [Pant...    145   2e-36 
ref|WP_016715799.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   2e-36 
ref|WP_000840726.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_025638445.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_025522019.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
ref|WP_026196828.1|  hypothetical protein [Sciscionella marina]      145   2e-36 
ref|WP_013014446.1|  hypothetical protein [Meiothermus ruber]        144   2e-36 
ref|WP_005758041.1|  anhydro-N-acetylmuramic acid kinase [Past...    145   2e-36 
gb|KFE22437.1|  hypothetical protein DA89_2855 [Vibrio cholerae]     145   2e-36 
ref|WP_025622197.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    145   2e-36 
gb|EXD32728.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    144   2e-36 
gb|EUM11996.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    145   2e-36 
ref|WP_028012907.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   2e-36 
ref|WP_023313969.1|  anhydro-N-acetylmuramic acid kinase [Ente...    145   2e-36 
ref|WP_019092763.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   2e-36 
gb|KFF78073.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    145   2e-36 
ref|WP_025535972.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
gb|EXE71164.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    144   3e-36 
ref|WP_008568230.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   3e-36 
ref|WP_023584933.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
gb|KEE94634.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    144   3e-36 
ref|WP_000840728.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_010907365.1|  anhydro-N-acetylmuramic acid kinase [Past...    145   3e-36 
ref|WP_004410264.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_007947968.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   3e-36 
ref|WP_018122123.1|  hypothetical protein [Wohlfahrtiimonas ch...    145   3e-36 
ref|WP_021450229.1|  hypothetical protein [Vibrio parahaemolyt...    144   3e-36 
gb|KED46840.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    144   3e-36 
ref|WP_025546166.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_011310969.1|  anhydro-N-acetylmuramic acid kinase [Thio...    144   3e-36 
ref|WP_023624845.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_017059352.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_008790826.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    144   3e-36 
ref|WP_007162615.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   3e-36 
ref|WP_029809654.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
gb|KDN26915.1|  anhydro-N-acetylmuramic acid kinase [Vibrio fo...    144   3e-36 
ref|WP_025627173.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_016533611.1|  anhydro-N-acetylmuramic acid kinase [Past...    144   3e-36 
ref|WP_002041120.1|  anhydro-N-acetylmuramic acid kinase [Baci...    145   3e-36 
ref|WP_006808995.1|  anhydro-N-acetylmuramic acid kinase [Ente...    144   3e-36 
ref|WP_029847239.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_004574936.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   3e-36 
ref|WP_000274971.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   3e-36 
ref|WP_000274960.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    145   3e-36 
ref|WP_006118999.1|  anhydro-N-acetylmuramic acid kinase [Pant...    144   3e-36 
ref|WP_009225979.1|  anhydro-N-acetylmuramic acid kinase [Paen...    145   3e-36 
ref|WP_000840717.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
gb|ETT75016.1|  anhydro-N-acetylmuramic acid kinase [Bacillus ...    145   3e-36 
ref|WP_007146259.1|  anhydro-N-acetylmuramic acid kinase [Meth...    144   3e-36 
ref|WP_029628511.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_016506868.1|  Anhydro-N-acetylmuramic acid kinase [Salm...    144   3e-36 
ref|WP_025578456.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_003850265.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    144   3e-36 
ref|WP_029797954.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
ref|WP_029225446.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   3e-36 
gb|AHF69750.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    144   3e-36 
ref|WP_021487249.1|  hypothetical protein [Vibrio parahaemolyt...    144   3e-36 
ref|WP_011953320.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   3e-36 
ref|WP_014883570.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    144   3e-36 
ref|WP_000840719.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_031470798.1|  hypothetical protein [Sciscionella sp. SE31]    144   4e-36 
ref|WP_025593038.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_005707214.1|  anhydro-N-acetylmuramic acid kinase [Haem...    144   4e-36 
ref|WP_003189220.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   4e-36 
ref|WP_029796210.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_029712907.1|  hypothetical protein [candidate division ...    144   4e-36 
ref|WP_014548679.1|  anhydro-N-acetylmuramic acid kinase [Fran...    144   4e-36 
ref|WP_025631969.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_023292625.1|  anhydro-N-acetylmuramic acid kinase [Ente...    144   4e-36 
ref|WP_020933157.1|  putative molecular chaperone/HSP70-fold m...    144   4e-36 
ref|WP_006660070.1|  anhydro-N-acetylmuramic acid kinase [Prov...    144   4e-36 
ref|WP_029843083.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_003297531.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   4e-36 
ref|WP_029841347.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_025553382.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_025636883.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_010430345.1|  anhydro-N-acetylmuramic acid kinase [Ente...    144   4e-36 
ref|WP_000274972.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    144   4e-36 
ref|WP_014207693.1|  anhydro-N-acetylmuramic acid kinase [Acin...    144   4e-36 
ref|WP_025587405.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_019693891.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   4e-36 
ref|WP_021454432.1|  hypothetical protein [Vibrio parahaemolyt...    144   4e-36 
ref|WP_000840715.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
ref|WP_012019788.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   4e-36 
ref|WP_016796541.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
emb|CCQ74554.1|  Anhydro-N-acetylmuramic acid kinase [Magnetos...    144   4e-36 
ref|WP_016797240.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   4e-36 
gb|KFF89874.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    144   4e-36 
ref|WP_017658044.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   5e-36 
ref|WP_017642982.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   5e-36 
ref|WP_011213695.1|  anhydro-N-acetylmuramic acid kinase [Legi...    144   5e-36 
ref|WP_016787578.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
ref|WP_016799825.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|KFJ88094.1|  anhydro-N-acetylmuramic acid kinase [Vibrio sp...    144   5e-36 
ref|WP_016783942.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|ADI17172.1|  predicted molecular chaperone distantly relate...    144   5e-36 
ref|WP_022549714.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|KEY84967.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    144   5e-36 
ref|WP_000274977.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   5e-36 
ref|WP_002061370.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   5e-36 
ref|WP_017070059.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
ref|WP_029838816.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|ETT17610.1|  hypothetical protein D028_1609 [Vibrio parahae...    144   5e-36 
ref|WP_005286137.1|  anhydro-N-acetylmuramic acid kinase [Edwa...    144   5e-36 
ref|WP_017062861.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|AHG79359.1|  Anhydro-N-acetylmuramic acid kinase [Mannheimi...    144   5e-36 
ref|WP_025541349.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   5e-36 
gb|ETS99672.1|  anhydro-N-acetylmuramic acid kinase [Providenc...    144   5e-36 
ref|WP_020295501.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   6e-36 
ref|WP_014843815.1|  anhydro-N-acetylmuramic acid kinase [Legi...    144   6e-36 
ref|WP_021543340.1|  anhydro-N-acetylmuramic acid kinase [Esch...    144   6e-36 
ref|WP_019823147.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   6e-36 
ref|WP_011737444.1|  anhydro-N-acetylmuramic acid kinase [Cand...    143   6e-36 
ref|WP_025536229.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
ref|WP_025507876.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
ref|WP_029999936.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
ref|WP_000274966.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    144   6e-36 
dbj|GAJ69986.1|  anhydro-N-acetylmuramic acid kinase [Vibrio s...    144   6e-36 
ref|WP_025789305.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
ref|WP_000840718.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
ref|WP_025500444.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    144   6e-36 
sp|Q81DH0.2|ANMK_BACCR  RecName: Full=Anhydro-N-acetylmuramic ...    144   6e-36 
ref|WP_025633162.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   7e-36 
ref|WP_002127404.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   7e-36 
ref|WP_016122501.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   7e-36 
ref|WP_002025780.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   7e-36 
ref|WP_028537712.1|  anhydro-N-acetylmuramic acid kinase [Paen...    144   7e-36 
ref|WP_002195501.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   7e-36 
ref|WP_029807309.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   7e-36 
ref|WP_014169790.1|  anhydro-N-acetylmuramic acid kinase [Ente...    144   7e-36 
ref|WP_005761391.1|  anhydro-N-acetylmuramic acid kinase [Past...    143   7e-36 
ref|WP_028621474.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   7e-36 
ref|WP_025630112.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   7e-36 
ref|WP_003176442.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   7e-36 
ref|WP_010768122.1|  hypothetical protein [Enterococcus phoeni...    143   7e-36 
ref|WP_012242219.1|  anhydro-N-acetylmuramic acid kinase [Acho...    144   7e-36 
ref|WP_003301281.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   7e-36 
ref|WP_015637235.1|  anhydro-N-acetylmuramic acid kinase AnmK ...    143   8e-36 
ref|WP_000274953.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   8e-36 
ref|WP_005397505.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_029839143.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_028610849.1|  anhydro-N-acetylmuramic acid kinase [Paen...    144   8e-36 
ref|WP_010378676.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    144   8e-36 
ref|WP_025792739.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_025804015.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   8e-36 
dbj|BAO30890.1|  hypothetical protein SUTH_03117 [Sulfuritalea...    143   8e-36 
ref|WP_029406179.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_029857229.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_025817146.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   8e-36 
ref|WP_000276042.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   8e-36 
ref|WP_021505456.1|  anhydro-N-acetylmuramic acid kinase [Serr...    143   9e-36 
ref|WP_000840730.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   9e-36 
ref|WP_000840729.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   9e-36 
gb|EZH82396.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    143   9e-36 
ref|WP_000274980.1|  anhydro-N-acetylmuramic acid kinase [Baci...    144   9e-36 
ref|WP_006743110.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   9e-36 
dbj|BAP41911.1|  anhydro-N-acetylmuramic acid kinase [Pseudomo...    143   9e-36 
ref|WP_009408532.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   9e-36 
ref|WP_023521930.1|  anhydro-N-acetylmuramic acid kinase [Baci...    143   9e-36 
ref|WP_005724845.1|  anhydro-N-acetylmuramic acid kinase [Past...    143   9e-36 
ref|WP_010446031.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   9e-36 
ref|WP_012017202.1|  anhydro-N-acetylmuramic acid kinase [Ente...    143   1e-35 
ref|WP_001961572.1|  Anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_000558350.1|  anhydro-N-acetylmuramic acid kinase [Baci...    143   1e-35 
ref|WP_003463420.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   1e-35 
ref|WP_013711104.1|  anhydro-N-acetylmuramic acid kinase [Carn...    143   1e-35 
ref|WP_020704901.1|  hypothetical protein [Oxalobacteraceae ba...    143   1e-35 
ref|WP_016790865.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_016927911.1|  anhydro-N-acetylmuramic acid kinase [Serr...    143   1e-35 
ref|WP_026795977.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    143   1e-35 
ref|WP_017629788.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_000835035.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    143   1e-35 
ref|WP_017216865.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   1e-35 
ref|WP_010951767.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    143   1e-35 
ref|WP_027255585.1|  anhydro-N-acetylmuramic acid kinase [Plan...    143   1e-35 
ref|WP_001587107.1|  anhydro-N-acetylmuramic acid kinase [Esch...    143   1e-35 
ref|WP_025758347.1|  anhydro-N-acetylmuramic acid kinase [Ente...    143   1e-35 
gb|EXU75941.1|  anhydro-N-acetylmuramic acid kinase [Erwinia m...    143   1e-35 
ref|WP_000289007.1|  anhydro-N-acetylmuramic acid kinase [Baci...    143   1e-35 
ref|WP_000835103.1|  anhydro-N-acetylmuramic acid kinase [Esch...    143   1e-35 
ref|WP_000835034.1|  anhydro-N-acetylmuramic acid kinase [Esch...    143   1e-35 
ref|WP_000835027.1|  anhydro-N-acetylmuramic acid kinase [Salm...    143   1e-35 
ref|WP_012842126.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_015432727.1|  Anhydro-N-acetylmuramic acid kinase [Bibe...    143   1e-35 
ref|WP_005477894.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_000840731.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|XP_001744950.1|  hypothetical protein [Monosiga brevicolli...    147   1e-35 
ref|WP_028110979.1|  anhydro-N-acetylmuramic acid kinase [Ferr...    142   1e-35 
ref|WP_025639936.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_005533280.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    143   1e-35 
ref|WP_000835049.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   1e-35 
gb|KFC10908.1|  anhydro-N-acetylmuramic acid kinase [Trabulsie...    143   1e-35 
gb|AGX33727.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    142   1e-35 
gb|KFC89674.1|  anhydro-N-acetylmuramic acid kinase [Leclercia...    143   1e-35 
ref|WP_001963975.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   1e-35 
emb|CDG12064.1|  anhydro-N-acetylmuramic acid kinase [Serratia...    143   1e-35 
gb|KEI67019.1|  hypothetical protein A19Y_2051 [Planktothrix a...    143   1e-35 
ref|WP_029405788.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   1e-35 
ref|WP_019001217.1|  hypothetical protein [Succinimonas amylol...    142   1e-35 
ref|WP_000835039.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   1e-35 
ref|WP_003408287.1|  anhydro-N-acetylmuramic acid kinase [Clos...    143   1e-35 
ref|WP_015377738.1|  anhydro-N-acetylmuramic acid kinase [Serr...    142   1e-35 
emb|CDK73759.1|  Anhydro-N-acetylmuramic acid kinase [Klebsiel...    142   1e-35 
ref|WP_009767339.1|  anhydro-N-acetylmuramic acid kinase [Mora...    143   1e-35 
ref|WP_005764120.1|  anhydro-N-acetylmuramic acid kinase [Past...    142   1e-35 
ref|WP_027224934.1|  anhydro-N-acetylmuramic acid kinase [Legi...    142   1e-35 
ref|WP_007892787.1|  anhydro-N-acetylmuramic acid kinase [Pant...    142   1e-35 
ref|WP_012127051.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   1e-35 
gb|EUD04513.1|  anhydro-N-acetylmuramic acid kinase [Providenc...    142   2e-35 
gb|ETT05107.1|  anhydro-N-acetylmuramic acid kinase [Providenc...    142   2e-35 
ref|WP_026785319.1|  anhydro-N-acetylmuramic acid kinase [Plan...    143   2e-35 
ref|WP_014398136.1|  anhydro-N-acetylmuramic acid kinase [Cora...    143   2e-35 
dbj|GAJ64249.1|  anhydro-N-acetylmuramic acid kinase [Edwardsi...    142   2e-35 
gb|EZP68955.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    142   2e-35 
ref|WP_011946420.1|  anhydro-N-acetylmuramic acid kinase [Legi...    142   2e-35 
ref|WP_016248675.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_029560238.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_022472470.1|  anhydro-N-acetylmuramic acid kinase [Sutt...    142   2e-35 
ref|WP_002024123.1|  anhydro-N-acetylmuramic acid kinase [Baci...    143   2e-35 
ref|WP_000835064.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
gb|EYD85573.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    142   2e-35 
ref|WP_000840732.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_023308016.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_000840727.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_029222925.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
gb|KCX25241.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    141   2e-35 
ref|WP_024159335.1|  anhydro-N-acetylmuramic acid kinase [Salm...    142   2e-35 
ref|WP_021550724.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_000274970.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   2e-35 
ref|WP_025768438.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_024230945.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_009615674.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_016496282.1|  anhydro-N-acetylmuramic acid kinase [Ente...    142   2e-35 
ref|WP_000274979.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   2e-35 
ref|WP_014755141.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_000835105.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_005755459.1|  anhydro-N-acetylmuramic acid kinase [Past...    142   2e-35 
ref|WP_004931296.1|  anhydro-N-acetylmuramic acid kinase [Serr...    142   2e-35 
ref|WP_029882777.1|  anhydro-N-acetylmuramic acid kinase [Ente...    142   2e-35 
ref|WP_011980928.1|  anhydro-N-acetylmuramic acid kinase [Sulf...    142   2e-35 
ref|WP_024242561.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_000835086.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_029223989.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_017674048.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   2e-35 
ref|WP_002614627.1|  hypothetical protein [Stigmatella auranti...    142   2e-35 
ref|WP_001563413.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_028688999.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_017255508.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_015461461.1|  anhydro-N-acetylmuramic acid kinase [Edwa...    143   2e-35 
ref|WP_027900657.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_000835033.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    142   2e-35 
ref|WP_009848453.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_000835036.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    142   2e-35 
ref|WP_010646599.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
emb|CDL53016.1|  Anhydro-N-acetylmuramic acid kinase [Klebsiel...    140   2e-35 
ref|WP_025869196.1|  anhydro-N-acetylmuramic acid kinase [Ente...    142   2e-35 
ref|WP_013096911.1|  anhydro-N-acetylmuramic acid kinase [Ente...    142   2e-35 
ref|WP_008952739.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_000840733.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_010322488.1|  anhydro-N-acetylmuramic acid kinase [Mari...    142   2e-35 
gb|KCV74538.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    142   2e-35 
ref|WP_027694246.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_001592543.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_001698457.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   2e-35 
ref|WP_003340065.1|  anhydro-N-acetylmuramic acid kinase [Brev...    142   2e-35 
ref|WP_017087552.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   2e-35 
ref|WP_005752312.1|  anhydro-N-acetylmuramic acid kinase [Past...    142   2e-35 
ref|WP_000289010.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    142   2e-35 
ref|WP_011063788.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   2e-35 
ref|WP_009101464.1|  anhydro-N-acetylmuramic acid kinase [Halo...    142   3e-35 
ref|WP_012848528.1|  anhydro-N-acetylmuramic acid kinase [Edwa...    142   3e-35 
ref|WP_002199705.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   3e-35 
ref|WP_000289009.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   3e-35 
gb|AHX18524.1|  anhydro-N-acetylmuramic acid kinase [Bacillus ...    142   3e-35 
ref|WP_002581419.1|  hypothetical protein [Clostridium butyricum]    142   3e-35 
ref|WP_000835017.1|  anhydro-N-acetylmuramic acid kinase [Salm...    142   3e-35 
ref|WP_017018655.1|  anhydro-N-acetylmuramic acid kinase [Alii...    142   3e-35 
ref|WP_000835084.1|  anhydro-N-acetylmuramic acid kinase [Shig...    142   3e-35 
ref|WP_016393176.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   3e-35 
ref|WP_029805358.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   3e-35 
ref|WP_003432082.1|  anhydro-N-acetylmuramic acid kinase [Clos...    142   3e-35 
ref|WP_012535090.1|  anhydro-N-acetylmuramic acid kinase [Alii...    142   3e-35 
ref|WP_023481513.1|  anhydro-N-acetylmuramic acid kinase [Ente...    142   3e-35 
ref|WP_000835066.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_001613166.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_017071389.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    142   3e-35 
ref|WP_017902851.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    142   3e-35 
gb|KFB55116.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    142   3e-35 
ref|WP_000835040.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_000835065.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_023154335.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_001488800.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_000835037.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_001337819.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   3e-35 
ref|WP_026958230.1|  anhydro-N-acetylmuramic acid kinase [Alia...    142   3e-35 
ref|WP_017939808.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   3e-35 
ref|WP_002111107.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   3e-35 
ref|WP_012905688.1|  anhydro-N-acetylmuramic acid kinase [Citr...    142   3e-35 
ref|WP_000274992.1|  hypothetical protein [Bacillus cereus]          139   3e-35 
ref|WP_000835058.1|  anhydro-N-acetylmuramic acid kinase [Esch...    142   3e-35 
ref|WP_011768632.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    142   3e-35 
gb|KDW31544.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    141   3e-35 
ref|WP_028631047.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   3e-35 
ref|WP_000835074.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   3e-35 
ref|WP_014841552.1|  anhydro-N-acetylmuramic acid kinase [Legi...    141   3e-35 
ref|WP_027308116.1|  anhydro-N-acetylmuramic acid kinase [Calo...    142   3e-35 
ref|WP_000274958.1|  anhydro-N-acetylmuramic acid kinase [Baci...    142   3e-35 
ref|WP_000835091.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   3e-35 
gb|ETX45533.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    141   3e-35 
gb|ETT47977.1|  anhydro-N-acetylmuramic acid kinase [Paenibaci...    142   3e-35 
emb|CDK44787.1|  Anhydro-N-acetylmuramic acid kinase [Escheric...    141   4e-35 
gb|AHG73634.1|  Anhydro-N-acetylmuramic acid kinase [Mannheimi...    141   4e-35 
ref|WP_000835075.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_019820536.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   4e-35 
ref|WP_026971261.1|  anhydro-N-acetylmuramic acid kinase [Alia...    141   4e-35 
ref|WP_021554143.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835108.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_005381909.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   4e-35 
ref|WP_014831634.1|  anhydro-N-acetylmuramic acid kinase [Ente...    141   4e-35 
gb|KFC80700.1|  anhydro-N-acetylmuramic acid kinase [Ewingella...    141   4e-35 
ref|WP_019924398.1|  hypothetical protein [Duganella zoogloeoi...    141   4e-35 
ref|WP_001530275.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835048.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_014087332.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   4e-35 
ref|WP_020287243.1|  anhydro-N-acetylmuramic acid kinase [Osed...    141   4e-35 
ref|WP_009681265.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   4e-35 
ref|WP_023232828.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   4e-35 
ref|WP_003285495.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   4e-35 
gb|KDY54530.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    141   4e-35 
ref|WP_000835081.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835076.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835072.1|  anhydro-N-acetylmuramic acid kinase [Shig...    141   4e-35 
ref|WP_001373652.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_029224689.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   4e-35 
ref|WP_001590171.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_018623262.1|  hypothetical protein [Kangiella aquimarina]     141   4e-35 
ref|WP_000835054.1|  anhydro-N-acetylmuramic acid kinase [Shig...    141   4e-35 
ref|WP_000835078.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   4e-35 
ref|WP_016484641.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   4e-35 
ref|WP_001599952.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_001515392.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835071.1|  anhydro-N-acetylmuramic acid kinase [Shig...    141   4e-35 
gb|KDS00564.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    141   4e-35 
ref|WP_021524192.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_016126937.1|  anhydro-N-acetylmuramic acid kinase [Baci...    141   4e-35 
ref|WP_027599091.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   4e-35 
gb|KEQ00929.1|  putative molecular chaperone distantly related...    141   4e-35 
ref|WP_023274097.1|  anhydro-N-acetylmuramic acid kinase [Acin...    141   4e-35 
ref|WP_005719202.1|  anhydro-N-acetylmuramic acid kinase [Past...    141   4e-35 
ref|WP_022586442.1|  anhydro-N-acetylmuramic acid kinase [Brev...    141   4e-35 
ref|WP_019455972.1|  anhydro-N-acetylmuramic acid kinase [Serr...    141   4e-35 
ref|WP_006708823.1|  anhydro-N-acetylmuramic acid kinase [Serr...    141   4e-35 
ref|WP_000835087.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_023261828.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   4e-35 
ref|WP_024234269.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835038.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835069.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   4e-35 
ref|WP_024522032.1|  anhydro-N-acetylmuramic acid kinase [Edwa...    141   4e-35 
ref|WP_001527075.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_000835083.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   4e-35 
ref|WP_014291104.1|  anhydro-N-acetylmuramic acid kinase [Ocea...    141   5e-35 
ref|WP_031565534.1|  anhydro-N-acetylmuramic acid kinase [Legi...    141   5e-35 
ref|WP_000835079.1|  anhydro-N-acetylmuramic acid kinase [Shig...    141   5e-35 
ref|WP_009843081.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   5e-35 
ref|WP_024850377.1|  hypothetical protein [Thiomicrospira kuen...    141   5e-35 
ref|WP_019341358.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   5e-35 
ref|WP_000835053.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
gb|ESJ40300.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   5e-35 
ref|WP_015348674.1|  anhydro-N-acetylmuramic acid kinase [Myxo...    141   5e-35 
ref|WP_027635166.1|  anhydro-N-acetylmuramic acid kinase [Clos...    141   5e-35 
gb|KEN44409.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    141   5e-35 
ref|WP_000835057.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   5e-35 
ref|WP_000835077.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   5e-35 
ref|WP_000835025.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   5e-35 
ref|WP_027226594.1|  anhydro-N-acetylmuramic acid kinase [Legi...    141   5e-35 
ref|WP_001409895.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_000835100.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_031433567.1|  anhydro-N-acetylmuramic acid kinase [Meth...    141   5e-35 
ref|WP_002043174.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   5e-35 
ref|WP_008290226.1|  anhydro-N-acetylmuramic acid kinase [Meth...    141   5e-35 
ref|WP_000835101.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_023168629.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   5e-35 
ref|WP_000835068.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_000835067.1|  anhydro-N-acetylmuramic acid kinase [Shig...    141   5e-35 
ref|WP_000835085.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_005034812.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   5e-35 
ref|WP_000835046.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
gb|ETU77434.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    141   5e-35 
ref|WP_004823967.1|  anhydro-N-acetylmuramic acid kinase [Acin...    141   5e-35 
ref|WP_017066925.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   5e-35 
ref|WP_000835104.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   5e-35 
ref|WP_023243906.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   5e-35 
ref|WP_016972417.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   5e-35 
ref|WP_029276910.1|  anhydro-N-acetylmuramic acid kinase [Carn...    141   5e-35 
ref|WP_005385936.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   5e-35 
ref|WP_019815100.1|  hypothetical protein [Osedax symbiont Rs1]      141   5e-35 
ref|WP_027594417.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    141   5e-35 
ref|WP_018952622.1|  anhydro-N-acetylmuramic acid kinase [Thio...    141   6e-35 
ref|WP_017056138.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   6e-35 
ref|WP_025709618.1|  anhydro-N-acetylmuramic acid kinase [Baci...    141   6e-35 
ref|WP_024249133.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    141   6e-35 
ref|WP_001538792.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
gb|KEY49431.1|  anhydro-N-acetylmuramic acid kinase [Citrobact...    141   6e-35 
emb|CDH45034.1|  conserved hypothetical protein [Candidatus Co...    141   6e-35 
ref|WP_020560242.1|  hypothetical protein [Thiothrix flexilis]       141   6e-35 
ref|WP_000274963.1|  anhydro-N-acetylmuramic acid kinase [Baci...    141   6e-35 
ref|WP_008915523.1|  anhydro-N-acetylmuramic acid kinase [Prov...    141   6e-35 
ref|WP_024009067.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
gb|AHO16929.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   6e-35 
ref|WP_005425337.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    141   6e-35 
gb|KDA58327.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    141   6e-35 
ref|WP_001648886.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
ref|WP_000835070.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
ref|WP_023212223.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
ref|WP_014861772.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   6e-35 
ref|WP_029939618.1|  hypothetical protein [Thiomicrospira sp. ...    140   6e-35 
ref|WP_023220689.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
ref|WP_024557670.1|  anhydro-N-acetylmuramic acid kinase [Cron...    141   6e-35 
ref|WP_000835082.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
ref|WP_000835088.1|  anhydro-N-acetylmuramic acid kinase [Esch...    141   6e-35 
ref|WP_000835028.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
gb|AIM21718.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    141   6e-35 
ref|WP_001644504.1|  Anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
ref|WP_024250381.1|  anhydro-N-acetylmuramic acid kinase [Shig...    140   6e-35 
gb|KFR77513.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    139   6e-35 
ref|WP_018294323.1|  hypothetical protein [Mariprofundus ferro...    141   6e-35 
ref|WP_024552237.1|  anhydro-N-acetylmuramic acid kinase [Cron...    141   6e-35 
ref|WP_023220917.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
ref|WP_000835020.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   6e-35 
ref|WP_025040418.1|  anhydro-N-acetylmuramic acid kinase [Nitr...    140   7e-35 
ref|WP_000835021.1|  anhydro-N-acetylmuramic acid kinase [Salm...    141   7e-35 
ref|WP_028498233.1|  anhydro-N-acetylmuramic acid kinase [Micr...    140   7e-35 
ref|WP_021573326.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   7e-35 
ref|WP_000835012.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
ref|WP_001817647.1|  Anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
gb|ETV24489.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    140   7e-35 
ref|WP_001337332.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   7e-35 
ref|WP_023223723.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
gb|EZQ57165.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    140   7e-35 
ref|WP_001647092.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   7e-35 
ref|WP_029855600.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   7e-35 
ref|WP_001358571.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   7e-35 
gb|KFC81354.1|  anhydro-N-acetylmuramic acid kinase [Buttiauxe...    140   7e-35 
dbj|GAK24832.1|  LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...    140   7e-35 
ref|WP_020183397.1|  hypothetical protein [Methylotenera sp. 1...    140   7e-35 
ref|WP_000835023.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
ref|WP_000835022.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
gb|KFD74763.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    140   7e-35 
ref|WP_020683599.1|  hypothetical protein [Marinobacterium rhi...    140   7e-35 
ref|WP_000835026.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   7e-35 
gb|KDN13990.1|  Anhydro-N-acetylmuramic acid kinase [Snodgrass...    140   7e-35 
ref|WP_000276043.1|  anhydro-N-acetylmuramic acid kinase [Baci...    141   8e-35 
ref|WP_000835095.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   8e-35 
ref|WP_029406797.1|  hypothetical protein [Thiomicrospira sp. ...    140   8e-35 
ref|WP_023183133.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   8e-35 
ref|WP_029592722.1|  anhydro-N-acetylmuramic acid kinase [Cron...    140   8e-35 
ref|WP_027896281.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   8e-35 
gb|AIA48922.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    140   8e-35 
dbj|GAK85093.1|  anhydro-N-acetylmuramic acid kinase [Vibrio p...    140   8e-35 
ref|WP_004263845.1|  anhydro-N-acetylmuramic acid kinase [Prov...    140   8e-35 
ref|WP_000835018.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   8e-35 
ref|WP_000835019.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   8e-35 
ref|WP_023248111.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   8e-35 
gb|AHR06138.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   8e-35 
ref|WP_027219495.1|  anhydro-N-acetylmuramic acid kinase [Legi...    140   8e-35 
ref|WP_014869906.1|  anhydro-N-acetylmuramic acid kinase [Mari...    140   8e-35 
ref|WP_013970620.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    140   8e-35 
ref|WP_019603329.1|  anhydro-N-acetylmuramic acid kinase [Tere...    140   8e-35 
ref|WP_017821495.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   8e-35 
ref|WP_016533974.1|  anhydro-N-acetylmuramic acid kinase [Past...    140   8e-35 
gb|AHO12014.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   8e-35 
ref|WP_029225873.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   8e-35 
gb|AHU40605.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   9e-35 
ref|WP_000835062.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
ref|WP_023201511.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   9e-35 
gb|KDL92166.1|  anhydro-N-acetylmuramic acid kinase [Klebsiell...    140   9e-35 
ref|WP_002907746.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   9e-35 
ref|WP_000835107.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
gb|AIK92663.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   9e-35 
ref|WP_023206052.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   9e-35 
ref|WP_029615062.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   9e-35 
ref|WP_000835024.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   9e-35 
dbj|GAJ68831.1|  anhydro-N-acetylmuramic acid kinase [Edwardsi...    140   9e-35 
ref|WP_001571501.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
gb|KDN13052.1|  Anhydro-N-acetylmuramic acid kinase [Snodgrass...    140   9e-35 
ref|WP_023250309.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   9e-35 
ref|WP_013201951.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    140   9e-35 
ref|WP_024233801.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
ref|WP_000835060.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
ref|WP_021533642.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   9e-35 
gb|KAJ99205.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    140   9e-35 
ref|WP_020159249.1|  anhydro-N-acetylmuramic acid kinase [Meth...    140   9e-35 
gb|AHD12577.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    140   9e-35 
gb|ETX64737.1|  anhydro-N-acetylmuramic acid kinase [Citrobact...    140   1e-34 
dbj|GAK19086.1|  LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...    140   1e-34 
emb|CAI78477.1|  hypothetical protein [uncultured beta proteob...    140   1e-34 
ref|WP_001512787.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
gb|AHM79228.1|  Hypothetical protein KPNJ2_02448 [Klebsiella p...    140   1e-34 
ref|WP_007622606.1|  anhydro-N-acetylmuramic acid kinase [Glac...    140   1e-34 
ref|WP_002623459.1|  Anhydro-N-acetylmuramic acid kinase [Cyst...    140   1e-34 
ref|WP_021530092.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_011215419.1|  anhydro-N-acetylmuramic acid kinase [Legi...    140   1e-34 
ref|WP_028881810.1|  anhydro-N-acetylmuramic acid kinase [Tere...    140   1e-34 
ref|WP_000835102.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_020166118.1|  hypothetical protein [Methyloversatilis u...    140   1e-34 
dbj|GAL04433.1|  anhydro-N-acetylmuramic acid kinase [Photobac...    140   1e-34 
ref|WP_004718919.1|  anhydro-N-acetylmuramic acid kinase [Acin...    140   1e-34 
ref|WP_009849446.1|  predicted molecular chaperone [Mariprofun...    140   1e-34 
emb|CDF81969.1|  Anhydro-N-acetylmuramic acid kinase [Pseudomo...    140   1e-34 
ref|WP_009599974.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   1e-34 
ref|WP_023629313.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_020846661.1|  Anhydro-N-acetylmuramic acid kinase [Acin...    140   1e-34 
ref|WP_000835011.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   1e-34 
emb|CDK94094.1|  Anhydro-N-acetylmuramic acid kinase [Klebsiel...    140   1e-34 
emb|CDL08190.1|  Anhydro-N-acetylmuramic acid kinase [Klebsiel...    140   1e-34 
gb|KDF18269.1|  anhydro-N-acetylmuramic acid kinase [Citrobact...    140   1e-34 
ref|WP_014538398.1|  anhydro-N-acetylmuramic acid kinase [Acin...    140   1e-34 
ref|WP_024309668.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_029884528.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   1e-34 
ref|WP_023318432.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   1e-34 
ref|WP_001718345.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_026399864.1|  anhydro-N-acetylmuramic acid kinase [Acho...    140   1e-34 
gb|AIG28090.1|  anhydro-N-acetylmuramic acid kinase [Brevibaci...    140   1e-34 
ref|WP_001649602.1|  Anhydro-N-acetylmuramic acid kinase [Salm...    140   1e-34 
gb|EUM68404.1|  anhydro-N-acetylmuramic acid kinase [Enterobac...    140   1e-34 
ref|WP_023287715.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   1e-34 
ref|WP_001467243.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_021535692.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
gb|KEQ14819.1|  anhydro-N-acetylmuramic acid kinase [Endozoico...    140   1e-34 
ref|WP_008784673.1|  anhydro-N-acetylmuramic acid kinase [Citr...    140   1e-34 
ref|WP_012703074.1|  anhydro-N-acetylmuramic acid kinase [Azot...    140   1e-34 
ref|WP_029843534.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   1e-34 
ref|WP_024872571.1|  anhydro-N-acetylmuramic acid kinase [Tolu...    140   1e-34 
ref|WP_000835031.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
gb|EKE04683.1|  hypothetical protein ACD_20C00022G0008 [uncult...    140   1e-34 
ref|WP_024249050.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_000835029.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   1e-34 
ref|WP_025795773.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   1e-34 
ref|WP_007082571.1|  anhydro-N-acetylmuramic acid kinase [Rhod...    140   1e-34 
ref|WP_009727111.1|  anhydro-N-acetylmuramic acid kinase [Meth...    140   1e-34 
ref|WP_000835041.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_002005071.1|  anhydro-N-acetylmuramic acid kinase [Baci...    140   1e-34 
ref|WP_016152999.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    140   1e-34 
ref|WP_019371418.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_004735046.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   1e-34 
gb|AHG86573.1|  Anhydro-N-acetylmuramic acid kinase [Biberstei...    140   1e-34 
ref|WP_016156434.1|  anhydro-N-acetylmuramic acid kinase [Citr...    140   1e-34 
ref|WP_003255510.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_004898604.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   1e-34 
ref|WP_004143831.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    140   1e-34 
ref|WP_027266544.1|  anhydro-N-acetylmuramic acid kinase [Legi...    140   1e-34 
ref|WP_000835106.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_023119531.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_025566610.1|  hypothetical protein [Gammaproteobacteria...    140   1e-34 
ref|WP_000835042.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_001733034.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_021560825.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   1e-34 
ref|WP_015502290.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    140   1e-34 
ref|WP_021544450.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   1e-34 
gb|KFZ28509.1|  hypothetical protein IDAT_09385 [Idiomarina sp...    140   1e-34 
emb|CDQ54221.1|  anmK [Klebsiella pneumoniae]                        140   2e-34 
ref|WP_000274973.1|  anhydro-N-acetylmuramic acid kinase [Baci...    140   2e-34 
ref|WP_022372481.1|  anhydro-N-acetylmuramic acid kinase [Sutt...    140   2e-34 
ref|WP_005568509.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    140   2e-34 
ref|WP_000835063.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   2e-34 
ref|WP_000835061.1|  anhydro-N-acetylmuramic acid kinase [Esch...    140   2e-34 
ref|WP_011467568.1|  anhydro-N-acetylmuramic acid kinase [Sacc...    140   2e-34 
ref|WP_000835008.1|  anhydro-N-acetylmuramic acid kinase [Salm...    140   2e-34 
ref|WP_003142820.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
gb|KDF05461.1|  anhydro-N-acetylmuramic acid kinase [Citrobact...    140   2e-34 
ref|WP_023090308.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_029887372.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_023107761.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_007153447.1|  anhydro-N-acetylmuramic acid kinase [Mari...    139   2e-34 
ref|WP_006174950.1|  anhydro-N-acetylmuramic acid kinase [Ente...    140   2e-34 
ref|WP_007525757.1|  anhydro-N-acetylmuramic acid kinase [Haem...    140   2e-34 
ref|WP_023129207.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
gb|KEA14927.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   2e-34 
ref|WP_023127005.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_017244328.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_028876283.1|  anhydro-N-acetylmuramic acid kinase [Tere...    140   2e-34 
ref|WP_023278942.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    140   2e-34 
ref|WP_003029171.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    140   2e-34 
ref|WP_007725356.1|  anhydro-N-acetylmuramic acid kinase [Carn...    140   2e-34 
ref|WP_001569900.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
ref|WP_023088789.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_017675635.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   2e-34 
gb|AHN28711.1|  Anhydro-N-acetylmuramic acid kinase [Snodgrass...    139   2e-34 
ref|WP_004739505.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    140   2e-34 
ref|WP_010558390.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_023117823.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_000835093.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
gb|EXI62119.1|  anhydro-N-acetylmuramic acid kinase [Mannheimi...    139   2e-34 
ref|WP_000835009.1|  anhydro-N-acetylmuramic acid kinase [Salm...    139   2e-34 
ref|WP_015046872.1|  anhydro-N-acetylmuramic acid kinase [Simi...    139   2e-34 
emb|CDL41527.1|  Anhydro-N-acetylmuramic acid kinase [Escheric...    139   2e-34 
ref|WP_021207019.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
gb|EWD84336.1|  anhydro-N-acetylmuramic acid kinase [Klebsiell...    139   2e-34 
ref|WP_014703582.1|  anhydro-N-acetylmuramic acid kinase [Meth...    139   2e-34 
ref|WP_023095160.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_017636160.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    139   2e-34 
gb|ADI17331.1|  predicted molecular chaperone distantly relate...    139   2e-34 
gb|EZJ86172.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
ref|WP_000835096.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
gb|KED56253.1|  anhydro-N-acetylmuramic acid kinase [Vibrio pa...    139   2e-34 
ref|WP_023187189.1|  anhydro-N-acetylmuramic acid kinase [Salm...    139   2e-34 
ref|WP_003101656.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_020197979.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    139   2e-34 
ref|WP_007350183.1|  anhydro-N-acetylmuramic acid kinase [Mari...    139   2e-34 
ref|WP_006684681.1|  anhydro-N-acetylmuramic acid kinase [Citr...    139   2e-34 
ref|WP_011869821.1|  anhydro-N-acetylmuramic acid kinase [Herm...    139   2e-34 
gb|KFH81984.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
gb|KDD79910.1|  anhydro-N-acetylmuramic acid kinase [Haemophil...    139   2e-34 
ref|WP_000835092.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
ref|WP_001402272.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
ref|WP_014462668.1|  anhydro-N-acetylmuramic acid kinase [Acin...    139   2e-34 
emb|CDS58270.1|  anhydro-N-acetylmuramic acid kinase [Serratia...    139   2e-34 
ref|WP_000349209.1|  anhydro-N-acetylmuramic acid kinase [Acin...    139   2e-34 
ref|WP_016763276.1|  anhydro-N-acetylmuramic acid kinase [Baci...    139   2e-34 
ref|WP_024539113.1|  anhydro-N-acetylmuramic acid kinase [Coma...    139   2e-34 
ref|WP_003113168.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   2e-34 
ref|WP_020307848.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_013171172.1|  hypothetical protein [ [Bacillus seleniti...    140   2e-34 
gb|AIN17220.1|  hypothetical protein DJ57_1173 [Yersinia krist...    139   2e-34 
ref|WP_012638960.1|  anhydro-N-acetylmuramic acid kinase [Thio...    139   2e-34 
ref|WP_017413758.1|  hypothetical protein [Clostridium tunisie...    139   2e-34 
gb|KDV48006.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
ref|WP_000835097.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
ref|WP_028380392.1|  anhydro-N-acetylmuramic acid kinase [Legi...    139   2e-34 
gb|ETU97574.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   2e-34 
ref|WP_004202863.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    139   2e-34 
pdb|3QBW|A  Chain A, Crystal Structure Of Pseudomonas Aerugino...    139   2e-34 
ref|WP_012270225.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
gb|KDW55982.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
ref|WP_013082027.1|  anhydro-N-acetylmuramic acid kinase [Baci...    139   2e-34 
gb|AAT51334.1|  PA0666 [synthetic construct]                         139   2e-34 
ref|WP_008089523.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
emb|CDI22258.1|  anhydro-N-acetylmuramic acid kinase [Klebsiel...    139   2e-34 
gb|KEL82105.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
ref|WP_008940649.1|  anhydro-N-acetylmuramic acid kinase [Mari...    139   2e-34 
ref|WP_021109672.1|  anhydro-N-acetylmuramic acid kinase [Haem...    139   2e-34 
ref|WP_029320911.1|  anhydro-N-acetylmuramic acid kinase [Baci...    139   2e-34 
ref|WP_003129240.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_000835047.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   2e-34 
ref|WP_025872971.1|  anhydro-N-acetylmuramic acid kinase [Meth...    139   2e-34 
gb|KDZ07866.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    139   2e-34 
ref|WP_027695240.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    139   2e-34 
ref|WP_000835094.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   2e-34 
ref|WP_004174582.1|  Anhydro-N-acetylmuramic acid kinase [Nitr...    139   2e-34 
ref|WP_029414355.1|  anhydro-N-acetylmuramic acid kinase [Acid...    139   2e-34 
ref|WP_003085271.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   2e-34 
ref|WP_023130557.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   2e-34 
ref|WP_017901088.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    139   3e-34 
ref|WP_007980852.1|  anhydro-N-acetylmuramic acid kinase [Hala...    140   3e-34 
ref|WP_016252941.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
gb|KDE38694.1|  Anhydro-N-acetylmuramic acid kinase [Nitrincol...    139   3e-34 
ref|WP_015431329.1|  anhydro-N-acetylmuramic acid kinase [Glac...    139   3e-34 
ref|WP_014682272.1|  anhydro-N-acetylmuramic acid kinase [Soli...    140   3e-34 
ref|WP_010947132.1|  anhydro-N-acetylmuramic acid kinase [Legi...    139   3e-34 
ref|WP_023306005.1|  anhydro-N-acetylmuramic acid kinase [Ente...    139   3e-34 
ref|WP_007620335.1|  anhydro-N-acetylmuramic acid kinase [Glac...    139   3e-34 
gb|EZO36012.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   3e-34 
ref|WP_003121856.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_000835051.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
gb|EXF46865.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   3e-34 
ref|WP_020240342.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_001397340.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_000835050.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_012621874.1|  anhydro-N-acetylmuramic acid kinase [Haem...    139   3e-34 
ref|WP_013292346.1|  anhydro-N-acetylmuramic acid kinase [Gall...    139   3e-34 
ref|WP_023131576.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_023011613.1|  anhydro-N-acetylmuramic acid kinase [Mari...    139   3e-34 
ref|WP_027907294.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_023435418.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_016561547.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_001630113.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_001575351.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_022647911.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   3e-34 
ref|WP_009840279.1|  hypothetical protein [Pseudoalteromonas t...    139   3e-34 
ref|WP_029490068.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_023238401.1|  anhydro-N-acetylmuramic acid kinase [Salm...    139   3e-34 
ref|WP_003832781.1|  anhydro-N-acetylmuramic acid kinase [Citr...    139   3e-34 
ref|WP_026177915.1|  anhydro-N-acetylmuramic acid kinase [Hala...    139   3e-34 
ref|WP_000835059.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_031338740.1|  anhydro-N-acetylmuramic acid kinase [Xant...    139   3e-34 
ref|WP_019472954.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   3e-34 
ref|WP_022291449.1|  anhydro-N-acetylmuramic acid kinase [Stap...    139   3e-34 
ref|WP_020925253.1|  Anhydro-N-acetylmuramic acid kinase [Achr...    139   3e-34 
ref|WP_012800346.1|  anhydro-N-acetylmuramic acid kinase [Kang...    139   3e-34 
gb|ETX36513.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    139   3e-34 
ref|WP_023234536.1|  anhydro-N-acetylmuramic acid kinase [Salm...    139   3e-34 
gb|KFJ92305.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   3e-34 
ref|WP_017148741.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_001481623.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
gb|AID71909.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    139   3e-34 
ref|WP_001552913.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_003137422.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_023086933.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_016852420.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    139   3e-34 
ref|WP_008813568.1|  anhydro-N-acetylmuramic acid kinase [Ente...    139   3e-34 
dbj|BAO33713.1|  anhydro-N-acetylmuramic acid kinase [Serratia...    139   3e-34 
ref|WP_005349074.1|  anhydro-N-acetylmuramic acid kinase [Aero...    139   3e-34 
ref|WP_023874883.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
emb|CDL86294.1|  Anhydro-N-acetylmuramic acid kinase [Xenorhab...    139   3e-34 
ref|WP_002691466.1|  molecular chaperone [Beggiatoa alba]            139   3e-34 
ref|WP_018016193.1|  anhydro-N-acetylmuramic acid kinase [Tere...    139   3e-34 
ref|WP_016311939.1|  hypothetical protein [Paenibacillus baren...    139   3e-34 
ref|WP_001619493.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   3e-34 
ref|WP_027590657.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_023382644.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_024067699.1|  Anhydro-N-acetylmuramic acid kinase [Achr...    139   3e-34 
ref|WP_029610113.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_003117984.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   3e-34 
ref|WP_025801057.1|  anhydro-N-acetylmuramic acid kinase [Hafn...    139   4e-34 
ref|WP_020898739.1|  anhydro-N-acetylmuramic acid kinase [Salm...    139   4e-34 
gb|KFE64702.1|  Anhydro-N-acetylmuramic acid kinase [Hyalangiu...    139   4e-34 
ref|WP_015268741.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   4e-34 
ref|WP_025223471.1|  anhydro-N-acetylmuramic acid kinase [Meth...    139   4e-34 
ref|WP_004355127.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    139   4e-34 
ref|WP_006914947.1|  anhydro-N-acetylmuramic acid kinase [Sali...    139   4e-34 
ref|WP_017802195.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    139   4e-34 
ref|WP_007810507.1|  anhydro-N-acetylmuramic acid kinase [Rhod...    139   4e-34 
ref|WP_021519412.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   4e-34 
ref|WP_022991913.1|  anhydro-N-acetylmuramic acid kinase [Mari...    139   4e-34 
ref|WP_007104889.1|  anhydro-N-acetylmuramic acid kinase [Glac...    139   4e-34 
ref|WP_009629490.1|  Anhydro-N-acetylmuramic acid kinase [Pseu...    139   4e-34 
ref|WP_000835043.1|  anhydro-N-acetylmuramic acid kinase [Esch...    139   4e-34 
dbj|GAJ75850.1|  anhydro-N-acetylmuramic acid kinase [Vibrio s...    139   4e-34 
ref|WP_013576072.1|  anhydro-N-acetylmuramic acid kinase [Rahn...    139   4e-34 
ref|WP_028942120.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    138   4e-34 
ref|WP_029554381.1|  anhydro-N-acetylmuramic acid kinase [Verm...    138   4e-34 
ref|WP_013366180.1|  anhydro-N-acetylmuramic acid kinase [Ente...    139   4e-34 
ref|WP_024246339.1|  anhydro-N-acetylmuramic acid kinase [Esch...    138   4e-34 
ref|WP_011218441.1|  anhydro-N-acetylmuramic acid kinase [Phot...    139   4e-34 
ref|WP_027312091.1|  anhydro-N-acetylmuramic acid kinase [Baln...    138   5e-34 
ref|WP_001566468.1|  anhydro-N-acetylmuramic acid kinase [Esch...    138   5e-34 
ref|WP_026375912.1|  hypothetical protein [Aestuariibacter sal...    138   5e-34 
sp|Q6LRE4.2|ANMK_PHOPR  RecName: Full=Anhydro-N-acetylmuramic ...    139   5e-34 
ref|WP_031412378.1|  anhydro-N-acetylmuramic acid kinase [Brev...    139   5e-34 
ref|WP_012139331.1|  anhydro-N-acetylmuramic acid kinase [Mari...    138   5e-34 
ref|WP_027267047.1|  anhydro-N-acetylmuramic acid kinase [Legi...    138   5e-34 
dbj|GAK76307.1|  anhydro-N-acetylmuramic acid kinase [Nonlaben...    133   5e-34 
ref|WP_018127821.1|  hypothetical protein [Balneola vulgaris]        138   5e-34 
ref|WP_017304636.1|  hypothetical protein [Spirulina subsalsa]       139   5e-34 
ref|WP_017072886.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    138   5e-34 
ref|WP_023932466.1|  anhydro-N-acetylmuramic acid kinase [Phot...    138   5e-34 
ref|WP_018983326.1|  hypothetical protein [Salinimonas chungwh...    138   5e-34 
ref|WP_006304224.1|  anhydro-N-acetylmuramic acid kinase [Atop...    139   5e-34 
ref|WP_026383216.1|  anhydro-N-acetylmuramic acid kinase [Achr...    138   5e-34 
ref|WP_003161908.1|  Anhydro-N-acetylmuramic acid kinase [Pseu...    138   6e-34 
ref|WP_005710660.1|  anhydro-N-acetylmuramic acid kinase [Haem...    138   6e-34 
ref|WP_017023271.1|  anhydro-N-acetylmuramic acid kinase [Alii...    138   6e-34 
ref|WP_008105979.1|  anhydro-N-acetylmuramic acid kinase [Meth...    138   6e-34 
ref|WP_008221614.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    138   6e-34 
ref|WP_026860805.1|  hypothetical protein [Idiomarina sediminum]     138   6e-34 
ref|WP_029404944.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    138   6e-34 
ref|WP_029203479.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    138   6e-34 
ref|WP_021559241.1|  anhydro-N-acetylmuramic acid kinase [Esch...    138   6e-34 
ref|WP_005298989.1|  anhydro-N-acetylmuramic acid kinase [Phot...    138   6e-34 
ref|WP_011784225.1|  anhydro-N-acetylmuramic acid kinase [Mari...    138   6e-34 
ref|WP_005495553.1|  Anhydro-N-acetylmuramic acid kinase [Pseu...    139   6e-34 
gb|AHN24592.1|  Anhydro-N-acetylmuramic acid kinase [Gilliamel...    138   6e-34 
ref|WP_023464280.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    138   6e-34 
ref|WP_003300939.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    138   6e-34 
ref|WP_028407698.1|  anhydro-N-acetylmuramic acid kinase [Baci...    138   7e-34 
ref|WP_016527792.1|  anhydro-N-acetylmuramic acid kinase [Haem...    138   7e-34 
ref|WP_026916907.1|  anhydro-N-acetylmuramic acid kinase [Haem...    138   7e-34 
ref|WP_008748596.1|  anhydro-N-acetylmuramic acid kinase [Stre...    138   7e-34 
gb|EWH05471.1|  anhydro-N-acetylmuramic acid kinase [Pseudoalt...    139   7e-34 
ref|WP_023603905.1|  anhydro-N-acetylmuramic acid kinase [Alii...    138   7e-34 
ref|WP_019405630.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    138   7e-34 
ref|WP_015690121.1|  anhydro-N-acetylmuramic acid kinase [Rahn...    138   7e-34 
gb|KES23796.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    138   7e-34 
gb|KES13438.1|  putative molecular chaperone distantly related...    138   7e-34 
ref|WP_008986936.1|  anhydro-N-acetylmuramic acid kinase [Phot...    138   7e-34 
ref|WP_007021148.1|  anhydro-N-acetylmuramic acid kinase [Nept...    138   7e-34 
ref|WP_009460674.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    138   7e-34 
ref|WP_028373604.1|  anhydro-N-acetylmuramic acid kinase [Legi...    138   7e-34 
ref|WP_005502818.1|  anhydro-N-acetylmuramic acid kinase [Grim...    137   8e-34 
ref|WP_023289931.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    138   8e-34 
ref|WP_027873026.1|  anhydro-N-acetylmuramic acid kinase [Meli...    138   8e-34 
ref|WP_028783828.1|  anhydro-N-acetylmuramic acid kinase [Thal...    138   8e-34 
ref|WP_019907234.1|  anhydro-N-acetylmuramic acid kinase [Ther...    138   8e-34 
gb|AHY13203.1|  anhydro-N-acetylmuramic acid kinase [Citrobact...    138   8e-34 
ref|WP_005440590.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    138   8e-34 
ref|WP_023128350.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   8e-34 
ref|WP_015819570.1|  anhydro-N-acetylmuramic acid kinase [Tere...    138   8e-34 
ref|WP_002440393.1|  anhydro-N-acetylmuramic acid kinase [Shim...    137   8e-34 
emb|CDQ14748.1|  anhydro-N-acetylmuramic acid kinase [Klebsiel...    138   8e-34 
ref|WP_021946457.1|  anhydro-N-acetylmuramic acid kinase [Clos...    138   8e-34 
ref|WP_006388645.1|  anhydro-N-acetylmuramic acid kinase [Achr...    137   9e-34 
ref|WP_001417927.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   9e-34 
gb|ADI23801.1|  predicted molecular chaperone distantly relate...    137   9e-34 
gb|EZJ29783.1|  anhydro-N-acetylmuramic acid kinase [Escherich...    137   9e-34 
gb|KDH36047.1|  anhydro-N-acetylmuramic acid kinase [Klebsiell...    137   9e-34 
ref|WP_015697782.1|  anhydro-N-acetylmuramic acid kinase [Rahn...    137   9e-34 
ref|WP_005102395.1|  anhydro-N-acetylmuramic acid kinase [Shig...    137   9e-34 
ref|WP_000835044.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   9e-34 
ref|WP_021724797.1|  Putative Anhydro-N-acetylmuramic acid kin...    137   9e-34 
ref|WP_007654005.1|  anhydro-N-acetylmuramic acid kinase [Pont...    138   9e-34 
ref|WP_012979074.1|  anhydro-N-acetylmuramic acid kinase [Legi...    137   1e-33 
ref|WP_014911418.1|  anhydro-N-acetylmuramic acid kinase [Noca...    138   1e-33 
gb|EPN26735.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    135   1e-33 
ref|WP_013789741.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_004717607.1|  anhydro-N-acetylmuramic acid kinase [Yers...    137   1e-33 
ref|WP_025748705.1|  anhydro-N-acetylmuramic acid kinase [Cald...    138   1e-33 
ref|WP_027913654.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_001400381.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_002951430.1|  Anhydro-N-acetylmuramic acid kinase [Salm...    137   1e-33 
gb|KFE39254.1|  anhydro-N-acetylmuramic acid kinase [Yersinia ...    137   1e-33 
ref|WP_008284854.1|  anhydro-N-acetylmuramic acid kinase [gamm...    137   1e-33 
ref|WP_001720151.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_004136807.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    137   1e-33 
ref|WP_006645783.1|  anhydro-N-acetylmuramic acid kinase [Phot...    137   1e-33 
ref|WP_019396112.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_004352281.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_010049905.1|  anhydro-N-acetylmuramic acid kinase [Carn...    137   1e-33 
ref|WP_024550081.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    137   1e-33 
ref|WP_010795954.1|  hypothetical protein [Pseudomonas sp. HPB...    137   1e-33 
ref|WP_001256262.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_000274957.1|  anhydro-N-acetylmuramic acid kinase [Baci...    137   1e-33 
ref|WP_015248009.1|  molecular chaperone [Singulisphaera acidi...    138   1e-33 
ref|WP_018402526.1|  anhydro-N-acetylmuramic acid kinase [Mari...    137   1e-33 
ref|WP_001700960.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_001504315.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_025137588.1|  anhydro-N-acetylmuramic acid kinase [Alca...    137   1e-33 
ref|WP_001707111.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   1e-33 
ref|WP_012682425.1|  anhydro-N-acetylmuramic acid kinase [Gemm...    137   1e-33 
ref|WP_014544218.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    137   1e-33 
ref|WP_031320629.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_012316531.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_026484382.1|  anhydro-N-acetylmuramic acid kinase [Alca...    137   1e-33 
ref|WP_016112862.1|  anhydro-N-acetylmuramic acid kinase [Baci...    137   1e-33 
ref|WP_024763555.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   1e-33 
ref|WP_020945711.1|  anhydro-N-acetylmuramic acid kinase [Prot...    137   1e-33 
ref|WP_029104076.1|  hypothetical protein [Moraxella caprae]         137   1e-33 
gb|AIK91232.1|  anhydro-N-acetylmuramic acid kinase [Haemophil...    137   2e-33 
ref|WP_020826691.1|  anhydro-N-acetylmuramic acid kinase [Serr...    137   2e-33 
ref|WP_024357977.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    137   2e-33 
ref|WP_010764395.1|  hypothetical protein [Enterococcus moravi...    137   2e-33 
ref|WP_001427676.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   2e-33 
ref|WP_003869038.1|  anhydro-N-acetylmuramic acid kinase [Ther...    137   2e-33 
ref|WP_023120180.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   2e-33 
ref|WP_019409884.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   2e-33 
ref|WP_023083952.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   2e-33 
emb|CCD15106.1|  unnamed protein product [Trypanosoma congolen...    135   2e-33 
ref|WP_010786649.1|  anhydro-N-acetylmuramic acid kinase [Haem...    137   2e-33 
ref|WP_029326273.1|  anhydro-N-acetylmuramic acid kinase [Baci...    137   2e-33 
ref|WP_023655003.1|  Anhydro-N-acetylmuramic acid kinase [Erwi...    137   2e-33 
dbj|GAK33769.1|  anhydro-N-acetylmuramic acid kinase [alpha pr...    137   2e-33 
gb|EHC39021.1|  Anhydro-N-acetylmuramic acid kinase [Salmonell...    137   2e-33 
ref|WP_000835030.1|  anhydro-N-acetylmuramic acid kinase [Salm...    137   2e-33 
gb|EIQ75415.1|  anhydro-N-acetylmuramic acid kinase [Shigella ...    137   2e-33 
gb|AHN71875.1|  hypothetical protein CF65_01538 [Aggregatibact...    137   2e-33 
ref|WP_025749647.1|  anhydro-N-acetylmuramic acid kinase [Baci...    137   2e-33 
gb|KES01509.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    137   2e-33 
ref|WP_004346302.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   2e-33 
gb|KFK49457.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    137   2e-33 
ref|WP_012441524.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    137   2e-33 
ref|WP_026004193.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    137   2e-33 
ref|WP_020238579.1|  anhydro-N-acetylmuramic acid kinase [Esch...    137   2e-33 
ref|WP_019557046.1|  hypothetical protein [Thiomicrospira arct...    137   2e-33 
ref|WP_025710833.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    137   2e-33 
gb|KFC87140.1|  anhydro-N-acetylmuramic acid kinase [Hafnia al...    136   2e-33 
gb|AHI29064.1|  anhydro-N-acetylmuramic acid kinase [Marinobac...    136   2e-33 
ref|XP_003289810.1|  hypothetical protein DICPUDRAFT_88670 [Di...    137   2e-33 
ref|WP_027909771.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    136   2e-33 
ref|WP_014538954.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    137   2e-33 
dbj|GAK26517.1|  anhydro-N-acetylmuramic acid kinase [Serratia...    137   2e-33 
gb|KFK55861.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    137   2e-33 
gb|EZN81720.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    136   2e-33 
ref|WP_012551896.1|  anhydro-N-acetylmuramic acid kinase [Alii...    136   2e-33 
ref|WP_014700288.1|  Anhydro-N-acetylmuramic acid kinase [Pect...    135   2e-33 
ref|WP_005558168.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    137   2e-33 
ref|WP_009577163.1|  Anhydro-N-acetylmuramic acid kinase [gamm...    137   2e-33 
ref|WP_021151096.1|  Anhydro-N-acetylmuramic acid kinase [Ente...    135   2e-33 
gb|AID24781.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    136   2e-33 
ref|WP_019916446.1|  MULTISPECIES: hypothetical protein [Rhodo...    136   2e-33 
ref|WP_016132314.1|  anhydro-N-acetylmuramic acid kinase [Baci...    137   2e-33 
ref|WP_011399943.1|  anhydro-N-acetylmuramic acid kinase [Hahe...    136   2e-33 
dbj|GAF63754.1|  putative anhydro-N-acetylmuramic acid kinase ...    137   2e-33 
ref|WP_003450679.1|  Anhydro-N-acetylmuramic acid kinase [Pseu...    136   2e-33 
ref|WP_005546351.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    136   2e-33 
ref|WP_028470804.1|  anhydro-N-acetylmuramic acid kinase [Nept...    136   2e-33 
ref|WP_021440250.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    136   2e-33 
gb|AIL69733.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    137   3e-33 
ref|WP_015964269.1|  molecular chaperone [Enterobacteriaceae b...    136   3e-33 
ref|WP_011797074.1|  anhydro-N-acetylmuramic acid kinase [Acid...    136   3e-33 
ref|WP_015075563.1|  uncharacterised family protein [Carnobact...    136   3e-33 
gb|EWD52145.1|  anhydro-N-acetylmuramic acid kinase [Klebsiell...    136   3e-33 
ref|WP_006231740.1|  anhydro-N-acetylmuramic acid kinase [Phot...    136   3e-33 
ref|WP_004919210.1|  anhydro-N-acetylmuramic acid kinase [Prov...    136   3e-33 
ref|WP_022562317.1|  hypothetical protein [Salmonella enterica]      136   3e-33 
ref|WP_006537033.1|  anhydro-N-acetylmuramic acid kinase [Prot...    136   3e-33 
gb|EWS69366.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    136   3e-33 
ref|WP_031491963.1|  hypothetical protein [Succinivibrio dextr...    136   3e-33 
ref|WP_018276601.1|  anhydro-N-acetylmuramic acid kinase [Tere...    136   3e-33 
ref|WP_026130507.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    137   3e-33 
ref|WP_016497735.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    136   3e-33 
ref|WP_017372856.1|  anhydro-N-acetylmuramic acid kinase [Ente...    136   3e-33 
ref|WP_003631737.1|  anhydro-N-acetylmuramic acid kinase [Legi...    136   3e-33 
ref|WP_005569297.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    136   3e-33 
gb|EUJ41463.1|  anhydro-N-acetylmuramic acid kinase [Listeria ...    136   3e-33 
ref|WP_001451692.1|  anhydro-N-acetylmuramic acid kinase [Esch...    136   3e-33 
ref|WP_004285067.1|  anhydro-N-acetylmuramic acid kinase [Neis...    136   3e-33 
emb|CDN06894.1|  anhydro-N-acetylmuramic acid kinase [Klebsiel...    136   3e-33 
ref|WP_008242876.1|  anhydro-N-acetylmuramic acid kinase [Sulf...    136   3e-33 
ref|WP_026050204.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    136   3e-33 
gb|KCX29013.1|  anhydro-N-acetylmuramic acid kinase [Acinetoba...    135   3e-33 
ref|WP_024302760.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    136   3e-33 
ref|WP_024529912.1|  anhydro-N-acetylmuramic acid kinase [Serr...    136   3e-33 
dbj|GAF14536.1|  anhydro-N-acetylmuramic acid kinase [Bacillus...    136   4e-33 
ref|WP_013717361.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   4e-33 
ref|WP_012668185.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    136   4e-33 
ref|WP_012078165.1|  anhydro-N-acetylmuramic acid kinase [Jant...    136   4e-33 
gb|KFK59166.1|  anhydro-N-acetylmuramic acid kinase [Vibrio vu...    136   4e-33 
ref|WP_005367528.1|  anhydro-N-acetylmuramic acid kinase [Phot...    136   4e-33 
gb|KEQ19086.1|  anhydro-N-acetylmuramic acid kinase [Endozoico...    136   4e-33 
ref|WP_027334170.1|  hypothetical protein [Mycoplasma elephantis]    136   4e-33 
ref|WP_024015244.1|  Anhydro-N-acetylmuramic acid kinase [Erwi...    136   4e-33 
ref|WP_004157446.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    136   4e-33 
ref|WP_026740285.1|  anhydro-N-acetylmuramic acid kinase [Lons...    136   4e-33 
ref|WP_009025383.1|  anhydro-N-acetylmuramic acid kinase [gamm...    136   4e-33 
gb|KEY58013.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    136   4e-33 
ref|WP_011978913.1|  anhydro-N-acetylmuramic acid kinase [Acti...    136   4e-33 
ref|WP_006217314.1|  anhydro-N-acetylmuramic acid kinase [Achr...    136   4e-33 
ref|WP_004390200.1|  anhydro-N-acetylmuramic acid kinase [Yers...    136   4e-33 
ref|WP_028384511.1|  anhydro-N-acetylmuramic acid kinase [Legi...    135   4e-33 
gb|ADI23343.1|  predicted molecular chaperone distantly relate...    135   4e-33 
ref|WP_028124846.1|  anhydro-N-acetylmuramic acid kinase [Erem...    136   4e-33 
ref|WP_030996645.1|  anhydro-N-acetylmuramic acid kinase [Stre...    136   4e-33 
ref|WP_006302180.1|  anhydro-N-acetylmuramic acid kinase [Atop...    136   4e-33 
ref|WP_014167510.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    136   4e-33 
ref|WP_014658230.1|  anhydro-N-acetylmuramic acid kinase [Prov...    135   4e-33 
ref|WP_021178080.1|  Anhydro-N-acetylmuramic acid kinase [Serr...    135   4e-33 
ref|WP_004169726.1|  Anhydro-N-acetylmuramic acid kinase [Erwi...    135   4e-33 
sp|Q8DET7.2|ANMK_VIBVU  RecName: Full=Anhydro-N-acetylmuramic ...    135   4e-33 
ref|WP_024602619.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    136   4e-33 
ref|WP_028686611.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   5e-33 
gb|AIC09305.1|  anhydro-N-acetylmuramic acid kinase [Xylella f...    136   5e-33 
ref|WP_011078586.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    136   5e-33 
ref|WP_023399198.1|  putative molecular chaperone distantly re...    136   5e-33 
ref|WP_007514380.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    135   5e-33 
ref|WP_008314665.1|  Anhydro-N-acetylmuramic acid kinase [Wohl...    136   5e-33 
ref|WP_008958824.1|  anhydro-N-acetylmuramic acid kinase [Halo...    135   5e-33 
ref|WP_023007987.1|  anhydro-N-acetylmuramic acid kinase [Mari...    135   5e-33 
ref|WP_018232202.1|  hypothetical protein [Thioalkalivibrio th...    135   5e-33 
ref|WP_011201105.1|  anhydro-N-acetylmuramic acid kinase [Mann...    135   5e-33 
gb|EUJ45245.1|  anhydro-N-acetylmuramic acid kinase [Listeriac...    136   5e-33 
gb|KEZ76517.1|  anhydro-N-acetylmuramic acid kinase [Salinisph...    135   5e-33 
ref|WP_002800363.1|  anhydro-N-acetylmuramic acid kinase [Micr...    135   5e-33 
ref|WP_006094861.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    135   5e-33 
ref|WP_028412253.1|  anhydro-N-acetylmuramic acid kinase [Baci...    135   6e-33 
gb|KFD21163.1|  anhydro-N-acetylmuramic acid kinase [Yokenella...    135   6e-33 
ref|WP_026148489.1|  anhydro-N-acetylmuramic acid kinase [Lept...    135   6e-33 
gb|KDN95732.1|  hypothetical protein EI16_05400 [Hydrogenovibr...    135   6e-33 
ref|WP_007241500.1|  anhydro-N-acetylmuramic acid kinase [Haem...    135   6e-33 
gb|ADI18292.1|  predicted molecular chaperone distantly relate...    135   6e-33 
ref|WP_011857953.1|  anhydro-N-acetylmuramic acid kinase [Acin...    134   6e-33 
ref|WP_010892711.1|  anhydro-N-acetylmuramic acid kinase [Xyle...    135   6e-33 
gb|AHU10814.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    135   6e-33 
ref|WP_016490513.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   6e-33 
ref|WP_014461295.1|  anhydro-N-acetylmuramic acid kinase [Baci...    135   6e-33 
ref|WP_009207723.1|  anhydro-N-acetylmuramic acid kinase [Sulf...    135   6e-33 
ref|WP_010455134.1|  anhydro-N-acetylmuramic acid kinase [Succ...    135   6e-33 
ref|WP_019605694.1|  anhydro-N-acetylmuramic acid kinase [Tere...    135   7e-33 
ref|WP_015674332.1|  anhydro-N-acetylmuramic acid kinase [Acti...    135   7e-33 
ref|WP_004910450.1|  anhydro-N-acetylmuramic acid kinase [Prov...    135   7e-33 
ref|WP_028387122.1|  hypothetical protein [Legionella geestiana]     135   7e-33 
gb|KFF65567.1|  anhydro-N-acetylmuramic acid kinase [Pectobact...    135   7e-33 
ref|WP_003158468.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   7e-33 
ref|WP_021804542.1|  Anhydro-N-acetylmuramic acid kinase [Serr...    135   7e-33 
ref|WP_013572382.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    135   7e-33 
ref|WP_003147208.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   7e-33 
ref|WP_004095113.1|  anhydro-N-acetylmuramic acid kinase [Hafn...    135   7e-33 
ref|WP_011071524.1|  anhydro-N-acetylmuramic acid kinase [Shew...    135   8e-33 
ref|WP_028863185.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    135   8e-33 
ref|WP_014821646.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   8e-33 
ref|WP_002786706.1|  anhydro-N-acetylmuramic acid kinase [Micr...    135   8e-33 
ref|WP_005576635.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    135   8e-33 
ref|WP_011411265.1|  anhydro-N-acetylmuramic acid kinase [Soda...    135   8e-33 
ref|WP_027904832.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   8e-33 
ref|WP_027221584.1|  anhydro-N-acetylmuramic acid kinase [Legi...    135   8e-33 
ref|WP_029324932.1|  anhydro-N-acetylmuramic acid kinase [Baci...    135   8e-33 
ref|WP_013055724.1|  anhydro-N-acetylmuramic acid kinase [Baci...    135   8e-33 
ref|WP_004851448.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    135   8e-33 
ref|WP_027711780.1|  anhydro-N-acetylmuramic acid kinase [Erwi...    135   8e-33 
ref|WP_028760851.1|  anhydro-N-acetylmuramic acid kinase [Shew...    135   8e-33 
emb|CBX80575.1|  Anhydro-N-acetylmuramic acid kinase [Erwinia ...    135   8e-33 
ref|WP_015475301.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   8e-33 
gb|AIN63121.1|  anhydro-N-acetylmuramic acid kinase [Providenc...    135   9e-33 
gb|AHO21798.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    134   9e-33 
ref|WP_021034667.1|  anhydro-N-acetylmuramic acid kinase [Haem...    135   9e-33 
ref|WP_000835014.1|  anhydro-N-acetylmuramic acid kinase [Salm...    133   9e-33 
ref|WP_023511552.1|  anhydro-N-acetylmuramic acid kinase [Spor...    135   9e-33 
ref|WP_006820107.1|  anhydro-N-acetylmuramic acid kinase [Yoke...    135   9e-33 
ref|WP_019079334.1|  anhydro-N-acetylmuramic acid kinase [Yers...    135   9e-33 
ref|WP_007641495.1|  anhydro-N-acetylmuramic acid kinase [Glac...    135   9e-33 
ref|WP_008114383.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    135   1e-32 
ref|WP_029147440.1|  anhydro-N-acetylmuramic acid kinase [Meth...    135   1e-32 
ref|WP_000835089.1|  anhydro-N-acetylmuramic acid kinase [Esch...    135   1e-32 
ref|WP_005539545.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    135   1e-32 
gb|KEA52884.1|  anhydro-N-acetylmuramic acid kinase [Mangrovib...    135   1e-32 
ref|WP_005818995.1|  anhydro-N-acetylmuramic acid kinase [Acti...    135   1e-32 
ref|WP_000835090.1|  anhydro-N-acetylmuramic acid kinase [Esch...    135   1e-32 
ref|WP_031297944.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
ref|WP_007827953.1|  anhydro-N-acetylmuramic acid kinase [Vari...    135   1e-32 
gb|KFX01177.1|  anhydro-N-acetylmuramic acid kinase [Pectobact...    135   1e-32 
ref|WP_003459464.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
gb|AHQ40724.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    134   1e-32 
ref|WP_000835015.1|  anhydro-N-acetylmuramic acid kinase [Salm...    133   1e-32 
ref|WP_001493085.1|  anhydro-N-acetylmuramic acid kinase [Esch...    135   1e-32 
ref|WP_010393296.1|  anhydro-N-acetylmuramic acid kinase [Jant...    134   1e-32 
ref|WP_014851497.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
ref|WP_011804083.1|  anhydro-N-acetylmuramic acid kinase [Acid...    135   1e-32 
ref|WP_017533693.1|  anhydro-N-acetylmuramic acid kinase [Noca...    135   1e-32 
gb|KFB89238.1|  anhydro-N-acetylmuramic acid kinase [Serratia ...    135   1e-32 
ref|WP_012655621.1|  anhydro-N-acetylmuramic acid kinase [Acid...    134   1e-32 
ref|WP_031436583.1|  anhydro-N-acetylmuramic acid kinase [Meth...    134   1e-32 
ref|WP_012208310.1|  anhydro-N-acetylmuramic acid kinase [Petr...    135   1e-32 
dbj|GAF58870.1|  LOW QUALITY PROTEIN: anhydro-N-acetylmuramic ...    135   1e-32 
sp|Q7MNL7.2|ANMK_VIBVY  RecName: Full=Anhydro-N-acetylmuramic ...    134   1e-32 
ref|WP_003290144.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
ref|WP_014595771.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
ref|WP_001499689.1|  anhydro-N-acetylmuramic acid kinase [Esch...    134   1e-32 
ref|WP_002564039.1|  MULTISPECIES: hypothetical protein [Atopo...    135   1e-32 
ref|WP_008445146.1|  anhydro-N-acetylmuramic acid kinase AnmK ...    134   1e-32 
ref|WP_024915804.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   1e-32 
ref|WP_001475975.1|  anhydro-N-acetylmuramic acid kinase [Esch...    134   1e-32 
ref|WP_025118931.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    134   1e-32 
ref|WP_013934750.1|  anhydro-N-acetylmuramic acid kinase [Zymo...    134   1e-32 
ref|WP_018719316.1|  hypothetical protein [Arhodomonas aquaeolei]    134   1e-32 
gb|KEO83470.1|  hypothetical protein EL26_09635 [Tumebacillus ...    135   1e-32 
ref|WP_021863503.1|  anhydro-N-acetylmuramic acid kinase [Clos...    135   1e-32 
gb|KFF63870.1|  anhydro-N-acetylmuramic acid kinase [Pectobact...    134   1e-32 
gb|AAR37555.1|  conserved hypothetical protein [uncultured mar...    134   1e-32 
ref|WP_026873132.1|  anhydro-N-acetylmuramic acid kinase [Inqu...    134   1e-32 
gb|EWG13877.1|  anhydro-N-acetylmuramic acid kinase [Xylella f...    134   1e-32 
ref|WP_001405250.1|  anhydro-N-acetylmuramic acid kinase [Esch...    134   1e-32 
ref|WP_015170145.1|  hypothetical protein [Geitlerinema sp. PC...    134   1e-32 
ref|WP_015449129.1|  anhydro-N-acetylmuramic acid kinase [Rhod...    134   1e-32 
ref|WP_028684763.1|  anhydro-N-acetylmuramic acid kinase [Phas...    134   1e-32 
ref|WP_022481965.1|  anhydro-N-acetylmuramic acid kinase [Clos...    134   2e-32 
gb|AHI30828.1|  anhydro-N-acetylmuramic acid kinase [Marinobac...    134   2e-32 
ref|WP_001685885.1|  anhydro-N-acetylmuramic acid kinase [Salm...    133   2e-32 
ref|WP_013543661.1|  anhydro-N-acetylmuramic acid kinase [Vari...    134   2e-32 
ref|WP_011149561.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    134   2e-32 
ref|WP_026742640.1|  anhydro-N-acetylmuramic acid kinase [Lons...    134   2e-32 
ref|WP_005586167.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    134   2e-32 
gb|AID90540.1|  anhydro-N-acetylmuramic acid kinase [Klebsiell...    134   2e-32 
gb|AHM74147.1|  AnhMurNAc kinase [Yersinia enterocolitica LC20]      134   2e-32 
ref|WP_027226912.1|  anhydro-N-acetylmuramic acid kinase [Legi...    134   2e-32 
ref|WP_020710383.1|  hypothetical protein [Acidobacteriaceae b...    134   2e-32 
ref|WP_019656356.1|  anhydro-N-acetylmuramic acid kinase [Vari...    134   2e-32 
ref|WP_004102661.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    134   2e-32 
ref|WP_004087784.1|  anhydro-N-acetylmuramic acid kinase [Xyle...    134   2e-32 
gb|AHO06779.1|  anhydro-N-acetylmuramic acid kinase [Salmonell...    133   2e-32 
gb|KFF61838.1|  anhydro-N-acetylmuramic acid kinase [Pectobact...    134   2e-32 
ref|WP_022000240.1|  anhydro-N-acetylmuramic acid kinase [Acet...    134   2e-32 
ref|WP_012603283.1|  anhydro-N-acetylmuramic acid kinase [Vibr...    134   2e-32 
ref|WP_012418604.1|  anhydro-N-acetylmuramic acid kinase [Bord...    134   2e-32 
gb|AIL59710.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    134   2e-32 
ref|WP_010276618.1|  anhydro-N-acetylmuramic acid kinase [Pect...    134   2e-32 
ref|WP_015584199.1|  anhydro-N-acetylmuramic acid kinase [Raou...    134   2e-32 
ref|WP_012154253.1|  anhydro-N-acetylmuramic acid kinase [Shew...    134   2e-32 
ref|WP_004243120.1|  anhydro-N-acetylmuramic acid kinase [Prot...    134   2e-32 
ref|WP_024006399.1|  anhydro-N-acetylmuramic acid kinase [Adve...    134   2e-32 
ref|WP_018414374.1|  anhydro-N-acetylmuramic acid kinase [Tere...    134   2e-32 
ref|WP_012769446.1|  anhydro-N-acetylmuramic acid kinase [Dick...    134   2e-32 
ref|WP_008274378.1|  anhydro-N-acetylmuramic acid kinase [Cyan...    134   2e-32 
ref|WP_015834073.1|  anhydro-N-acetylmuramic acid kinase [Phot...    134   2e-32 
ref|WP_006871640.1|  anhydro-N-acetylmuramic acid kinase [Legi...    134   2e-32 
ref|WP_000835010.1|  anhydro-N-acetylmuramic acid kinase [Salm...    134   2e-32 
ref|WP_027094571.1|  anhydro-N-acetylmuramic acid kinase [Cohn...    134   2e-32 
ref|WP_029095388.1|  anhydro-N-acetylmuramic acid kinase [Budv...    134   2e-32 
ref|WP_005270391.1|  anhydro-N-acetylmuramic acid kinase [Yers...    134   2e-32 
ref|WP_007649957.1|  anhydro-N-acetylmuramic acid kinase [Shew...    134   2e-32 
ref|WP_023532803.1|  anhydro-N-acetylmuramic acid kinase [Pseu...    134   2e-32 
ref|WP_028249518.1|  anhydro-N-acetylmuramic acid kinase [Vari...    134   2e-32 
ref|WP_013517608.1|  anhydro-N-acetylmuramic acid kinase [Alic...    134   2e-32 
ref|WP_024913075.1|  anhydro-N-acetylmuramic acid kinase [Serr...    134   2e-32 
ref|WP_019083063.1|  anhydro-N-acetylmuramic acid kinase [Yers...    134   2e-32 
ref|WP_019613598.1|  hypothetical protein [Psychromonas ossiba...    134   2e-32 
ref|WP_015278305.1|  molecular chaperone [Pseudomonas stutzeri]      134   2e-32 
ref|WP_004119512.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    134   3e-32 
ref|WP_005338511.1|  anhydro-N-acetylmuramic acid kinase [Aero...    134   3e-32 
ref|WP_017461554.1|  hypothetical protein [Dyella ginsengisoli]      134   3e-32 
ref|WP_002432137.1|  anhydro-N-acetylmuramic acid kinase [Esch...    134   3e-32 
ref|WP_011799925.1|  anhydro-N-acetylmuramic acid kinase [Pola...    134   3e-32 
ref|WP_022329669.1|  anhydro-N-acetylmuramic acid kinase [Firm...    134   3e-32 
ref|WP_005630920.1|  anhydro-N-acetylmuramic acid kinase [Haem...    134   3e-32 
ref|WP_014915735.1|  anhydro-N-acetylmuramic acid kinase [Pect...    134   3e-32 
ref|WP_015840593.1|  anhydro-N-acetylmuramic acid kinase [Pect...    134   3e-32 
ref|WP_023321118.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    134   3e-32 
ref|WP_017446096.1|  hypothetical protein [Gayadomonas joobini...    133   3e-32 
ref|WP_010760742.1|  hypothetical protein [Enterococcus haemop...    134   3e-32 
ref|WP_018478761.1|  anhydro-N-acetylmuramic acid kinase [Pont...    134   3e-32 
emb|CDT05494.1|  Anhydro-N-acetylmuramic acid kinase [Sphingob...    134   3e-32 
ref|WP_015466308.1|  anhydro-N-acetylmuramic acid kinase [Psyc...    133   3e-32 
gb|ERO63285.1|  anhydro-N-acetylmuramic acid kinase [Pseudomon...    133   3e-32 
ref|WP_021616700.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    134   3e-32 
gb|KAJ96522.1|  anhydro-N-acetylmuramic acid kinase [Raoultell...    133   3e-32 
ref|WP_020651111.1|  hypothetical protein [Singularimonas vari...    133   3e-32 
ref|WP_028834281.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    134   3e-32 
gb|KEZ14935.1|  Anhydro-N-acetylmuramic acid kinase [Haemophil...    133   3e-32 
ref|WP_004862682.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    133   3e-32 
ref|WP_014575941.1|  anhydro-N-acetylmuramic acid kinase [Mari...    133   3e-32 
ref|WP_013462912.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    134   3e-32 
gb|EZH84767.1|  anhydro-N-acetylmuramic acid kinase [Aeromonas...    133   3e-32 
ref|WP_009544496.1|  MULTISPECIES: anhydro-N-acetylmuramic aci...    134   3e-32 
ref|WP_023329784.1|  anhydro-N-acetylmuramic acid kinase [Kleb...    133   3e-32 
ref|WP_021116691.1|  anhydro-N-acetylmuramic acid kinase [Haem...    133   3e-32 
ref|WP_010302292.1|  anhydro-N-acetylmuramic acid kinase [Pect...    133   3e-32 
ref|WP_005703502.1|  anhydro-N-acetylmuramic acid kinase [Aggr...    133   3e-32 
ref|WP_021111608.1|  anhydro-N-acetylmuramic acid kinase [Haem...    133   3e-32 
ref|WP_017024789.1|  hypothetical protein [Vibrio rumoiensis]        133   3e-32 
ref|WP_015047230.1|  anhydro